WorldWideScience

Sample records for rane willerslev soul

  1. Soul Pain

    Directory of Open Access Journals (Sweden)

    Sarah L. Jirek

    2015-07-01

    Full Text Available This study extends prior research on vicarious traumatization and emotion management by exploring a deeper, more life-altering effect of working with traumatized clients—namely, “soul pain.” Analyses of in-depth interviews with 29 advocates working with survivors of physical and sexual violence reveal that, as a direct consequence of hearing countless stories of human brutality, some staff members experience a profound wounding of their spirit. This finding expands our understanding of the occupational hazards of the helping professions by revealing another dimension of advocates’ lives—that of the soul or spirit—that may be affected by their work with trauma survivors.

  2. Soulful Technologies

    DEFF Research Database (Denmark)

    Fausing, Bent

    2010-01-01

    , - in short modernity - have taken away from human existence. What old technology has removed now comes back through new technology promoting a better humanity. The present article investigates how digital technology and affects are presented and combined, with examples from everyday imagery, e.g. TV...... or anthropomorphism is important for the branding of new technology. Technology is seen as creating a techno-transcendence towards a more qualified humanity which is in contact with fundamental human values like intuition, vision, and sensing; all the qualities that technology, industrialization, and rationalization......Samsung introduced in 2008 a mobile phone called "Soul" made with a human touch and including itself a "magic touch". Through the analysis of a Nokia mobile phone TV-commercials I want to examine the function and form of digital technology in everyday images. The mobile phone and its digital camera...

  3. The Soul of Leadership.

    Science.gov (United States)

    Chopra, Deepak

    2002-01-01

    Discusses the soul of leadership, including basic principles such as a leader is the symbolic soul of the group. Describes the essentials of leadership using the acronym LEADERS: Look and listen, Empowerment, Awareness, Doing, Emotional freedom and empathy, Responsibility, and Synchronicity. (PKP)

  4. Sherlock Holmesi salapärane päritolu / Aare Ermel

    Index Scriptorium Estoniae

    Ermel, Aare, 1957-2013

    2004-01-01

    Sir Arthur Conan Doyle'i detektiivilugudest BBC poolt aastail 2000-2001 toodetud 6-osalisest telesarjast "Mõrvatoad" ilmus Eestis kaht filmi sisaldav DVD "Sherlock Holmesi salapärane päritolu" ja "Sherlock Holmes : Patsiendi silmad"

  5. RELIGION AND PURIFICATION OF SOUL

    Directory of Open Access Journals (Sweden)

    Azam Khodashenas Pelko

    2010-11-01

    Full Text Available The Jainism emphasizes three major teachings about the purification of the soul (jiva, Ahimsa, Aparigrapha and anekantwad. Jainism, The focus of this religion has been purification of the soul by means of right conduct, right faith and right knowledge. The ultimate goal of Hinduism is Moksha or liberation (total freedom. In Hinduism, purification of the soul is a goal that one must work to attain. The Buddhism is the science of pursuing the aim of making the human mind perfect, and of purifying the human soul. The knowledge of purifying of the soul and softening of the hearts is as essential for human. They having the correct motivations means purifying our souls from hypocrisy, caprice, and heedlessness. The primary goal of Taoism may be described as the mystical intuition of the Tao, which is the way, the undivided unity, and the ultimate Reality. According to the Christianity access to truth cannot be conceived without purity of the soul

  6. Iamblichus on the Soul

    Directory of Open Access Journals (Sweden)

    Eugene Afonasin

    2012-07-01

    Full Text Available Built on two previous studies, dedicated, respectively, to Iamblichus of Chalcis’ (c. 240 – 325 Letters and his vision of the afterlife (ΣΧΟΛΗ 4.1 (2010 166–193 and ΣΧΟΛΗ 4.2 (2010 239–245, the author now turns to the De anima of the Syrian Neoplatonist, preserved only fragmentary in John of Stobi’s Eclogae. Unfortunately, only a doxographic part of Iamblichus’ original treatise On the Soul was preserved by Stobaeus. The fragments were collected and for the first time studied by Festugière (1953, are then comprehensively edited, translated and commented by J. Finamore and J.M. Dillon (2002. The text is interesting for many respects. It supplies us with a considerable amount of information concerning ancient opinions about the nature of the soul, its powers, activities and faculties, considers the questions related with the number of the souls, their descent, encounter with the body, life and death, and, finally, such eschatological matters as purification, judgment, punishment and reward. Besides, the fragments allow us to perceive Iamblichus’ own concept of the soul as a mediator between the world and the higher reality, immersed in the context of his sharp criticism of his predecessors, such as Numenius, Plutarch, Atticus, Albinus, Plotinus, Amelius, and Porphyry. The fragments are translated into the Russian for the first time.

  7. Oblici roditeljskoga glazbenog kulturnog kapitala i glazbena socijalizacija djece rane i predškolske dobi

    OpenAIRE

    Boneta, Željko; Čamber Tambolaš, Akvilina; Ivković, Željka

    2017-01-01

    Od devedesetih godina 20. stoljeća učestala su sociološka istraživanja međugeneracijske transmisije kulturnog kapitala potaknuta Bourdieuovom teorijom kulturne reprodukcije. U njihovu je fokusu uglavnom bila analiza utjecaja roditeljskoga kulturnog kapitala na djecu školske dobi. Ovaj je rad problematizirao vezu roditeljskoga glazbenog kulturnog kapitala i glazbene socijalizacije dobne skupine koja je u dosadašnjim istraživanjima bila zanemarena – djece rane i predškolske dobi. Bourdieuova te...

  8. Oblici roditeljskoga glazbenog kulturnog kapitala i glazbena socijalizacija djece rane i predškolske dobi

    Directory of Open Access Journals (Sweden)

    Željko Boneta

    2017-06-01

    Full Text Available Od devedesetih godina 20. stoljeća učestala su sociološka istraživanja međugeneracijske transmisije kulturnog kapitala potaknuta Bourdieuovom teorijom kulturne reprodukcije. U njihovu je fokusu uglavnom bila analiza utjecaja roditeljskoga kulturnog kapitala na djecu školske dobi. Ovaj je rad problematizirao vezu roditeljskoga glazbenog kulturnog kapitala i glazbene socijalizacije dobne skupine koja je u dosadašnjim istraživanjima bila zanemarena – djece rane i predškolske dobi. Bourdieuova teza o trima oblicima kulturnog kapitala operacionalizirana je u području glazbe. Kao indikatori institucionaliziranoga glazbenog kulturnog kapitala roditelja korišteni su opće i glazbeno obrazovanje, utjelovljenoga glazbeni angažman roditelja i djece i roditeljske glazbene odgojne prakse, a objektiviranoga materijalni glazbeni resursi koje obitelj posjeduje i kojim se koriste u procesu glazbene socijalizacije. Istraživanje je provedeno 2013. godine metodom ankete na uzorku roditelja čija djeca pohađaju vrtić na području grada Rijeke (N = 342. Kod većine obitelji učestalo je prakticiranje glazbenih aktivnosti s djecom, posjedovanje glazbenih resursa koji te aktivnosti omogućuju, ali i vrlo ograničeno uključivanje djece u izvanvrtićke glazbene aktivnosti. Pronađene su razmjerno slabe veze roditeljskoga općeg i glazbenog obrazovanja s oblicima glazbenih odgojnih praksi i posjedovanja glazbenih materijalnih resursa. Na transmisiju glazbenog kapitala snažnije, ali još uvijek relativno slabo, utječu glazbeno obrazovanje roditelja i prošli ili sadašnji roditeljski glazbeni angažman od njihova općeg obrazovanja. Zaključno, glazbena socijalizacija djece te dobi nema, u burdijeovskom smislu, distinktivnu funkciju transmisije kulturnog kapitala, nego se zbiva u sklopu rodnog obrasca roditeljske brige za dijete rane i predškolske dobi, prema kojem je majka u svim dimenzijama (glazbene socijalizacije angažiranija od oca.

  9. Plotinus’ views on soul, suicide, and incarnation

    Directory of Open Access Journals (Sweden)

    Kalogiratou, Androniki

    2009-06-01

    Full Text Available There is a question to be answered if one is to grasp the function of suicide in the Plotinian universe and its connection to the subject matters of soul, incarnation, murder and killing living beings. How far does the body exist as a degenerative trait? Could the purpose of embodying a soul purify it and to what extent does the particular use of it by an individual soul point towards its ability to uncover hidden potentiality or simply makes it an instrument of self-destruction and self-alienation? Our view of Plotinus’ philosophy and its significance depends upon how we chose to solve this puzzle. Although Plotinus ultimately changed his attitude on suicide in Ennead 1.4.46 as compared to Ennead 1.9.16, the concept appears under three basic guises in his philosophy. One is the more traditional notion that we have today, whether given a choice to remain or to leave the body, the soul should remain? Beyond that, Plotinus enriches our view of suicide with two further notions: One is the idea of soul’s incarnation as an involuntary suicide, committed in the rush to attain matter. Finally there is the notion of suicide in the form of murder or killing a living being or plant. Killing another living being would be like attempting suicide: killing a part of the one unified, single soul to which we also partake. The difference between Plotinus and later Neoplatonists, of which Damascius was one, is that the latter won’t allow for the absolute detachment of the soul from the body, while the body is still alive. It thus becomes impossible for the soul of the prospective wise man, to venture completely into the positive nothingness of the Ineffable, because the soul is always bound to the body, and that results in its inability to escort its own self, so as to say, into that which is total nothingness and alien to the soul.

  10. Self and Soul, from Logic to Experience

    Directory of Open Access Journals (Sweden)

    Marchal Bruno

    2017-05-01

    Full Text Available We explain in brief terms the discovery of the third-person self in computer science. We explain how the incompleteness phenomenon makes consistent, natural, and nontrivial the definition of knowledge given by Theaetetus (Plato, and we make use of it to define a first-person knower, which, as I have suggested in previous papers (Marchal 2007, 2015a is a good candidate for the soul. This invites us to attach a notion of a soul to the machine canonically. We justify that the soul of the classical universal machine knows already that she is *not* a machine, and can assess some antic argument in favor of the immortality of the soul. We end by looking if a personal experience can corroborate this, and in which sense could a human or a machine experience its immortality, and what could that mean.

  11. Soul Anatomy: A virtual cadaver

    Directory of Open Access Journals (Sweden)

    Moaz Bambi

    2014-01-01

    Full Text Available In the traditional science of medicine and medical education, teaching human anatomy in the class has always been done using human cadavers. Not only does this violate human sanctity, but according to our research, it is not adequate to provide students with the alleged educational value that it is supposed to deliver. It is very cumbersome to organise all the aspects of cadaver care. Cadavers are also very limited when it comes to controlling their structures and any benefit is almost completely altered the first time the cadaver is used (dissected, and ironically, it is very weak at delivering actual real-life scenarios of a human body to students. Virtual anatomy has been a promising solution that many are counting on. But even today, we have not found a complete solution that combines all the benefits of using human cadavers and those introduced by its technical counterparts. "Soul Anatomy" aims to do just that. It brings the best of all worlds, from a natural intuitive control system, life-like feel of organs, precise accuracy in moving and controlling bodily structures, to the smallest details of being able to show medical information overlays from various medical databases connected to the internet; thus making use of technology in teaching human anatomy by providing a modern learning experience.

  12. GALEN'S RECOGNITION OF THREE SOULS AND THEIR ORIGIN

    OpenAIRE

    Mahdihassan, S.

    1986-01-01

    Galen's three souls incorporate previously existing ideas of soul. Soul is matter – cum – energy. As matter it is airlike, the finest by nature and as movement, like sound, the form of energy most subtle of its kind. Creator is depicted with Creation as the Cosmic egg and snake as Cosmic soul and the syllable Om, as the word incorporating creative energy. Om as humming sound is symbolized by Bees which produce such sound.

  13. Leonardo da Vinci: the search for the soul.

    Science.gov (United States)

    Del Maestro, R F

    1998-11-01

    The human race has always contemplated the question of the anatomical location of the soul. During the Renaissance the controversy crystallized into those individuals who supported the heart ("cardiocentric soul") and others who supported the brain ("cephalocentric soul") as the abode for this elusive entity. Leonardo da Vinci (1452-1519) joined a long list of other explorers in the "search for the soul." The method he used to resolve this anatomical problem involved the accumulation of information from ancient and contemporary sources, careful notetaking, discussions with acknowledged experts, and his own personal search for the truth. Leonardo used a myriad of innovative methods acquired from his knowledge of painting, sculpture, and architecture to define more clearly the site of the "senso comune"--the soul. In this review the author examines the sources of this ancient question, the knowledge base tapped by Leonardo for his personal search for the soul, and the views of key individuals who followed him.

  14. Soul Work: A Phenomenological Study of College English Professors

    Science.gov (United States)

    Ashby, Sjon F.

    2011-01-01

    English teachers can encourage writing that opens college students to transformative learning through what John Dirkx called soul work. This soul work involves the conscious attempt to bring to the surface myths, images, and metaphors from the unconscious through imaginative writing and thinking processes. Participants in this study engaged in…

  15. Neuroscience, quantum indeterminism and the Cartesian soul.

    Science.gov (United States)

    Clarke, Peter G H

    2014-02-01

    Quantum indeterminism is frequently invoked as a solution to the problem of how a disembodied soul might interact with the brain (as Descartes proposed), and is sometimes invoked in theories of libertarian free will even when they do not involve dualistic assumptions. Taking as example the Eccles-Beck model of interaction between self (or soul) and brain at the level of synaptic exocytosis, I here evaluate the plausibility of these approaches. I conclude that Heisenbergian uncertainty is too small to affect synaptic function, and that amplification by chaos or by other means does not provide a solution to this problem. Furthermore, even if Heisenbergian effects did modify brain functioning, the changes would be swamped by those due to thermal noise. Cells and neural circuits have powerful noise-resistance mechanisms, that are adequate protection against thermal noise and must therefore be more than sufficient to buffer against Heisenbergian effects. Other forms of quantum indeterminism must be considered, because these can be much greater than Heisenbergian uncertainty, but these have not so far been shown to play a role in the brain. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Walking by Ourselves with our Toes: An Exploration of Soul

    Directory of Open Access Journals (Sweden)

    Kara ARVIKO

    2010-07-01

    Full Text Available Much of our time as professionals involves a focus on rational thought: completing administrative tasks, setting course outcomes, planning lessons, marking assignments and evaluating tasks. As Thomas Moore reminds us in his paper Educating the Soul, todays emphasis on mind has resulted in a neglect of the soul (as cited in Miller, Karsten, Denton, Orr, & Colalillo Kates, 2005, p. 9. In this article, Kara Arviko sets out to explore what it means to discover and nourish the soul, and to identify how that discovery impacts her interactions with and understanding of her students. She concludes it is a journey worth taking.

  17. AHP 1: Calling Back the Lost Namuyi Tibetan Soul

    Directory of Open Access Journals (Sweden)

    Libu Lakhi

    2009-06-01

    Full Text Available A na53 mʑi53 person falls accidentally and is panicked. The rə53 hĩ53 'soul' leaves the body and the person becomes lethargic. It is nearly always the patient's mother who calls the soul back, if she knows the correct chant. Five thousand na53 mʑi53 Tibetans live mostly in Liangshan Yi Autonomous Prefecture, Sichuan Province, PR China with Han and Nuosu (Yi. The ritual is commonly done for children less than ten years of age, though anyone may lose their soul. The chant is presented along with a brief discussion of na53 mʑi53 cosmology and beliefs concerning the soul.

  18. Notes on the historiography of Música soul and Funk carioca

    Directory of Open Access Journals (Sweden)

    Carlos Palombini

    2010-01-01

    Full Text Available Un panorama crítico de la historia de los bailes funk cariocas y su música y sus relaciones con la música negra norteamericana y la emergencia de un orgullo negro en la música popular brasileñaPalabras Clave: Baile funk, música soul, black soul, bailes black, hip-hop, música negra____________________________Abstract:A critical survey of the history of Rio de Janeiro bailes funk and their music in their relations with African North-American musics and the emergence of black pride in Brazilian popular music. Keywords: Baile funk, música soul, black soul, bailes black, hip-hop, black music

  19. On the Record: Savera Kalideen, senior Advocacy Manager for Soul ...

    African Journals Online (AJOL)

    Abstract. Chandré Gould speaks to Savera Kalideen, senior Advocacy Manager for Soul City, about the Phuza Wize campaign and the challenges of developing and implementing holistic violence prevention campaigns.

  20. Soul and psyche: The Bible in psychological perspective

    Directory of Open Access Journals (Sweden)

    Willem J. Smith

    2004-10-01

    Full Text Available During the last third of the twentieth century a discipline that applies psychological and psychoanalytic insight to the study of the Bible, has resurfaced within biblical studies. In his book, Soul and Psyche, Wayne Rollins offers a psychological biblical approach as one of the new approaches to Scripture since the 1960’s. This approach tends to bring a renewed appreciation for the role of the human psyche or soul in the history of the Bible and its interpretation.

  1. Soul and psyche: The Bible in psychological perspective

    Directory of Open Access Journals (Sweden)

    Willem J. Smith

    2004-11-01

    Full Text Available During the last third of the twentieth century a discipline that applies psychological and psychoanalytic insight to the study of the Bible, has resurfaced within biblical studies. In his book, Soul and Psyche, Wayne Rollins offers a psychological biblical approach as one of the new approaches to Scripture since the 1960’s. This approach tends to bring a renewed appreciation for the role of the human psyche or soul in the history of the Bible and its interpretation.

  2. The soul in the mediaeval Psalter

    Directory of Open Access Journals (Sweden)

    Kinga Lis

    2016-06-01

    Full Text Available The soul in the mediaeval Psalter The paper is an attempt to examine what lies at the heart and soul of the mediaeval Psalter in the contemporaneous approach(es to its vernacularisations. In particular, the paper investigates the applications of the mediaeval translation theory in relation to a 12th-century Anglo-Norman, a 15th-century Middle French and four 14th-century Middle English prose Psalter renditions, with a view to locate them within the spirit of the attitude to biblical translations current in the Middle Ages and against the backdrop of the position of the Psalter in the period. In practical terms, the analysis is conducted on the basis of the equivalent selection strategies for rendering four Latin nouns central to the Psalter: anima, animae ‘soul,’ cor, cordis ‘heart’ and, perhaps surprisingly, ren, renis ‘kidney’ and lumbus, lumbi ‘loins’. All cases of variation in this respect are studied closely from intra- as well as extra-textual perspectives in order to establish the possible reasons behind the divergences, as these constitute exceptions rather than the rule, even in apparently heterodox renditions.   Dusza w średniowiecznym Psałterzu Artykuł stanowi próbę bliższego przyjrzenia się podstawowym zasadom średniowiecznego podejścia do tłumaczenia psałterza na języki wernakularne. Przedstawiono w nim analizę zastosowania mediewalnej teorii tłumaczeń w odniesieniu do dwunastowiecznego Psałterza anglo-normandzkiego, piętnastowiecznego Psałterza średniofrancuskiego i czterech czternastowiecznych tłumaczeń Księgi Psalmów na średnioangielski. Celem było wykazanie, w jakim stopniu analizowane teksty odzwierciedlają ówczesne podejście do tłumaczeń biblijnych w kontekście znaczenia psałterza w średniowieczu. Badanie przeprowadzone jest na podstawie doboru ekwiwalentów w tłumaczeniu czterech – niezwykle istotnych z powodu rangi tych tekstów w średniowieczu – łacińskich rzeczownik

  3. Soul and its Fate after Death in Jainism

    Directory of Open Access Journals (Sweden)

    Banafshe Mutaqi

    2015-12-01

    Full Text Available Although considered as one of the Hindu religions and despite some similarities, Jainism, due to its attitude towards soul and its origin, is placed somehow contrary to Hinduism.  Jainism and Hinduism have many similar characteristic features, including the concepts of samsara, karma and moksha.  However, Jain’s attitude to human nature and his final goal and the way to reach that goal distinguishes it from Hinduism. Despite huge complexities of Jainism, it can be said that soul (jÄ«va plays a critical role in this religion; respect to creatures, no matter in what rank they are (Ahiṃsā, is the main and fundamental rule of Jainism; this respect is derived definitely not from a materialistic aspect, but rather due to a soul which reaches a superior rank of human existence by passing through different worlds; therefore, Jainists, following specific ethical principles and going through severe physical austerities, as a result of which  the effect of Matter (AjÄ«va on the soul (jÄ«va is disappeared, can achieve the state of sincerity (Maqam e Kholus and essence of being. This state has a godlike status in Jainism. However, achieving this feature will be examined by describing the issues relevant to this religion. Clearly, it will be explained by examining the concept of soul and its type and the relationship between soul/body and soul/deed, as well as the issue of incarnation and the way to salvation in this religion

  4. Soul and its Fate after Death in Jainism

    Directory of Open Access Journals (Sweden)

    Muhammad Mehdi Alimardi

    2016-01-01

    Full Text Available Although considered as one of the Hindu religions and despite some similarities, Jainism, due to its attitude towards soul and its origin, is placed somehow contrary to Hinduism.  Jainism and Hinduism have many similar characteristic features, including the concepts of samsara, karma and moksha.  However, Jain’s attitude to human nature and his final goal and the way to reach that goal distinguishes it from Hinduism. Despite huge complexities of Jainism, it can be said that soul (jīva plays a critical role in this religion; respect to creatures, no matter in what rank they are (Ahiṃsā, is the main and fundamental rule of Jainism; this respect is derived definitely not from a materialistic aspect, but rather due to a soul which reaches a superior rank of human existence by passing through different worlds; therefore, Jainists, following specific ethical principles and going through severe physical austerities, as a result of which  the effect of Matter (Ajīva on the soul (jīva is disappeared, can achieve the state of sincerity (Maqam e Kholus and essence of being. This state has a godlike status in Jainism. However, achieving this feature will be examined by describing the issues relevant to this religion. Clearly, it will be explained by examining the concept of soul and its type and the relationship between soul/body and soul/deed, as well as the issue of incarnation and the way to salvation in this religion

  5. The Life Of Soul In Simmel And Lúkacs

    Directory of Open Access Journals (Sweden)

    Sergiano Alcântara da Silva

    2014-10-01

    Full Text Available The present paper deals with two philosophical points of view concerning the dualist problem about the relation of the soul with the world: on the one hand, there is Georg Simmel pointing, in an eloquent fashion, the shades of the life of soul in a world dominated by the fragmentary dimension of modernity; on the other hand, there is Georg Lúkacs trying to find a place where such a landscape can be nullified and overcome. This way, we aim to bring both visions of the world closer as well as to put them apart.

  6. Notes on the historiography of Música soul and Funk carioca

    OpenAIRE

    Carlos Palombini

    2010-01-01

    Un panorama crítico de la historia de los bailes funk cariocas y su música y sus relaciones con la música negra norteamericana y la emergencia de un orgullo negro en la música popular brasileñaPalabras Clave: Baile funk, música soul, black soul, bailes black, hip-hop, música negra____________________________Abstract:A critical survey of the history of Rio de Janeiro bailes funk and their music in their relations with African North-American musics and the emergence of black pride in Brazilian ...

  7. The Life Of Soul In Simmel And Lúkacs

    Directory of Open Access Journals (Sweden)

    Sergiano Alcântara da Silva

    2014-08-01

    Full Text Available The present paper deals with two philosophical points of view concerning the dualist problem about the relation of the soul with the world: on the one hand, there is Georg Simmel pointing, in an eloquent fashion, the shades of the life of soul in a world dominated by the fragmentary dimension of modernity; on the other hand, there is Georg Lúkacs trying to find a place where such a landscape can be nullified and overcome. This way, we aim to bring both visions of the world closer as well as to put them apart.

  8. On The Epistemological Dimension Of The Soul in Plato

    Directory of Open Access Journals (Sweden)

    Telmir de Souza Soares

    2014-09-01

    Full Text Available This article proposes to investigate the epistemological dimension of the knowledge of the soul in Plato. For this we take as base the idea that the knowledge comes from the principle of differencition betwen the man [soul] and the world [nature] in the western thought. From antient greeks, this question appears by its given responses that in after philosophy remains as principal point of discussion and attention amogn different traditions and philsophers. In this article we will show interpretation of Plato regarding to that question.

  9. The Power of Being Vulnerable in Christian Soul Care: Common Humanity and Humility.

    Science.gov (United States)

    Kim, Kyubo

    2017-02-01

    Soul caregivers often hesitate to be vulnerable in their pastoral practices. Jesus, however, embraced his vulnerabilities as a human to redeem humanity even though he was the Son of God. This paper first explores the dynamics of shame and power that make soul caregivers reluctant to accept their vulnerabilities and then describes the contributions of sharing caregiver's vulnerabilities in a soul care practice. This article argues that being vulnerable allows a soul caregiver to imitate Jesus by sharing in the client's common humanity, initiating an authentic relationship between the client and the soul caregiver; it is also a practice of humility, inviting God's cure in soul care. This study proposes the necessity of embracing vulnerability in soul care ministry, instead of hiding it.

  10. Neuroscience and the Soul: Competing Explanations for the Human Experience

    Science.gov (United States)

    Preston, Jesse Lee; Ritter, Ryan S.; Hepler, Justin

    2013-01-01

    The development of fMRI techniques has generated a boom of neuroscience research across the psychological sciences, and revealed neural correlates for many psychological phenomena seen as central to the human experience (e.g., morality, agency). Meanwhile, the rise of neuroscience has reignited old debates over mind-body dualism and the soul.…

  11. A Musical Fight between Soul and Body in 1600

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2014-01-01

    The subject of this article is a discussion of Emilio de' Cavalieri's early Baroque music drama, Rappresentatione di anima, et di corpo (The Play of Soul and Body), performed in Rome in 1600 with a particular focus on the ambivalence apparent in this work between the text's explicit pious plea...

  12. Flannery O'Connor's Country of the Soul

    Directory of Open Access Journals (Sweden)

    Mary Aswell Doll

    2014-01-01

    Full Text Available O'Connor's Catholicism takes an iconoclastic stand against religion that privileges subject superiority. Using violence as a means to shatter comfort in the separation such superiority presupposes, O'Connor brings her characters into direct confrontation with natural figures and objects--animals, trees, rocks, clay-- to draw attention to their soul energies in God's world. This essay offers a new way to appreciate Flannery O'Connor's spiritual intentions by invoking Neoplatonic ideas of the anima mundi (soul in the world, mythic understanding of the connection among all life forms, as well as depth psychologist James Hillman's re-visioning psychology. According to these strands, the cosmos is alive, sacred, and intentional and has lessons to teach pious Bible thumpers about the breadth of an animating spirit in the surrounding world.

  13. Soul, butterfly, mythological nymph: psyche in philosophy and neuroscience.

    Science.gov (United States)

    Antonakou, Elena I; Triarhou, Lazaros C

    2017-03-01

    The term "psyche" and its derivatives - including "Psychology" and "Psychiatry" - are rooted in classical philosophy and in mythology. Over the centuries, psyche has been the subject of discourse and contemplation, and of fable; it has also come to signify, in entomology, the order of Lepidoptera. In the current surge of research on brain and mind, there is a gradual transition from the psyche (or the "soul") to the specified descriptors defined by the fields of Behavioral, Cognitive and Integrative Neuroscience.

  14. Black Paul: a soul music no Brasil nos anos 1970

    OpenAIRE

    Paiva, Carlos Eduardo Amaral de [UNESP

    2015-01-01

    This thesis investigates the acclimatisation of soul music genres in Brazil in the 70's by the analysing the songs of important black musicians of the era: Tim Maia, Jorge Ben and Tony Tornado as well as the movement called Black Rio. We suggest an inflection on the formation of the black identity in the country that represented the emergence of a black structure of feelings in transnational levels. This structure of feelings is chacacterised by its ethinic affirmation and its internationalis...

  15. On the nature of implicit soul beliefs: when the past weighs more than the present.

    Science.gov (United States)

    Anglin, Stephanie M

    2015-06-01

    Intuitive childhood beliefs in dualism may lay the foundation for implicit soul and afterlife beliefs, which may diverge from explicit beliefs formed later in adulthood. Brief Implicit Association Tests were developed to investigate the relation of implicit soul and afterlife beliefs to childhood and current beliefs. Early but not current beliefs covaried with implicit beliefs. Results demonstrated greater discrepancies in current than in childhood soul and afterlife beliefs among religious groups, and no differences in implicit beliefs. These findings suggest that implicit soul and afterlife beliefs diverge from current self-reported beliefs, stemming instead from childhood beliefs. © 2014 The British Psychological Society.

  16. The Origin of the Soul from Antiquity to the early Modern Period

    NARCIS (Netherlands)

    Spruit, L.

    2014-01-01

    The origin of the soul became a systematic subject of speculation in Greek philosophy and medicine. In early Christian thought, three theories evolved: the soul was held to be either generated from the parents (traducianism) or it was believed to be formed by a special act of creation on God’s part

  17. The Soul and the Body in the Philosophy of the Rambam

    Directory of Open Access Journals (Sweden)

    Avshalom Mizrahi

    2011-04-01

    Full Text Available Among the wide-spectrum contribution of the Rambam – the Maimonides – in philosophy to the word and to Judaism are his ideas on the body and on the soul and on the relations between them. His major approaches in these subjects are the following: 1 The body is the home of the soul, and the soul guides the body. That means the body and the soul are one unit. 2 The soul has five virtual parts. Each part is responsible for another activity in the human being. 3 Except for the treatment of diseases of the body and the soul with drugs, foods, physical exercise, etc., the Rambam believes that maintaining the health – of the body and of the soul – lies first of all, and probably exclusively, in observing the commandments and improving one’s ways, morals and conduct up to their highest levels, toward all of the world’s creatures. 4 The Rambam is of the opinion that one needs to persist in learning the Torah. One should worship God with awe and love and observe good values and virtues. All of these build the frameworks that maintain mental health and strengthen man’s abilities to develop skills for maintaining bodily health. This is so because body and soul are one – which is the basis of the Rambam’s philosophy of health and medicine.

  18. The image of the black soul: From the hut near the Congo to the ...

    African Journals Online (AJOL)

    The black man, argues the paper, has drunk from life-giving essences, and thereby borrowed from immortality. The black soul is capable of moving up and down the hierarchy of life or being. It is therefore part of the essence of the black soul to move from slaves to freemen. The paper concludes that as the rivers deepen with ...

  19. “ Habitus ” in soul care. Towards “spiritual fortigenetics” (parrhesia ...

    African Journals Online (AJOL)

    It is argued that habitus plays a fundamental role in both a practical theological and pastoral-anthropological approach in order to focus on the “wholeness” of the human soul (soul as a qualitative and relational entity). It is hypothesized that a spiritual understanding of fortigenetics and the emphasis on a positive growth ...

  20. Learning through the Soul: Concepts Relating to Learning and Knowledge in the Mayan Cultures of Mexico.

    Science.gov (United States)

    King, Linda

    1999-01-01

    Describes the central concept of Mayan culture, the possession of the soul, or ch'ulel, in the process of forming a knowledgeable person. Soul acquisition is important to becoming the ideal person, and to the educational formation of future generations. Looks at the role language plays in culture as memory, thought formation, and learning process.…

  1. The soul and the body in the philosophy of the rambam.

    Science.gov (United States)

    Mizrahi, Avshalom

    2011-04-01

    Among the wide-spectrum contribution of the Rambam - the Maimonides - in philosophy to the word and to Judaism are his ideas on the body and on the soul and on the relations between them. His major approaches in these subjects are the following: 1) The body is the home of the soul, and the soul guides the body. That means the body and the soul are one unit. 2) The soul has five virtual parts. Each part is responsible for another activity in the human being. 3) Except for the treatment of diseases of the body and the soul with drugs, foods, physical exercise, etc., the Rambam believes that maintaining the health - of the body and of the soul - lies first of all, and probably exclusively, in observing the commandments and improving one's ways, morals and conduct up to their highest levels, toward all of the world's creatures. 4) The Rambam is of the opinion that one needs to persist in learning the Torah. One should worship God with awe and love and observe good values and virtues. All of these build the frameworks that maintain mental health and strengthen man's abilities to develop skills for maintaining bodily health. This is so because body and soul are one - which is the basis of the Rambam's philosophy of health and medicine.

  2. Understanding brain, mind and soul: contributions from neurology and neurosurgery.

    Science.gov (United States)

    Pandya, Sunil K

    2011-01-01

    Treatment of diseases of the brain by drugs or surgery necessitates an understanding of its structure and functions. The philosophical neurosurgeon soon encounters difficulties when localising the abstract concepts of mind and soul within the tangible 1300-gram organ containing 100 billion neurones. Hippocrates had focused attention on the brain as the seat of the mind. The tabula rasa postulated by Aristotle cannot be localised to a particular part of the brain with the confidence that we can localise spoken speech to Broca's area or the movement of limbs to the contralateral motor cortex. Galen's localisation of imagination, reasoning, judgement and memory in the cerebral ventricles collapsed once it was evident that the functional units-neurones-lay in the parenchyma of the brain. Experiences gained from accidental injuries (Phineas Gage) or temporal lobe resection (William Beecher Scoville); studies on how we see and hear and more recent data from functional magnetic resonance studies have made us aware of the extensive network of neurones in the cerebral hemispheres that subserve the functions of the mind. The soul or atman, credited with the ability to enliven the body, was located by ancient anatomists and philosophers in the lungs or heart, in the pineal gland (Descartes), and generally in the brain. When the deeper parts of the brain came within the reach of neurosurgeons, the brainstem proved exceptionally delicate and vulnerable. The concept of brain death after irreversible damage to it has made all of us aware of 'the cocktail of brain soup and spark' in the brainstem so necessary for life. If there be a soul in each of us, surely, it is enshrined here.

  3. Descartes' Passions of the soul--seeds of psychiatry?

    Science.gov (United States)

    Albuquerque, Joy; Deshauer, Dorian; Grof, Paul

    2003-09-01

    Rene Descartes (1596-1650), often called the 'father of modern philosophy', aimed at rooting all knowledge in certainty so that our understanding of the world could progress without error. To achieve this, he needed at least one sure thing on which to build. Starting with the most basic knowledge, the fact of his own existence--cogito ergo sum (I think therefore I am), he systematically proceeded to explain the world. Such systematic understanding would be accessible to anyone who applied the Cartesian method, and in turn would lead to a good life. Descartes' Passions of the Soul was written according to his method of certainty and fits in with a meticulously refined worldview. It is one of the first systematic treatises to explain a wide array of emotions, both normal and abnormal. Based on the Cartesian dualistic model of mind and body, the work helps ground a long medical tradition of separating 'rational' consciousness from emotions. For Descartes, emotions arose from two sources, the intellect and the body (Passions of the Soul and Passions of the Body). The more subtle 'Passions of the Soul' were viewed as superior to coarser and often-troublesome emotions taking root in the body. It is interesting to note the absence of clarity, however, in Descartes' division of intellectual emotions from bodily emotions, perhaps revealing an enduring weakness in the dualistic model itself. The work grapples with the multi-causal nature of psychopathology and brings out complex interactions between temperament and life experience. While modern neuroscience makes ever-tighter associations between physiology and experience, many of the basic scientific challenges we face today are outlined in this 350-year-old book.

  4. A possible way to naturalize the human soul

    Directory of Open Access Journals (Sweden)

    José Luis Guijarro Morales

    2010-12-01

    Full Text Available Normal 0 21 false false false ES X-NONE X-NONE MicrosoftInternetExplorer4 One of the most basic linguistic principles (or parameters, according to some is used to point to a likely necessary (though, probably, not sufficient condition of human uniqueness (i.e. being able to speak, communicate complex messages, have religious feelings, indulge in art and humour, and so on which has been conceptualised either as the fact that we have human souls, in religious contexts, or human minds, in other contexts.

  5. The pursuit of immortality: from the ego to the soul.

    Science.gov (United States)

    Miller, Lisa; Miller, Kenneth; Haught, John; Murphy, Nancey

    2011-10-01

    Moderated by Lisa Miller from Newsweek, evolutionary biologist Kenneth Miller (Brown University) and theologians John Haught (Georgetown University) and Nancey Murphy (Fuller Theological Seminary) discuss the questions Are we immortal? Do our souls exist beyond our bodies? and What scientific evidence is there for mystical experience? from a cultural, historical, and scientific perspective. The following is an edited transcript of the discussion that occurred March 23, 2011, 7:00-8:15 PM, at the New York Academy of Sciences in New York City. © 2011 New York Academy of Sciences.

  6. FRAGILE WOMEN-BEASTS: LIFE SCARS ON FEMALE SOUL

    OpenAIRE

    Roselene Berbigeier Feil

    2013-01-01

    On female characters Mia Couto delegates a mission: fly the route, or suf­fered mild, between the dream world and reality, adding them in both worlds pains of soul and body will leave indelible scars. Revelations about female behavior, submission in relation to male power and self-assertion in tough times are in the dream world of the satisfaction of desires more romantic and more feminine needs. Among the mishaps of everyday life and the hope of better days, women of Mia Couto transiting the...

  7. The generation of the soul in the philosophy of Mulla Sadra

    Directory of Open Access Journals (Sweden)

    Halilović Tehran

    2016-01-01

    Full Text Available All Islamic philosophers agree with the idea that the human soul is immaterial and that after it exits the body it continues its life. Also, it is clear that the soul is one of the creatures of God and that its existence is the effect of the Divine Being. In this article, we will not be examining what the soul is or what its cause is. Rather, we will be examining the problem of how Muslim philosophers explain the generation of the human soul. We will especially examine the view of Mulla Sadra who had a visible command over philosophical discussions regarding the soul. This is a problem whose importance will be understood when we examine different parts of religious texts including verses of the Qur'an and the traditions. Some of these texts state that the human soul was generated before the body. However, some others state that the human soul is generated at the time when its body is formed in the womb of its mother. Based upon his new philosophical innovations, which he established in his Transcendent Philosophy, Mulla Sadra leveled many objections against the popular notion that the immaterial human soul is generated at the same time as its material body is formed. In reality, the theory that Mulla Sadra has presented in his philosophy perfects the thoughts of the previous philosophers regarding the generation of the soul. He explains that the human soul - as many verses of the Qur'an have indicated - is generated with the body. However, it is not immaterial at that time. Rather, this immateriality is something that is acquired gradually when it elevates its existential degrees.

  8. The Soul, as an Uninhibited Mental Activity, is Reduced into Consciousness by Rules of Quantum Physics.

    Science.gov (United States)

    Ceylan, Mehmet Emin; Dönmez, Aslıhan; Ünsalver, Barış Önen; Evrensel, Alper; Kaya Yertutanol, Fatma Duygu

    2017-12-01

    This paper is an effort to describe, in neuroscientific terms, one of the most ambiguous concepts of the universe-the soul. Previous efforts to understand what the soul is and where it may exist have accepted the soul as a subjective and individual entity. We will make two additions to this view: (1) The soul is a result of uninhibited mental activity and lacks spatial and temporal information; (2) The soul is an undivided whole and, to become divided, the soul has to be reduced into unconscious and conscious mental events. This reduction process parallels the maturation of the frontal cortex and GABA becoming the main inhibitory neurotransmitter. As examples of uninhibited mental activity, we will discuss the perceptual differences of a newborn, individuals undergoing dissociation, and individuals induced by psychedelic drugs. Then, we will explain the similarities between the structure of the universe and the structure of the brain, and we propose that consideration of the rules of quantum physics is necessary to understand how the soul is reduced into consciousness.

  9. Soulful Technologies. Everyday Aesthetics and Images in New Media

    DEFF Research Database (Denmark)

    Fausing, Bent

    2016-01-01

    - in short modernity - have taken away from human existence. What old technology has removed is now brought back through new technology promoting a better humanity. The present article investigates how digital technology and affects are presented and combined with examples from everyday imagery, e.g. TV...... or anthropomorphism is important for the branding of new technology. Technology is seen as creating a techno-transcendence towards a more qualified humanity which is in contact with fundamental human values like intuition, vision, and sensing; all the qualities that technology, industrialization, and rationalization...... Samsung introduced last year a mobile phone called "Soul" made with a human touch and including itself a "magic touch". Through the analysis of Nokia mobile phone TV commercials I want to examine the function and form of digital technology in everyday images.  The mobile phone, its digital camera...

  10. Psychicones: Visual Traces of the Soul in Late Nineteenth-Century Fluidic Photography.

    Science.gov (United States)

    Pethes, Nicolas

    2016-07-01

    The article discusses attempts to visualise the soul on photographic plates at the end of the nineteenth century, as conducted by the French physician Hippolyte Baraduc in Paris. Although Baraduc refers to earlier experiments on fluidic photography in his book on The Human Soul (1896) and is usually mentioned as a precursor to parapsychological thought photography of the twentieth century, his work is presented as a genuine attempt at photographic soul-catching. Rather than producing mimetic representations of thoughts and imaginations, Baraduc claims to present the vital radiation of the psyche itself and therefore calls the images he produces psychicones. The article first discusses the difference between this method of soul photography and other kinds of occult media technologies of the time, emphasising the significance of its non-mimetic, abstract character: since the soul itself was considered an abstract entity, abstract traces seemed all the more convincing to the contemporary audience. Secondly, the article shows how the technological agency of photography allowed Baraduc's psychicones to be tied into related discourses in medicine and psychology. Insofar as the photographic plates displayed actual visual traces, Baraduc and his followers no longer considered hallucinations illusionary and pathological but emphasised the physical reality and normality of imagination. Yet, the greatest influence of soul photography was not on science but on art. As the third part of the paper argues, the abstract shapes on Baraduc's plates provided inspiration for contemporary avant-garde aesthetics, for example, Kandinsky's abstract paintings and the random streams of consciousness in surrealistic literature.

  11. The Gaze of the Soul and of the Angel in the Renaissance Philosophy of Marsilio Ficino

    Directory of Open Access Journals (Sweden)

    Marko Uršič

    2015-04-01

    Full Text Available The Renaissance rediscovered the soul as the focus of the universe. Marsilio Ficino calls the soul the “bond of the world” (copula mundi, because it connects the earth and the heaven, immanence and transcendence, time and eternity. On the other hand, the centre of the world becomes more and more relative during the Renaissance period, and individual souls live more and more in their particular times and spaces. In Renaissance paintings, a soul's point of view is determined by perspective, as developed by Masaccio, Fra Angelico, Piero della Francesca et al., and the very position of the eye also features as a “symbolic form” (Erwin Panofsky. However, above each individual and “mobile” soul there are the wings of the “motionless” angel: super animam mobilem est immobilis angelus, as Ficino says in his renaissance Christianity, in reviewing the Platonic-Gnostic myth of the omnipresent angelic gaze. In the archetype of the angel Ficino perceives a metaphor for the all-knowing Intellect, towards which the human soul ascends. Following the iconology of Ernst Gombrich, this paper also takes notice of the influence of Ficino's philosophy on Botticelli's paintings.

  12. Big Bang Day : Afternoon Play - Torchwood: Lost Souls

    CERN Multimedia

    2008-01-01

    Martha Jones, ex-time traveller and now working as a doctor for a UN task force, has been called to CERN where they're about to activate the Large Hadron Collider. Once activated, the Collider will fire beams of protons together recreating conditions a billionth of a second after the Big Bang - and potentially allowing the human race a greater insight into what the Universe is made of. But so much could go wrong - it could open a gateway to a parallel dimension, or create a black hole - and now voices from the past are calling out to people and scientists have started to disappear... Where have the missing scientists gone? What is the secret of the glowing man? What is lurking in the underground tunnel? And do the dead ever really stay dead? Lost Souls is a spin-off from the award-winning BBC Wales TV production Torchwood. It stars John Barrowman, Freema Agyeman, Eve Myles, Gareth David-Lloyd, Lucy Montgomery (of Titty Bang Bang) and Stephen Critchlow.

  13. The "soul of professionalism" in the Hippocratic Oath and today.

    Science.gov (United States)

    Heubel, Friedrich

    2015-05-01

    This article views the Hippocratic Oath from a new perspective and draws consequences for modern health care. The Oath consists of two parts, a family-like alliance where the teacher of the "art" is equal to a father and a set of maxims how the "art" is to be practiced. Self-commitments stated before the gods tie the parts together and give the alliance trustworthiness. One might call this a proto-profession. Modern physicians form a similar alliance. Specific knowledge and skills and specific action guiding rules are elements of a profession but its trustworthiness rests on a combination of professional autonomy and public control. In order to be granted autonomy the profession must show some effort in enforcing its specific rules and in order to do so its members need to be convinced of the intrinsic value of their profession (the "soul of professionalism" according to Freidson). Whereas in antiquity physicians acted as single individuals the modern alliance is shaped by division of labour. Physicians use each other and other professions by mutual consent and the health care system as means in the diagnostic-therapeutic process. As any actor is reponsible for the means he uses physicians are co-responsible accordingly. Thus, professional conduct now entails care for the organisation of the alliance as detailed in the "Charter on Medical Professionalism". The effort the profession gives to this task will confirm its trustworthiness.

  14. FRAGILE WOMEN-BEASTS: LIFE SCARS ON FEMALE SOUL

    Directory of Open Access Journals (Sweden)

    Roselene Berbigeier Feil

    2013-04-01

    Full Text Available On female characters Mia Couto delegates a mission: fly the route, or suf­fered mild, between the dream world and reality, adding them in both worlds pains of soul and body will leave indelible scars. Revelations about female behavior, submission in relation to male power and self-assertion in tough times are in the dream world of the satisfaction of desires more romantic and more feminine needs. Among the mishaps of everyday life and the hope of better days, women of Mia Couto transiting the impossible of possible, the absolute strength of weakness. In most novels the author Mozambique, among them The other foot mermaid (2006, Earth sleepwalker (2007 and Confession Lioness (2012 found women are overcoming model, women who make life a journey in search of spiritual comfort, since the emotional and material they seem unattainable. The aim is to test a meeting very par­ticular with Constance and Mwadia Malunga, Farida, Virgínia Pinto, Hanifa Assulua, Naftalinda Makwala and Mariamar Mpepe who will have the op­portunity to share a part of their rich and painful life experiences.

  15. Material souls and imagination in late Aristotelian embryology.

    Science.gov (United States)

    Blank, Andreas

    2010-04-01

    This article explores some continuities between Late Aristotelian and Cartesian embryology. In particular, it argues that there is an interesting consilience between some accounts of the role of imagination in trait acquisition in Late Aristotelian and Cartesian embryology. Evidence for this thesis is presented using the extensive biological writings of the Padua-based philosopher and physician, Fortunio Liceti (1577-1657). Like the Cartesian physiologists, Liceti believed that animal souls are material beings and that acts of imagination result in material images that can be transmitted by means of medical spirits to the embryo. Moreover, while the Cartesian embryologists accepted such a view in a quite speculative way, one finds penetrating criticism of imagination theories of trait acquisition in the Late Aristotelian tradition. Evidence for this thesis is presented using the no less extensive biological writings of Liceti's contemporary, Emilio Parisano (1567-1643). In conclusion, the Late Aristotelian tradition itself provides the theoretical tools for excising immaterial formative forces from embryology and at the same time evinces a much more acute sense for the problems inherent in imagination theories of trait acquisition than the Cartesian tradition.

  16. Rousseau's Ethics of Truth: a sublime science of simple souls

    Directory of Open Access Journals (Sweden)

    Jason Neildleman

    2017-09-01

    Full Text Available ROUSSEAU’S ETHICS OF TRUTH - A SUBLIME SCIENCE OF SIMPLE SOULS Resumo: este artigo é um resumo do livro com o mesmo título, publicado pelas edições da Routledge, nos Estados Unidos. Tanto no livro quanto neste artigo, o autor pretende discutir a coerência dos textos de Rousseau, na qual é possível prospectar uma "ética da verdade" cujo objetivo seja alcançar um vínculo de comunhão com as pessoas e com as coisas. O autor tenta ainda discutir as implicações da ética da verdade de Rousseau sobre o nosso sentido de si mesmo e o sentido de existência no mundo. Palavras-chave: Rousseau. Ética. Verdade. Filosofia. Abstract: This paper is a summary of the book published by Routledge in the United States. The author aims to discuss the coherence of Rousseau’s texts thought which it is possible to prospect an “ethics of truth”, so to achieve a communion bond with people and things. The author tries also to discuss the implications of Rousseau’s ethics of truth on our sense of self and the implications in the real existence in the world. Keywords: Rousseau. Ethics. Truth. Philosophy.

  17. Schizoanalyzing Souls: Godard, Deleuze, and the Mystical Line of Flight

    Directory of Open Access Journals (Sweden)

    David Sterritt

    2010-01-01

    Full Text Available "In an article on montage written for Cahiers du cinéma, Jean-Luc Godard made an observation that has been quoted many times in many contexts:If direction is a look, montage is a heartbeat…what one seeks to foresee in space, the other seeks in time….Cutting on a look is…to bring out the soul under the spirit, the passion behind the intrigue, to make the heart prevail over the intelligence by destroying the notion of space in favor of that of time. This passage appeared in 1956, almost three decades before Gilles Deleuze published Cinema 1: The Movement-Image and Cinema 2: The Time-Image in 1983 and 1985, respectively. Yet despite the distance between those dates, the young critic’s remark anticipates key aspects of the philosopher’s film-theoretical stance. The need to displace the notional bias toward space with a conception of time as a concrete and dynamic force is the single most vital element in the thinking of Henri Bergson, whose ideas about this subject – ramified into such areas as affect, memory, perception, language, and the ontological properties of mind itself – play indispensable roles in Deleuze’s writings on cinema and allied areas of immanence, multiplicity, and difference..."

  18. Hungry earth and vengeful stars: soul loss and identity in the Peruvian Andes.

    Science.gov (United States)

    Greenway, C

    1998-10-01

    This article contributes to the cross-cultural literature on fright sickness and soul loss with an analysis of cases among Quechua indians (runa) in a rural community in the southern Peruvian Andes. One of the aims of this article is to incorporate an emic understanding of the intersection of the cosmological and social landscapes into discussions of Quechua conceptions of health and illness. It outlines Quechua constructions of body, self, and cosmos that are relevant to explaining the concepts of soul/spirit, interior/exterior, and runa/nonruna that are related to soul loss. The illness suffered by victims of fright sickness embodies the Quechua construction of self and is linked not only to broader sociopolitical realities of Peru but also to cosmological beliefs. The diagnosis of spirit loss and fright in this cultural context reveals a crisis of identity: sufferers represent nonruna, or nonhumans. They succumb to fright or soul loss because of an emic concept of vulnerability that transcends the characteristics of gender and age usually associated with soul loss cross-culturally. Treatments, therefore, involve a reaffirmation of ethnic identity and a reintegration of patients into their families in terms of a culturally specific understanding of identity, community, and cosmos. rights reserved

  19. The Soul Mates Model: A Seven-Stage Model for Couple's Long-Term Relationship Development and Flourishing

    Science.gov (United States)

    De La Lama, Luisa Batthyany; De La Lama, Luis; Wittgenstein, Ariana

    2012-01-01

    This article presents the integrative soul mates relationship development model, which provides the helping professionals with a conceptual map for couples' relationship development from dating, to intimacy, to soul mating, and long-term flourishing. This model is informed by a holistic, a developmental, and a positive psychology conceptualization…

  20. Psychicones: Visual Traces of the Soul in Late Nineteenth-Century Fluidic Photography

    Science.gov (United States)

    Pethes, Nicolas

    2016-01-01

    The article discusses attempts to visualise the soul on photographic plates at the end of the nineteenth century, as conducted by the French physician Hippolyte Baraduc in Paris. Although Baraduc refers to earlier experiments on fluidic photography in his book on The Human Soul (1896) and is usually mentioned as a precursor to parapsychological thought photography of the twentieth century, his work is presented as a genuine attempt at photographic soul-catching. Rather than producing mimetic representations of thoughts and imaginations, Baraduc claims to present the vital radiation of the psyche itself and therefore calls the images he produces psychicones. The article first discusses the difference between this method of soul photography and other kinds of occult media technologies of the time, emphasising the significance of its non-mimetic, abstract character: since the soul itself was considered an abstract entity, abstract traces seemed all the more convincing to the contemporary audience. Secondly, the article shows how the technological agency of photography allowed Baraduc’s psychicones to be tied into related discourses in medicine and psychology. Insofar as the photographic plates displayed actual visual traces, Baraduc and his followers no longer considered hallucinations illusionary and pathological but emphasised the physical reality and normality of imagination. Yet, the greatest influence of soul photography was not on science but on art. As the third part of the paper argues, the abstract shapes on Baraduc’s plates provided inspiration for contemporary avant-garde aesthetics, for example, Kandinsky’s abstract paintings and the random streams of consciousness in surrealistic literature. PMID:27292323

  1. [The diseases of the soul in medieval arabic texts an encounter between philosophy and medicine].

    Science.gov (United States)

    Koetschet, Pauline

    2013-01-01

    In the medical texts written in Arabic between the 9(th) and the 11(th) centuries, the diseases of the soul played an important part in the physicians' reflection on the nature of the soul and its relationship to the body. In the 9(th) and the beginning of the 10(th) century, this medical anthropology was shaped by a tradition that was both Platonic and Galenic. But in the 10(th), the influence of Aristotle became most prominent in Arabic philosophy, and as a result the main lines of this medical anthropology were questioned, as was the role of medical knowledge and its relation to natural philosophy.

  2. From an Outsider's Point of View : Lorenzo Valla on the Soul

    NARCIS (Netherlands)

    Nauta, Lodi

    2008-01-01

    In his Repastinatio Lorenzo Valla launched a heavy attack on Aristotelian-scholastic thought. While most of this book is devoted to metaphysics, language and argumentation, Valla also incorporates chapters on the soul and natural philosophy. Using as criteria good Latin, common sense and common

  3. Lost Souls? The Demoralization of Academic Labour in the Measured University

    Science.gov (United States)

    Sutton, Paul

    2017-01-01

    In this conceptual paper, I contend that the soul of academic labour is becoming lost in performativity. Performativity, I explain, is a form of regulation and control that deploys technical rationality and judgements to incentivize and punish academics. Indeed, performativity is central to the culture of measurement within contemporary…

  4. Warrior Spirit: Soul Wound and Coping among American Indians in Law Enforcement

    Science.gov (United States)

    Arndt, Leah M. Rouse; Davis, Amileah R.

    2011-01-01

    This qualitative, exploratory study examined the role vocation played for American Indian non-Tribal law enforcement officers in adaptively coping with historical trauma, or "Soul Wound." Participants' views of career in relationship to its perceived congruence with their Nations' warrior societies and how this vocation may facilitate or constrain…

  5. 'He has a life, a soul, a meaning that extends far deeper than his ...

    African Journals Online (AJOL)

    'He has a life, a soul, a meaning that extends far deeper than his medical assessment … .': The role of reflective diaries ... Guided content analysis, using a framework compiled from the literature, was used to code the data. The coding ... Forty-eight portfolios with reflective diaries were available for analysis. Data saturation ...

  6. Ivan Albright: "Into the World There Came a Soul Called Ida."

    Science.gov (United States)

    Sousa, Jean

    1987-01-01

    Ivan Albright's 1929 oil-on-canvas painting called "Into the World There Came a Soul Called Ida" is used as the vehicle for a senior high school art lesson designed to introduce students to symbolism, aesthetic issues, and the formal elements of painting. (JDH)

  7. Spirituality in Educational Leadership. The Soul of Educational Leadership Series. Volume 4

    Science.gov (United States)

    Houston, Paul D.; Blankstein, Alan M.; Cole, Robert W.

    2008-01-01

    This fourth volume of "The Soul of Educational Leadership" series offers key strategies for identifying the moral and ethical dimensions of school leadership practice. With thought-provoking contributions from top leadership figures like Terrence E. Deal, Dawna Markova, and Scott Thompson, this enlightening resource combines research with…

  8. Ancient philosophical ideas of the soul (Plato-Aristotelian tradition and Stoicism as a source of Patristic Thought

    Directory of Open Access Journals (Sweden)

    Zaitsev Cornelius

    2014-10-01

    Full Text Available The article discusses the ancient idea of the soul that in the patristic era has been enriched by the perception of the methodology of ancient philosophy. Greek and Roman thinkers considered some properties of the soul, its immortality, revealed its “levels and strata” (Plato, Aristotle, expressed first guesses about the nature of sinful passions (the Stoics. But some aspects still remained unresolved so far. This is the issue of materiality or immateriality, of the soul, which "raised" in the Russian Empire in the 19th century (the dispute saints Theophan the Recluse and Ignatius Brianchaninov and remains relevant today.

  9. IMAGE AGAINST PURE REPRESENTATION: BODIES, SOULS AND COSMOPOTICS IN THE AMAZON

    Directory of Open Access Journals (Sweden)

    Leif Grunewald

    2011-12-01

    Full Text Available A close look to the notion of soul as presented in a variety of ethnographies about south american lowland societies reveals us a curious relation between ‘soul’ and ‘image’, describing it as corporal ‘images’ which can set relations with non-humans alterity forms. These relations, as we commonly know, are riskful, due to the possibility of a soul being aggressed or captured by those non-humans beings. This, of course, by only one side. By the other, those same relations with non-human beings have a special deal in shamanism and naming-rituals. This essay aims, thus, to amplify comprehension of which type of image might be this one called ‘soul’, and how it could be understood as a specific non-representational image.

  10. ERRÂNCIA E EXÍLIO NA SOUL MUSIC: do movimento Black-Rio nos anos 70 ao Quarteirão do Soul em Belo Horizonte, 2010WANDERING AND EXILE IN SOUL MUSIC: the Black-Rio movement in the 70’s to the Quarteirão do Soul in Belo Horizonte, 2010

    Directory of Open Access Journals (Sweden)

    Rita Aparecida da Conceição Ribeiro

    2010-12-01

    The twentieth century witnessed several diasporas. Some of them clearly addressed by the vehicles of mass communication, others less so. This study addresses the emergence of a movement of affirmation of black identity in Brazil, the movement Black-Rio, which appeared in the mid-70s. It suffered persecution, not only on the political side, but also from the media, until its extinction in the same decade. The importance of the Black-Rio was confirmed thirty years later, with the constitution of the Quarteirão do Soul in Belo Horizonte, a movement with similar ideology. It started downtown in 2004 with a group of friends, became a space of sociability and affirmation of black identity and, like its predecessor, begins to suffer harassment. Keywords: Black identity. Soul music. Mass culture.

  11. Windows of the Soul in the Worldview of Philo of Alexandria

    Directory of Open Access Journals (Sweden)

    Botica Aurelian

    2017-10-01

    Full Text Available One of the most important paradigm shifts in the history of Greek philosophy was the ‘rediscovery’ of transcendence in the movement of Intermediate Platonism. Less than a century before the birth of Hellenism (late 4th century BC, Plato had advocated an intentional preoccupation with the life of the mind / soul, encouraging the individual to avoid being entrapped in the material limitations of life and instead discover its transcendental dimension. The conquest of Athens by the Macedonians, followed by the invasion of the Orient by Alexander the Great, set in motion sociological and cultural changes that challenged the relevance of Platonic philosophy. The transcendental vision of Platonism left the individual still struggling to find happiness in the world created by Alexander the Great. This was the context in which the schools the of Cynicism, Stoicism, Epicureanism and Skepticism challenged Platonism with their call to happiness in this world and by means of the Hellenistic dominance and the rise of Roman supremacy stirred a renewed spiritual and philosophical effort to rediscover the world beyond; that is, the transcendental world of Plato. This was Middle Platonism and the Jewish philosopher Philo of Alexandria was one of its most prolific writers. In this paper, we will examine the concept of the soul in the writings of Philo, with an emphasis on the role that the soul plays in the act of approaching God through the means of the external / material cult (Temple, sacrifices, priests, etc.. Philo offers a complex vision of the soul, one that remains critically relevant to understanding the Greek, Jewish, and Christian thought that emerged after Philo.

  12. Mixing the medicine: the unintended consequence of amphetamine control on the Northern soul scene

    OpenAIRE

    Wilson, A.

    2008-01-01

    Examining the influences leading to the introduction of amphetamine controls in Britain, this article focuses upon the consequences of the Drugs (Prevention of Misuse) Act 1964, and subsequent legislation. These laws had a major impact upon earlier Mod and later Northern Soul Scene subcultures in Britain, because both held amphetamine use as a central component of their recreational activities. The paper aims to provide greater understanding of the way criminalisation of amphetamines impacted...

  13. Searching the seat of the soul in Ancient Greek and Byzantine medical literature.

    Science.gov (United States)

    Lykouras, Eleftherios; Poulakou-Rebelakou, Effie; Ploumpidis, Demetrios N

    2010-12-01

    The objective of this paper was to examine the ancient and medieval concepts about the seat of the mental functions, as exposed in Greek texts from Antiquity to Byzantine times. The review of the philosophical and medical literature from the original ancient Greek language from the Homeric epics to the Holy Fathers of Christianity, as the problem of the seat of the soul remained without a certain answer through the centuries. Primitive concepts attributed great significance to the soul and dictated cannibal behaviours for the possession and eating of the defeated enemy's heart. Mental functions, such as thinking, feeling and mainly those related to affective manifestations, were attributed to the heart and to some other internal organs (liver, diaphragm) from the times of Greek mythology. Philosophy and empirical medicine had underestimated the brain probably because it is a 'silent' organ, contrary to the palpitating heart, with its obvious participations in the emotional reactions. The role of the brain as the mental organ and the seat of emotions has been gradually recognized. The permanent question of the seat of the soul had been for many centuries a critical dispute and the contribution of Greek philosophical and medical thought was decisive for the contemporary transformation of the whole concept.

  14. The anatomic location of the soul from the heart, through the brain, to the whole body, and beyond: a journey through Western history, science, and philosophy.

    Science.gov (United States)

    Santoro, Giuseppe; Wood, Mark D; Merlo, Lucia; Anastasi, Giuseppe Pio; Tomasello, Francesco; Germanò, Antonino

    2009-10-01

    To describe representative Western philosophical, theological, and scientific ideas regarding the nature and location of the soul from the Egyptians to the contemporary period; and to determine the principal themes that have structured the history of the development of the concept of the soul and the implications of the concept of the soul for medical theory and practice. We surveyed the ancient Egyptian, Greek, and Roman periods, the early, Medieval, and late Christian eras, as well as the Renaissance, Enlightenment, and Modern periods to determine the most salient ideas regarding the nature and location of the soul. In the history of Western theological, philosophical, and scientific/medical thought, there exist 2 dominant and, in many respects, incompatible concepts of the soul: one that understands the soul to be spiritual and immortal, and another that understands the soul to be material and mortal. In both cases, the soul has been described as being located in a specific organ or anatomic structure or as pan-corporeal, pervading the entire body, and, in some instances, trans-human and even pan-cosmological. Moreover, efforts to discern the nature and location of the soul have, throughout Western history, stimulated physiological exploration as well as theoretical understanding of human anatomy. The search for the soul has, in other words, led to a deepening of our scientific knowledge regarding the physiological and, in particular, cardiovascular and neurological nature of human beings. In addition, in virtually every period, the concept of the soul has shaped how societies thought about, evaluated, and understood the moral legitimacy of scientific and medical procedures: from performing abortions and autopsies to engaging in stem cell research and genetic engineering. Our work enriches our shared understanding of the soul by describing some of the key formulations regarding the nature and location of the soul by philosophers, theologians, and physicians. In

  15. Severing the bonds of love: a case study in soul loss.

    Science.gov (United States)

    Steedly, M M

    1988-01-01

    Karo Batak ceremonial curing practices in urban Indonesia take place in a disputed zone of acts and meanings, in which neither social nor cultural coherence can be presumed by the analyst. Examining the therapeutic efforts of an urban Karo spirit possession cult aimed at curing the soul loss suffered by a young man, the Christian son of one of the cult's premier spirit mediums, this paper questions the relevance of the 'integrative model' in such cases, and suggests an alternative approach, looking at the sets of social, cultural and interpersonal tensions that run through the cult's practices and which, at the same time, those practices seek to contain.

  16. Songs for the Soul: A Program to Address a Nurse's Grief
.

    Science.gov (United States)

    Phillips, Carolyn; Welcer, Barbara

    2017-04-01

    When caring for patients with cancer, a number of situations arise that cause nurses to grieve. Nurses need time and space to grieve to prevent the untoward effects of cumulative grief. While providing a safe space for nurses to be vulnerable in grief, Songs for the Soul combines the healing effects of expressive writing, storytelling, and music to help nurses address the grief and suffering they experience in their work. The use of storytelling through music portrays an expression of their grief that matches the intensity of their caregiving experience.

  17. "The soul has ears": Music and movement in the poetry of John Berryman

    OpenAIRE

    COBAIN, EVE CLAIRE

    2017-01-01

    APPROVED "The soul has ears": Music and Movement in the Poetry of John Berryman Berryman?s musical interest is consistently remarked on by readers of his work, but remains vastly understudied, though it touches almost every aspect of his poetic project. The poet?s obsession with ?hearing? was one that spilled across from one art form into another, and his musical enthusiasm expresses itself in a way that is all-pervasive. Berryman?s work represents a deep enquiry into the influence of...

  18. Instilling a soul in your organization without losing yours to it.

    Science.gov (United States)

    Stegall, M Scott

    2002-01-01

    Health-care professionals are accustomed to struggling with ethical considerations brought about by advances in the medical sciences. How aware are these professionals of the ethical dilemmas created by advances in the management sciences? Deeply embedded in organizational and departmental changes are theories, paradigms, and philosophies that often are understood poorly even by their promoters. Although these system changes can occur at glacial speed, they also can be glacial in their effects on an organization's culture. Are individuals aware that the latest implemented management fad is changing their behaviors? By becoming mindful of the potential ramifications of change, individuals increase their ability to behave in a civil manner--that is, ethically choosing to embrace or resist the change. By acting within their own sphere of influence, civil individuals at all levels of the organization collectively instill a soul in their organization rather than losing their own souls to it. This article is adapted from a commencement speech presented to graduates of an executive health-care administration program. Most of these graduates were a mixture of hospital department heads, middle managers, and a few medical and hospital executives. Each year, I distribute my current version of this teaching note or mini-lecture to students completing my leadership class in hope that it will help them put in perspective the appropriate use of the management sciences they intensely study.

  19. The Soul and Personal Identity. Derek Parfit’s Arguments in the Substance Dualist Perspective

    Directory of Open Access Journals (Sweden)

    Sepetyi Dmytro

    2017-07-01

    Full Text Available This paper re-evaluates Derek Parfit’s attack on the commonly held view that personal identity is necessarily determinate and that it is what matters. In the first part we first argue against the Humean view of personal identity; secondly, we classify the remaining alternatives into three kinds: the body theory and the brain theory, the quasi-Humean theory, and the soul theory, and thirdly we deploy Parfit’s arguments and related considerations to the point that none of the materialistic alternatives is consistent with the commonly held view. This leaves us with the alternative: either we accept the radical and highly implausible materialistic view Parfit calls ‘Reductionism’, or we accept the view that we are nonphysical indivisible entities—Cartesian egos, or souls. The second part of the paper discusses Parfit’s objections against the Cartesian view: that there is no reason to believe in the existence of such nonphysical entities; that if such entities exist, there is no evidence that they are enduring (to span a human life; that even if they exist and are enduring, they are irrelevant for the psychological profile and temporal continuity of a person; that experiments with ‘brain-splitted’ patients provide strong evidence against the Cartesian view. We argue that these objections are in part mistaken, and that the remaining (sound part is not strong enough to make the Cartesian view less plausible than Reductionism.

  20. Soul in the world: symbolic culture as the medium for psyche.

    Science.gov (United States)

    Colman, Warren

    2017-02-01

    Whilst the loss of a sense of living connection with the material world is mainly associated with the scientific revolution in seventeenth century Europe, it can be traced back to Plato's introduction of a hierarchy between soul and body. Jung's attempted solution to this - esse in anima - is ingenious but maintains the Cartesian split by which the aliveness of the world is reduced to a projection of psychic forces (the archetypes). An alternative approach is proposed, rooted in the Aristotelean emphasis on practical activity that sees the soul as a function of our way of being in the world. Human cognition is extended and distributed by our social and material engagement with the world, especially via collective representations whose symbolic character is constitutive of the reality of the world in which we live. Despite the dominance of 'scientific Cartesian' representations in the modern Western world, there remain numerous instances of participation mystique that cannot be captured by the Cartesian notion of projection. These indicate an opening to ways of being in the world that may lead us out of the impasse of the Cartesian matrix. © 2017, The Society of Analytical Psychology.

  1. Salapärane mustlashobune / Ingrid Randlaht

    Index Scriptorium Estoniae

    Randlaht, Ingrid

    2011-01-01

    Ristandhobustest, ametliku nimega Irish cob (iiri cob), ingliskeelses maailmas valdavalt Gypsy Horse ehk mustlashobusena tuntud ning Mandri-Euroopas peremeeste järgi tinkeriteks kutsutavatest hobustest, samuti Iirimaa kuulsast Ballinasloe hobulaadast, kus müüakse tinkereid, ning Mätta turismitalust Lääne-Virumaal, kus on suurim tinkerite kari Eestis

  2. Pöörane magnet / Urmas Vadi

    Index Scriptorium Estoniae

    Vadi, Urmas, 1977-

    2003-01-01

    12. XII esitletakse Tartu Kirjanduse Majas raamatut "Kollane maja : oodatud köik, kes armunud Supilinna!" (Tallinn : Piller, 2003). Õhtu kavast. Näeb Maie-Ann Rauna ja Urmo Rausi klaasikunsti ning filme "Supilinn 2002" ja "Ruhnu rubiinid"

  3. Scattered Souls

    Science.gov (United States)

    Stanistreet, Paul

    2005-01-01

    The London Irish Centre is celebrating its 50th anniversary. Set up as a refuge for new immigrants, the centre's focus has changed, as has its client base. Increasingly, as younger members of the London Irish community move away, the centre's work has focused on the learning and support needs of an ageing community. The older generation are coming…

  4. Soul music.

    Science.gov (United States)

    Dopson, Laurence

    2005-10-01

    'I t's just like being in church.' So say those who listen to a CD of favourite hymns produced by the Dementia Services Development Centre at Stirling University. The CD features recordings of hymns sung by ordinary congregations, not choirs, and sung at a slower pace which older people, including those with dementia, can keep up with. The CD is in demand from nursing and care homes, and from personal carers as well.

  5. Dead souls

    Index Scriptorium Estoniae

    2008-01-01

    Venemaa ei lase end gaasijuhtme Nord Stream kavandamisel häirida Euroopa Parlamendi liikme Andres Tarandi ja ajaloolase Mati Õuna väitel gaasijuhtme piirkonda jäävatest laevavrakkidest ja sõjahaudadest

  6. Contested Souls

    DEFF Research Database (Denmark)

    Skvirskaja, Vera

    2014-01-01

    Soviet images and social forms. People’s reliance on semantic memory in diverse and mutually hostile religious frameworks overrides a distinction between innovative religious movements characterised by evocative images and a doctrinal mode of religiosity based on routinised forms of worship and ‘general......Religious revival has consistently shown itself to be a central characteristic of broader ideological shifts in post-Soviet Russia. This article discusses how new religious currents – Orthodox Christianity and a Protestant denomination condemned by the Church – affected rural indigenous dwellers...... on Yamal at the turn of the millennium. It contends that rather than simply filling a post-Soviet ideological vacuum, as is often suggested in mass media and social scientific literature, new religious discourses challenged and resurrected native traditions for new purposes as well as revoked certain...

  7. Soul Bounder

    OpenAIRE

    Lorenzo Santiago, Javier

    2014-01-01

    EL proyecto se trata de un videojuego tanto en versión ejecutable para Windows, Mac OS y Linux, como para ser jugado mediante un navegador Web. El proceso abarca tanto el ámbito de la programación, diseño gráfico, modelado 3D y audio digital. El principal reto propuesto era el de crear un sistema de juego combinando dos de los géneros que están teniendo mucho éxito en la actualidad, Roguelike y Puzzle. Ambos son géneros muy distintos y que por lo general atraen a público opuesto. Los juego...

  8. A Few Remarks on the Poetics of Turbulence in Richard Powers’ Operation Wandering Soul

    Directory of Open Access Journals (Sweden)

    Jean-Yves Pellegrin

    2010-02-01

    Full Text Available Dans le roman de Richard Powers Operation Wandering Soul, la linéarité conventionnelle du récit cède le pas à une forme de discontinuité et de circularité qui évoque le mouvement imprévisible d’une turbulence. On propose de montrer ici que cette turbulence met en œuvre une nouvelle manière d’écrire et de lire les récits. Dans le roman, la turbulence apparaît toujours sous l’aspect d’une force désorganisatrice qu’il faut maîtriser, un bruit qui doit être supprimé. Cet impératif, témoin des aspirations du récit au sens et à la clôture, peut se concevoir comme l’indice de la manière dont l’ordre narratif s’efforce de soumettre toute turbulence en dissimulant son chaos sous une linéarité de façade et des dénouements postiches. Cette activité transforme le récit (et le type de lecture qu’elle induit en une sorte d’eschatologie dont Operation Wandering Soul dénonce le mensonge et la fuite en avant. Pour en combattre les effets néfastes, le roman s’emploie à perturber l’ordre narratif et à bousculer nos habitudes de lecture ; il se fait texte turbulent en conformant sa structure la plus intime à celle des systèmes non linéaires.In Richard Powers’ Operation Wandering Soul, the conventional linearity of narrative gives way to a type of discontinuity and circularity that is reminiscent of the unpredictable movement of turbulent flows. This paper suggests that such turbulence enacts a new way of writing and reading narrative. Turbulence is always described in the novel as a disruptive force that must be checked or a noise that must be silenced. This imperative, which testifies to narrative’s desire for closure and meaning, may be construed as an index of the way narrative order attempts to subdue all turbulence by covering up its proliferating chaos with perfunctory linearity and cosmetic endings. Such activity turns narrative—and the type of reading it encourages—into some kind of

  9. Memorial stones for the souls of animals killed for human welfare in Japan.

    Science.gov (United States)

    Kast, A

    1994-05-01

    In Japan, at the old ports of the whaling industry, at all 365 slaughterhouses of the country, at some of the more than 90 wholesale markets of marine products, and at most of the about 170 testing facilities using laboratory animals, there are memorial stones for the souls of the animals killed for human welfare. Except at the whaling ports, where the memorials often can be dated back to the 17. century, all stones have been erected in the 20. century, most of them during the last 2 decades. The roots of this Japanese folk custom are probably in the prehistoric times of Shintoism. With the introduction of Buddhism in the 6. century, the killing of animals was considered sinful. Following the opening of the country in 1860, slaughterhouses were established.

  10. The Ancient Greek Way of Life and the Consequences of the Dominance of the Appetitive Part of the Soul in Mankind Today

    Directory of Open Access Journals (Sweden)

    Yiorgo N. Maniatis

    2011-01-01

    Full Text Available In this paper I examine the healthy ancient Greek way of life by contrast to the unhealthy way of life of contemporary man, who at the greatest percentage is homo economicus. First, I examine the ancient Greek philosophical perceptions of the soul, with emphasis on the great psychological theory of Plato, aiming to show the healthy way that the ancient Greeks perceived the soul and the homologous ethical way that they lived their life in accordance with its nature in order to live as much eudaimonically as possible. Next, in comparison, I examine the new contemporary man, homo economicus, in whom the appetitive part of the soul dominates, and investigate those catastrophic consequences that this dominance of the inferior part of the human soul have brought in our global era, in sectors such as the economy, education and politics, resulting to the decadence of life.

  11. Searching for the Origin through Central Nervous System: A Review and Thought which Related to Microgravity, Evolution, Big Bang Theory and Universes, Soul and Brainwaves, Greater Limbic System and Seat of the Soul.

    Science.gov (United States)

    Idris, Zamzuri

    2014-07-01

    Cerebrospinal fluid (CSF) serves buoyancy. The buoyancy thought to play crucial role in many aspects of the central nervous system (CNS). Weightlessness is produced mainly by the CSF. This manuscript is purposely made to discuss its significance which thought contributing towards an ideal environment for the CNS to develop and function normally. The idea of microgravity environment for the CNS is supported not only by the weightlessness concept of the brain, but also the noted anatomical position of the CNS. The CNS is positioned in bowing position (at main cephalic flexure) which is nearly similar to an astronaut in a microgravity chamber, fetus in the amniotic fluid at early gestation, and animals and plants in the ocean or on the land. Therefore, this microgravity position can bring us closer to the concept of origin. The hypothesis on 'the origin' based on the microgravity were explored and their similarities were identified including the brainwaves and soul. Subsequently a review on soul was made. Interestingly, an idea from Leonardo da Vinci seems in agreement with the notion of seat of the soul at the greater limbic system which has a distinctive feature of "from God back to God".

  12. The ghost in the machine is the elephant in the room: souls, death, and harm at the end of life.

    Science.gov (United States)

    Disilvestro, Russell

    2012-10-01

    The idea that we human beings have souls that can continue to have conscious experiences after the deaths of our bodies is controversial in contemporary academic bioethics; this idea is obviously present whenever questions about harm at the end of life are discussed, but this idea is often ignored or avoided because it is more comfortable to do so. After briefly discussing certain types of experiences that lead some people to believe in souls that can survive the deaths of their bodies, I begin to answer the question, "If personal postmortem survival of some sort is real, then how should this alter the way we approach our bioethical discussions about death, the harm of death, and harming the dead?" The bioethics issues I briefly discuss in the remaining two sections are the debate about defining death and the decision whether to forego life-prolonging treatments.

  13. The body of the soul. Lucretian echoes in the Renaissance theories on the psychic substance and its organic repartition.

    Science.gov (United States)

    Tutrone, Fabio

    2014-01-01

    In the 16th and 17th centuries, when Aristotelianism still was the leading current of natural philosophy and atomistic theories began to arise, Lucretius' De Rerum Natura stood out as an attractive and dangerous model. The present paper reassesses several relevant aspects of Lucretius' materialistic psychology by focusing on the problem of the soul's repartition through the limbs discussed in Book 3. A very successful Lucretian image serves as flu rouge throughout this survey: the description of a snake chopped up, with its pieces moving on the ground (Lucretius DRN 1969, 3.657-669). The paper's first section sets the poet's theory against the background of ancient psychology, pointing out its often neglected assimilation of Aristotelian elements. The second section highlights the influence of De Rerum Natura and its physiology of the soul on Bernardino Telesio, Agostino Doni and Francis Bacon, since all of these authors engage in an original recombination of mechanical and teleological explanations.

  14. Purification of Body and Soul for the Next Journey. Practices Surrounding Death and Dying Among Muslim Women.

    Science.gov (United States)

    Ahaddour, Chaïma; Van den Branden, Stef; Broeckaert, Bert

    2017-01-01

    This study aims, first, to compare normative Islamic practices toward death and dying and actual practices of Moroccan Muslim women. Second, it seeks to compare the views and practices of middle-aged and elderly women. Qualitative empirical research was conducted with 30 middle-aged and elderly Moroccan Muslim women living in Antwerp (Belgium) and with 15 experts in the field. Our study shows that religious beliefs and worldview have a great impact on Muslims' practices surrounding death and dying. More specifically, practices are strongly shaped by their eschatological beliefs. The rituals are perceived as preparations for the hereafter, entailing purification of both soul and body, and demonstrate the belief in a continued existence of the soul. We found striking similarities between our participants' views and normative Islamic views. We did not find a more secular understanding of death and dying among the middle-aged women.

  15. Soul and body: Transcending the dialectical intellectual legacy of the West with an integral biblical view?

    Directory of Open Access Journals (Sweden)

    Danie Strauss

    2014-12-01

    Full Text Available Greek philosophy informed the Medieval dualistic understanding of ‘body’ and ‘soul’, which continued to influence modern Humanism and Christian views during and after the Middle Ages. These fluctuating conceptions express the directing role of dialectical basic motives. It was mainly the Greek motive of matter and form which directed the thought of Plato and Aristotle, resulting in a dualistic view of the relationship between a so-called material body and rational soul. At the Council of Vienne (1312, the Aristotelian-Thomistic doctrine of the soul as the substantial form of the body was adopted. Within Protestant circles, the‘two-substances’ view caused a distinction between a (temporal material body and an (eternal rational soul (see article 7 of the Swiss Confessio Helvetica Posterior and the Westminster Confession Chapter 4, paragraph 2. Dooyeweerd shows how modern philosophy has received its deepest motivation from the dialectical motive of nature and freedom, which informed the development from Descartes up to Gould and Jaspers. Finally, in the last sections, the main contours of a biblically informed view are articulated with reference to the centrality of the human I-ness, to the theory of enkaptic interlacements and to the problem of supra-temporality. Siel en liggaam: Is dit moontlik om die dialektiese intellektuele erfenis van die Westevanuit ‘n integrale bybelse siening te bowe te kom? Die Griekse filosofie vorm die agtergrond van die Middeleeuse dualistiese verstaan van ‘liggaam’ en ‘siel’ wat op sy beurt die moderne Humanisme en latere Christelike opvattinge beïnvloed het – almal in die greep van dialektiese grondmotiewe. Dit was hoofsaaklik die Griekse basiese vorm-materie-motief wat die dualistiese siening van ’n materie-liggaam en ’n redelike siel tot gevolg gehad het, soos dit in die denke van Plato en Aristoteles beslag gekry het. By die Konsilie van Wenen (1312 is die Aristotelies

  16. Fit body and soul: a church-based behavioral lifestyle program for diabetes prevention in African Americans.

    Science.gov (United States)

    Dodani, Sunita; Kramer, M Kaye; Williams, Lovoria; Crawford, Stacey; Kriska, Andrea

    2009-01-01

    Faith-based initiatives for lifestyle change show promise in helping to promote healthy behaviors in African American communities. It has been suggested that faith communities and programs within faith communities can influence health care practices and health care planning especially in high risk, minority populations. African American individuals are more likely to attend and participate in faith-based services than Whites from similar backgrounds. Our proposed intervention, Fit Body and Soul, has been adopted and modified from the proven diabetes prevention program (DPP) lifestyle intervention program, and uses the church-community experiences of the "Body and Soul" study as a faith-based effort. The intervention has been developed keeping in mind the church mission and goal of being spiritually healthy and has adopted bible scripture to develop a 12-session intervention. In this article, we present the development of the church-based Fit Body and Soul behavioral lifestyle intervention using community-based participatory research in partnership with African American churches.

  17. Light-seeds within: The alchemy of re-finding light in the world soul

    Science.gov (United States)

    Erickson, Stacy Lynn

    The light of the Anima Mundi has been repressed for over two thousand years. From a feminine in-sighting, this dissertation considers the reasons for the World Soul's repression and how her light can be renewed. The division of body and mind, image and word, physicality and spirituality, as well as nature and science has been costly, though this time of crisis also holds great opportunity to change perspective and live differently. The art of alchemy contains the secrets to transform elements in opposition into those in relationship in order to give birth to something new. Where feminine and masculine have been divorced and divided, the 'Royal Art' of alchemy seeks to renew soul in the world as an experience of life's interconnectivity and as a sacred marriage of matter and spirit. Through the four elements and three alchemical stages, this journey articulates the amorphous unconscious to evolve the light within the body of the microcosm and the macrocosm. The study's phenomenological perspective merges creative imagination with experiential gnosis in an exploration of the rich tapestry and mystery of an esoteric tradition. Through dream tending and active imagination, one connects to the subtle body, the imaginal world, and mythological regions with archetypal energies where elemental symbols are seeds. When cultivated and tended, these seeds grow into embodied feelings, visceral happenings. These experiential moments contain the revelations necessary for personal and global transmutation. Alchemy's tenet of 'as above, so below' holds a simple truth. When an individual works on her light, the Anima Mundi's light grows brighter. The alchemical process awakens love as the animating essence, the divine spark within the heart of all life---the gold in every atom of creation. Where matter and spirit conjoin, the hierosgamos reveals life's divine nature as an intimate dance and a web of interconnectivity. When lived for the sake of the whole and seen with the eyes of an

  18. Extreme rituals in a BDSM context: the physiological and psychological effects of the 'Dance of Souls'.

    Science.gov (United States)

    Klement, Kathryn R; Lee, Ellen M; Ambler, James K; Hanson, Sarah A; Comber, Evelyn; Wietting, David; Wagner, Michael F; Burns, Valerie R; Cutler, Bert; Cutler, Nadine; Reid, Elwood; Sagarin, Brad J

    2017-04-01

    Participation in extreme rituals (e.g., fire-walking, body-piercing) has been documented throughout history. Motivations for such physically intense activities include religious devotion, sensation-seeking and social bonding. The present study aims to explore an extreme ritual within the context of bondage/discipline, dominance/submission and sadism/masochism (BDSM): the 'Dance of Souls', a 160-person ritual involving temporary piercings with weights or hooks attached and dancing to music provided by drummers. Through hormonal assays, behavioural observations and questionnaires administered before, during and after the Dance, we examine the physiological and psychological effects of the Dance, and the themes of spirituality, connectedness, transformation, release and community reported by dancers. From before to during the Dance, participants showed increases in physiological stress (measured by the hormone cortisol), self-reported sexual arousal, self-other overlap and decreases in psychological stress and negative affect. Results suggest that this group of BDSM practitioners engage in the Dance for a variety of reasons, including experiencing spirituality, deepening interpersonal connections, reducing stress and achieving altered states of consciousness.

  19. Friedrich Albert Lange on neo-Kantianism, socialist Darwinism, and a psychology without a soul.

    Science.gov (United States)

    Teo, Thomas

    2002-01-01

    Friedrich Albert Lange was a German philosopher, political theorist, educator, and psychologist who outlined an objective psychology in the 1860s. This article shows how some of the most important worldviews of the nineteenth century (Kantianism, Marxism, and Darwinism) were combined creatively in his thought system. He was crucial in the development of neo-Kantianism and incorporated psycho-physiological research on sensation and perception in order to defend Kant's epistemological idealism. Based on a critique of phrenology and philosophical psychology of his time, Lange developed a program of a psychology without a soul. He suggested that only those phenomena that can be observed and controlled should be studied, that psychology should focus on actions and speech, and that for each psychological event the corresponding physical or physiological processes should be identified. Lange opposed introspection and subjective accounts and promoted experiments and statistics. He also promoted Darwinism for psychology while developing a socialist progressive-democratic reading of Darwin in his social theory. The implications of socialist Darwinism on Lange's conceptualization of race are discussed and his prominence in nineteenth century philosophy and psychology is summarized. Copyright 2002 Wiley Periodicals, Inc.

  20. Cerebral automatism, the brain, and the soul in Bram Stoker's Dracula.

    Science.gov (United States)

    Stiles, Anne

    2006-06-01

    Neither literary critics nor historians of science have acknowledged the extent to which Bram Stoker's Dracula (1897) is indebted to late-Victorian neurologists, particularly David Ferrier, John Burdon-Sanderson, Thomas Huxley, and William Carpenter. Stoker came from a family of distinguished Irish physicians and obtained an M.A. in mathematics from Trinity College, Dublin. His personal library contained volumes on physiology, and his composition notes for Dracula include typewritten pages on somnambulism, trance states, and cranial injuries. Stoker used his knowledge of neurology extensively in Dracula. The automatic behaviors practiced by Dracula and his vampiric minions, such as somnambulism and hypnotic trance states, reflect theories about reflex action postulated by Ferrier and other physiologists. These scientists traced such automatic behaviors to the brain stem and suggested that human behavior was "determined" through the reflex action of the body and brain-a position that threatened to undermine entrenched beliefs in free will and the immortal soul. I suggest that Stoker's vampire protagonist dramatizes the pervasive late-nineteenth-century fear that human beings are soulless machines motivated solely by physiological factors.

  1. A cold of the soul: a Japanese case of disease mongering in psychiatry.

    Science.gov (United States)

    Ihara, Hiroshi

    2012-01-01

    In Japan, depression provides the most drastic example of the impact of disease awareness campaigns. Until the late 1990 s, the public's attitude toward depression was generally unfavorable, due to the negative connotations of the Japanese word for clinical depression, 'utsubyou'. After the 1999 introduction of the first selective serotonin re-uptake inhibitor, pharmaceutical companies initiated educational campaigns. In order to aid the drug's acceptance, they coined the catchphrase 'kokoro no kaze', which literally means 'a cold of the soul'. Thanks to these marketing practices, antidepressant sales have increased six fold, from ¥ 14.5 billion in 1998 to ¥ 87 billion in 2006. However, the catchphrase 'kokoro no kaze' masked a critical difference between a cold and depression. It falsified the nature of treatment for depression by concealing the putative duration of medication. Owing to this distortion of information, pharmaceutical companies were assured a steady stream of profits. Now, the pharmaceutical industry is shifting its focus from depression to bipolar disorder. Japanese psychiatrists can learn a great deal from their experience with the aggressive marketing of antidepressants. In the case of depression, over-medication arguably did more harm than good. The same risk exists with other conditions, including bipolar disorder.

  2. Soul Mates: Religion, Sex, Love, and Marriage among African Americans and Latinos.

    Science.gov (United States)

    Gillum, Richard F; Dodd, Kristen D

    2016-01-01

    This book review analyzes the complex and profound impact active religious participation has on relationships and family outcomes among African Americans and Latinos. In Soul Mates, Wilcox and Wolfinger discuss the legacy of slavery and Jim Crow laws and the resulting devastating effects on African American and Latino families despite their high religious involvement. The authors make the case that many African American men are unlikely candidates for marriage or stable relationships due to trends of family instability driven by the declining income-power of working-class men as well as entry of more women into the labor force, government penalties for low-income couples, revolt against traditional values, increased access to birth control and abortion, and the persistence of discrimination and incarceration of minority men. The authors examine data from six national surveys as well as additional data from interviews, focus groups, ethnographic field work, and an extensive literature review. Wilcox and Wolfinger find evidence that when African American couples actively participate in Christian churches, the men are more likely to adhere to a "code of decency" which decreases street behaviors, such as binge drinking, having multiple sex partners, and having multi-partner fertility, which are known to inhibit family stability. This book will be helpful for health providers who would like to better understand and serve their African American and Latino patients. The findings suggest that health care providers can promote a healthy emotional environment for families by encouraging minority men to renew or maintain church involvement. Copyright © 2016 National Medical Association. Published by Elsevier Inc. All rights reserved.

  3. Discussing Medieval Dialogue between the Soul and the Body and Question of Dualism

    Directory of Open Access Journals (Sweden)

    Barbara Peklar

    2015-12-01

    Full Text Available This contribution is based on the rejection of medieval dualism or on distinguishing the body from the flesh, as suggested by Suzannah Biernoff (2002. This differentiation corresponds to an interpretation of the body, actually corpse, within some of the body and soul debates including the popular Visio Philiberti. Here the body is not sinful flesh, but is presented neutrally or realistically (not grotesquely, because the personality is thematized instead of the ideology. Thus in this debate, physicality is distinct from problematic weakness, and expresses the individual. This means that, unlike in the transi where the individual is transient or perishes with the decaying flesh (and finally becomes an anonymous skeleton, individuality is not fixed to the flesh or inconstant matter. Rather, it is carried by the incorporeal body or spiritual image which is autonomous or distinct from its material grounding, and so individuality is not superficial. The difference between the body and the flesh is also maintained in illustrations, although they are corporeal images, since the parchment displays the image of the individual just as skin does, however, in the preparation of parchment, the flesh was removed from the skin. Or, in the picturesque words of Giles of Rome, “liquid is taken into and poured out of a waterskin but the skin remains”,44 meaning, in accordance with Paul (1 Corinthians 15, 49, individuality is the individual form, independent of material, and therefore worth preserving. In short, not only the individuality is important, but it also has to be expressed by the image.

  4. Implementation of the fit body and soul, a church-based life style program for diabetes prevention in high-risk African Americans: a feasibility study.

    Science.gov (United States)

    Dodani, S; Fields, J Z

    2010-01-01

    The purpose of this study was to determine the effects of a behavioral faith-based diabetes prevention program called the Fit Body and Soul program in a semi-urban African-American church using a community-based participatory approach. The 12-session Fit Body and Soul program was modified from the group lifestyle balance intervention that was modified from the successful National Institute of Health (NIH) funded Diabetes Prevention Program. The Fit Body and Soul program was implemented in a semi-urban African-American church community. Based on the results of physical examinations and increased body mass index (BMI > or = 25), 40 adult members of the church were identified as being at high risk for diabetes. Four church ministers, after receiving Fit Body and Soul program training for 2 days, served as study interventionists. The primary objective was weight loss of at least 5% by the end of the 12-session Fit Body and Soul intervention. Screening of church participants was conducted at the Gospel Water Branch Baptist Church in Augusta, Georgia. A total of 40 individuals having a BMI > or = 25 were selected. Of the 40, a total of 35 (87.5%) attended at least 10 sessions and provided information required for the study. Of the 35, a total of 48% lost at least 5% of baseline weight, 26% lost 7% or more, and 14% lost >10% of baseline weight. This pilot trial suggests that carrying out a larger Fit Body and Soul study in a faith-based setting, using behavioral lifestyle interventions, in the context of a diabetes prevention program for African American communities is feasible, as is the possibility that subjects in that larger study will achieve a clinically significant degree of weight loss.

  5. Inclination of the soul toward obscenity in the human life from viewpoint of the Quran and School of the analytical psychology

    Directory of Open Access Journals (Sweden)

    Hamid Taher Neshat Doost

    2015-02-01

    Full Text Available The human being sometimes inclines toward the goodness and beauty, and sometimes toward the obscenity. So, Allah in the Quran has reminded man of dangers and wicked thoughts of the soul, and has described “al-Nafsul Ammāra” (commanding soul as a source of the souls` inclination toward the obscenity which is quite deceptive. It has also been mentioned that self-scrutiny would act as cause for attaining the way of life recommended by Quran. One of the duties of the psychology is to elaborate on the sources of the souls` inclination toward obscenity and the factors that deviating the human life. One of the psychological schools that especially studies this issue is the School of analytical psychology. Among psychologists of this school, viewpoints of Sigmund Freud and Carl Jung need to be compared with the Islamic-Quranic viewpoint. This article firstly tries to clarify the concept of the soul and its characteristics, and then explains the process through which “al-Nafsul Ammāra”, influences. It also describes the origin of the soul's tendency toward obscenity from Freuds` viewpoint and satanic influences from viewpoint of Carl Jung comparing them with the Quranic attitude. The origin of inclination of the soul toward the obscenity is called “al-Nafsul Ammāra” based in the Quranic text while according to the Frauds` theory it is called ID. From the Quranic viewpoint, “al-Nafsul Ammāra” that is affected by the internal negative tendencies of the soul (Haway-e Nafs and external invisible stimuli(Satan commands the human and leads him to the obscenity. So the Quran introduces the Satan as the enemy of the human being that brings about his decadence. The Quran presents the human being a practical plan for struggling against the Satan. Analytical psychology of Jung also emphasizes the role of the satanic influences on the human tendency toward the obscenity and considers struggling with the Satan as a way for freedom and

  6. Inclination of the soul toward obscenity in the human life from viewpoint of the Quran and School of the analytical psychology

    Directory of Open Access Journals (Sweden)

    Ali Banaeian Esfahani

    2015-03-01

    Full Text Available The human being sometimes inclines toward the goodness and beauty, and sometimes toward the obscenity. So, Allah in the Quran has reminded man of dangers and wicked thoughts of the soul, and has described “al-Nafsul Ammāra” (commanding soul as a source of the souls` inclination toward the obscenity which is quite deceptive. It has also been mentioned that self-scrutiny would act as cause for attaining the way of life recommended by Quran. One of the duties of the psychology is to elaborate on the sources of the souls` inclination toward obscenity and the factors that deviating the human life. One of the psychological schools that especially studies this issue is the School of analytical psychology. Among psychologists of this school, viewpoints of Sigmund Freud and Carl Jung need to be compared with the Islamic-Quranic viewpoint. This article firstly tries to clarify the concept of the soul and its characteristics, and then explains the process through which “al-Nafsul Ammāra”, influences. It also describes the origin of the soul's tendency toward obscenity from Freuds` viewpoint and satanic influences from viewpoint of Carl Jung comparing them with the Quranic attitude. The origin of inclination of the soul toward the obscenity is called “al-Nafsul Ammāra” based in the Quranic text while according to the Frauds` theory it is called ID. From the Quranic viewpoint, “al-Nafsul Ammāra” that is affected by the internal negative tendencies of the soul (Haway-e Nafs and external invisible stimuli(Satan commands the human and leads him to the obscenity. So the Quran introduces the Satan as the enemy of the human being that brings about his decadence. The Quran presents the human being a practical plan for struggling against the Satan. Analytical psychology of Jung also emphasizes the role of the satanic influences on the human tendency toward the obscenity and considers struggling with the Satan as a way for freedom and sublimation

  7. A Corpus-Based Stylistic Analysis of "Body-Soul" and "Heaviness-Lightness" Metaphors in Kundera's Novel "The Unbearable Lightness of Being"

    Science.gov (United States)

    Hussein, Khalid Shakir; Ameer, May Ali Abdul

    2015-01-01

    This paper represents an attempt to conduct a corpus-based stylistic analysis of two conceptual metaphors in "The Unbearable Lightness of Being," which is a novel written by Milan Kundera. "Soul-body" and "lightness-heaviness" metaphors are foregrounded as being central themes all through the novel. The way such…

  8. Evaluating the Dissemination of "Body & Soul," an Evidence-based Fruit and Vegetable Intake Intervention: Challenges for Dissemination and Implementation Research

    Science.gov (United States)

    Allicock, Marlyn; Campbell, Marci K.; Valle, Carmina G.; Carr, Carol; Resnicow, Ken; Gizlice, Ziya

    2012-01-01

    Objective: To evaluate whether the evidence-based "Body & Soul" program, when disseminated and implemented without researcher or agency involvement and support, would achieve results similar to those of earlier efficacy and effectiveness trials. Design: Prospective group randomized trial. Setting: Churches with predominantly African American…

  9. Prayers for the salvation of the soul. Obituary in stone in Sant Pau del Camp monastery in Barcelona

    Directory of Open Access Journals (Sweden)

    Javier de Santiago Fernández

    2016-12-01

    Full Text Available This paper examines some inscriptions preserved in the monastery of Sant Pau del Camp, in Barcelona, in order to determine their functionality and find out who were their moral authors. We try to answer the questions of who and why. This collection of epigraphs is peculiar in Spanish medieval epigraphy; it cannot be assimilated exactly to epitaphia necrologica, because those in Sant Pau del Camp specially emphasize the foundation of anniversaries, that guarantee perpetual prayer for the deceased’s soul. Consequently, we have conceptualized some of these inscriptions as fundationes of anniversary. This tradition is not habitual in other areas of the Iberian Peninsula, except Catalonia. Also, we can find similar inscriptions in the south of France. We also analyze the relationship of these epigraphs with obituaries and testamentary dispositions.

  10. The Soul's Legacy: A Program Designed to Help Prepare Senior Adults Cope With End-of-Life Existential Distress.

    Science.gov (United States)

    Grewe, Fred

    2017-01-01

    Current innovative psychological therapies have made great progress in addressing existential suffering in dying patients but are often begun to late in the end-of-life process and often ignore religion, which for many is a major component in the meaning-making process. Therefore, this article explores how chaplains (who are familiar with various religious traditions without promoting them) can help prepare senior adults effectively cope with inevitable end-of-life existential issues. The project described in this article provides tools for chaplains to address the real issues that terrify us all, but particularly the elderly: death, isolation, and meaninglessness. It is proposed that the addition of a spiritual will or legacy of the soul added to end-of-life planning can help ameliorate existential suffering at life's end.

  11. A soul, monsters and life on the Moon. Anthropological theory in Wojciech Tylkowski’s baroque scientia curiosa

    Directory of Open Access Journals (Sweden)

    Grzegorz Raubo

    2013-01-01

    Full Text Available The article deals with the main points of the anthropological theory presented in the work of a baroque encyclopedist Wojciech Tylkowski which is entitled Uczone rozmowy [Learned Conversations] (1692. This theory combined the elements of theology, philosophy, science and common knowledge. It was presented as scientia curiosa, i.e. a convention which was used during the baroque era to popularize science. The most important aspects of the theory are: the concept of the human soul, four temperaments, the structure and operation of sense organs, the reasons for monstrous births, origins and manifestations of insanity, care of a guardian angel for a man, speculations about the idea of plurality of worlds and the possibility of people living on the Moon.

  12. [The historical background of the pineal gland: I. From a spiritual valve to the seat of the soul].

    Science.gov (United States)

    López-Muñoz, Francisco; Marín, Fernando; Alamo, Cecilio

    Throughout history, the special anatomical location of the pineal gland in the central nervous system has given rise to a number of physiological hypotheses regarding the functional role of this organ. In classical ancient times, the pineal body (conarium) was considered to be a sort of valve-like sphincter that regulated the flow of the spiritus animalis at the ventricular level. But it was not until the 17th century that the pineal gland finally reached its highest levels of physiological significance, when Rene Descartes considered it to be the anatomical structure that housed the seat of the soul. The Cartesian hypotheses regarding the pineal gland did not arouse much interest in the scientific community of the time, and attention to this organ dwindled from then until the 20th century, when its neuroendocrinological nature was finally confirmed.

  13. Achieving social change on gender-based violence: a report on the impact evaluation of Soul City's fourth series.

    Science.gov (United States)

    Usdin, S; Scheepers, E; Goldstein, Susan; Japhet, Garth

    2005-12-01

    The Soul City Institute for Health and Development Communication--a South African multi-media health promotion project--together with the National Network on Violence Against Women, formulated an intervention to address domestic violence. Recognising that behavioural change interventions aimed solely at individuals have limited impact, the intervention was designed to impact at multiple mutually reinforcing levels; individual, community and socio-political environment. The intervention and its evaluation results are presented. Soul City successfully reached 86%, 25% and 65% of audiences through television, print booklets and radio, respectively. On an individual level there was a shift in knowledge around domestic violence including 41% of respondents hearing about the helpline. Attitude shifts were also associated with the intervention, with a 10% increase in respondents disagreeing that domestic violence was a private affair. There was also a 22% shift in perceptions of social norms on this issue. Qualitative data analysis suggests the intervention played a role in enhancing women's and communities' sense of efficacy, enabling women to make more effective decisions around their health and facilitating community action. The evaluation concluded that implementation of the Domestic Violence Act can largely be attributed to the intervention. While demonstrating actual reductions in levels of domestic violence was not possible, the evaluation shows a strong association between exposure to intervention components and a range of intermediary factors indicative of, and necessary to bring about social change. This paper reports on the evaluation, discusses its limitations and challenges as well as lessons learned regarding multi-level interventions on domestic violence.

  14. Person-centered osteopathic practice: patients’ personality (body, mind, and soul and health (ill-being and well-being

    Directory of Open Access Journals (Sweden)

    Elin Fahlgren

    2015-10-01

    Full Text Available Background. Osteopathic philosophy and practice are congruent with the biopsychosocial model, a patient-centered approach when treating disease, and the view of the person as a unity (i.e., body, mind, and soul. Nevertheless, a unity of being should involve a systematic person-centered understanding of the patient’s personality as a biopsychosociospiritual construct that influences health (i.e., well-being and ill-being. We suggest Cloninger’s personality model, comprising temperament (i.e., body and character (i.e., mind and soul, as a genuine paradigm for implementation in osteopathic practice. As a first step, we investigated (1 the relationships between personality and health among osteopathic patients, (2 differences in personality between patients and a control group, and (3 differences in health within patients depending on the presenting problem and gender.Method. 524 osteopathic patients in Sweden (age mean = 46.17, SD = 12.54, 388 females and 136 males responded to an online survey comprising the Temperament and Character Inventory and measures of health (well-being: life satisfaction, positive affect, harmony in life, energy, and resilience; ill-being: negative affect, anxiety, depression, stress, and dysfunction and suffering associated to the presenting problem. We conducted two structural equation models to investigate the association personality-health; graphically compared the patients’ personality T-scores to those of the control group and compared the mean raw scores using t-tests; and conducted two multivariate analyses of variance, using age as covariate, to compare patients’ health in relation to their presenting problem and gender.Results. The patients’ personality explained the variance of all of the well-being (R2 between .19 and .54 and four of the ill-being (R2 between .05 and .43 measures. Importantly, self-transcendence, the spiritual aspect of personality, was associated to high levels of positive emotions

  15. Man – body and soul, as well as the relationship between them in the view of St. Justin the Martyr and Philosopher

    Directory of Open Access Journals (Sweden)

    ROTARU Ioan-Gheorghe

    2014-11-01

    Full Text Available Among the first Church Fathers, where we find the concern for anthropological issues, is St. Justin the Martyr and the Philosopher. Even though St. Justin has not developed a proper anthropology, because it was too early for such a performance, however he draw a few lines in this regard, that influenced later patristic tradition, also showing interest in humanist culture in general, because this culture has a pronounced character of continuity, keeping the principles of permanent value, principles earned through the efforts of the spirit and society over time. Man, in the conception of St. Justin the Martyr and the Philosopher, is a rational being comprised of two elements: body and soul. Taken separately, the two elements, body or soul, do not form the man, this being the union and unity of the two elements. Sf. Justin says that God, summoned to life and resurrection this entire assembly, that is the man, and not just a part of him. He considers man as being a miracle, if we take into account the small drop of seed which he derives from and which produces and develops the bones, nerves and flesh. As for the relationship between body and soul, St. Justin the Martyr and the Philosopher says that they are closely connected by the very act of creation.

  16. Person-centered osteopathic practice: patients’ personality (body, mind, and soul) and health (ill-being and well-being)

    Science.gov (United States)

    Nima, Ali A.; Archer, Trevor

    2015-01-01

    Background. Osteopathic philosophy and practice are congruent with the biopsychosocial model, a patient-centered approach when treating disease, and the view of the person as a unity (i.e., body, mind, and soul). Nevertheless, a unity of being should involve a systematic person-centered understanding of the patient’s personality as a biopsychosociospiritual construct that influences health (i.e., well-being and ill-being). We suggest Cloninger’s personality model, comprising temperament (i.e., body) and character (i.e., mind and soul), as a genuine paradigm for implementation in osteopathic practice. As a first step, we investigated (1) the relationships between personality and health among osteopathic patients, (2) differences in personality between patients and a control group, and (3) differences in health within patients depending on the presenting problem and gender. Method. 524 osteopathic patients in Sweden (age mean = 46.17, SD = 12.54, 388 females and 136 males) responded to an online survey comprising the Temperament and Character Inventory and measures of health (well-being: life satisfaction, positive affect, harmony in life, energy, and resilience; ill-being: negative affect, anxiety, depression, stress, and dysfunction and suffering associated to the presenting problem). We conducted two structural equation models to investigate the association personality-health; graphically compared the patients’ personality T-scores to those of the control group and compared the mean raw scores using t-tests; and conducted two multivariate analyses of variance, using age as covariate, to compare patients’ health in relation to their presenting problem and gender. Results. The patients’ personality explained the variance of all of the well-being (R2 between .19 and .54) and four of the ill-being (R2 between .05 and .43) measures. Importantly, self-transcendence, the spiritual aspect of personality, was associated to high levels of positive emotions and

  17. Person-centered osteopathic practice: patients' personality (body, mind, and soul) and health (ill-being and well-being).

    Science.gov (United States)

    Fahlgren, Elin; Nima, Ali A; Archer, Trevor; Garcia, Danilo

    2015-01-01

    Background. Osteopathic philosophy and practice are congruent with the biopsychosocial model, a patient-centered approach when treating disease, and the view of the person as a unity (i.e., body, mind, and soul). Nevertheless, a unity of being should involve a systematic person-centered understanding of the patient's personality as a biopsychosociospiritual construct that influences health (i.e., well-being and ill-being). We suggest Cloninger's personality model, comprising temperament (i.e., body) and character (i.e., mind and soul), as a genuine paradigm for implementation in osteopathic practice. As a first step, we investigated (1) the relationships between personality and health among osteopathic patients, (2) differences in personality between patients and a control group, and (3) differences in health within patients depending on the presenting problem and gender. Method. 524 osteopathic patients in Sweden (age mean = 46.17, SD = 12.54, 388 females and 136 males) responded to an online survey comprising the Temperament and Character Inventory and measures of health (well-being: life satisfaction, positive affect, harmony in life, energy, and resilience; ill-being: negative affect, anxiety, depression, stress, and dysfunction and suffering associated to the presenting problem). We conducted two structural equation models to investigate the association personality-health; graphically compared the patients' personality T-scores to those of the control group and compared the mean raw scores using t-tests; and conducted two multivariate analyses of variance, using age as covariate, to compare patients' health in relation to their presenting problem and gender. Results. The patients' personality explained the variance of all of the well-being (R (2) between .19 and .54) and four of the ill-being (R (2) between .05 and .43) measures. Importantly, self-transcendence, the spiritual aspect of personality, was associated to high levels of positive emotions and

  18. Two Interlocked Triads in Pat Kinevane’s Recent Plays: Self-Soul-Conscousness and Birth-Death-Rebirth

    Directory of Open Access Journals (Sweden)

    Nicoleta Stanca

    2017-05-01

    Full Text Available Everyting conceivable, all that has ever been imagined, can be included in our minds and souls. As psyche means “breath”, “soul” and “mind”, it points to the relevance of psychology as a study of mental, emotional and spiritual processes involved in our identity make-up. One of the main organizers of our self and psychological experiences is our relationhip with death: our fear of abandonement and of being alone when conceiving our own death, the fear of the loss of the others, leading to the fear of attachment and emotional death. Pat Kinevane, a contemporary Irish playright, deals, in his 2005 play, Forgotten, with the idea of family and social abandonment of old people in nursing homes. The interconnected stories of Dora, Eucharia, Flor and Gustus, the characters in the play, aged 80-100 years old, living in separate retirement and care facilities around Ireland, reveal these fears. Mental illness in the current explosion of anxiety is also crucial to our identity. Another play by Kinevane, Silent (2010, ends with the word silent, which indicates the insanity, invisibility and ultimately the death of the protagonist, Tino McGoldring, a homeless man tormented by the suicide of his brother. His self after the loss of his brother, wife, family, job, mind is constructed in relation to the past and the imaginary world of the Italian-American icon of the film industry of the 1920s, Rudolph Valentino.

  19. A modern conceptualization of phobia in al-Balkhi's 9th century treatise: Sustenance of the Body and Soul.

    Science.gov (United States)

    Awaad, Rania; Ali, Sara

    2016-01-01

    Morbid fears and phobias have been mentioned in religious, philosophical and medical manuscripts since ancient times. Despite early insights by the Greeks, phobias did not appear as a separate clinical phenomenon in Western medicine until the 17th century and has evolved substantially since. However, robust investigations attempting to decipher the clinical nature of phobias emerged in pre-modern times during the oft-overlooked Islamic Golden Era (9th-12th centuries); which overlapped with Europe's medieval period. An innovative attempt was made by the 9th century Muslim scholar, Abu Zayd al-Balkhi, in his medical manuscript "Sustenance of the Body and Soul," to define phobias as a separate diagnostic entity. Al-Balkhi was one of the earliest to cluster psychological and physical symptoms of phobias under one category, "al-Fazaá", and outline a specific management plan. We analyze al-Balkhi's description of phobias, according to the modern understanding of psychiatric classifications and symptomatology as described in the DSM-5. Copyright © 2015. Published by Elsevier Ltd.

  20. [The English Sweating Sickness' of 1529 in Augsburg: a challenge to body and soul and the printer].

    Science.gov (United States)

    Resch, Claudia

    2009-01-01

    In 1529, Sudor anglicus, the 'English Sweating Sickness', spread from England to Germany reaching the city of Augsburg. Its exact nature is unclear: the symptoms were profuse sweating, uncontrollable thirst, and headaches, with death occurring within hours of infection. Those who survived the first twenty-four hours returned to health. According to one source the fever arrived in Autumn 1529 and in September there were 800 deaths; another source gives November as the onset with 600 deaths. While these death rates were in fact relatively low compared with the plague, for instance, people were particularly frightened by the sudden appearance of an unknown fever and the speed of death. Augsburg was aware that the 'English Sweating Sickness' was spreading in Germany. What is remarkable was the quick reaction of the printing trade. Two related types of handbooks so on appeared; whichwill serve as the subject of this paper. Firstly, handbooks dealing with the fever as a medical issue, and secondly, those dealing with the fever as an issue of theology. An illustrative example of each handbook is discussed here. Authored at speed and quickly published, they reflect the urgent response to the outbreak. What is demonstrated is the need to attend both to body and soul, that the 'English Sweating Sickness' was a challenge not just to physicians but also to theologians. The printing trade seized the opportunity to meet both needs.

  1. La Peyronie and the experimental search for the seat of the soul: neuropsychological methodology in the eighteenth century.

    Science.gov (United States)

    Kaitaro, T

    1996-09-01

    The birth of scientific neuropsychology is traditionally considered to have taken place during the 19th century when disturbances or losses of specific mental functions were systematically correlated with post-mortem findings of localized cerebral pathology. Attempts at localizing psychic functions were of course made earlier, but they were usually not based on scientific observations with one notable and so far neglected exception. At the beginning of the 18th century the French surgeon François Gigot de La Peyronie systematically tried to correlate deficits of mental functions with autopsy findings. The methodological principles he formulated were sound and do not essentially differ from those used in modern scientific neuropsychology. His method was based on the systematic exclusion of those areas of the brain whose lesions are not associated with disruption of the faculties of the soul combined with the careful examination of cases where such association consistently exists. His conclusions were, however, disappointing from the modern point of view and he obviously failed to found a new scientific discipline. The reasons for this failure obviously lay in the dualistic presuppositions which made him look for the unique locus of mind-body interaction instead of localizing specific functions.

  2. [The historical background of the pineal gland: II. From the seat of the soul to a neuroendocrine organ].

    Science.gov (United States)

    López-Muñoz, Francisco; Marín, Fernando; Alamo, Cecilio

    Throughout history a number of speculations have been put forward concerning the functional role of the pineal gland, perhaps some of the most important being the neurophysiological proposals by Descartes. The psychophysiological role conferred on the pineal gland by Descartes in the 17th century, that is, as the seat of the human soul, had barely any scientific support at the time. Throughout the 18th century interest in the pineal gland gradually declined and it was considered to be just a vestigial evolutionary element until the second half of the 19th century, thanks to the boom of comparative anatomy, which confirmed the photoreceptive role of the parietal organ of the anurans, and of microscopic anatomy, which revealed the histological structure of the pineal gland of mammals. In the early 20th century the first data were published in the scientific literature on the endocrine aspect of the pineal gland (on the relation between pineal tumours and precocious puberty), but its ultimate confirmation took place in 1958, with the isolation of melatonin by the team led by Aaron B. Lerner. Later, the term 'neuroendocrine transducer' was introduced to explain the principle of the pineal gland, that is to say, the transformation of information about light from the retina into an endocrine response consisting in the synthesis and release of the hormone melatonin. In turn, this hormone acts as a powerful neurotransmitter in the central nervous system, which makes the pineal gland a kind of 'biological clock'.

  3. The soul-sucking wasp by popular acclaim--museum visitor participation in biodiversity discovery and taxonomy.

    Science.gov (United States)

    Ohl, Michael; Lohrmann, Volker; Breitkreuz, Laura; Kirschey, Lukas; Krause, Stefanie

    2014-01-01

    Taxonomy, the science of describing and naming of the living world, is recognized as an important and relevant field in modern biological science. While there is wide agreement on the importance of a complete inventory of all organisms on Earth, the public is partly unaware of the amount of known and unknown biodiversity. Out of the enormous number of undescribed (but already recognized) species in natural history museum collections, we selected an attractive example of a wasp, which was presented to museum visitors at a special museum event. We asked 300 visitors to vote on a name for the new species and out of four preselected options, Ampulex dementor Ohl n. sp. was selected. The name, derived from the 'soul sucking' dementors from the popular Harry Potter books is an allusion to the wasps' behavior to selectively paralyze its cockroach prey. In this example, public voting on a scientific name has been shown to be an appropriate way to link museum visitors emotionally to biodiversity and its discovery.

  4. The soul-sucking wasp by popular acclaim--museum visitor participation in biodiversity discovery and taxonomy.

    Directory of Open Access Journals (Sweden)

    Michael Ohl

    Full Text Available Taxonomy, the science of describing and naming of the living world, is recognized as an important and relevant field in modern biological science. While there is wide agreement on the importance of a complete inventory of all organisms on Earth, the public is partly unaware of the amount of known and unknown biodiversity. Out of the enormous number of undescribed (but already recognized species in natural history museum collections, we selected an attractive example of a wasp, which was presented to museum visitors at a special museum event. We asked 300 visitors to vote on a name for the new species and out of four preselected options, Ampulex dementor Ohl n. sp. was selected. The name, derived from the 'soul sucking' dementors from the popular Harry Potter books is an allusion to the wasps' behavior to selectively paralyze its cockroach prey. In this example, public voting on a scientific name has been shown to be an appropriate way to link museum visitors emotionally to biodiversity and its discovery.

  5. Reisikott kui isikupärane reisikaaslane / Karoli Saar

    Index Scriptorium Estoniae

    Saar, Karoli

    2011-01-01

    Uurimuse eesmärgiks oli vaadelda reisikottide liike ja kujundusvõtteid nii ajaloos kui ka tänapäeval, pöörates tähelepanu kottidel kasutatavale dekoorile ja funktsionaalsuse ning mustri koosmõjule. Eraldi on välja toodud reisimise ja meene omavaheline seos, Eesti sümboolika kasutamine suveniiridel ning ülevaade Eestis tegutsevatest ettevõtetest ja konkurssidest. Praktilise tööna valmis reisikottide kollektsioon, mis kajastab eestlaste tasakaalukat ja looduslähedast elutunnetust

  6. Suurepärane! Ma ostan selle! / Vanessa Friedman

    Index Scriptorium Estoniae

    Friedman, Vanessa

    2000-01-01

    Liibanoni päritolu, Pariisis elaval Mouna Ayoub'il, kes kulutab aastas kõrgmoele 16 miljonit krooni, on kavas avada oma muuseum. M. Ayoub ostab rõivaid Valentinolt, Diori, Givenchy ja Chaneli moemajadest, Gaultier' ja Versace kauplustest, kübaraid Philip Treacy'lt ja mujalt

  7. Salapärane mastermind / Helina Mägi

    Index Scriptorium Estoniae

    Mägi, Helina

    2011-01-01

    Napoleon Hilli raamatus Mõtlemist muutes rikkaks tutuvustatud tehnikast, mida seal on mainitud küll ajutrusti nime all, ning mis tähendab ühise eesmärgi nimel töötavat kahte või enamat inimest

  8. Environmental Education of Body and Soul by Methods Shareholders to Students of 6 to 9 Years of Basic Education

    Directory of Open Access Journals (Sweden)

    Flávio Roberto Chaddad

    2011-06-01

    Full Text Available Earth is undergoing intense transformations that are threatening the life of living beings. One of the means to remedy this critical state is by means of environmental education. It is being developed at EMEFEI Teacher Laura Rebouças de Abreu, Dois Córregos (SP, the project called "Environmental education of body and soul". The goals are to make the students to recognize themselves as an integral part of nature, to see themselves as historical subjects endowed with the perception that they can change their realities and that their attitudes may have continuity. This project has been using participative methodologies that give voice to all participants, making them to recognize, analyze and propose solutions to their problems. It is dialectic, reflective and aims at overcoming the contradictions experienced through the critical appropriation of reality. Three changes in the students were observed. The first was the extension of their conception of environment and its problematics. Based on this conception, the students built the tree of dreams, meaning what they wanted to happen in order to change their realities. The third momentum was called the stones of the path, that are nothing else than the obstacles found to solve the problems. Based on these findings they began to search and construct the initial and necessary knowledge to obtain their achievements, which are already being put into practice. The conclusion is that environmental education developed by means of these methodologies results in the formation of reflective and politically participatory human beings, so necessary nowadays.

  9. On flora semantics in house names found in Vidzeme: materials contained in the 1826 counting of souls in Vidzeme province

    Directory of Open Access Journals (Sweden)

    Ilga Jansone

    2014-12-01

    Full Text Available On flora semantics in house names found in Vidzeme: materials contained in the 1826 counting of souls in Vidzeme province The information of the counting of souls containing both house names and names of individuals is an essential aspect of historical onomastics. The first counting of souls in Vidzeme took place in 1782 and coincided with the 4th analogous census of the provinces of Russia. Subsequently these took place at irregular intervals, the 5th in 1795, the 6th in 1811, the 7th in 1816, the 8th in 1834, the 9th in 1850, and the final, 10th in 1858. The number of house names entered in the 1826 counting of souls in Vidzeme province (guberna is 14,500, including those of peasant homes that had been separated from another property whilst retaining the same name. House names based on flora (incl. names of mushrooms semantics are listed for 574 dwellings, which represent just about 4% of all house names listed for Vidzeme, providing that repeated house names are counted separately. In case of several manors data is missing (lost for the 1826 census, information for these manors is taken from previous and subsequent censuses. In many instances (279 cases registered house names were based on the names of deciduous trees found in their immediate vicinity: such names comprise 48.6% of all house names of flora semantic origin, i. e., ozols ‘oak-tree’, bērzs ‘birch-tree’, kārkls ‘osier’, liepa ‘linden tree’, kļava ‘maple tree’, apses ‘aspen’, osis ‘ash tree’, alksnis ‘alder’, lazda ‘hazel-tree’, vītols ‘willow’, ieva ‘bird cherry’. Names based on names of conifers are found (35 instances were recorded, or 6.1% of all house names based on flora semantics, i. e., egle ‘spruce tree’, paeglis, kadiķis ‘juniper’, priede ‘pine-tree’. House names based on names of fruit trees and bushes are only occasionally found in Vidzeme, with 8 recorded instances, or 1.4% of all house names based on flora

  10. When the Soul has left the Body: A presentation and analysis of the moment of death within the German version of Dirc van Delft’s Table of Christian Faith

    DEFF Research Database (Denmark)

    Robbe, Joost Roger

    2017-01-01

    This article provides a literary analysis of a 15th-century text, Die sele als sy verscheiden is uitten lichaem (When the soul has left the body), which, until now, remains overlooked and unedited by current scholarship. The text describes what happens to the soul immediately after the moment...... of physical death and is found in the German version of Dirc van Delft’s Table of Christian Faith. This article discusses the context, function and structure of the text in both its German and (original) Dutch version, and it offers a critical edition and English translation. It concludes by suggesting why...

  11. Alternative medicine: Soul healers

    Directory of Open Access Journals (Sweden)

    Stojanović Marko

    2005-01-01

    Full Text Available The wars and subsequent crisis in the former Yugoslavia have brought about a different, distressed value system to the populations in Serbia. One of its reflections is seen in an establishment of the so-called alternative healing systems. The contemporary, modern medicine holds that illnesses are caused by various psycho-somatic agents, therefore, I take contemporary healers to be alternative psychiatrists and therapists which balance and cure individual distresses. Crisis in societies are psycho-physical triggers that initiate structural disturbances in personalities of active and passive participants, and initiate a search for psycho-therapeutic methods which include transcendental. The processes of globalization and urbanization have helped clear up the fact that the official/established and alternative/traditional medicines have structural determination and corresponding status with the prevailing value system and religious affiliation of the population. Cultural-historic processes are often established in the alternative, and the opposite.

  12. With body and soul

    DEFF Research Database (Denmark)

    Bech, Nikolaj Ilsted

    2002-01-01

    Aktuel Naturvidenskab(4):34-36. 2002 Short description: ?Man, has by evolution, been equipped with different systems of learning. Children and adults alike have a head as well as a body and both parts can be stimulated,? writes Nikolaj Ilsted Bech and Theresa Schilhab in this article from...

  13. Micturition and the soul

    NARCIS (Netherlands)

    Holstege, G

    2005-01-01

    There is a close connection between micturition and emotion. Several species use micturition to signal important messages as territorial demarcation and sexual attraction. For this reason, micturition is coordinated not in the spinal cord but in the brainstem, where it is closely connected with the

  14. The Soul of Invention

    Science.gov (United States)

    Nelson, Scott Reynolds

    2013-01-01

    Technology shifts gears. The workers who control it need to learn how to shift gears, too. Workers brought up with universal schooling would respect authority, learn enough "geometry and mechanics" to use in their trades, keep invention alive, and finally see through "the interested complaints of faction and sedition." In other…

  15. No Soul for Sale

    DEFF Research Database (Denmark)

    Christensen, Signe Meisner

    2014-01-01

    maintain, is not to escape from it. It is rather to invent new forms of performative instituting. By turning the idea of institution into an active verb, it becomes possible to invent modes of action in museums that take into account the intricacies of working in between consumption and critical production......The dissertation focuses on the turn in contemporary art museums to new exhibition formats that stage art projects as communicative events. The dissertation develops a theoretical framework to engage with this transformation. It claims that the change evidences a transition to immaterial production....... Immaterial Production as a New Condition for Art Museums It is the argument of the dissertation that in order to understand the present change in exhibition formats in art museums, it is productive to consider it as a new logic of production. I define this logic as immaterial production. Immaterial...

  16. Micturition and the soul.

    Science.gov (United States)

    Holstege, Gert

    2005-12-05

    There is a close connection between micturition and emotion. Several species use micturition to signal important messages as territorial demarcation and sexual attraction. For this reason, micturition is coordinated not in the spinal cord but in the brainstem, where it is closely connected with the limbic system. In cat, bladder afferents terminate in a cell group in the lateral dorsal horn and lateral part of the intermediate zone. Neurons in this cell group project to supraspinal levels, not to the thalamus but to the central periaqueductal gray (PAG). Neurons in the lateral PAG, not receiving direct sacral cord afferents, project to the pontine micturition center (PMC). The PMC projects directly to the parasympathetic bladder motoneurons and to sacral GABA-ergic and glycinergic premotor interneurons that inhibit motoneurons in Onuf's nucleus innervating the external striated bladder sphincter. Thus, PMC stimulation causes bladder contraction and bladder sphincter relaxation, i.e., complete micturition. Other than the PAG, only the preoptic area and a cell group in the caudal hypothalamus project directly to the PMC. The ventromedial upper medullary tegmentum also sends projections to the PMC, but they are diffuse and also involve structures that adjoin the PMC. Neuroimaging studies in humans suggest that the systems controlling micturition in cat and human are very similar. It seems that the many structures in the brain that are known to influence micturition use the PAG as relay to the PMC. This basic organization has to be kept in mind in the fight against overactive bladder (OAB) and urge-incontinence. (c) 2005 Wiley-Liss, Inc.

  17. Vibrations in the Soul

    Science.gov (United States)

    Ellyn, Tracy

    2007-01-01

    As artists of many centuries have known, there is a psychology and spirituality behind every color, every shape, and every movement. In his pioneering work, Concerning the Spiritual in Art, Wassily Kandinsky explained his vision to free art from material reality to inner life. He called for a spiritual revolution that would allow artists to…

  18. The Soul of Sophistry

    DEFF Research Database (Denmark)

    Larsen, Jens Kristian

    2007-01-01

    Artiklen søger at påvise, at en omstridt passage i Platons dialog "Sofisten", som oftest anses som en art digression i forhold til resten af dialogen, er en afgørende, metodisk passage, der kaster lys over målsætningen for hele dialogen. Hermed søges det tillige vist, at det "sokratiske element" ...

  19. Starting with the Soul

    Science.gov (United States)

    Intrator, Sam M.; Kunzman, Robert

    2006-01-01

    Intrator and Kunzman argue that professional development for teachers follows an orientation similar to Abraham Maslow's hierarchy of needs--and that this orientation needs to be reversed. Maslow posited that people must fulfill subsistence needs such as needs for food and safety before they can pursue higher needs like the need for…

  20. The Pilgrim Soul.

    Science.gov (United States)

    McGlinn, Marguerite

    1995-01-01

    Gives advice for the beginning teacher by narrating the fictional experiences of one teacher's childhood and explaining how these experiences shaped the teacher's professional outlook. Concentrates on the visit of one of the teacher's uncles to America. (HB)

  1. Magnolia grandiflora L. ve Magnolia x soulangiana Soul. Türlerinin Bazı Tohum Özelliklerinin Belirlenmesi Üzerine Araştırmalar

    OpenAIRE

    Ebcin Korkusuz, Ebru

    2012-01-01

    ÖzetMagnolia grandiflora L. ve Magnolia x soulangiana Soul. türleri tohumlarının morfolojisi, olgunlaşma zamanı, çimlenme engeli ya da dormansi fizyolojisi ve tohum gücü (doğrudan, dolaylı), laboratuarda gerçekleştirilen bir dizi deneysel çalışmalarla araştırılmıştır. Manolya türleri tohumlarında ön işlemleri zorunlu kılan çimlenme engeli (dormansi) mevcuttur. Çalışma kapsamında söz konusu çimlenme engelinin giderilmesi için her iki türde soğuk katlama, çıplak katlama, osmotik stres ile koşul...

  2. Quae dicitur vita, mors est: The Platonic Doctrines of the Embodied Soul at the Outset of Neo-Platonism in Comparison to Their Gnostic Parallels

    Directory of Open Access Journals (Sweden)

    Sonja Weiss

    2009-07-01

    Full Text Available The article presents the leading Platonic doctrines of the embodied soul, examining the relation between their Orphic and Pythagorean roots and Plotinus’ correction of the Neo-Pythagorean pessimism on the one hand, and Gnostic solutions of the problem on the other. The analysis of certain Gnostic passages clearly shows that, in spite of Plotinus’ anti-Gnostic polemic, some of the ideas proposed by the philosopher as an alternative to his opponents’ pessimism are also present in the Gnostic descriptions of the emanation from the first Principle and the multiplication of the Eons. The article focuses on the passages which, avoiding an ethical valuation of the generation and multiplication process, limit the concept of sin to the human domain, where it belongs in Plotinus’ view as well. Moreover, the article endeavours to throw light on some of the most controversial themes, which were to remain irreconcilable despite a number of tenets shared by both sides.

  3. It Is Reasonable to Uphold a Non-Reductive Christian Monism? Theology Confronted with the Mind-Brain and Body-Soul Problem

    Directory of Open Access Journals (Sweden)

    Luis O. Jiménez-Rodríguez

    2016-02-01

    Full Text Available Is Christian Anthropology essentially dualist or it is reasonable to uphold a particular form of Christian monism? Recent developments in neurosciences challenge the idea of an immaterial soul, source of spiritual operations such as cognition, volition, freedom, values, aesthetics and even religiosity. This article presents two neurological anthropologies, one represented by Jean Pierre Changeux’ book L’homme neuronal and the other represented by Gerald Edelman’s work. Through an analysis of biblical anthropology and some relevant texts written by Saint Irenaeus of Lyon and Saint Thomas Aquinas, the article seeks to demonstrate the existence of a Christian tradition characterized by a non-reductionist monism. Furthermore, a series of pertinent theological principles are retrieved from this tradition, which have inspired, and still ought to inspire, the development of a non-dualist Christian Anthropology: the principle of creation, an incarnation principle and an eschatological principle. This Christian tradition and a dialogue with natural sciences inspired two contemporary Christian theologians to develop their holistic anthropologies: Karl Rahner and Alexander Ganoczy. Finally, the article discusses what could be the contribution of theology in the ongoing interdisciplinary dialogue between neuroscientists, philosophers of mind and theologians.

  4. Role of soluble endothelial cell-selective adhesion molecule biomarker in albuminuria and kidney function changes in patients with coronary artery disease: the Heart and Soul Study.

    Science.gov (United States)

    Park, Meyeon; Vittinghoff, Eric; Ganz, Peter; Peralta, Carmen A; Whooley, Mary; Shlipak, Michael G

    2014-01-01

    Endothelial dysfunction is a possible mechanism to explain the association between atherosclerosis and kidney disease. This study evaluated circulating soluble endothelial cell-selective adhesion molecule (sESAM), a marker of endothelial dysfunction, as a risk factor for kidney function decline and albuminuria. In the Heart and Soul Study, we measured sESAM from baseline serum samples and defined elevated levels of sESAM by the highest quartile (quartile 4 [Q4]: >65.4 ng/mL). We evaluated the associations of high sESAM with baseline estimated glomerular filtration rate (eGFR) and ratio of urine albumin to creatinine (ACR), and with longitudinal changes in eGFR and ACR. Among 990 participants with sESAM measurements, median sESAM was 54.5 ng/mL (interquartile range, 45.3-65.8). After multivariable adjustment, elevated levels of sESAM were strongly and independently associated with baseline reduced eGFR albuminuria and reduced kidney function in both cross-sectional and longitudinal analyses. These findings implicate endothelial dysfunction as a potential contributor to the elevated kidney disease risk in persons with cardiovascular disease.

  5. A Corpus-based Stylistic Analysis of Body-Soul and Heaviness-Lightness Metaphors in Kundera's Novel The Unbearable Lightness of Being

    Directory of Open Access Journals (Sweden)

    Khalid Shakir Hussein

    2015-10-01

    Full Text Available This paper represents an attempt to conduct a corpus-based stylistic analysis of  two conceptual metaphors in The Unbearable Lightness of Being, which is a novel written by Milan Kundera. Soul-body and lightness-heaviness metaphors are foregrounded as being central themes all through the novel. The way such metaphors are used in the novel indicates an insightful employment of metaphor as a cognitive tool which empowers language users with a capacity of conceptualizing different experiences. The researcher adopts conceptual metaphor theory to produce a sort of conceptual analysis incorporating Leech's semantic componential analysis within the overall analytic procedure. Different techniques are figured out in relation to the creative ways of manipulating the cognitive level of language, such as conceptual switching, conceptual extension, and conceptual fusion. These creative techniques are carefully used in the novel under investigation with different ranges of metaphorical creativity. Conceptual switching might be simple but very active in deviating from the conventional conceptual system. Conceptual extension marks certain minute elaborations conventional metaphors undergo extending the limits of cognitive conceptualization. As for conceptual fusion, it proves to be interestingly powerful in producing certain aggregations of metaphorical mappings. Keywords: Conceptual Metaphor Theory, Metaphorical Creativity, Metaphorical Mappings, Corpus Stylistics

  6. Trauma exposure predicts alcohol, nicotine, and drug problems beyond the contribution of PTSD and depression in patients with cardiovascular disease: data from the Heart and Soul Study.

    Science.gov (United States)

    Waldrop, Angela E; Cohen, Beth E

    2014-01-01

    This study examined the role of lifetime trauma exposure in a longitudinal study of adults with cardiovascular disease to determine the unique contribution of trauma exposure to risk for drug and alcohol problems and smoking. Data were drawn from the Heart and Soul Study, a prospective cohort study designed to determine the mechanisms of associations between psychological factors and increased risk of cardiovascular events in high-risk patients (n = 1,022). Lifetime exposure to a higher number of trauma types predicted substance use outcomes beyond risk explained by PTSD and depression. In addition, across trauma types, interpersonal traumas were most strongly associated with substance use problems. Our results suggest that, though PTSD and depression play a role in the association between trauma exposure and substance use, many other factors also contribute; therefore focusing on these psychological comorbidities alone is not sufficient. The integration of mental health care and/or case management support with primary and specialty medical care may improve detection and treatment for patients with substance use and comorbid mental and physical health problems. Screening for trauma exposure is an important part of good clinical care. © American Academy of Addiction Psychiatry.

  7. The reins of the soul: the centrality of the intercostal nerves to the neurology of Thomas Willis and to Samuel Parker's theology.

    Science.gov (United States)

    Knoeff, Rina

    2004-07-01

    Thomas Willis's description of the intercostal nerves has not received much attention by historians of medicine. Yet the intercostal nerves are of paramount importance for his neurology. Willis explained that via these nerves, which connect the brain to the heart and lower viscera, the brain controls the passions and instincts of the lower body. In other words, Willis believed that the intercostal nerves mediate a kind of rationality and that therefore they make a human a rational being. Willis's theory, I argue, must be seen in the context of the early modern mind-body problem. In the second part of the article I discuss how Oxford theologian Samuel Parker took up Willis's argument while stating that the intercostal nerves are the most important instruments (reins) of the soul. They control the bodily passions so that humans can transform into more virtuous beings. The explanation of the intercostal nerves offered by Willis and Parker fits the Anglican optimism about the abilities of human reason as well as about the moral potential of humankind.

  8. Georg Büchner, Sigmund Freud and the "Schädelnerven" (cranial nerves) - research on the brain and soul in the 19th century.

    Science.gov (United States)

    Hildebrandt, Gerhard; Ruppert, Christina; Stienen, Martin N; Surbeck, Werner

    2014-10-01

    One of the authors' encounter with one of Sigmund Freud's original works about the anatomy of the human brain stem and his interest in the scientist, anatomist, philosopher, writer and revolutionary Georg Büchner led to re-examination and review of the original writings of two major 19th century protagonists of brain anatomy research. The aim of the authors is to highlight the achievements of both Freud and Büchner in the field of comparative brain morphology. The medical and philosophical publications of Georg Büchner were reviewed with reference to the historical-critical edition of his complete works and writings (the so-called Marburg edition). Evaluation of the neuroanatomical achievements of Sigmund Freud was based on a summary of his publications and also partially on his autobiographical writings. After careful review of their publications both Freud and Büchner should be acknowledged as brain scientists focusing particularly on comparative morphology. Both chose fish as the subject of their macroscopic (Büchner) and microscopic (Freud) neuroanatomical studies, and both cut across their own language and cultural space by continuing their work in France. In interpreting their findings both were influenced by their respective contemporary methodological schools of thought. Büchner became a soul scientist/psychologist by turning to the writing of literary texts, heralding the end of his idealistic and metaphysical interpretation of life. Likewise, Freud increasingly devoted himself to the destiny of man and his "conditio humana," eventually turning away from anatomical brain research. Review of the biographies and medical-scientific, as well as philosophical publications, of Georg Büchner and Sigmund Freud reveal striking parallels between the two researchers in addition to common insights that have generally been ignored or only marginally addressed in the past. Both should be appreciated and remembered as forerunners of today's neuroscientific

  9. Design of a cluster-randomized controlled trial of a diabetes prevention program within African-American churches: The Fit Body and Soul study.

    Science.gov (United States)

    Williams, Lovoria B; Sattin, Richard W; Dias, James; Garvin, Jane T; Marion, Lucy; Joshua, Thomas; Kriska, Andrea; Kramer, M Kaye; Echouffo-Tcheugui, Justin B; Freeman, Arin; Narayan, K M Venkat

    2013-03-01

    Evidence from varied community settings has shown that the Group Lifestyle Balance (GLB) Program and other adaptations of the Diabetes Prevention Program (DPP) intervention are effective in lowering diabetes risk. Most DPP data originated from studies of pre-diabetic whites, with only sparse evidence of the effect of DPP in African Americans (AAs) in community settings. This paper describes the design, methods, baseline characteristics and cost effective measures, of a single-blinded, cluster-randomized trial of a faith-based adaptation of the GLB program, Fit Body and Soul (FBAS). The major aims are to test efficacy and cost utility of FBAS in twenty AA churches. Randomization occurred at the church level and 604 AA overweight/obese (BMI≥25kg/m(2)) adults with fasting plasma glucose range from normal to pre-diabetic received either FBAS or a health-education comparison program. FBAS is a group-based, multi-level intervention delivered by trained church health advisors (health professionals from within the church), with the goal of ≥7% weight loss, achieved through increasing physical activity, healthy eating and behavior modification. The primary outcome is weight change at 12weeks post intervention. Secondary outcomes include hemoglobin A1C, fasting plasma glucose, waist circumference, blood pressure, physical activity level, quality of life measures, and cost-effectiveness. FBAS is the largest known cohort of AAs enrolled in a faith-based DPP translation. Reliance on health professionals from within the church for program implementation and the cost analysis are unique aspects of this trial. The design provides a model for faith-based DPPs and holds promise for program sustainability and widespread dissemination. Copyright © 2013 Elsevier Inc. All rights reserved.

  10. THE WINDOW TO THE WORLD OF THE GOSPEL TRUTH: THE POWER OF RUSSIAN FOLK SPEECH IN NIKOLAI GOGOL'S NOVEL "DEAD SOULS"

    Directory of Open Access Journals (Sweden)

    Vladimir Alekseevich Voropaev

    2013-11-01

    Full Text Available The article studies the function of Russian folk speech and its evangelical implication in Nikolai Gogol's poetics. Folk proverbs and parables is the key source of national identity in Gogol’s aesthetics, which should inspire all Russian poets. The paper asserts that the proverbial method of generalization is one of the most significant principles of typification in Gogol's novel Dead Souls. The author expresses the essence of this or that phenomenon, a situation or a human type using imaginative pictures and traits of characters. The more generalized form they take, the more they resemble the traditional folk and poetic formulas. The article also reveals the hidden message of a Russian proverb Russians are good at thinking in hindsight (“Russkiy chelovek zadnim umom krepok”. This characteristic of the Russian mind is the one with which Gogol connects the great destiny of Russia. At the end of his first volume the author resorts to the allegorical form of a parable that plays a key role in the perception of the novel. Transforming into the generalized symbol, its characters accumulate the most significant generic features and qualities of Dead Souls’ characters. The grotesque images of Kifa Mokiyevich and Mokiy Kifovich help to look at the characters of the novel from every possible side, not from one side only that shows them as small-minded and worthles people. Gogol’s characters do not possess definitely disgusting and ugly qualities, which should be eliminated for the sake of people's improvement. Sobakevich's powerful physique and pragmatism, Plushkin's thrift, Manilov's meditativeness and cordiality, as well as Nozdryov's valor and energy are not bad qualities at all and do not deserve condemnation. However, all of them as Gogol used to say are carried to extremes and take perverse and exaggerated forms.

  11. Another Language Is Another Soul

    Science.gov (United States)

    Wilson, Rosemary

    2013-01-01

    For many language learners, studying a foreign language is a compulsory, high-stakes activity. It is perhaps for this reason that positive feelings about language learning are rarely mentioned in the literature on language learning. The focus is predominantly on negative feelings: the anxiety caused by being asked to speak in the foreign language…

  12. Linea Trasversale, Flesh and Soul

    DEFF Research Database (Denmark)

    Chemi, Tatiana

    2003-01-01

    The following article answers the specific need of providing information to all those who continually ask, “What is Linea Trasversale (LT)?” LT was founded in 1995 as a strategy to avoid isolation, in the shadow of the educational network called University of Eurasian Theatre (Università del Teatro...

  13. Soul, mind and brain in pre-history and early human civilizations / Alma, mente e cérebro na pré-história e nas primeiras civilizações humanas

    Directory of Open Access Journals (Sweden)

    Fabiano dos Santos Castro

    2010-01-01

    Full Text Available Currently, the debate about the nature of the human mind is taking new directions through the development of several studies in the field of neuroscience which investigates the location of brain functions. These studies have contributed to a better understanding of the neural substrates of mental functions and the etiology of various mental disorders. However, the knowledge developed by neuroscience did not occur abruptly. Indeed, the study of mind-brain relationship is not new. From pre-history to the present days, various different types of inquiries have been made about the possible materiality and location of human mental functions. This paper presents, in a historic manner, how prehistoric populations as well as early civilizations located in Egypt, Mesopotamia, India, and China developed and employed concepts related to the soul, the mind and the human brain.

  14. Huere Siech! Salapärane "Šveitsi mudel" Eesti maksukaristusõiguses / Lasse Lehis

    Index Scriptorium Estoniae

    Lehis, Lasse, 1972-

    2007-01-01

    Karistusseadustiku muudatustest seoses maksupettustega ja vastavast seaduseelnõust (931 SE). Lisatud: karistusseadustik ; väljavõte Tartu Ülikooli finantsõiguse dotsendi dr. iur. Lasse Lehise arvamusest Riigikogu õiguskomisjonile (16. oktoober 2006) ; ettepanekud seaduseelnõu 931 kohta ; karistusseadustiku muudatused on samm tagasi õigusriigi arengus ; karistusseadustiku ja selle muutmisega seonduvate seaduste muutmise seaduse eelnõu (931 SE) II lugemise jätk ; Hirvoja, Martin. Nii aiast kui ka aiaaugust : kommentaar

  15. Tanel Saare omapärane duett Jüri Järvetiga / Tiiu Laks

    Index Scriptorium Estoniae

    Laks, Tiiu, 1984-

    2010-01-01

    VAT Teatri lavastusest "... viimane lint / Saare esimene lint", kus põimuvad Tanel Saare esitus ja Jüri Järvet vana Krappina ekraanil. Tanel Saar lindistab S. Becketti "Krappi viimase lindi" salvestatud osa, mille kuulamine taaslavastatakse 30 aasta pärast, kui T. Saar ise on juba vana Krappi eas

  16. Loitsumees ja salapärane autojuht / Mare Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Mare, 1958-

    2014-01-01

    Artikkel on kirjutatud Sandra Rannastiku magistritöö põhjal (Tallinna Ülikool, kasvatusteaduste instituut, algõpetuse osakond, 2014). Magistritöö põhineb uuringul, mille jaoks valiti välja kümme raamatut, et uurida milliseid ootusi üks või teine raamat lastes tekitab ja viidi läbi 72 neljanda klassi õpilase hulgas

  17. Salapärane spioonikolmnurk Moskva-Washington-Bermuda / Mikk Salu

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2007-01-01

    Briti agentidena esinenud detektiivid petsid audiitorfirmast KMPG välja saladokumente, niidid viivad Venemaale. Vt. samas: Spiooniskandaal Hewlett-Packardis. Kommenteerib ekskriminaalpolitseinik Koit Pikaro

  18. Käepärane teabevärav Johannes Käisist / Viivi Eksta

    Index Scriptorium Estoniae

    Eksta, Viivi

    2007-01-01

    Tiigrihüppe sihtasutuse rahalisel toel valmistasid Tallinna Ülikooli Eesti Pedagoogika Arhiivmuuseumi töötajad veebilehekülje "Johannes Käis" (aadressiga www.htk.tlu.ee/kais). Projekti autor on Ilmar Kopso, teostajad Jana Järvsoo, Viivi Eksta ja Riina Taro

  19. Internet - kas vaimse tervise edendamise suurepärane tööriist? / Airi Mitendorf

    Index Scriptorium Estoniae

    Mitendorf, Airi, 1974-

    2012-01-01

    Üleeuroopalise terviseprogrammi projekti SUPREME (Suicide Prevention by Internet and Media Based Mental Health Promotion) raames kaardistati veebileheküljed, mis avanesid märksõnadele suitsiid ja enesetapp

  20. Salapärane Boeing tõi Eestisse konteinereid / Ester Vilgats

    Index Scriptorium Estoniae

    Vilgats, Ester

    2005-01-01

    Ilmunud ka: Pärnu Postimees 8. nov., lk. 3, Postimees : na russkom jazõke 10. nov. lk. 10. Pärnu lennujaama juhataja Erki Teemägi ja Kaitsepolitsei Pärnu osakonna politseidirektor Kalev Kont kinnitasid, et Pärnu lennuväljal 12. jaanuaril 2003. aastal maandunud Boeing 737 vedas kaubakonteinereid, mitte terroristidest sõjavange, nagu väitis ajaleht Washington Post. Vt. samas: Neeme Raud. Inimõiguslased ootavad euroliidu sekkumist

  1. Säärane mulk, ehk sada vakka etteheiteid / Avo Üprus

    Index Scriptorium Estoniae

    Üprus, Avo, 1954-

    2004-01-01

    Ilmunud ka: Hiiumaa, 24. juuli 2004, lk. 2; Võrumaa Teataja, 24. juuli 2004, lk. 2; Vooremaa, 24. juuli 2004, lk. 2; Meie Maa, 23. juuli 2004, lk. 2; Järva Teataja, 27. juuli 2004, lk. 4; Lääne Elu, 27. juuli 2004, lk. 2; Koit, 27. juuli 2004, lk. 6; Pärnu Postimees, 28. juuli 2004, lk. 15; Virumaa Teataja, 30. juuli 2004, lk. 7; Vali Uudised, 30. juuli 2004, lk. 2; Põhjarannik, 30. juuli 2004, lk. 2; Severnoje Poberezhje, 30. juuli 2004, lk. 2; Hiiu Leht, 3. aug. 2004, lk. 2; Sakala, 3. aug. 2004, lk. 2; Valgamaalane, 12. aug. 2004, lk. 2. Vastuseks Helir-Valdor Seederi art. 17. juuli ajal. Meie Maa. Uus poliitika tähendab üldinimlike väärtuste taasväärtustamise kaudu pidevalt uuenevat riiki.

  2. Veneetsia biennaal ehk maailmu luues - keskpärane / Anders Härm

    Index Scriptorium Estoniae

    Härm, Anders, 1977-

    2009-01-01

    53. Veneetsia biennaal "Making Worlds" ("Tehes maailmu") kestab 7. juunist kuni 22. novembrini, kuraator Daniel Birnbaum. Eestit esindab Kristina Normani töö "After-War", kuraator Marco Laimre. Lähemalt rootsi kunstniku Öyvind Fahlströhmi tööst

  3. VRIJEDNOST KARBOKSITERAPIJE PRI LIJEČENJU KRONIČNE RANE POTKOLJENICE

    OpenAIRE

    KOVAČEVIĆ, JADRANKA; SINOŽIĆ, TAMARA

    2015-01-01

    Karboksiterapija je potporna metoda liječenja kroničnih rana koja se provodi kutanim ili subkutanim ubrizgavanjem medicinskog ugljičnog dioksida (Co2). osnovni princip djelovanja ubrizganog plina Co2 je korekcija tkivne hipoksije temeljem Bohrovog efekta. Djelujući na endotelne faktore rasta potiče neoangiogenezu te stimuliraju ibroblaste na sintezu kolagena što sve zajedno dovodi do boljeg zacjeljivanja rana. Brojna su područja primjene karboksiterapije: od liječenja kroničnih rana, bolesti ...

  4. Sin as an Ailment of Soul and Repentance as the Process of Its Healing. The Pastoral Concept of Penitentials as a Way of Dealing with Sin, Repentance, and Forgiveness in the Insular Church of the Sixth to the Eighth Centuries

    Directory of Open Access Journals (Sweden)

    Kursawa Wilhelm

    2017-05-01

    Full Text Available Although the advent of the Kingdom of God in Jesus contains as an intrinsic quality the opportunity for repentance (metanoia as often as required, the Church of the first five-hundred years shows serious difficulties with the opportunity of conversion after a relapse in sinning after baptism. The Church allowed only one chance of repentance. Requirement for the reconciliation were a public confession and the acceptance of severe penances, especially after committing the mortal sin of apostasy, fornication or murder. As severe as this paenitentia canonica appears, its entire conception especially in the eastern part of the Church, the Oriental Church, is a remedial one: sin represents an ailment of the soul, the one, who received the confession, is called upon to meet the confessing person as a spiritual physician or soul-friend. Penance does not mean punishment, but healing like a salutary remedy. Nevertheless, the lack of privacy led to the unwanted practice of postponing repentance and even baptism on the deathbed. An alternative procedure of repentance arose from the sixth century onwards in the Irish Church as well as the Continental Church under the influence of Irish missionaries and the South-West-British and later the English Church (Insular Church. In treatises about repentance, called penitentials, ecclesiastical authorities of the sixth to the eight centuries wrote down regulations, how to deal with the different capital sins and minor trespasses committed by monks, clerics and laypeople. Church-representatives like Finnian, Columbanus, the anonymous author of the Ambrosianum, Cummean and Theodore developed a new conception of repentance that protected privacy and guaranteed a discrete, an affordable as well as a predictable penance, the paenitentia privata. They not only connected to the therapeutic aspect of repentance in the Oriental Church by adopting basic ideas of Basil of Caesarea and John Cassian, they also established an

  5. La filosofía antigua como “terapéutica del alma”, ¿antecedente del psicoanálisis?/Ancient philosophy as "the soul therapeutics", antecedent of psychoanalysis?

    Directory of Open Access Journals (Sweden)

    Andrea Díaz Genis

    2010-03-01

    Full Text Available En este artículo recuperamos la tradición antigua del cuidado de sí, que asocia a la filosofía con el psicoanálisis, entendido como una cura del alma a través de la palabra, el autoexamen y la relación entre médico- paciente o filósofo-discípulo y de una verdad que necesita de la “conversión” del sujeto. Se recupera para ello la filosofía del Banquete de Platón y La Tranquilidad del Alma de Séneca.In this paper we bring back the ancient tradition of self-care, which associates psychoanalysis, with philosophy, understanding psychoanalysis as a cure of the soul through the word, the self examination, the relationship between patient and physician or philosopher and disciple, and a kind of truth which needs the subject’s "conversion". It is brought back through the philosophy of Plato's Symposium and “Tranquility of the soul” by Seneca.

  6. Espelho da alma: teoria social e subjetivação em um conto de Machado de Assis Mirror of the soul: subjectivity and social theory in a short history by Machado de Assis

    Directory of Open Access Journals (Sweden)

    César Sabino

    2011-01-01

    Full Text Available O objetivo deste trabalho é delinear de forma breve as interseções teóricas existentes no conto "O espelho. Um esboço de uma nova teoria da alma humana", de Machado de Assis, e parte da tradição da teoria social que sugere uma síntese sociológica entre ação e estrutura relacionada ao aspecto da construção da identidade e subjetivação, reprodução e mudança social.This paper aims to present a brief outline of the theoretical intersections in the short history "The looking glass. Rough draft of a new theory of the human soul", by Machado de Assis. It departs from the tradiction of social theory that suggests a sociological syntheses between action and strutcture that is closely linked to the issue of one's construction of identity and subjectivaction, their reproduction and social transformation.

  7. Alma, mente e cérebro na pré-história e nas primeiras civilizações humanas Soul, mind and brain in pre-history and early human civilizations

    Directory of Open Access Journals (Sweden)

    Fabiano dos Santos Castro

    2010-04-01

    Full Text Available Atualmente, o debate sobre a natureza da mente humana vem tomando novos rumos graças ao desenvolvimento de diversos estudos, no campo das neurociências, que investigam a localização das funções cerebrais. Esses trabalhos vêm contribuindo para uma melhor compreensão dos substratos neurais das funções mentais, bem como da etiologia de diversos transtornos mentais. Entretanto, o conhecimento acumulado pela neurociência não ocorreu de forma súbita. Na verdade, o estudo das relações entre o cérebro e a mente não é recente. Da pré-história aos dias atuais, surgiram vários tipos de questionamentos a respeito da possível materialidade e localização das funções mentais humana. O presente trabalho apresenta, de forma histórica, como populações pré-históricas, assim como as primeiras civilizações, localizadas no Egito, na Mesopotâmia, na Índia e na China, desenvolveram e utilizaram conceitos relacionados com a alma, a mente e o cérebro humano.Currently, the debate about the nature of the human mind is taking new directions through the development of several studies in the field of neuroscience which investigates the location of brain functions. These studies have contributed to a better understanding of the neural substrates of mental functions and the etiology of various mental disorders. However, the knowledge developed by neuroscience did not occur abruptly. Indeed, the study of mind-brain relationship is not new. From pre-history to the present days, various different types of inquiries have been made about the possible materiality and location of human mental functions. This paper presents, in a historic manner, how prehistoric populations as well as early civilizations located in Egypt, Mesopotamia, India, and China developed and employed concepts related to the soul, the mind and the human brain.

  8. Association of growth differentiation factor 11/8, putative anti-ageing factor, with cardiovascular outcomes and overall mortality in humans: analysis of the Heart and Soul and HUNT3 cohorts.

    Science.gov (United States)

    Olson, Kristoff A; Beatty, Alexis L; Heidecker, Bettina; Regan, Mathilda C; Brody, Edward N; Foreman, Trudi; Kato, Shintaro; Mehler, Robert E; Singer, Britta S; Hveem, Kristian; Dalen, Havard; Sterling, David G; Lawn, Richard M; Schiller, Nelson B; Williams, Stephen A; Whooley, Mary A; Ganz, Peter

    2015-12-21

    Growth differentiation factor 11 and/or its homologue growth differentiation factor 8 (GDF11/8) reverses age-related cardiac hypertrophy and vascular ageing in mice. We investigated whether GDF11/8 associates with cardiovascular outcomes, left ventricular hypertrophy (LVH), or age in humans. We measured plasma GDF11/8 levels in 928 participants with stable ischaemic heart disease in the Heart and Soul study. We adjudicated heart failure hospitalization, stroke, myocardial infarction, death, and their composite endpoint. Left ventricular hypertrophy was evaluated by echocardiography. We used multivariable Cox proportional hazards models to compare rates of cardiovascular events and death across GDF11/8 quartiles and logistic regression models to evaluate the association between GDF11/8 and LVH. Four hundred and fifty participants (48.5%) experienced a cardiovascular event or death during 8.9 years of follow-up. The adjusted risk of the composite endpoint was lower in the highest compared with the lowest GDF11/8 quartile [hazard ratio (HR), 0.45; 95% confidence interval (CI), 0.33-0.60; P < 0.001]. We replicated this relationship of GDF11/8 to adverse events in 971 participants in the HUNT3 cohort (adjusted HR, 0.34; 95% CI, 0.23-0.51; P < 0.001). Left ventricular hypertrophy was present in 368 participants (39.7%) at baseline. Participants in the highest quartile of GDF11/8 were less likely to have LVH than those in the lowest quartile (adjusted OR, 0.55; 95% CI, 0.35-0.86; P = 0.009). GDF11/8 levels were lower in older individuals (P < 0.001). In patients with stable ischaemic heart disease, higher GDF11/8 levels are associated with lower risk of cardiovascular events and death. Our findings suggest that GDF11/8 has similar cardioprotective properties in humans to those demonstrated in mice. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2015. For permissions please email: journals.permissions@oup.com.

  9. Faculdades da alma e suas implicações para a educação: saberes divulgados no século XIX Faculties of the soul and their implications for education: knowledges circulated in the 19th century

    Directory of Open Access Journals (Sweden)

    Raquel Martins de Assis

    2012-03-01

    Full Text Available Este artigo descreve resultados de uma pesquisa que buscou investigar como o tema das faculdades da alma e de suas implicações no desenvolvimento humano e na educação da pessoa foi divulgado, ao final do século XIX, pela imprensa periódica. Esperando contribuir para a história da psicologia e da educação, o artigo apresenta a análise de escritos sobre educação moral e educação estética de uma Secção Scientífica ou Pedagógica assinada por José Miguel de Siqueira e publicada no jornal O Baependyano (1877-1889. Inicialmente, são feitas breves descrições do periódico e de sua posição na conjuntura da época, bem como do lugar em que foi publicado. Em seguida, tratamos da definição de pedagogia apresentada pelo jornal, levando em consideração as apropriações de autores estrangeiros comumente presentes no campo da educação. A pedagogia considerada moderna é definida em tais escritos como a expansão e o desenvolvimento das forças animais, racionais e morais do ser humano; sua finalidade seria a formação do homem social pronto para o trabalho e para o serviço da sociedade e do Estado. Partindo dessa discussão, abordamos as concepções de educação espontânea, educação regular e instrução contidas no periódico. A educação é entendida como a unidade entre cultura e instrução, sendo a cultura a principal responsável pelo direcionamento das faculdades da alma e pela formação moral; a instrução, por sua vez, é tomada como aquisição de conhecimentos, mas também desempenha um papel importante na formação de hábitos e costumes.The article describes the results of a research that investigated how the theme of the faculties of the soul and of their implications for human development and for the education of a person was made available in the late 19th century by the circulating press. In an attempt to contribute to the history of psychology and education, the article presents the analysis of

  10. Megalopolis as the mirrorof the soul Mегаполис как зеркало души

    Directory of Open Access Journals (Sweden)

    Frolov Aleksandr Viktorovich

    2013-03-01

    Full Text Available The article focuses on some civilization-related factors determining the life of a contemporary megalopolis and influencing the structure of the human soul. The system of global capitalism appears to be the most important factor producing a strong impact onto the urban population. The present-day megalopolis operates as an economic centre having pragmatic rhythms and spaces. «Homo economicus» is a relevant definition of the present-day man.This state of affairs reflects the structure of the human soul and its needs. It is overcrowded with sensual stimuli and temptations producing misbalance and stress. Two phenomenological distinctions are employed to analyze the experience of urban residents: noise vs. silence and motion vs. quietness. Noise and motion constitute the background of the human experience here; silence and quietness are local and volatile. On the contrary, outside of the city, silence is the background of the experience, and any motion vanishes in the realm of quietness. Nature is calm, and we need its calmness to give some rest to our senses. The effect of permanent haste typical for the lifestyle in big cities makes people unconscious of themselves. They lose their lifetime to implement their basic functions like eating/working/sleeping. Any higher incomes and comfort don’t make people happier; therefore, they have to look for alternative lifestyles (e.g. “downshifting”. Some people are not eager to be part of the global economy, but they have no opportunity to get out of the urban space. They need some remedy to resist the urban attack. That remedy could be a kind of a psychological technique reducing the effect of aggression. In this respect, the practice of hesychia deriving from the Christian ascetical tradition seems to be useful for an urban resident allowing him/her to attain the state of inner silence. This technique may be employed as a way to survive in the urban haste.Сделана попытка

  11. Uncertainty the soul of modeling, probability & statistics

    CERN Document Server

    Briggs, William

    2016-01-01

    This book presents a philosophical approach to probability and probabilistic thinking, considering the underpinnings of probabilistic reasoning and modeling, which effectively underlie everything in data science. The ultimate goal is to call into question many standard tenets and lay the philosophical and probabilistic groundwork and infrastructure for statistical modeling. It is the first book devoted to the philosophy of data aimed at working scientists and calls for a new consideration in the practice of probability and statistics to eliminate what has been referred to as the "Cult of Statistical Significance". The book explains the philosophy of these ideas and not the mathematics, though there are a handful of mathematical examples. The topics are logically laid out, starting with basic philosophy as related to probability, statistics, and science, and stepping through the key probabilistic ideas and concepts, and ending with statistical models. Its jargon-free approach asserts that standard methods, suc...

  12. Constitutional Government: The Soul of Modern Democracy.

    Science.gov (United States)

    Mansfield, Harvey C., Jr.

    1987-01-01

    Discusses the dilemma faced by constitutionalism today: limited, constitutional government requires that people and society be independent and distrustful of the state, but if the people are too independent and capable of ruling, they may wish to extend their powers and attempt to rule over others. (PS)

  13. Arts Education: Searching Its Own Soul.

    Science.gov (United States)

    Spearman, Carlesta Elliot

    2000-01-01

    Focuses on various topics related to arts education policy such as the creation of the national arts standards, the influence of racism on policy decisions, the importance for equal access to education at all educational levels, and the work of Howard Gardner on multiple intelligences that helped legitimize the arts. (CMK)

  14. ‘The Souls of Europe’

    NARCIS (Netherlands)

    Buijs, G.J.

    2009-01-01

    How should Europe deal politically with its legacy as a so-called ‘Christian civilization’? Should this imply an overt reference to God or to the Christian or Judeo-Christian tradition in European constitutional documents (as was debated when the so called ‘Treaty Establishing a Constitution for

  15. Human Being Human: Culture and the Soul

    OpenAIRE

    Hauke, Chris

    2005-01-01

    Human Being Human explores the classical question 'What is a human being?'\\ud \\ud In examining our human being, Christopher Hauke challenges the notion of human nature, questions the assumed superiority of human consciousness and rational thinking and pays close attention to the contradiction of living simultaneously as an autonomous individual and a member of the collective community. The main chapters include:\\ud \\ud who's in charge here?\\ud knowledge power and human being\\ud that thinking ...

  16. Cuerpo y espíritu tipográfico en el proyecto de diseño de “EHU Tipografia” = Typographic body and soul of "EHU Tipografia" type design project

    Directory of Open Access Journals (Sweden)

    Eduardo Herrera Fernández

    2014-12-01

    Full Text Available Las letras son ideas acerca de cómo son las cosas. Dicho de otra manera, son el espíritu que aflora tras el cuerpo de una palabra. Desde estos presupuestos, en este artículo presentamos los principios conceptuales de creación de la fuente tipográfica “EHU Tipografia”. Este proyecto surgió con el encargo de crear una tipografía específica para la Universidad del País Vasco/Euskal Herriko Unibertsitatea, como parte de la estrategia de gestión de su identidad visual corporativa. Para ello, apuntando a la energía sensitiva del cuerpo de las letras, se recurrió a las especulaciones estéticas sobre la forma materializadas por Eduardo Chillida. En la producción artística de Chillida encontramos una sutil coincidencia con principios vitales para la creación tipográfica, en cuanto al planteamiento de formas en las que el rigor geométrico es vencido por una suerte de organicidad que parte del núcleo mismo de la estructura —cursus—, por la fuerza vital que imprime la acción modulada del gesto —ductus—, por la dialéctica entre lo lleno y lo vacío —forma/contraforma—, por el impulso y la espontaneidad —carácter—, o por la afirmación de un lenguaje plástico en la cultura diferenciada del medio en el que se vive —identidad—. Abstract Letter forms are ideas about how things are. In other words, they are the soul that flourishes behind a word’s body. From this premise, this article shows those conceptual principles which have been the basis in the design of EHU typeface. This project arose as a request of designing a custom typeface for University of Basque Country, as part of its corporate visual identity management. For this propose, pointing at a sensitive energy from letterforms’ body, we turn to aesthetic speculations on the form to which Eduardo Chillida gave material form. In the artistic production of Chillida, we find a subtle coincidence with some vital fundamentals in type design as far as his

  17. Mood = isiklik puudutus = loominguline vabadus = isikupärane tarbija / Urmas Väljaots, Anu Lensment ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Väljaots, Urmas, 1981-

    2001-01-01

    7. IV Vene Draamateatris toimuvast moedisainikonkursist "SuperNoova", žürii koosseis (Eestist Anu Samarüütel, Toomas Volkmann). Briti moekunsti näitusest "Fabric of Fashion" Tallinna Kunstihoones. Seosest tekstiili- ja moekunsti vahel Eestis, koostööst Ele Praksiga.

  18. Eestipärane nädalavahetus Kopenhaagenis jõulukuul / Maie Veskis Hove ; fotod: Taavi Toom

    Index Scriptorium Estoniae

    Veskis Hove, Maie

    2006-01-01

    3. detsembril EV Suursaatkonnas korraldatud H. C. Anderseni muinasjutu teemalise näituse "Vankumatu Tinasõdur" avamisest, kunstnik Raivo Järvi joonistamisest lastele ning 4. detsembri jumalateenistusest Hans Tauseni kirikus, jõuluvanast, ühisest koosviibimisest

  19. Kamahouse'i asutamise pöörane lugu / Kadri Jakobson ; vahendanud Ursula Zimmermann ; kommenteerinud William Piper

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2012-01-01

    Kunsti ja äri ühendamisest: kobarärist Koplis, kuhu kuuluvad Kamahouse Galerii, Eero Kotli Tellisstuudio, Unique Home Art, William Piper konsultatsioonibüroo, Meeskonnakoolituse ja Arenduse OÜ, kauplus-stuudio Õnneküpsis, kohvik Kamahouse'i Köök

  20. Itaaliapärane restoran Jõe tänaval : Gianni = Italian-style restaurant on Jõe street : Gianni

    Index Scriptorium Estoniae

    2007-01-01

    Tallinnas Jõe t. 4 asuva restorani Gianni sisekujundus. Sisearhitekt Pille Lausmäe (Pille Lausmäe SAB), kaasa töötasid Kristina Roots ja Ville Lausmäe. Plaan, 6 värv. vaadet, foto P. Lausmäest

  1. I prodotti alimentari minori: chiocciole e rane Allevamento e specie commerciali, normative igienico-sanitarie e prospettive future.

    OpenAIRE

    Vitali, Edoardo

    2015-01-01

    The heliciculture and frog breeding are zootechnic activities of great relevance that, actually, have not been taken in particular consideration overall by laws collected in the so named “Hygiene Package” because considered minor food or only food of niche. In fact, the presence of these meats on the market is still limited. The author wishes to underline the importance of nutritive value of snails and frogs meat and so the public can appreciate this alternative food by a correct consumer's i...

  2. Protein (Viridiplantae): 831920 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available rane protein 4 Cucumis melo MNRHNDPNPFDEEEVNPFSKGGGAPGSKFRIPQMVSDTLGFGQKHDATVDIPL...DTMNDPKKKERELAAWEAELNRKEKEIKKREEAVSKAGVPADDRNWPPFFPIIHHDIANEIPVHAQKLQYLAFASWLGIVLCLFFNVIAITVCWIRGGGVKIFFLAVIYAILGIPL

  3. A educação do corpo para o "soldado integral", "forte de físico, culto de cérebro e grande de alma" The education of the body for an "integral soldier", "physically strong, intelligent and soul superior"

    Directory of Open Access Journals (Sweden)

    Renata Duarte Simões

    2012-06-01

    Full Text Available Este estudo reflete sobre o treinamento paramilitar realizado pela Milícia Integralista, unidade armada da Ação Integralista Brasileira (AIB, principal partido de extrema direita no Brasil da década de 1930, no sentido de formar o "soldado integral", "forte de físico, culto de cérebro e grande de alma". Analisa os números do jornal Monitor Integralista, periódico doutrinário e prescritivo do movimento, encontrado no Arquivo Público e Histórico do Município de Rio Claro, SP, e o jornal A Offensiva, que se encontra microfilmado na Biblioteca Nacional no Rio de Janeiro. Concluiu que o objetivo de Plínio Salgado, Chefe Nacional da AIB, era treinar verbalmente, por meio de discursos, de propaganda boca a boca e pelo voto, ou corporalmente, pela luta armada e corporal, os integralistas para torná-los aptos a defender as causas do movimento.This study examines the paramilitary training carried out by the Integralist Militia (Milícia Integralista, unit of the Brazilian Integralist Action (Ação Integralista Brasileira, AIB of the extreme right wing political party in Brazil in the 1930s. The training was aimed to create the "integral soldier", a "physically strong, intelligent and soul superior" one. The study analyzes issues of the newspaper "Monitor Integralista", a prescriptive and dogmatic journal of the movement, found in the Public and History Archives of the city of Rio Claro, State of São Paulo, and in the "A Offensiva" newspaper, microfilmed an archived at the National Library of Rio de Janeiro. It concludes that Plínio Salgado's goal, the National Head of the AIB, was to train, by using verbal persuasion, speeches, word of mouth and by vote, by force and physical combat, the integralists to defend the causes of the movement.

  4. Važnost rane dijagnostike razvojnih i topografskih aberacija trećih trajnih molara — prevencija mogućih komplikacija

    OpenAIRE

    Miličić, Asja; Kesić-Balaško, Zdenka

    1980-01-01

    Ispitivanju razvojnih, morfoloških i topografskih karakteristika zametaka trećih trajnih molara podvrgnuto je 108 ortopantomografskih snimaka ortodontskih pacijenata, kojih se dob kretala od 8 — 18 godina. Vrednovanjem faktora koji bi posredno ili neposredno mogli utjecati na daljnji razvoj trećeg trajnog molara kao i na nastanak tercijarne kompresije, odnosno pogoršanja postojeće ortodontske anomalije, postavljena je prognoza eruptivne faze razvoja tog zuba. Prognoza je okvalificirana kao: —...

  5. "Jumalale meelepärane seletus ehk mõnede südametunnistuse-küsimuste teoloogiline deduktsioon" : vaimulik vs ilmalik 17. sajandi Tallinnas / Lea Kõiv

    Index Scriptorium Estoniae

    Kõiv, Lea

    2008-01-01

    Tallinna sisepingetest 17. sajandil. Linnavõimu ja vaimulike vahelisest konfliktist 1662. aastal. Vaimulike poolt koostatud kirjalikust läkitusest Tallinna Raele. Rae reageeringust deduktsioonile. Konflikti ajast ja oludest. Tallinna kirikukorraldusest 16.-17. sajandil. Ilmalike võimude ja kiriku vahekorrast.

  6. The Soul of Islam: Writing and Publishing as Engaged Sufism ...

    African Journals Online (AJOL)

    and confidently counter them with an emphasis on pluralism of interpretations and proof for the organic connection between. Sufism and Islam. To be a Sufi is to be a lover, but not just any kind of lover. We need knowledge to know what to love and what love asks of us, in order that we might become love itself. Journal for ...

  7. “Narcissism” and the Creation of Soulful Space

    African Journals Online (AJOL)

    denise

    narcissism'. Using both the psychoanalytic tradition and the literary myth of Narcissus as 'touchstones', it unfolds a view of existential dilemmas and possibilities that are announced by this discourse. As such, it seeks to clarify the existential task.

  8. The Soul is Willing but...: Exploring Community Sanitation ...

    African Journals Online (AJOL)

    Sanitation has been identified as an essential aspect of development as it affects the quality of life and productivity of the population. But sanitation facilities are only sustainable when people make their own choices and contribution towards obtaining and maintaining them. This paper therefore examines sanitation ...

  9. Ability to Listen one’s Own Soul

    Directory of Open Access Journals (Sweden)

    Vera K. Krylova

    2014-07-01

    Full Text Available The article considers the idea of the Russian classic repertoire in Yakutsk Drama Theatre. A focus is made on the playwright ‘Forest’ by A.N. Ostrovsky, as an acting techniques motivator. The performing arts by leading actors D. Khodulov, P. Reshchetnikov and others are presented.

  10. Selling My Queer Soul or Queerying Quantitative Research?

    OpenAIRE

    Kath Browne

    2008-01-01

    Sexualities research is increasingly gaining prominence within, and outside, of academia. This paper will use queer understandings to explore the contingent (re)formation of quantitative data, particularly those that seek to gain insights into Lesbian, Gay, Bisexual and Trans populations and lifestyles. I use queer critiques to explore the creation and normalising impulses of quantitative sexualities research and argue that research that addresses 'deviant'/other/(homo)sexualities brings cate...

  11. Renovating the house of being: genomes, souls, and selves.

    Science.gov (United States)

    Mauron, Alex

    2003-10-01

    In recent years, the views of the German philosopher Peter Sloterdijk about humanism and the biological self-engineering of mankind caused much turmoil in European intellectual circles. However, this is just one episode in a more general current controversy about the ethics of self-manipulation, a debate that often centers around the recent progress in genomics and the possibility of shaping human genetic structure. The complete sequencing of the human genome has reinforced this focus. Making the human genome the object of a highly visible world-wide research effort has reinforced popular notions stressing the centrality of the genome in defining individuality and humanity. As a result, proponents and opponents of the self-engineering of human nature have often concentrated on technologies related to the genome. However, if one compares "genome-based" and "brain-based" explanations of Self and behavior, it turns out that neural aspects of human nature are more directly relevant. Many philosophical and ethical questions traditionally raised about genetics and genomics acquire more relevance and urgency when re-examined in the context of neuroscience.

  12. Soul / Randy Becker, Bill Evans, Evelin Samuel ; interv. Sven Sapelson

    Index Scriptorium Estoniae

    Becker, Randy

    2007-01-01

    The Soulbop Bandi rajajad Randy Becker ja Bill Evans ning meie Evelin Samuel gospeli ja rhytmblues'i juurtega soulist. Lk. 72-73 Inessa Josingu ja Ande Kaalepi souliteemaline fotolavastusega ruumikujundus

  13. Jung and the Soul of Education (at the "Crunch")

    Science.gov (United States)

    Rowland, Susan

    2012-01-01

    C. G. Jung offers education a unique perspective of the dilemma of collective social demands versus individual needs. Indeed, so radical and profound is his vision of the learning psyche as collectively embedded, that it addresses the current crisis over the demand for utilitarian higher education. Hence post-Jungian educationalists can develop…

  14. Saving IT's Soul: Human-Centered Information Management.

    Science.gov (United States)

    Davenport, Thomas H.

    1994-01-01

    Argues that, unless information technology managers pay attention to how people share information, advanced technological systems cannot achieve their full potential. Outlines how organizations can rebuild their information cultures, integrating human flexibility and disorder into information systems and changing employee behavior. (JOW)

  15. Embodying the Global Soul: Internationalism and the American Evangelical Left

    Directory of Open Access Journals (Sweden)

    David R. Swartz

    2012-09-01

    Full Text Available In the last half of the twentieth century, neo-evangelicalism moved from an anticommunist nationalist consensus to a new internationalism characterized by concern for human rights, justice, and economic development. Case studies of World Vision, a global relief and development organization, and InterVarsity Christian Fellowship, a campus ministry, demonstrate that this trajectory was due in part to a growing global reflex in which many missionaries and third-world evangelicals “spoke back” to American evangelicalism. Interpreting the Bible for themselves—and increasingly for American evangelicals—substantial numbers of non-Western converts and missionaries offered sharp criticisms of American politics, culture, and capitalism. These critiques, sacralized by their origins on the mission field, helped turn some young evangelicals toward Vietnam protests, poverty relief, civil rights, and a tempered nationalism. By the 1970s, these progressive elements—and a more resolute global concern generally—had become important markers of the evangelical left.

  16. The Apoptosome: Heart and Soul of the Cell Death Machine

    Directory of Open Access Journals (Sweden)

    Arul M. Chinnaiyan

    1999-04-01

    Full Text Available Apoptosis is a fundamental biologic process by which metazoan cells orchestrate their own self-demise. Genetic analyses of the nematode C elegans identified three core components of the suicide apparatus which include CED-3, CED-4, and CED-9. An analogous set of core constituents exists in mammalian cells and includes caspase-9, Apaf-1, and bcl-2/xL, respectively. CED-3 and CED-4, along with their mammalian counterparts, function to kill cells, whereas CED-9 and its mammalian equivalents protect cells from death. These central components biochemically intermingle in a ternary complex recently dubbed the “apoptosome.” The C elegans protein EGL-1 and its mammalian counterparts, pro-apoptotic members of the bcl-2 family, induce cell death by disrupting apoptosome interactions. Thus, EGL-1 may represent a primordial signal integrator for the apoptosome. Various biochemical processes including oligomerization, adenosine triphosphate ATP/dATP binding, and cytochrome c interaction play a role in regulating the ternary death complex. Recent studies suggest that cell death receptors, such as CD95, may amplify their suicide signal by activating the apoptosome. These mutual associations by core components of the suicide apparatus provide a molecular framework in which diverse death signals likely interface. Understanding the apoptosome and its cellular connections will facilitate the design of novel therapeutic strategies for cancer and other disease states in which apoptosis plays a pivotal role.

  17. Searching the Soul: Veterans and Their Arts and Crafts

    Science.gov (United States)

    Hasio, Cindy

    2011-01-01

    For military veterans suffering from the long-term trauma of warfare, arts and crafts become much more than the fabrication of relics; they can literally save the spirit. Dialogue and interaction between the veterans, volunteers, and staff are crucial to the success of veterans' arts and crafts program. The purpose of this research was threefold.…

  18. Modeling the Soul Surface Seal from a Filtration Perspective

    Directory of Open Access Journals (Sweden)

    N.M. Somaratne

    1998-01-01

    Full Text Available A physically based model of soil surface scaling is proposed. The governing equations are formulated on the principle of conservation of mass assuming Darcy's law applies to suspension flowing through the soil surface. The model incorporates the physics of surface sealing by mechanisms that capture suspended particles moving with infiltrating water. As a result of particle retention in the soil system, the intrinsic porosity is reduced and hulk density is increased, resulting in changes to soil hydraulic properties such as moisture retention and hydraulic conductivity. Empirical functions are developed to describe the changes of these properties as the seal develops. With this approach, the seal can be mathematically described by well defined initial and boundary conditions and transient seal properties can be simulated in a physically realistic manner.

  19. Savera Kalideen, senior Advocacy Manager for Soul City

    African Journals Online (AJOL)

    our strategy and have focused on media work, through our television ... how to engage in the formation of policy and law through developing .... change policy. It also seems that this is the fate of many violence prevention initiatives. Do you think that donors and the state are sufficiently aware of the importance of these kinds ...

  20. "Almost Like Weighing Someone's Soul": Chemistry in Contemporary Film

    Science.gov (United States)

    Wink, Donald J.

    2001-04-01

    Students approaching a chemistry course for the first time do have previous experience with the discipline, at the very least from images in popular media. This paper discusses examples of images from films that can be used to start discussions in general chemistry classes. The examples include scenes from realistic films (i.e., not science fiction) where chemical substances are an important element in a scene or where chemistry is presented as a topic of discussion. The scenes illustrate some of the ways in which people, including students, may think about science.

  1. The metaphysics market - selling language as soul | Botha ...

    African Journals Online (AJOL)

    AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News. OTHER RESOURCES... for Researchers · for Journals · for Authors · for Policy Makers · about Open Access · Journal Quality.

  2. Man is a Puppet, Soul is a Rat

    DEFF Research Database (Denmark)

    Rösing, Lilian Munk

    2015-01-01

    Ratatouille is the Pixar film that seems to have the most imaginative answer to the question, what animates the human being? A small rat hidden under the hat, directing man as a puppet. The marionette as a metaphor for the human being is not new in the Western history of thought, but the rat as a...... as the true love story between the rat and the culinary critic, illustrating Lacan’s dictum: “Love is to give something you do not have to someone who does not want it.”...

  3. What Will It Be? Reading or Machismo and Soul?

    Science.gov (United States)

    Vail, Edward O.

    1970-01-01

    Children in American schools should be taught to read and write standard English since any attempt to teach them a local dialect or a foreign language will only handicap them when they enter the adult world of work. (CK)

  4. Embodiments of Public Pedagogy: The Art of Soulful Resistance

    Science.gov (United States)

    Darder, Antonia

    2011-01-01

    This article provides a space to explore, through artistic representations and the words of artists themselves, the manner in which politically engaged artists use their visual art, poetry, music, dance, and theatre performances as an effective tool for public pedagogy. In turn, these artists provide those who enter into their cultural production…

  5. The soul of the machine: continual improvement in ISO 14001

    NARCIS (Netherlands)

    Brouwer, M.A.C.; van Koppen, C.S.A.|info:eu-repo/dai/nl/166978841

    2008-01-01

    Continual improvement is a key component of ISO 14001, but in contrast to most other specifications in the standard, it is difficult to assess. Based on interviews with 19 certified companies in the chemical, food, and environmental services sectors, this article explores the dynamics of continual

  6. The soul of the machine: continual improvement in ISO 14001.

    NARCIS (Netherlands)

    Brouwer, M.A.C.; Koppen, van C.S.A.

    2008-01-01

    Continual improvement is a key component of ISO 14001, but in contrast to most other specifications in the standard, it is difficult to assess. Based on interviews with 19 certified companies in the chemical, food, and environmental services sectors, this article explores the dynamics of continual

  7. Confucianism and Qualitative Interviewing: Working Seoul to Soul

    Directory of Open Access Journals (Sweden)

    Sunghee Park

    2015-03-01

    Full Text Available With the internationalization of higher education, research settings and researcher backgrounds are becoming increasingly complex, further complicating disciplinary assumptions, traditions and techniques. This article highlights key practical and conceptual issues that arose during planning fieldwork, fieldwork conduct, subsequent analysis and writing up of a qualitative study carried out within a Confucian setting. Drawing on the experience with a detailed research study of a pay for performance scheme (involving 31 in-depth interviews undertaken by a South Korean researcher, this article explores conceptual and practical issues that emerged between Anglophone methods and countries with a Confucian heritage. It is discussed how processes of sampling/recruitment, ethics, fieldwork conduct (including insider relations, power hierarchies, and translation are complicated in such settings. The article seeks to expand our understandings of qualitative research vis-à-vis contemporary Confucian cultures, something which has previously not been well addressed and which is part of the ongoing project of "globalizing qualitative research." URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs150274

  8. Souls in Jeopardy: Questions and Innovations for Bibliotherapy with Fiction

    Science.gov (United States)

    Detrixhe, Jonathan J.

    2010-01-01

    How is bibliotherapy with fiction hypothesized to work, and what are the ideal conditions for treatment success? Patterns in the bibliotherapy literature are explored. Questions are posed and suggestions offered regarding the practice of bibliotherapy with fiction.

  9. Soul, butterfly, mythological nymph: psyche in philosophy and neuroscience

    Directory of Open Access Journals (Sweden)

    Elena I. Antonakou

    Full Text Available ABSTRACT The term “psyche” and its derivatives – including “Psychology” and “Psychiatry” – are rooted in classical philosophy and in mythology. Over the centuries, psyche has been the subject of discourse and contemplation, and of fable; it has also come to signify, in entomology, the order of Lepidoptera. In the current surge of research on brain and mind, there is a gradual transition from the psyche (or the “soul” to the specified descriptors defined by the fields of Behavioral, Cognitive and Integrative Neuroscience.

  10. Baring the soul: Paul Bindrim, Abraham Maslow and 'nude psychotherapy'.

    Science.gov (United States)

    Nicholson, Ian

    2007-01-01

    Nude psychotherapy is one of the most flamboyant therapeutic techniques ever developed in American psychology. Largely forgotten today, the therapy was an academic and popular sensation upon its introduction in 1967. Developed by psychologist Paul Bindrim, the therapy promised to guide clients to their authentic selves through the systematic removal of clothing. This paper explores the intellectual, cultural and ethical context of nude therapy and its significance as a form of unchurched spirituality. Although nude therapy has an indisputable tabloid character, it is also rooted in a long-standing academic search for authenticity and ultimate meaning through science. Bindrim's career demonstrates the historically long-standing interweaving of spirituality and science within American psychology while simultaneously highlighting the field's extraordinary capacity for adaptive reinvention.

  11. Buying Back Your Soul: Restoring Ideals in Social Studies Teaching.

    Science.gov (United States)

    Sears, Alan

    1992-01-01

    Discusses problem of socialization to school environment. Explains that the process can have a negative impact on teachers' attitudes toward social studies teaching and can result in noncreative teaching. Recommends methods for retaining the ideals learned in education courses. Suggests doing things in manageable steps, reserving time for…

  12. Success through Dancing: Teaching Skills and Awakening Young Souls

    Science.gov (United States)

    Miles, Tara

    2017-01-01

    Dance is important for all students, but it is especially important for deaf and hard of hearing students. Dance is visual, and students can learn to dance without barriers. Teaching dance to deaf and hard of hearing children allows them to have the same kind of experiences as those of hearing children. It allows them to be open to taking risks,…

  13. Kepler's cosmological synthesis astrology, mechanism and the soul

    CERN Document Server

    Boner, Patrick J

    2013-01-01

    Spanning the course of his career, this book brings new light to Kepler's vitalistic views and their central place in his world picture. It challenges our view of Kepler as a nascent mechanical philosopher who fell back on an older form of physics.

  14. Finding Soul: Voice and Visibility for Youth | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    These are the kind of concerns the young people express in their music. IDRC : Has the project had an impact on government policy toward youth in Brazil? Grzybowski: In a new program, the government provides grants for youth to continue their studies at the university level — there are maybe 200 000 young people ...

  15. A very large soul: selected letters from Margaret Laurence to Canadian writers A very large soul: selected letters from Margaret Laurence to Canadian writers

    Directory of Open Access Journals (Sweden)

    John J. O'Connor

    2008-04-01

    Full Text Available “This will be a brief letter, as I have a horrifying stack of business letters to catch up on,” wrote Margaret Laurence to her friend and fellow novelist Gabrielle Roy in 1978, echoing an earlier lament to her epistolary friend Ernest Buckler about the need to “keep pace with the ghastly flow of business correspondence.” Although she was always to face some tension between her personal and professional selves as correspondent, her priority was never in question: “Must go. I have 70 letters to reply to, having got far behind in correspondence ... am trying now to communicate once again with dear friends first, and then to answer all the others, which will no doubt be my winter project” (4 Sept. 1974 letter to Silver Donald Cameron. “This will be a brief letter, as I have a horrifying stack of business letters to catch up on,” wrote Margaret Laurence to her friend and fellow novelist Gabrielle Roy in 1978, echoing an earlier lament to her epistolary friend Ernest Buckler about the need to “keep pace with the ghastly flow of business correspondence.” Although she was always to face some tension between her personal and professional selves as correspondent, her priority was never in question: “Must go. I have 70 letters to reply to, having got far behind in correspondence ... am trying now to communicate once again with dear friends first, and then to answer all the others, which will no doubt be my winter project” (4 Sept. 1974 letter to Silver Donald Cameron.

  16. Õiguspärane sundvõõrandamine rahvusvahelises õiguses ning maagaasiseaduse ja majandustegevuse seadustiku üldosa seaduse muutmise seaduse eelnõus : [magistritöö] / Kristjan Kotkas ; Tartu Ülikool, õigusteaduskond ; juhendaja: Maarja Torga

    Index Scriptorium Estoniae

    Kotkas, Kristjan

    2012-01-01

    Sundvõõrandamisest ja selle lubatavusest rahvusvahelises õiguses, eelnõus toodud meetmete analüüsist rahvusvahelise õiguse taustal, õiguspärase sundvõõrandamise tingimuste olemasolust eelnõus

  17. Õiguspärane ja õigusvastane piinamine ius commune kriminaalprotsessis / Peter Oestmann ; tõlkinud Astri Schönfelder, tõlget konsulteeris Marju Luts-Sootak

    Index Scriptorium Estoniae

    Oestmann, Peter

    2012-01-01

    Piinamise õigusajaloolisest käsitlusest 16. sajandist alates. Piinamise normatiivse reguleerimise kolmest astmest. Artikkel põhineb autori saksakeelsel ettekandel "Rechtmäβige und rechtswidrige Folter im gemeinen Strafprozeβ" Tartus 27. veebruaril 2009

  18. Cold Sore, Cold Soul? An Examination of Orolabial Herpes in Film

    Directory of Open Access Journals (Sweden)

    Alex C. HOLLIDAY

    2016-04-01

    Full Text Available The sociocultural phenomenon of herpes is attributed to two strains of the herpes simplex virus: herpes simplex virus type 1 (HSV-1 causes orolabial cold sores while herpes simplex virus type 2 (HSV-2 is typically identified in genital lesions, though both viruses may cause clinically similar signs and symptoms anywhere in or on the body. While these infections are extremely prevalent and typically benign, media sources such as film have perpetuated a negative public perception of the disease. Thus, a large portion of society continues to associate these conditions with sexual misconduct and moral failing. Despite decades of available antiviral therapy to shorten and suppress outbreaks, movies continue to exploit herpes for degradation and for humor. Portrayal of genital herpes in films is avoided in order to avert unnecessary and grotesque nude scenes, so depictions of cold sores are preferred. This article analyzes the use of orolabial herpes lesions in selected English language films released from 1984-2012.

  19. Are Eyes a Mirror of the Soul? What Eye Wrinkles Reveal about a Horse's Emotional State.

    Science.gov (United States)

    Hintze, Sara; Smith, Samantha; Patt, Antonia; Bachmann, Iris; Würbel, Hanno

    2016-01-01

    Finding valid indicators of emotional states is one of the biggest challenges in animal welfare science. Here, we investigated in horses whether variation in the expression of eye wrinkles caused by contraction of the inner eyebrow raiser reflects emotional valence. By confronting horses with positive and negative conditions, we aimed to induce positive and negative emotional states, hypothesising that positive emotions would reduce whereas negative emotions would increase eye wrinkle expression. Sixteen horses were individually exposed in a balanced order to two positive (grooming, food anticipation) and two negative conditions (food competition, waving a plastic bag). Each condition lasted for 60 seconds and was preceded by a 60 second control phase. Throughout both phases, pictures of the eyes were taken, and for each horse four pictures per condition and phase were randomly selected. Pictures were scored in random order and by two experimenters blind to condition and phase for six outcome measures: qualitative impression, eyelid shape, markedness of the wrinkles, presence of eye white, number of wrinkles, and the angle between the line through the eyeball and the highest wrinkle. The angle decreased during grooming and increased during food competition compared to control phases, whereas the two phases did not differ during food anticipation and the plastic bag condition. No effects on the other outcome measures were detected. Taken together, we have defined a set of measures to assess eye wrinkle expression reliably, of which one measure was affected by the conditions the horses were exposed to. Variation in eye wrinkle expression might provide valuable information on horse welfare but further validation of specific measures across different conditions is needed.

  20. Strategy and Sociability: The Mind, the Body, and the Soul of Chess

    Science.gov (United States)

    Fine, Gary Alan

    2014-01-01

    Chess is a game of minds, bodies, and emotions. Most players recognize each of these as essential to playful competition, and all three are embedded in social relations. Thus chess, despite its reputation as a game of the mind, is not only a deeply thoughtful exercise, but also a test of physical endurance and strong emotions in its joys and…

  1. Meno the Politikos. Politics and Unity of the Soul in Plato’s Meno

    OpenAIRE

    Sergio Ariza

    2012-01-01

    Se analizan algunos usos del tópico de la política en el Menón, para mostrar que la virtud discutida es política, no sólo porque los interlocutores están interesados exclusivamente en la cualidad que debe poseer el gobernante, sino también porque tal cualidad consiste en una forma de autogobierno del alma. El alma es vista así como una entidad política cuya excelencia depende del tipo de gobierno impuesto. Se relaciona esta propuesta con la psicología implícita en la primera sección del diál...

  2. Meno the Politikos. Politics and Unity of the Soul in Plato’s Meno

    Directory of Open Access Journals (Sweden)

    Sergio Ariza

    2012-08-01

    Full Text Available Se analizan algunos usos del tópico de la política en el Menón, para mostrar que la virtud discutida es política, no sólo porque los interlocutores están interesados exclusivamente en la cualidad que debe poseer el gobernante, sino también porque tal cualidad consiste en una forma de autogobierno del alma. El alma es vista así como una entidad política cuya excelencia depende del tipo de gobierno impuesto. Se relaciona esta propuesta con la psicología implícita en la primera sección del diálogo, en la que se discute la unidad de la virtud. El Menón se muestra así como un diálogo que prefigura la analogía de alma y polis expuesta en la República.

  3. Injured body, injured soul? Predicting and preventing posttraumatic stress disorder after injury

    NARCIS (Netherlands)

    Mouthaan, J.

    2014-01-01

    Traumatic injury is common and may have a major impact on the survivor’s life. In the Netherlands alone, over 7 million injuries are registered yearly, caused by accidents in traffic, at home, at work, or by interpersonal violence. Besides physical recovery, survivors often deal with the

  4. Lewis Nkosi: A Fragile Soul's Quest for Home | Gall | English in Africa

    African Journals Online (AJOL)

    Lewis Nkosi left South Africa in 1961 on a permanent exit visa on his way to study at Harvard as a Nieman Fellow. During his seventy-three years, he lived in England, America, Zambia, Poland, and Switzerland, and he transitioned from denying homesickness (because he had no home) to feeling it acutely (because he had ...

  5. Helping the Soul: The Relationship between Connectivity and Well-Being within a Church Community

    Science.gov (United States)

    Obst, Patricia; Tham, Naomi

    2009-01-01

    Although previous research attests to the importance of psychological sense of community (PSOC) to individuals' well-being, little research has examined this relationship for the four proposed dimensions of PSOC: membership, influence, integration and fulfillment of needs, and shared emotional connection (McMillan & Chavis, 1986). Further,…

  6. A Community of Curious Souls: An Analysis of Commenting Behavior on TED Talks Videos

    Science.gov (United States)

    Tsou, Andrew; Thelwall, Mike; Mongeon, Philippe; Sugimoto, Cassidy R.

    2014-01-01

    The TED (Technology, Entertainment, Design) Talks website hosts video recordings of various experts, celebrities, academics, and others who discuss their topics of expertise. Funded by advertising and members but provided free online, TED Talks have been viewed over a billion times and are a science communication phenomenon. Although the organization has been derided for its populist slant and emphasis on entertainment value, no previous research has assessed audience reactions in order to determine the degree to which presenter characteristics and platform affect the reception of a video. This article addresses this issue via a content analysis of comments left on both the TED website and the YouTube platform (on which TED Talks videos are also posted). It was found that commenters were more likely to discuss the characteristics of a presenter on YouTube, whereas commenters tended to engage with the talk content on the TED website. In addition, people tended to be more emotional when the speaker was a woman (by leaving comments that were either positive or negative). The results can inform future efforts to popularize science amongst the public, as well as to provide insights for those looking to disseminate information via Internet videos. PMID:24718634

  7. Soul, mind and brain in pre-history and early human civilizations

    OpenAIRE

    Fabiano dos Santos Castro; Landeira-Fernandez, J.

    2010-01-01

    Atualmente, o debate sobre a natureza da mente humana vem tomando novos rumos graças ao desenvolvimento de diversos estudos, no campo das neurociências, que investigam a localização das funções cerebrais. Esses trabalhos vêm contribuindo para uma melhor compreensão dos substratos neurais das funções mentais, bem como da etiologia de diversos transtornos mentais. Entretanto, o conhecimento acumulado pela neurociência não ocorreu de forma súbita. Na verdade, o estudo das relações entre o cérebr...

  8. Conspiring in Dreams: between Misdeeds and saving one’s Soul

    OpenAIRE

    Neyra, Andrea Vanina

    2016-01-01

    Thietmar of Merseburg was not an example of a virtuous, pious ecclesiastic; rather, he more closely exemplified an Amtsbischof and mentally anguished sinner. In the last book of his Chronicle, he narrates a dream in which he finds himself surrounded by a hostile crowd that incites him to consume a suspicious and peculiar drink: allegedly, it causes him to feel unpleasant sensations while performing his duties. Thietmar believes this apparition is the result of his sinful weakne...

  9. The body, "prison of the soul", and nation building in "Soledad" by Soledad Acosta de Samper

    Directory of Open Access Journals (Sweden)

    Sandra Leal Larrarte

    2015-12-01

    Full Text Available One of those novels from which little is known in the world of Colombian literature is “Dolores” (1887. Written at a time when women “did not write”, in which also the recently won freedom forced intellectuals in the region to create nation, their imaginary and their identity. To this join effort is added, the almost aristocratic writer and journalist Soledad Acosta de Samper, who, without forgetting her duty as a voice for women, presents a story proper of the romanticism that prevailed in her days. Here is analyzed how in “Dolores” the body is presented as a symbol of the strict social hierarchies in which the fledgling republic was organized, but also the sick body as a symbol of women’s isolation and the only resource of personal development in which it was wanted, and still is, to confine women.

  10. New Turkish Cinema-Some Remarks on the Homesickness of the Turkish Soul

    National Research Council Canada - National Science Library

    Kaim, Agnieszka Aysen

    2011-01-01

    ... as “homeland movies”. They paint the portrait of a Turkish middle class intellectual on the horns of a dilemma, the search for a modern identity and a place to belong in a modern world where values are constantly shifting.

  11. Jewish Education in the Age of the Rediscovery of the Soul

    Science.gov (United States)

    Yares, Laura

    2016-01-01

    The literature on Reform Jewish education in America rightly recognizes Emanuel Gamoran's work in establishing the direction of Hebrew schools in the Reform movement toward a cultural pluralism influenced by Samson Benderley et al. Yet the terrain onto which Gamoran stepped was not unmarked. Prior to his tenure, three Reform rabbis thought hard…

  12. "WHERE SOULS ARE FORGOTTEN" : Cultural Competencies, Forensic Evaluations, and International Human Rights

    NARCIS (Netherlands)

    Perlin, Michael L.; McClain, Valerie

    2009-01-01

    Cultural competency is critical in criminal forensic evaluations. Cultural competency eschews reliance on stereotypes, precluding the mistake of assuming that cultural dictates apply with equal force to all who share a cultural background, thus allowing the forensic examiner to provide a

  13. Music Chills: The Eye Pupil as a Window to the Soul of Music

    OpenAIRE

    Eidet, Lise Mette

    2015-01-01

    Strong emotional and bodily experiences with music are a very complex phenomenon that may be best observed in terms of the involuntary bodily reactions that can accompany strong musical experiences. Based on the relationship between the activation of noradrenaline (NE) and changes in pupil size, there is a theoretical ground for studying pupillary reactions when experiencing music chills. In the present study, participants listened to self-chosen songs versus control songs chosen by the other...

  14. Baring Skills, Not Soul: Carol Ann Duffy’s Intertextual Games

    Directory of Open Access Journals (Sweden)

    Catherine LANONE

    2008-10-01

    Full Text Available Maîtrisant à merveille la contre-interpellation ludique dans The World’s Wife, Carol Ann Duffy  est réputée pour ses jeux intertextuels et ses réécritures féministes des grands mythes, donnant la parole aux figures féminines que l’histoire effaçait pour faire triompher le féminin et rire du masculin. Mais son recueil Rapture, publié en 2005, s’écarte radicalement du modèle féministe pour tenter une appropriation plus discrète de la tradition pétrarquisante de la poésie amoureuse. Resémiotisant les clichés, jouant sur une simplicité incantatoire, Duffy pratique ici l’écho plutôt que la réécriture, dans un dépouillement sensuel, explorant amour puis désamour au rythme d’une poésie qui emprunte au jazz ses variations fluides ou syncopées.

  15. Are Eyes a Mirror of the Soul? What Eye Wrinkles Reveal about a Horse's Emotional State.

    Directory of Open Access Journals (Sweden)

    Sara Hintze

    Full Text Available Finding valid indicators of emotional states is one of the biggest challenges in animal welfare science. Here, we investigated in horses whether variation in the expression of eye wrinkles caused by contraction of the inner eyebrow raiser reflects emotional valence. By confronting horses with positive and negative conditions, we aimed to induce positive and negative emotional states, hypothesising that positive emotions would reduce whereas negative emotions would increase eye wrinkle expression. Sixteen horses were individually exposed in a balanced order to two positive (grooming, food anticipation and two negative conditions (food competition, waving a plastic bag. Each condition lasted for 60 seconds and was preceded by a 60 second control phase. Throughout both phases, pictures of the eyes were taken, and for each horse four pictures per condition and phase were randomly selected. Pictures were scored in random order and by two experimenters blind to condition and phase for six outcome measures: qualitative impression, eyelid shape, markedness of the wrinkles, presence of eye white, number of wrinkles, and the angle between the line through the eyeball and the highest wrinkle. The angle decreased during grooming and increased during food competition compared to control phases, whereas the two phases did not differ during food anticipation and the plastic bag condition. No effects on the other outcome measures were detected. Taken together, we have defined a set of measures to assess eye wrinkle expression reliably, of which one measure was affected by the conditions the horses were exposed to. Variation in eye wrinkle expression might provide valuable information on horse welfare but further validation of specific measures across different conditions is needed.

  16. Chicken soup really is good for the soul: "comfort food" fulfills the need to belong.

    Science.gov (United States)

    Troisi, Jordan D; Gabriel, Shira

    2011-06-01

    Theories of social surrogacy and embodied cognition assume that cognitive associations with nonhuman stimuli can be affectively charged. In the current research, we examined whether the "comfort" of comfort foods comes from affective associations with relationships. Two experiments support the hypotheses that comfort foods are associated with relationships and alleviate loneliness. Experiment 1 found that the consumption of comfort foods automatically activates relationship-related concepts. Experiment 2 found that comfort foods buffer against belongingness threats in people who already have positive associations with relationships (i.e., are secure in attachment style). Implications for social surrogacy, need to belong, embodied cognition, and eating behavior are discussed.

  17. "Two souls" leadership: dynamic interplay of Ubuntu, Western and New Testament leadership values

    OpenAIRE

    2010-01-01

    D.Litt. et Phil. The post-1994 South African society has become humanistic, pluralistic and tolerant. The era is characterised by a call and commitment to build a non–racial, non–sexist, and non–discriminatory society enshrined in the constitution of the Republic of South Africa. These conditions challenge African evangelical leaders to minister the gospel without losing their faith and cultural identity. They also provide such leaders with an opportunity to effectively minister the gospel...

  18. Towards Behaviorly Realistic Simulations of the Stock Market Traders with a Soul

    CERN Document Server

    Solomon, S

    1999-01-01

    The price fluctuations in the financial markets are the result of the individual operations by many individual investors. However for many decades the finacial theory did not use directly this "microscopic representation". The difficulties preventing it were multiple but the main two are being solved recently with the advent of modern computer technology: - massive detailed data on the individual market operations became available. - "microscopic simulations" of the stock markets in terms of their individual participating agents allow a very realistic treatment of the problem. Consequently, we are now able to confront real market data with the results of simulating "microscopic" realistic models which include any desired features in the investors behavior: departures from rationality, herding effects, heterogenous investor-specific trading strategies etc. In this way we propose to understand, explain and may be predict the macroscopic market behavior.

  19. New Turkish Cinema – Some Remarks On The Homesickness Of The Turkish Soul

    Directory of Open Access Journals (Sweden)

    Agnieszka Ayşen Kaim

    2011-10-01

    Full Text Available Contemporary cinematography reflects the dualism in modern Turkish society. The heart of every inhabitant of Anatolia is dominated by homesickness for his little homeland. This overpowering feeling affects common people migrating in search of work as well as intellectuals for whom Istanbul is a place for their artistic development but not the place of origin. The city and “the rest” have been considered in opposition to each other. The struggle between “the provincial” and “the urban” has even created its own film genre in Turkish cinematography described as “homeland movies”. They paint the portrait of a Turkish middle class intellectual on the horns of a dilemma, the search for a modern identity and a place to belong in a modern world where values are constantly shifting.

  20. In Search of a Soul of Relevance for European Management Research

    DEFF Research Database (Denmark)

    Hernes, Tor

    2014-01-01

    The argument is made that contemporary management research is driven by misplaced scientific ideals that keep research at a distance from managerial practice. Misplaced scientific ideals are institutionally reinforced, and therefore hard to change. To provide a viable alternative a different ‘sou...

  1. When still waters become a soul tsunami: using the Tidal Model to recover from shipwreck.

    Science.gov (United States)

    Kilmer, Debra L; Lane-Tillerson, Crystal

    2013-01-01

    The Tidal model, created by Phil Barker and Poppy Buchanan-Barker, metaphorically employs the natural resource of water to describe the person in crisis and offer a model toward recovery. The model, a midrange nursing theory used primarily in mental health settings, is applied to a women in crisis related to failed infertility treatment who attempts suicide.

  2. “Spirit or soul at work”: Myth or dependable reality

    Directory of Open Access Journals (Sweden)

    George, B.M.

    2013-03-01

    Full Text Available This text examined extant literature on the socio-psychological construct of “spirit at work”, for organization-man, popularized as workplace spirituality to ascertain its dependable reality or otherwise. The paper critically reviews various scholars’ views regarding work-place spirituality by giving deep insight into the theoretical underpinnings of spirituality and distinguishing between spirituality and religion. The review of literature makes the following expositions: first, two main theoretical perspectives namely: the intrinsic-origin view (inner search for meaning and the existential perspective (search for meaningful life and values, give rise to the hybridized perspective that conceptualizes spirituality on the dimensions of self- transcendence, interconnectedness, sense of purpose, and ultimate concern. The other perspective is the ambit that views spirituality through the lens of spirituality leadership for spiritual survival in the leadership and followership continuum. Second, a distinction between spirituality and religion was made. However, the point of emphasis is that the two concepts are interrelated and complimentary in nature; thirdly, Spirit at work manifests as a result of the interactions of personal and integrated factors. Finally, an avalanche of empirical-based individual (micro and organizational (macro level benefits associated with the construct were extensively examined and highlighted. In view of the foregoing therefore, we are inclined to infer that spirit at work appears a dependable reality. Some review implications are presented.

  3. Beauty is in the soul of the beholder: psychological implications of beauty and African American women.

    Science.gov (United States)

    Hall, C C

    1995-01-01

    The criteria for beauty in the United States are primarily based on Caucasian European American, middle-class standards. African American women tend to vary greatly from these criteria. Though very few studies have been conducted on the body image of Black women in the United States, historically, the physical images portrayed of African American women in the United States have not been positive. Mental health practitioners must understand how these negative images may affect the body image and self-esteem of African American women. Therapeutic and community interventions are discussed.

  4. A community of curious souls: an analysis of commenting behavior on TED talks videos

    National Research Council Canada - National Science Library

    Tsou, Andrew; Thelwall, Mike; Mongeon, Philippe; Sugimoto, Cassidy R

    2014-01-01

    ... to which presenter characteristics and platform affect the reception of a video. This article addresses this issue via a content analysis of comments left on both the TED website and the YouTube platform...

  5. Battling for the Soul of Education: Moving beyond School Reform to Educational Transformation

    Science.gov (United States)

    Abbott, John

    2015-01-01

    John Abbott is seeking a revolution in education that will put learning back into the hands of the learner. He writes of the learner needing to be free-ranging and weaned from instruction. He is the director of a new wave of thinkers who are members of The 21st Century Learning Initiative, which places emphasis on the skills of critical thinking,…

  6. Uncertainty Einstein, Heisenberg, Bohr, and the struggle for the soul of science

    CERN Document Server

    Lindley, David

    2007-01-01

    The uncertainty in this delightful book refers to Heisenberg's Uncertainty Principle, an idea first postulated in 1927 by physicist Werner Heisenberg in his attempt to make sense out of the developing field of quantum mechanics. As Lindley so well explains it, the concept of uncertainty shook the philosophical underpinnings of science. It was Heisenberg's work that, to a great extent, kept Einstein from accepting quantum mechanics as a full explanation for physical reality. Similarly, it was the Uncertainty Principle that demonstrated the limits of scientific investigation: if Heisenberg is correct there are some aspects of the physical universe that are to remain beyond the reach of scientists. As he has done expertly in books like Boltzmann's Atom, Lindley brings to life a critical period in the history of science, explaining complex issues to the general reader, presenting the major players in an engaging fashion, delving into the process of scientific discovery and discussing the interaction between scien...

  7. "Tonalism": Name, Soul, Destiny and Identity Determined by the 260-Day Calendar in Mesoamerica

    Directory of Open Access Journals (Sweden)

    Lars Kirkhusmo Pharo

    2012-08-01

    Full Text Available In various Mesoamerican cultures, i.e. civilisations of Middle America, a calendar name is part of the antroponym. Besides having conventional personal names, both human beings and deities carry day-names from the 260-day calendar. In addition, world ages or world periods, periods of the traditional 365-day calendar and the 52-year calendar as well as the cardinal directions of the quadripartite world were categorised by day-names of the 260-day calendar. Thus not only human and divine beings but also space and time received designations from this calendar. Moreover, this onomastic practice of giving personal names from day signs of the 260-day calendar - called "tonalism" (from Nahuatl - is related to the Mesoamerican concepts of destiny and to what is known in history of religions as the "freesoul". Consequently, this anthropnymic tradition provides identity to human, divine beings and spatial-temporal phenomena.

  8. Body or soul: representing lesbians in post-soviet Russian culture.

    Science.gov (United States)

    Baer, Brian James

    2011-01-01

    This article examines representations of lesbians in contemporary Russian literature and film as expressions of a host of post-Soviet anxieties over the social, political, and economic turmoil following the fall of communism. In particular, the author examines three recurrent motifs: the lesbian as narcissist; the lesbian as prostitute; and the lesbian as predator. While many authors and filmmakers present these qualities as a threat to the (patriarchal) social order, others celebrate those very attributes as a liberating alternative to the narrow roles traditionally available to Russian women, which stress their qualities of maternal love and self-sacrifice.

  9. Logo in Mainstream Schools: The Struggle Over the Soul of an Educational Innovation.

    Science.gov (United States)

    Agalianos, Angelos; Noss, Richard; Whitty, Geoff

    2001-01-01

    Discusses Logo, an education philosophy and accompanying family of programming languages. Explores Logo in the institutional and organizational cultures of United States and United Kingdom mainstream schools after its introduction in the early 1980s. Addresses how Logo was received in the educational arena and implicated in the politics of…

  10. A soul of truth in things erroneous: Popper's "amateurish" evolutionary philosophy in light of contemporary biology.

    Science.gov (United States)

    Vecchi, Davide; Baravalle, Lorenzo

    2015-01-01

    This paper will critically assess Popper's evolutionary philosophy. There exists a rich literature on the topic with which we have many reservations. We believe that Popper's evolutionary philosophy should be assessed in light of the intriguing theoretical insights offered, during the last 10 years or so, by the philosophy of biology, evolutionary biology and molecular biology. We will argue that, when analysed in this manner, Popper's ideas concerning the nature of selection, Lamarckism and the theoretical limits of neo-Darwinism can be appreciated in their full biological and philosophical value.

  11. A home for body and soul: substance using women in recovery.

    Science.gov (United States)

    Kruk, Edward; Sandberg, Kathryn

    2013-12-20

    We report on an in-depth qualitative study of 28 active and former substance addicted women of low or marginal income on the core components of a harm reduction-based addiction recovery program. These women volunteered to be interviewed about their perceptions of their therapeutic needs in their transition from substance addiction to recovery. Data were gathered about women's experiences and essential needs in addiction recovery, what helped and what hindered their past efforts in recovery, and their views of what would constitute an effective woman-centred recovery program. The research was based upon the experience and knowledge of the women in interaction with their communities and with recovery programs. The study was informed by harm reduction practice principles that emphasize the importance of individual experience in knowledge construction, reduction of harm, low threshold access, and the development of a hierarchy of needs in regard to addiction recovery. Three core needs were identified by study participants: normalization and structure, biopsychosocial-spiritual safety, and social connection. What hindered recovery efforts as identified by participants was an inner urban location, prescriptive recovery, invidious treatment, lack of safety, distress-derived distraction, problem-focused treatment, coercive elements of mutual support groups, and social marginalization. What helped included connection in counselling and therapy, multidisciplinary service provision, spirituality focus, opportunities for learning and work, and a safe and flexible structure. Core components of an effective recovery program identified by women themselves stand in contrast to the views of service providers and policymakers, particularly in regard to the need for a rural location for residential programs, low threshold access, multidisciplinary service provision of conventional and complementary modalities and therapies for integrated healing, long-term multi-phase recovery, and variety and choice of programming. A key barrier to the addiction recovery of women is the present framework of addiction treatment, as well as current drug laws, policies and service delivery systems. The expectation of women is that harm reduction-based recovery services will facilitate safe, supportive transitioning from the point of the decision to access services, through independent living with community integration.

  12. Bohemia as the Homeland of the Soul in the Letters of Marina Tsvetaeva to Anna Teskova

    Directory of Open Access Journals (Sweden)

    Massimo Tria

    2014-03-01

    Full Text Available The article examines the letters sent by Marina Tsvetaeva to the translator and public figure Anna Teskova, who was one of the few poet’s Czech intimate friends, whom she met during her stay in Czechoslovakia (1922-1925. In the first part of the paper the Author focuses on the echoes of Prague and its culture in this specific correspondence, trying to ascertain to which extent Marina Tsvetaeva was acquainted with the cultural world she lived in: the lack of knowledge of the Czech language and the limited relationships with Prague intellectuals didn’t allow her to get a deep insight of the Czech cultural milieu. The textual analysis of the letters, though, on the basis of key concepts as “родной”, “родина”, “честь”, confirms the presence of a persistent feeling of Prague-homesickness in Tsvetaeva’s psycho- logical world, which brought her to develop an alternative model of Homeland, substitute to her native Russia and to Germany, which disappointed her after the rise of the Nazi Regime. Through this unique correspondence (including the first part of her Verses dedicated to Bohemia we gain the certainty that Tsvetaeva discovered in Prague and in the Czech lands an idealized model of a pacific, beautiful and faithful Homeland.

  13. Religious and spiritual issues in DSM-5: matters of the mind and searching of the soul.

    Science.gov (United States)

    Chandler, Emily

    2012-09-01

    Religion, spirituality, and psychiatric illnesses share a complex relationship in the realm of diagnosis. Historically, however, these three constructs have existed in a very peripheral place in the diagnostic taxonomy for psychiatry in the United States. Given the important role that spirituality and religion play for many people in the experiences of coping with health and illness, it seems odd that such important elements are in the margins of the powerful and commanding nosology of the DSM. Explanations for understanding the glaring absence are complex and impacted by some very powerful political and sociological forces, including contributory elements from within the mental health disciplines. This article invites the reader to explore salient issues in the emergence of a broader recognition of religion, spirituality and psychiatric diagnosis in the DSM-5.

  14. The Soul of Technology Education: Being Human in an Overly Rational World

    Science.gov (United States)

    Warner, Scott A.

    2009-01-01

    If technology education is to become a vital part of the general education curricula, it must recognize the importance of the humanistic aspects of teaching and learning. Warner states that to achieve this goal it will need to examine the story it wishes to tell. If educators choose the storyline written by Edward Thorndike then they will never be…

  15. The "soul" of language does not use statistics: reflections on vowels and consonants.

    Science.gov (United States)

    Mehler, Jacques; Peña, Marcela; Nespor, Marina; Bonatti, Luca

    2006-08-01

    This paper reviews studies of language processing with the aim of establishing whether any type of statistical information embedded in linguistic signals can be exploited by the language learner. The constraints as to the information that can be so used, we will argue, should be used to inform theories of language acquisition. We present two experiments with their respective controls. Both show that consonants (Cs) are much more suitable than vowels (Vs) to parse speech streams using statistical dependencies. These experiments use streams composed of items in which statistical information is carried either by the sequence of consonants or by the sequence of vowels. Both kinds of items are simultaneously present is the speech stream but, crucially, their overlap is only partial. Since the location of dips in transitional probabilities (TPs) between adjacent syllables differ for the first and the second type of sequences, we can explore whether consonants and vowels are equally efficient segments to parse signals. Our results show that "consonant words" (CW) are significantly preferred over "vowel words" (VW). We discuss the implication of our results for models of language acquisition.

  16. Experiences of encounters with ayahuasca--"the vine of the soul".

    Science.gov (United States)

    Kjellgren, Anette; Eriksson, Anders; Norlander, Torsten

    2009-12-01

    Ayahuasca is a psychoactive brew used by the indigenous populations of the Amazon. The aim of this qualitative study was to gain insight into the experiences of western users of ayahuasca, as well as to ascertain the experienced meaning that participants felt by their participation. Twenty-five people from Northern Europe with experiences of group sessions with ayahuasca wrote anonymous descriptions of their experiences. The Empirical Phenomenological Psychological method was used for this analysis. The analysis resulted in 33 categories which were assembled into six general themes: (a) motivation and aim, (b) contractile frightening state (c) sudden transformation of the experience, (d) limitless expansive states with transcendental experiences, (f) reflections, and (g) changed worldview and new orientation to life. These themes provided a new structure, called the transcendental circle. Participants reported many positive psychological and physical improvements that indicate that ayahuasca could be of potential interest in the development of new medicines and therapies.

  17. 78 FR 45918 - Application for Presidential Permit; Soule River Hydroelectric Project

    Science.gov (United States)

    2013-07-30

    ... comparable open access and non-discrimination that apply to transmission in interstate commerce. DOE has... non-discrimination contained in the Federal Power Act and articulated in Federal Energy Regulatory... person seeking to become a party to this proceeding must file a ] motion to intervene at the address...

  18. Teaching a Catholic Philosophy of Interpersonal Communication: The Case for "Soul Friendship"

    Science.gov (United States)

    Roberts, Kathleen Glenister

    2012-01-01

    While social justice education has a rich and ancient history within the Catholic Church, academic disciplines have only recently begun to make the idea of social justice relevant within courses for undergraduates. In the communication discipline, debate about social justice has been lively and varied over the last two decades, and has provided…

  19. A Community of Curious Souls: An Analysis of Commenting Behavior on TED Talks Videos

    OpenAIRE

    Andrew Tsou; Mike Thelwall; Philippe Mongeon; Sugimoto, Cassidy R.

    2014-01-01

    The TED (Technology, Entertainment, Design) Talks website hosts video recordings of various experts, celebrities, academics, and others who discuss their topics of expertise. Funded by advertising and members but provided free online, TED Talks have been viewed over a billion times and are a science communication phenomenon. Although the organization has been derided for its populist slant and emphasis on entertainment value, no previous research has assessed audience reactions in order to de...

  20. A community of curious souls: an analysis of commenting behavior on TED talks videos.

    Directory of Open Access Journals (Sweden)

    Andrew Tsou

    Full Text Available The TED (Technology, Entertainment, Design Talks website hosts video recordings of various experts, celebrities, academics, and others who discuss their topics of expertise. Funded by advertising and members but provided free online, TED Talks have been viewed over a billion times and are a science communication phenomenon. Although the organization has been derided for its populist slant and emphasis on entertainment value, no previous research has assessed audience reactions in order to determine the degree to which presenter characteristics and platform affect the reception of a video. This article addresses this issue via a content analysis of comments left on both the TED website and the YouTube platform (on which TED Talks videos are also posted. It was found that commenters were more likely to discuss the characteristics of a presenter on YouTube, whereas commenters tended to engage with the talk content on the TED website. In addition, people tended to be more emotional when the speaker was a woman (by leaving comments that were either positive or negative. The results can inform future efforts to popularize science amongst the public, as well as to provide insights for those looking to disseminate information via Internet videos.

  1. A community of curious souls: an analysis of commenting behavior on TED talks videos.

    Science.gov (United States)

    Tsou, Andrew; Thelwall, Mike; Mongeon, Philippe; Sugimoto, Cassidy R

    2014-01-01

    The TED (Technology, Entertainment, Design) Talks website hosts video recordings of various experts, celebrities, academics, and others who discuss their topics of expertise. Funded by advertising and members but provided free online, TED Talks have been viewed over a billion times and are a science communication phenomenon. Although the organization has been derided for its populist slant and emphasis on entertainment value, no previous research has assessed audience reactions in order to determine the degree to which presenter characteristics and platform affect the reception of a video. This article addresses this issue via a content analysis of comments left on both the TED website and the YouTube platform (on which TED Talks videos are also posted). It was found that commenters were more likely to discuss the characteristics of a presenter on YouTube, whereas commenters tended to engage with the talk content on the TED website. In addition, people tended to be more emotional when the speaker was a woman (by leaving comments that were either positive or negative). The results can inform future efforts to popularize science amongst the public, as well as to provide insights for those looking to disseminate information via Internet videos.

  2. Latinitas i Cyrillianitas. In Search of the Soul of Europe Latinitas i cyrillianitas. Poszukiwanie Duszy Europy

    Directory of Open Access Journals (Sweden)

    Aleksander Wojciech Mikołajczak

    2013-02-01

    Full Text Available This article illustrates the axiological-conceptual categories ofCyrillianitas and Latinitas, devised by the author in order to systematize the multiform and multilingual cultural legacy of the Slavic countries. Mikołajczak recalls the main interpretative categories of the Slavic cultural-historical legacy (Slavia Latina,Slavia Orthodoxa, Slavia Orientalis, Slavia Occidentalis, Slavia Romana, Slavia Christiana, Slavia Cyrillo-Methodiana: in the author’s opinion, the Cyrillo-Methodian tra- dition shows the inadequacy of the categorizing formulas that interpret culture only from the point of view of single confessional, ethnic or institutional determinants. According to Mikołajczak, it would be more appropriate to single out categories which, without claiming to embrace all the wealth of historical reality, may integrally bring together both, the cultural and the religious levels of that experience, and at the same time may take their distance from the model of the two opposed Slaviae. Such categories instead should take the point of view of the Cyrillo-Methodian oecumene as their own in order to find what unites the Slavic countries and binds them to Europe. Mikołajczak formulates these two categories as Latinitasand Cyrillianitas. While the former is not new in scholarly literature, the latter is understood by the author to includee not only the most ancient experience of Slavic Christianity before the schism and the definitive divergence of Rome and Constantinople, but also all the subsequent phenomena that define the logos and the ethos of the culture that has developed from the seeds sown by the two brothers from Thessaloniki.This article illustrates the axiological-conceptual categories of Cyrillianitas and Latinitas, devised by the author in order to systematize the multiform and multilingual cultural legacy of the Slavic countries. Mikołajczak recalls the main interpretative categories of the Slavic cultural-historical legacy (Slavia Latina, Slavia Orthodoxa, Slavia Orientalis, Slavia Occidentalis, Slavia Romana, Slavia Christiana, Slavia Cyrillo-Methodiana: in the author’s opinion, the Cyrillo-Methodian tra- dition shows the inadequacy of the categorizing formulas that interpret culture only from the point of view of single confessional, ethnic or institutional determinants. According to Mikołajczak, it would be more appropriate to single out categories which, without claiming to embrace all the wealth of historical reality, may integrally bring together both, the cultural and the religious levels of that experience, and at the same time may take their distance from the model of the two opposed Slaviae. Such categories instead should take the point of view of the Cyrillo-Methodian oecumene as their own in order to find what unites the Slavic countries and binds them to Europe. Mikołajczak formulates these two categories as Latinitas and Cyrillianitas. While the former is not new in scholarly literature, the latter is understood by the author to includee not only the most ancient experience of Slavic Christianity before the schism and the definitive divergence of Rome and Constantinople, but also all the subsequent phenomena that define the logos and the ethos of the culture that has developed from the seeds sown by the two brothers from Thessaloniki.

  3. Body and Soul: Do Children Distinguish between Foods When Generalizing Biological and Psychological Properties?

    Science.gov (United States)

    Thibaut, Jean-Pierre; Nguyen, Simone P.; Murphy, Gregory L.

    2016-01-01

    Research Findings: In 2 experiments, we tested whether children generalize psychological and biological properties to novel foods. We used an induction task in which a property (either biological or psychological) was associated with a target food. Children were then asked whether a taxonomically related and a script-related food would also have…

  4. Soul-Searching in Cyberspace: Christianity and New Age on the internet

    NARCIS (Netherlands)

    I.K. Noomen (Ineke); D. Houtman (Dick); S.D. Aupers (Stef)

    2006-01-01

    textabstractIn the last few decades the Internet has developed into an indispensable medium in the daily lives of most western people. Not surprisingly, also religious and spiritual groups use the Internet intensively to proclaim their beliefs and to get in contact with fellow believers. Yet, from

  5. Star Wars and the State of Our Souls. Special Issue. The Whole Earth Papers, No. 20.

    Science.gov (United States)

    Mische, Patricia M.

    These two essays are intended to make U.S. citizens think about what they are doing, to put contemplation before action when considering the "Star Wars" proposals, i.e., proposals for research, development, and testing of space weapons. It is emphasized that the "Star Wars" proposals offer no real breakthroughs in strengthening…

  6. The Soul of Leadership: African American Students' Experiences in Historically Black and Predominantly White Organizations

    Science.gov (United States)

    Hotchkins, Bryan K.

    2013-01-01

    This study addresses African American students' leadership experiences at predominantly White institutions. Findings indicated participants utilized servant leadership in historically Black organizations and transformational leadership in predominantly White organizations. The differences displayed showed that participants' leadership perceptions…

  7. Lost Soul or New Dawn? Lifelong Learning Lessons and Prospects from East Asia

    Science.gov (United States)

    Duke, Chris

    2015-01-01

    Most learning takes place in communities, neighbourhoods and workplaces. Here practical solutions to big problems work or fall down. We may call this the iron law of social learning, recognised in "community development", "community capacity-building", "workplace", "work-based" and…

  8. Timaios of Locri. On the nature of the world and the soul

    Directory of Open Access Journals (Sweden)

    Anna Afonasina

    2013-01-01

    Full Text Available In the seventieth of the last century interest to the pseudo-Pythagorean literature was relatively widespread among philologists. It was fuelled by the fact that these texts, written in the Hellenistic period and falsely ascribed to the Ancient Pythagoreans, were notable for their syncretism both in language and content. They posed difficult questions concerning their provenance and dating and, thanks to the efforts of such eminent scholars as H. Thesleff, W. Burkert, W. Marg, M. Baltes, and T. Szlezák, who had undertaken to place the Pythagorean pseudoepigrapha in the proper Hellenistic and Early Roman philosophical and literary context, for the first time entered the mainstream of contemporary classical studies. Still, despite the research accomplished to date, there remain numerous unsolved questions that continue to puzzle everyone entering on the field of Ancient pseudoepigraphica. A treatise “On the nature of the world and the soul”, ascribed to an ancient Pythagorean Timaios of Locri, is among the most interesting pseudonymous philosophical works available, and it is hoped that the first Russian translation of it will draw attention of Russian-speaking scholars to this intriguing document of Late Hellenistic thought. Information about Timaios’ identity and the nature of the work ascribed to him is given in the introduction to the translation. In the commentary we are trying to note some unclear or otherwise remarkable places, mostly on the basis of a comparison between our treatise and Plato’s dialog as it was understood in the Platonic tradition. Generally speaking this ex facte secondary work has proven to be an important source for our understanding of the development of Pythagorean and Platonic ideas from the Hellenistic period up to Late Antiquity and beyond.

  9. Nuevos sonidos, nuevos negros : Freedom songs, soul y funk en Estados Unidos, 1955-1979

    OpenAIRE

    Gatto, Ezequiel

    2016-01-01

    Soy Historiador (UNR), Doctor en Ciencias Sociales (UBA), Profesor Auxiliar de Teoría Sociológica en la carrera de Historia (UNR) y Becario Posdoctoral (CONICET). Mi Tesis de Licenciatura estuvo dedicada al análisis de un conjunto de pensadores sociales y activistas políticos afroamericanos en Estados Unidos en el contexto de la urbanización de grandes contingentes de población afroamericana (1890-1930). Mi Tesis Doctoral, por su parte, a la incidencia de un conjunto de nuevos géneros de músi...

  10. Body and Soul: The Natural Affinity Between the Alexander Technique and the Stanislavsky Method.

    Science.gov (United States)

    Richmond, Phyllis

    1996-01-01

    Describes the compatibility between the Alexander Technique and the Stanislavsky Method. Explains the basic concept behind both acting methods. Presents ideas for incorporating both methods in classes. (PA)

  11. 76 FR 9345 - Soule Hydro, LLC; Notice of Draft License Application and Preliminary Draft Environmental...

    Science.gov (United States)

    2011-02-17

    .../docs-filing/ecomment.asp . You must include your name and contact information at the end of your... Contact: Glen D. Martin, C/O Alaska Power & Telephone Company, P.O. Box 3222, Port Townsend, WA 98368... the last three digits in the docket number field to access the document. For assistance, contact FERC...

  12. A free irresponsible press: Wikileaks and the battle over the soul of the networked fourth estate

    National Research Council Canada - National Science Library

    Benkler, Yochai

    2011-01-01

    ... (as of this writing, it has risen to over 1900) cables from US embassies in cooperation with five traditional media organizations, at the time of the embassy cable release, about two-thirds of news reports incorrectly reported that Wikileaks had simply dumped over 250,000 classified cables onto the Net.

  13. Peripheral arterial disease, gender, and depression in the Heart and Soul Study

    NARCIS (Netherlands)

    Grenon, S. Marlene; Cohen, Beth E.; Smolderen, Kim; Vittinghoff, Eric; Whooley, Mary A.; Hiramoto, Jade

    2014-01-01

    Background Despite the high prevalence of peripheral arterial disease (PAD) in women, risk factors for PAD in women are not well understood. Methods Gender-specific risk factors for PAD were examined in a prospective cohort study of 1024 patients (184 women and 840 men) with stable coronary artery

  14. "The value of the soul." The discourses of management as modes of subjectivity at work.

    Directory of Open Access Journals (Sweden)

    Cecilia Beatriz Soria

    2012-03-01

    Full Text Available This review describes the main guidelines, questions and hypotheses that traverse the recent work of Marcela B. Zangaro, called "Subjectivity and work. A Foucauldian reading of management", edited by Herramienta. The book, as its title indicates, dives for two fundamental topics of modernity: the modes of subjectification and labor issues. The author, from a critical perspective, links the input matrix from the Foucauldian and other aspects of the New Sociology of Capitalism and Critical Discourse Analysis. Since this articulation, she analyzes a broad set of discourses of management, understanding them as a technology of power, a technology of self, which organizes the bodies and emotions of the workers. In this sense, the text becomes a valuable input to understand the practices of subjectivity in the context of the many changes that have experienced the world of work in recent decades. These mutations can only be examined in the light of the new forms of organization and capital accumulation, complainant labor force, in its broadest sense, such as physical and mental abilities present in the body and embodiment of the workers.

  15. Heavy Metal Islam: Rock, Resistance, and the Struggle for the Soul of Islam

    National Research Council Canada - National Science Library

    2008-01-01

    Adult/High School-- In the 1970s, heavy metal acts like Black Sabbath and Iron Maiden created dark, violent music that was as much political and social protest as it was adrenaline-laced sound energizing the mosh pit...

  16. "We're Fighting for the Heart and Soul of Education"

    Science.gov (United States)

    Hunt, Sally

    2011-01-01

    Reductions in further and higher education spending, combined with cuts to helping-hand schemes such as the Education Maintenance Allowance, present a fundamental threat to everything educators stand for. This author discusses the need to build a credible alternative that puts tertiary education at the heart of a strategy for economic growth and…

  17. Me and you, the soul of the aporia of intersubjectivity in Husserl’s phenomenology

    Directory of Open Access Journals (Sweden)

    Cesar Augusto Delgado Lombana

    2011-12-01

    Full Text Available This article aims to address the rising debate about the plane aporia phenomenological constitucion of otherness, by Husserl in the Cartesian Meditations. Because of the length of the text, we must focus on the Fifth Meditacion (In the transcendental sphere of Being is revealed as intersubjectivity monadological, which can be considered as the climax and centerpiece of the exhibition made by Husserl, which attempts to account the relationship between operant subjectivity (ego constituent and otherness constituted. From the outset, the aporía of intersubjectivity is determined by the nability to interpret the status of otherness without traveling by a preponderance that the ego is operating on another, ie, the inability to accept the objectivity of intersubjectivity if not is presumed certainty of the transcendental subject.

  18. FROM FACE-SAVING TO SOUL-SEARCHING: ON THE SERVICEABILITY OF OVERAPOLOGIZING IN EDUCATION

    Directory of Open Access Journals (Sweden)

    Alin Cristian

    2010-06-01

    Full Text Available This phenomenological inquiry attempts to render more transparent the connection between students’ failures to deliver as expected in school and their culturally sanctioned, high-frequency style of apologizing for it. In a social environment that overwhelmingly promotes consent, resistance and counteraction may take on increasingly undetectable forms rather than vanish. What could be symptomatic expressions of a deep-level resistance lose their conspicuousness and thus gain in subversive efficacy if trivialized through frequent apologizing. The argument’s conclusion is that by underestimating the educational role of conflict and the person’s capacity to handle certain levels thereof strictly on her own, a culture also deprives its members of the possibility to experience an inner rift apt to break tenacious failure patterns. This disablement remains difficult to legitimize within a global context, although persistently regarded as indispensable to the specific cultural identity education is called to reproduce.

  19. Heme degradation and human disease: diversity is the soul of life.

    Science.gov (United States)

    Shibahara, Shigeki; Kitamuro, Tomomi; Takahashi, Kazuhiro

    2002-08-01

    We all depend on molecular oxygen and heme for our life, as evident from the pigments in blood and daily wastes. About 80% of serum bilirubin is derived from hemoglobin of senescent erythrocytes, which have finished their mission of 120 days and have been phagocytized by macrophages in the reticuloendothelial system. Here we present an overview of the heme degradation processes and relevant disorders by focusing on heme oxygenase-1 (HO-1), a key enzyme in heme catabolism. HO-1 cleaves the porphyrin macrocycle of heme at the expense of molecular oxygen to release a linear tetrapyrrole biliverdin, carbon monoxide, and ferrous iron; biliverdin is rapidly reduced to bilirubin. Bilirubin is transported to the liver (hepatocytes), conjugated with glucuronic acid by bilirubin UDP-glucuronosyltransferase, and excreted into bile. Genetic diversity, a strategy in the host defense, is seen in the human ho-1 and UDP-glucuronosyltransferase genes. Moreover, striking interspecies variations are noted in the regulation of HO-1 expression by hypoxia, heat shock, or interferon-gamma, each of which mainly represses HO-1 expression in human cells. Implications of such a variety are discussed in relevance to the pathogenesis of severe malaria caused by Plasmodium falciparum, the most ancient foe of humans.

  20. Toward a ""Paideia" of the Soul": Education to Enrich America's Multicultural Democracy

    Science.gov (United States)

    Gibson, Melissa Leigh; Grant, Carl A.

    2012-01-01

    What role might education play in the reinvigoration of a robust American democracy? We argue that common understandings of democracy, citizenship, and democratic education are too anemic to right the political inequalities and stagnancies that have deadened American democracy. Instead, we look to notions of "paideia" and an educated, enlightened…

  1. Organ markets and human dignity: on selling your body and soul.

    Science.gov (United States)

    Stempsey, W E

    2000-08-01

    This article addresses the ethics of selling transplantable organs. I examine and refute the claim that Catholic teaching would permit and even encourage an organ market. The acceptance of organ transplantation by the Church and even its praise of organ donors should not distract us from the quite explicit Church teaching that condemns an organ market. I offer some reasons why the Church should continue to disapprove of an organ market. The recent commercial turn in medicine can blind us to the problem of an organ market. In addition, the reliance on the gift image in organ transplantation raises difficulties of its own. What is needed is a fuller appreciation of the fact that the human person is essentially embodied with all its parts, and not merely an autonomous being that possesses organs as properties to sell. I support this vision of the embodied human person by appealing to the writings of Immanuel Kant.

  2. Winning Bodies and Souls: State Building and the Necessity of Nationalism

    Science.gov (United States)

    2008-12-01

    Anderson describes the emergence of nationalism as the result of the dissipation of the dynastic and cosmological hold upon humanity beginning during...services. This 49 Adapted from Gordon McCormick, “A Systems Perspective on Insurgency,” Lecture #3 (Naval...of increasingly rapid communications, drove a harsh wedge between cosmology and history. No surprise then that the search was on, so to speak, for

  3. Seeking the Soul of Democracy: A Review of Recent Research into Citizens' Political Talk Culture

    National Research Council Canada - National Science Library

    Schmitt‐Beck, Rüdiger; Lup, Oana

    2013-01-01

    This article provides a review of extant empirical research on ordinary citizens' everyday political communication, its phenomenology, determinants, consequences, and relevance for democratic politics...

  4. Gaining the world and losing the soul? trust change in electronic government

    OpenAIRE

    Grimsley, Mike; Meehan, Anthony

    2008-01-01

    We describe an empirical study of reported changes in citizens' trust when an electronic government system supporting the allocation of public housing was introduced by a local government body in south east England. (Similar systems have been introduced in most local government districts of the UK.) We present an analysis of survey data (521 respondents) showing that users of the electronically-mediated service were much more likely to report a reduction in trust as a result of their experien...

  5. Programas trainees corporativos e o governo das almas Trainees corporate programs and the government of souls

    Directory of Open Access Journals (Sweden)

    Jairo Antônio da Cruz

    2012-04-01

    Full Text Available O artigo busca problematizar as transformações do trabalho na passagem da Modernidade para a Contemporaneidade, e alguns de seus efeitos nos domínios educacionais. Para tanto, mostramos o deslocamento de ênfase de um trabalho fabril para um trabalho que vem sendo chamado imaterial, que já não prioriza um sistema baseado na obediência a regulamentos e na vigilância do corpo. Sua organização lança mão de formas muito mais sutis de poder, apoiando-se em formas mais sofisticadas e complexas de atuar sobre os sujeitos. Esse quadro teórico serve de suporte para a análise de três programas trainees corporativos, que buscam capturar "grandes talentos" egressos de cursos superiores e torná-los fiéis colaboradores das organizações empresariais, fazendo com que desejem e passem a agir como autoem-presários prestadores de serviços.The article attempts to discuss changes in work in the passage from Modernity to Contemporary and some of its effects in education. For this, we show the displacement in emphasis from a factory work, guided by a disciplinary organization, to a work that is being called immaterial. This is no longer a priority a system based on obedience to rules and surveillance of the body. Its organization makes use of more subtle forms of power, relying on more sophisticated and complex ways of acting on the subject. This theoretical framework supports the analysis of three trainees corporate programs, whose purpose is capturing "great talents" graduates from colleges and making them loyal employees of business organizations, making they wish and start to act as self-entrepreneurs service providers.

  6. The SOLA Team: A Star Formation Project To Study the Soul of Lupus with ALMA

    Science.gov (United States)

    De Gregorio-Monsalvo, Itziar; Saito, M.; Rodon, J.; Takahashi, S.

    2017-06-01

    The SOLA team is a multi-national and multi-wavelength collaboration composed by scientists with technical expertise in ALMA and in infrared and optical techniques. The aim of the team is to establish a low-mass star formation scenario based on the Lupus molecular clouds. In this talk I will present our unique catalog of pre-stellar and proto-stellar cores toward Lupus molecular clouds, the results on our latest studies in protoplanetary disks, as well as our ALMA Cycle 3 data aiming at testing the formation mechanism of sub-stellar objects in Lupus molecular clouds.

  7. Serving the Reich the struggle for the soul of physics under Hitler

    CERN Document Server

    Ball, Philip

    2013-01-01

    Serving the Reich tells the story of physics under Hitler. While some scientists tried to create an Aryan physics that excluded any 'Jewish ideas', many others made compromises and concessions as they continued to work under the Nazi regime. Among them were three world-renowned physicists: Max Planck, pioneer of quantum theory, regarded it as his moral duty to carry on under the regime. Peter Debye, a Dutch physicist, rose to run the Reich's most important research institute before leaving for the United States in 1940. Werner Heisenberg, discovered the Uncertainty Principle, and became the leading figure in Germany's race for the atomic bomb. After the war most scientists in Germany maintained they had been apolitical or even resisted the regime: Debye claimed that he had gone to America to escape Nazi interference in his research; Heisenberg and others argued that they had deliberately delayed production of the atomic bomb. Mixing history, science and biography, Serving the Reich is a gripping exploration o...

  8. A cure for the soul? The benefit of live music in the general hospital.

    Science.gov (United States)

    Moss, H; Nolan, E; O'Neill, D

    2007-01-01

    From 2005 to 2006 a professional orchestra (the Irish Chamber Orchestra) performed in a university teaching hospital with the aims of bringing live music to patients who could not access traditional concert venues and of improving quality of life for patients and staff. This was the first time an orchestra was resident in a hospital in the Republic of Ireland. An independent contemporaneous evaluation was carried out to assess the benefit of live music for patients. Live music in hospital was found to enhance the quality of the aesthetic environment of the hospital, with both patients and staff stating that listening to live music helped them to relax, feel happier and more positive. Patients' perception of the hospital was affected positively by live music in waiting areas. Music was found to have strong emotional effect and the individual preferences and experiences of patients need to be carefully taken into account when programming music in hospital. Listening to live music while in hospital has positive benefits with few negative effects.

  9. SONUBHAU BASWANT COLLEGE OF ARTS AND COMMERCE LIBRARY’S SOUL OPAC AND WEB OPAC

    OpenAIRE

    Waghmode, S. S.

    2014-01-01

    “Save the time of the reader” it is the 4th Law of S.R. Ranganathan’s Five Laws of Library Science (1931). It is a challenge to ask whether the printed Library catalogues precisely do this for its library users. There is a common understanding that the evolution of OPAC should be in line with the evolution of technology and its services. Users are should be satisfied from library services. Online Public Access Catalogue should not be a complex matrix for the users. There is no doubt that Libr...

  10. Dialectic of Eros and Myth of the Soul in Plato's Phaedrus

    DEFF Research Database (Denmark)

    Larsen, Jens Kristian

    2010-01-01

    In this paper, I question a widespread reading of a passage in the last part of the Phaedrus dealing with the science of dialectic. According to this reading, the passage announces a new method peculiar to the later Plato aiming at defining natural kinds. I show that the Phaedrus itself does...

  11. Field observations into the environmental soul: spatial configuration and social life for people experiencing dementia.

    Science.gov (United States)

    Ferdous, Farhana; Moore, Keith Diaz

    2015-03-01

    This article focuses on the important, facilitating role architectural design plays in social interaction within long-term care facilities (LTCFs) serving people with dementia. Here, we apply space syntax, a set of theories and techniques for the analysis of spatial configurations, as an objective measure of environmental characteristics. Almost 150 rounds of behavioral observations were collected in the social spaces of 3 LTCFs. Using the visibility and proximity metrics of space syntax, the locations of occurrence of various social activities in relation to the furniture and spatial layout on architectural floor plans have been identified. The results did not confirm the space syntax hypothesis that spaces with greater visibility and proximity promote more social interaction. Further analysis revealed that when in settings with better visibility and accessibility, the residents were more likely to engage in low levels of interaction. High-level social interactions actually were more likely to occur in settings providing greater privacy (eg, less visibility and accessibility). The findings suggest an important nuance that architectural configuration factors impact not only the likelihood but also the type of conversations likely to occur in certain locations. This would have implications for both design and staff training on how best to utilize social spaces for therapeutic effect, particularly within the context of person-centered care. © The Author(s) 2014.

  12. [Injury to body and soul--psychiatric consequences of road traffic accidents in children and adolescents].

    Science.gov (United States)

    Di Gallo, A

    2005-03-23

    Road traffic accidents are a major cause for severe injury in children and adolescents. Many victims also suffer from psychological consequences, such as posttraumatic stress disorder, traffic-related fears or mood disturbances. High levels of distress during and immediately after the accident are associated with severe posttraumatic stress symptoms. Routine consideration of the psychological impact of road traffic accidents should receive the same priority as screening for physical injury.

  13. Belief in the Immortality of the Human Soul and a Future Life ...

    African Journals Online (AJOL)

    The paper is a reflection on ancient Basotho's conception of death. For ancient Basotho, death pertains to animals and other animate things, not humans. They believe in a future life. It is argued that it is unfair to regard a belief on the resurrection as meaningless simply because it does not pass either the verifiability criterion ...

  14. Brain-computer interfaces: a unique window into the hearing soul

    DEFF Research Database (Denmark)

    Treder, Matthias S.; Miklody, Daniel; Blankertz, Benjamin

    quality measure'. We were able to show that for stimuli close to the perceptual threshold, there was sometimes a discrepancy between overt responses and brain responses, shedding light on subjects using different response criteria (e.g., more liberal or more conservative). To conclude, brain-computer...... interfaces (BCIs) open up an new window into auditory perceptual experience. Although the application to cochlear implant (CI) patients is challenging due to electrical artefacts produced by the implant, we believe that this technology has the potential to contribute to the quality assessment and enhancement...

  15. Russian Refractions of Spanish 'National Soul': Konstantin Bal'mont and the Poetics of Vitalism

    NARCIS (Netherlands)

    Metz, E.; De Dobbeleer, M.; Vervaet, S.

    2013-01-01

    At the turn of the twentieth century, the Russian symbolist poet Konstantin Bal’mont devoted himself to translating the dramatic works of Calderón de la Barca. The poet’s translation project was part of his general enthusiasm for Spanish culture. Although this interest was to a large extent informed

  16. Horror from the Soul--Gothic Style in Allan Poe's Horror Fictions

    Science.gov (United States)

    Sun, Chunyan

    2015-01-01

    Edgar Allan Poe made tremendous contribution to horror fiction. Poe's inheritance of gothic fiction and American literature tradition combined with his living experience forms the background of his horror fictions. He inherited the tradition of the gothic fictions and made innovations on it, so as to penetrate to subconsciousness. Poe's horror…

  17. КОРОТКИЙ ІСТОРИЧНИЙ НАРИС ПРО СВЯТОГО ЛІКАРЯ ДУШ І ТІЛ ЄПИСКОПА-ХІРУРГА В. ВОЙНО-ЯСЕНЕЦЬКОГО / SHORT HISTORICAL ESSAY ABOUT SAINT, DOCTOR OF BODY AND SOUL, BISHOP AND SURGEON VOYNO-YASENETSKY

    Directory of Open Access Journals (Sweden)

    Волoдимир БЕНДАС

    2017-06-01

    Full Text Available Бендас В. Краткий исторический очерк о святом лекаре душ и тел епископе-хирурге В. Войно-Ясенецком В статье представлены материалы о известном хирурге В.Ф. Войно-Ясенецком, профессоре, докторе медицинских наук, лауреата Сталинской премии, одновременно политзаключенного (11 лет тюрем и ссылок, священнослужителя, епископа Крымского и Симферопольского, прилученного Украинской православной церковью Московского патриархата до лика Святых. Большое внимание обращено на медицинскую деятельность как врача и духовную деятельность как священнослужителя. Сделан краткий историко-библиографический экскурс по дороге жизни епископа Луки. Ключевые слова: епископ Лука, хирург, медицинская деятельность, духовность, церковь, честность, порядочность. Bendas V. Short historical essay about Voyno-Yasenetsky the Saint, doctor of body and soul, bishop and surgeon The article presents the results of the well-known surgeon V.F. Voyno-Yasenetsky, Professor, Doctor of Medical Sciences, the winner of the Stalin Prize, at the same time a political prisoner (11 years of prison and exile, clergyman, bishop of Simferopol and the Crimea, who was recognized by Ukrainian Orthodox Church of the Moscow Patriarchate to the faces of the Saints. Much attention is paid to his medical activit, and spiritual activities as a priest. A brief historical-bibliographical excursus

  18. Estconil jagati taas Stalkereid / Jüri Kallas

    Index Scriptorium Estoniae

    Kallas, Jüri

    2006-01-01

    Ulmeauhind Stalker 2006 - tõlkeromaan: Lukjanenko, Sergei. Peegelduste labürint / tõlkinud Tanel Rõigas; antoloogia või tõlkekogu: Arvi Nikkarevi koostatud antoloogia "Aphra"; tõlkejutt: Vance, Jack. Puukoi; algupärane raamat: Hargla, Indrek. French ja Koulu; algupärane jutt: Belials, Veiko. Wereke, wereke, ega sa wesi...

  19. Parimad valitud

    Index Scriptorium Estoniae

    1999-01-01

    Stalkerid. Parim möödunud aastal Eestis ilmunud ulmeraamat Dan Simmonsi "Hyperion" (kirjastus Varrak), parim algupärane jutustus Lew R. Bergi "Vaimudejõe viirastused", parim algupärane lühijutt Karen Orlau "Oraakli surm"

  20. [14.-15. juulini toimus Aegviidu lähistel Mustjõe kõrtsitalus Estcon 2001. Tehti teatavaks ka Stalkeri laureaadid

    Index Scriptorium Estoniae

    2001-01-01

    Stalkeri laureaadid: parim romaan - Orson Scott Card. Enderi mäng (Varrak); parim kogumik - Ray Bradbury. Kaleidoskoop (Varrak); parim tõlkejutt - Michael Moorcock. Unelev linn (ilmunud kogumikus "Valge hundi saatus", Fantaasia); parim algupärane jutustus - Indrek Hargla. Sindbadi kaheksas reis (Algernon, dets. 2000); parim algupärane lühijutt - Karen Orlau. Rannahiidsed (Mardus, 2000, nr. 3)

  1. العلامة السيد أبو القاسم رضي الدين علي بن موسى بن جعفر الحسني المعروف بابن طاووس(589هـ 664هـ ومنهجه في كتاب (سعد السعود للنفوس Alalmaa ALSayyed Abu al-Qasim Radhi al-Din Ali ibn Musa ibn Jaafar al-Hassani known as Ibn Tawoos (589 Ah 664 Ah And His method in the book (Saad Al Saud of souls

    Directory of Open Access Journals (Sweden)

    Dr. Mohmed Abbass Noemman Aljobry أ.م.د. محمد عباس نعمان الجبوري

    2012-06-01

    Full Text Available Praise be to Allah who created man, aware man of the statement, and peace and blessings on the pillow creatures Muhammad and his Generous family, and after: Jurists and scholars alive in the hearts and thoughts of the faithful and if they departed this world, their careers and their works live what remains forever, they are sponsored by it for the hearts and neighborhoods of hearts, that Mr. Radhi al-Din Ali bin Tawoos (God's mercy Beauty walk and role models who know her place above the level of the mind, knowledge is infinite factor the satisfaction of God Almighty Mahtata so most reservists, pride of Hilla city, his efforts to raise the nation and Asaaffha, and access to the height of greatness and integrity through Asudaih of tips and guidance gained from his grandfather and Ram and his father and his life. know religion his main concern and suggesting that arguments and evidence relied upon, teaches others how to derive rulings of the conversations of the Prophet (them blessings and peace. wrote books have scientific value and features Balothaqh text transfer in a topping books written in his time. His books (Saad Al Saud of souls have ways a new kind of authorship in this book, the first mention of suspicions and discussed and the response based on evidence and arguments. Vmnahjah Mr. Saad Saud book include the following: the oath on two fronts: Part One: Transfer of Qurans binoculars and Rabat Mecca. Part II: What transfer of interpretations of the Koran and the specialty, has explained in detail the methodology on which the book was keeping conclusion to reach the most important included in the search results.

  2. La vidéo et les soulèvements populaires en Égypte | CRDI - Centre ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Orient, quand j'ai vu les changements, en particulier les changements politiques, tout cela m'a beaucoup intéressée, m'a passionnée même. Et c'est ma passion pour ces mouvements qui m'a poussée à vouloir en savoir plus.

  3. Psyche--the meeting of mind and soul: current psychoanalytic views on the mental representation of god.

    Science.gov (United States)

    Clemens, Norman A

    2013-11-01

    The author presents an overview of two contemporary, related psychoanalytic perspectives on religious phenomena. Based on data from systematic interviews, Ana-Maria Rizzuto explores the way the human mind forms the idea of God as it evolves through the various stages of childhood and adult development. The object-representation of God is greatly influenced by the mental representations of mother, father, and other important adults in the child's life. Object relations theory and the writings of Winnicott play an important role in these concepts. William Meissner, a Jesuit priest as well as a psychoanalyst, addresses Freud's views of religious belief as an illusion, or when accepted with certainty as real, as a delusion. Instead, Meissner sees religious belief as a developmental process that resides in the mental realm of transitional phenomena where spirituality, creativity, appreciation of beauty, transcendental states, play, and the psychoanalytic process itself also take place. In psychoanalytic treatment, religious phenomena are not exempt from exploration and understanding, perhaps resulting in more mature development of object representations, ego functions, and the superego functions of conscience and ego ideal as well as more mature religious life.

  4. Healing the body and the soul through visualization: a technique used by the Community Healing Team of Cape Dorset, Nunavut.

    Science.gov (United States)

    Kingwatsiaq, Novaliinga; Pii, Kumaarjuk

    2003-01-01

    As Alice Kimiksana indicated, the Healing Circle or Healing Teams evolved to help First Nations people who attended residential schools deal with the aftermath of the abuse many of them suffered there. They use a variety of interventions, some traditional and some more Western in origin, for an innovative approach to a very serious problem. One technique developed by Western psychology, but very useful and adaptable in other cultural settings, is guided imagery or visualization. Often used for performance enhancement in sports, it is also applicable to other situations from medical settings to mental health treatment. In this presentation, Novaliinga Kingwatsiaq of Kingnait (Cape Dorset) led the audience through a modified version of a visualization used by her Community Healing Team. (During visualization one assumes a relaxed state with one’s eyes closed and imagines oneself in the context of a story told by the person guiding the imagery.) The imagery she chose is both symbolically and culturally appropriate. Most audience members were unfamiliar with the process of visualization, and several indicated that they were intrigued by the experience. Kumaarjuk Pii introduced Novaliinga Kingwatsiaq and translated for her.

  5. Struggling for the Soul of the Nation: Educational Policy, Democratic Leadership, and Radical Democracy in Neoliberal Times

    Science.gov (United States)

    Torres, Carlos Alberto

    2010-01-01

    Two conditions are crucial in preparing radical democratic leaders for a democratic society. In this article, the author argues against instrumental rationality and for radical democratic leaders with a critical perspective in education and schools.

  6. "How Can a Chord Be Weird if It Expresses Your Soul?" Some Critical Reflections on the Diagnosis of Aspergers Syndrome

    Science.gov (United States)

    Moloney, Paul

    2010-01-01

    This paper questions the way in which the diagnosis of Aspergers syndrome has come to be widely accepted and used as an essentially medical category. It does so by drawing upon sociological and historical analyses of society, psychiatry and psychology, as well as the writings of service users, other practitioners in the autistic spectrum disorder…

  7. The Balance Sheet of the Parallel Action carried out by the Secretariat of the Soul and Precision, 100 Years Later

    Directory of Open Access Journals (Sweden)

    Orio Giarini

    2013-10-01

    Full Text Available Exactly 100 years ago, Austrian writer Robert Musil’s book “The Man Without Qualities” foresaw the cultural challenge that Relativity and Quantum Theory would pose to the Newtonian mechanistic worldview of the 19th century. His book anticipated the transition that would eventually compel a deterministic, reductionist science of predictability to enter into dialogue with the emerging subjective and intuitive perception of uncertainty, complexity, freedom and creativity, which promises to revolutionize our way of thinking in the 21st century. Musil anticipated the reconciliation of science and the arts – universal, immutable, scientific truth and dynamic, indeterminate human nature. This essay traces the evolution of Economics from a deterministic material science seeking to emulate the mathematical precision and predictability of Physics into a human-centred social science compatible with indeterminism and uncertainty. The notion of Newtonian equilibrium in Economics is rapidly giving way to dynamic, evolutionary disequilibrium.

  8. Mirrors of the Soul and Mirrors of the Brain? The Expression of Emotions as the Subject of Art and Science

    NARCIS (Netherlands)

    Keestra, M.; Schwartz, G.

    2014-01-01

    Is it not surprising that we look with so much pleasure and emotion at works of art that were made thousands of years ago? Works depicting people we do not know, people whose backgrounds are usually a mystery to us, who lived in a very different society and time and who, moreover, have been ‘frozen’

  9. Is Comfort Food Really Good for the Soul? A Replication of Troisi and Gabriel’s (2011) Study 2

    National Research Council Canada - National Science Library

    Lay See eOng; Hans eIJzerman; Angela eLeung

    2015-01-01

    We report the results of three high-powered replications of Troisi and Gabriel’s (2011) idea that writing about comfort food reduces feelings of loneliness amongst securely attached individuals after a belongingness threat...

  10. Is comfort food really good for the soul? A replication of Troisi and Gabriel's (2011) Study 2

    OpenAIRE

    Lay See eOng; Hans eIJzerman; Angela eLeung

    2015-01-01

    We report the results of three high-powered replications of Troisi and Gabriel's (2011) idea that writing about comfort food reduces feelings of loneliness amongst securely attached individuals after a belongingness threat. We conducted our studies amongst a large group of participants (Total N = 649) amongst American (MTurk), Dutch (Tilburg University; TiU), and Singaporean (Singapore Management University; SMU) samples. Participants first completed an attachment style scale, followed by wri...

  11. Is comfort food really good for the soul? A replication of Troisi and Gabriel's (2011) Study 2.

    Science.gov (United States)

    Ong, Lay See; IJzerman, Hans; Leung, Angela K-Y

    2015-01-01

    We report the results of three high-powered replications of Troisi and Gabriel's (2011) idea that writing about comfort food reduces feelings of loneliness amongst securely attached individuals after a belongingness threat. We conducted our studies amongst a large group of participants (Total N = 649) amongst American (MTurk), Dutch (Tilburg University; TiU), and Singaporean (Singapore Management University; SMU) samples. Participants first completed an attachment style scale, followed by writing two essays for manipulating a sense of belongingness and salience of comfort food, and then reporting their loneliness levels. We did not confirm the overall effect over all three countries. However, exploratory results provide the preliminary suggestion that (1) the comfort food explanation likely holds amongst the American samples (including Troisi and Gabriel's), but not amongst the TiU and SMU samples, and potentially that (2) the TiU and SMU participants self-regulate through warmer (vs. colder) temperature foods. Both of these should be regarded with great caution as these analyses were exploratory, and because the Ns for the different temperature foods were small. We suspect we have uncovered first cross-cultural differences in self-regulation through food, but further confirmatory work is required to understand the cultural significance of comfort food for self-regulation.

  12. Survey Essay 2. Periodizing and Historicizing German Afro-Americanophilia: From Counterculture to Post-soul (1968-2005

    Directory of Open Access Journals (Sweden)

    Moritz Ege

    2015-09-01

    Full Text Available In our second periodizing essay, we begin with the ‘turning point’ of the late 1960s, when German Afro-Americanophilia modulated and intensified, and we then contemplate the rise of interest in the Black Diaspora amongst the new social movements, second-wave feminists, and Afro-German activists in the 1970s and 1980s, as well as various important moments in the German reception and re-contextualisation of African-American coded popular music such as disco (in the 1970s, and techno and hip-hop since the 1980s. We discuss the impact of migration and activism on heretofore unquestioned equivalences between Germanness and whiteness and contemplate the triangulation of desire within the reception and appropriation of U.S. hip-hop by diverse groups of young people in Germany.  We argue that Afro-Americanophile subject positions diversified and that, especially since the 1980s, some new dynamics have emerged that seem to leave behind ideas of racial ‘authenticity.’  Finally, we query what a timeframe-based overview may not address so well, namely the question of structural continuities in the patterns of twentieth-century Afro-Americanophilia in Germany.

  13. From the 'Village of a Thousand Souls' to 'Race Crossing in Jamaica': Arnold Gesell, eugenics and child development.

    Science.gov (United States)

    Weizmann, Fredric

    2010-01-01

    Perhaps best known for providing age-related norms in early development, norms that are still used as a basis for measures of developmental maturity, Arnold Gesell was a key figure in developmental psychology from the 1920s through the 1950s. After examining Gesell's reputation and status in the field, we explore Gesell's changing relationship to eugenics, both in terms of Gesell's often contradictory attitudes about the role of hereditary and environmental influences in development, and in terms of the broader relationship between the eugenics movement and science.

  14. Regenerating the Philosophy of Education: What Happened to Soul? Counterpoints: Studies in the Postmodern Theory of Education, Volume 352

    Science.gov (United States)

    Kincheloe, Joe L., Ed.; Hewitt, Randall, Ed.

    2011-01-01

    In this volume, Joe L. Kincheloe and Randall Hewitt have gathered an impressive and scholarly group of authors who argue for the continuing importance of the philosophy of education. Reviving the notion that philosophy is an essential foundation in the study and research of education, contributors to this volume directly confront the evisceration…

  15. Positive Affect and Survival in Patients With Stable Coronary Heart Disease : Findings From the Heart and Soul Study

    NARCIS (Netherlands)

    Hoen, Petra W.; Denollet, Johan; de Jonge, Peter; Whooley, Mary A.

    Objective: Positive affect can improve survival, but the mechanisms responsible for this association are unknown. We sought to evaluate the association between positive affect and mortality in patients with stable coronary heart disease and to determine biological and behavioral factors that might

  16. Depression and Leukocyte Telomere Length in Patients With Coronary Heart Disease : Data From The Heart and Soul Study

    NARCIS (Netherlands)

    Hoen, Petra W.; de Jonge, Peter; Na, Bee Ya; Farzaneh-Far, Ramin; Epel, Elissa; Lin, Jue; Blackburn, Elizabeth; Whooley, Mary A.

    Objective: Shortened telomere length has been associated with mortality in patients with coronary heart disease (CHD) and is considered as an emerging marker of biologic age. Whether depression is associated with telomere length or trajectory has not been evaluated in patients with CHD. Methods: In

  17. The Om mani padme hum, the Platonic Soul, the Tao, and the Greek Cross are an Architectural Tool

    Directory of Open Access Journals (Sweden)

    Tine Kurent

    1989-12-01

    Full Text Available The plan of Borobuclur conforms with two concentric octagrams. The lines of the scheme, their lengths, and their intersections, determine the articulation of the Borobudur composition, i. e. the sizes of every part and of the whole as well. The sizes of Borobudur are modular. Their modular multiples are Pell numbers, the ratios of which rationally approximate the irrational proportions in octagram  If Borobudur numbers are located in the Peli number-pattern and connected with a line, the syllable OM, written in Sanskrit, appears. The word octagram is only the modern European name of the symbol of OM. The prayer OM MANI PADME HUM, translated as 'the JEWEL and the LOTOS', is a good description of octagram.

  18. Apocalyptic souls: the existential (anti hero metaphor in the Metal Gear Solid: Snake Eater, Peace Walker and Ground Zeroes games

    Directory of Open Access Journals (Sweden)

    Daniel de Vasconcelos Guimarães

    2015-06-01

    Full Text Available In the present study, I drew a correlation between Søren Kierkegaard’s (1813-1855 existentialist theory and apocalyptic representations in the Metal Gear Solid: Snake Eater, Peace Walker and Ground Zeroes video games (Konami Computer Entertainment Japan, Kojima Productions, 2004, 2010 and 2014. In this successful franchise, the game’s main character, ‘Snake’ personifies ‘the knight of infinite resignation,’ the ‘tragic hero’ in ‘the infinite movement’ towards the achievement of ‘higher causes’. Also, Snake’s mentor ‘The Boss’, who sacrifices herself in order to reconcile the world from its 1960’s Cold War antagonism would represent another Kierkegaard notion called ‘the knight of faith’, who believes in his/her faith (the cause above all things. Such character traits enrich both gameplay and game narrative and the overall experience by introducing philosophical inquiries to the player. The methodology utilized was a free-form semiotic framework with emphasis on the symbolic representations along with Kierkegaard’s existentialism and other philosophical constructs as well.

  19. Reflections in the Mirror of Reggio Emilia's Soul: John Dewey's Foundational Influence on Pedagogy in the Italian Educational Project

    Science.gov (United States)

    Lindsay, Gai

    2015-01-01

    This paper articulates John Dewey's socio-political and historical influence upon the foundation and evolution of the world-renowned Reggio Emilia approach to early childhood education. It proposes that the pedagogical depth, influence and endurance of the Italian project are grounded in Dewey's philosophies of education, aesthetics and democracy.…

  20. Spirited Leadership and the Struggle for the Soul of Headteachers: Differentiating and Balancing Nine Types of Engagement

    Science.gov (United States)

    Luckcock, Tim

    2010-01-01

    This article is written from the perspective of a practicing headteacher as a contribution to the theory and practice of spiritual leadership in education. By using a conceptual map derived from personality type theory it seeks to articulate several distinct facets of spirited leadership, intended to denote what engages, enlivens and enlightens…

  1. The lonely soul wanders: on the role of impaired social functioning in the prediction of a first psychosis

    NARCIS (Netherlands)

    Velthorst, E.

    2011-01-01

    Eva Velthorst vergaarde meer kennis over de fase voorafgaand aan een eerste psychose: de Ultra Hoog Risico (UHR)-fase. Hierin doen zich milde positieve symptomen voor zoals achterdocht of vluchtige hallucinaties. Jongeren met deze symptomen hebben 10 tot 40 procent kans om binnen een jaar een eerste

  2. mHealth: a strategic field without a solid scientific soul. a systematic review of pain-related apps.

    Directory of Open Access Journals (Sweden)

    Rocío de la Vega

    Full Text Available BACKGROUND: Mobile health (mHealth has undergone exponential growth in recent years. Patients and healthcare professionals are increasingly using health-related applications, at the same time as concerns about ethical issues, bias, conflicts of interest and privacy are emerging. The general aim of this paper is to provide an overview of the current state of development of mHealth. METHODS AND FINDINGS: To exemplify the issues, we made a systematic review of the pain-related apps available in scientific databases (Medline, Web of Science, Gale, Psycinfo, etc. and the main application shops (App Store, Blackberry App World, Google Play, Nokia Store and Windows Phone Store. Only applications (designed for both patients and clinicians focused on pain education, assessment and treatment were included. Of the 47 papers published on 34 apps in scientific databases, none were available in the app shops. A total of 283 pain-related apps were found in the five shops searched, but no articles have been published on these apps. The main limitation of this review is that we did not look at all stores in all countries. CONCLUSIONS: There is a huge gap between the scientific and commercial faces of mHealth. Specific efforts are needed to facilitate knowledge translation and regulate commercial health-related apps.

  3. How Rembrandt surpassed the Ancients, Italians and Rubens as the Master of ‘the Passions of the Soul'

    Directory of Open Access Journals (Sweden)

    Eric Jan Sluijter

    2014-06-01

    Full Text Available The passions had to be rendered through the movements of the human figure (Van Mander; however it was an Italian cliché that Netherlandish artists were not able to depict figures properly. This article demonstrates how Rembrandt from his earliest works promoted the image of being the master of the lijdingen des gemoeds. Throughout his career Rembrandt aspired to surpass the artists of antiquity and the Italians through the portrayal of the passions to arouse the strongest possible empathy in the viewer, as Huygens immediately recognised. It is argued that concepts grafted onto classical rhetoric, such as oogenblikkige beweging (a term of his pupil Van Hoogstraten; a violent movement due to a sudden reversal of emotion that involves the viewer forcefully were paramount in his earlier period, and in which one finds parallels with the Senecan-Scaligerian tragedies popular at that time. In contrast, in his later works Rembrandt avoided any movement, realising that the depiction of violent motion undermines the persuasiveness of the still image; he forces the viewer to imagine the inner conflicts in the minds of the protagonists who recognise their fate. To engage the viewer powerfully through a radical ‘from life’ ideology (situating himself in a northern tradition was for Rembrandt a central concern in his continuous competition with the greatest exponents of his art (Titian, Rubens. Hoe Rembrandt schilders uit de Oudheid, de Italianen en Rubens overtrof als meester van de ‘lijdingen des gemoeds’.De passies dienden te worden verbeeld door middel van de bewegingen van de ledematen van de menselijke figuur (Van Mander, maar het was een Italiaanse gemeenplaats dat noorderlingen slecht waren in het schilderen van figuren. In dit artikel wordt gedemonstreerd hoe Rembrandt zich vanaf zijn vroegste werk nadrukkelijk presenteerde als dé meester van de ‘lijdingen des gemoeds’ en gedurende zijn gehele carrière ernaar streefde om door middel van de verbeelding van de passies en het  opwekken van een zo groot mogelijke empathie bij de toeschouwer de schilders uit de Oudheid en de Italianen te overtreffen, zoals Huygens direct onderkende. Beargumenteerd wordt dat een op de klassieke retorica geënt begrip als ‘oogenblikkige beweeging’ (een term van zijn leerling Van Hoogstraten: een heftige beweging veroorzaakt door een plotselinge omslag van emotie die de toeschouwer meebeleeft voor zijn vroegere werk cruciaal was, waarbij parallellen met de in die tijd populaire Senecaans-Scaligeriaanse tragedie zijn aan te wijzen. In zijn latere werk vermijdt hij daarentegen elke beweging, zich realiserend dat de uitbeelding van heftige beweging de overtuigingskracht van het stilstaande beeld ondermijnt, en dwingt hij de toeschouwer zich in te leven in de innerlijke conflicten van figuren die hun lot doorzien. Het krachtig betrekken van de toeschouwer bij het voorgestelde door middel van een radicale ‘naar het leven’ ideologie, waarmee hij zich in een Noordelijke traditie plaatste, stond voor Rembrandt altijd centraal bij zijn permanente wedijver met de  groten in zijn vak (Titiaan, Rubens.

  4. “I Carve You, Keeper of My Soul and My Writings, on My Seal...”

    Directory of Open Access Journals (Sweden)

    Nikolay Aleksandrovich Alekseenko

    2015-10-01

    Full Text Available The lead seals perfectly illustrate the indissoluble connection of Byzantine society with religion, its attributes and Christian symbols. There is not much data saved in annals of Byzantine history, including church sources, on the general background of hagiographic information about church figures, in particular about the clergymen of provincial dioceses, were. Their lists are not completed and the names of some of them had become famous only due to the findings of the Byzantine lead seals – molybdoboulles. Introduction of several new seals – seal of monk Kallinikos from Cherson (second half of the eleventh century, bullae of high priests from diocese of the Asian Minor region – John, bishop of Chaldia (first half of the eighth century, Basil, bishop of Magnesia ad Meandrum (eleventh century, and metropolitans of Sardeis Stilianos (second half of the eleventh century and Peter (eleventh century, John Koloneiates, proedros from Colonia (second half of the eleventh century and Michael, metropolitan of Traianoupolis (second half of the eleventh century allows us not only extend our information about individual dioceses of Byzantine empire, but in some cases to get unknown data on other sources.

  5. Black earth bonanza? : Soil, soul and depth in large-scale farmland investments in Russia and Ukraine

    NARCIS (Netherlands)

    O. Visser (Oane)

    2016-01-01

    textabstractThis paper deals with the centrality of what is called here the ‘celebration’ of black earth soil (fertility) in driving foreign investors’ land rush in the fertile black earth region of Russia and Ukraine. Since the mid-2000s, this region experienced a quick rise of farmland investment

  6. The container of my soul was severed from my shell : Metaphors of Death in Contemporary Finnish Metal Lyrics

    OpenAIRE

    Leikola, Kai

    2009-01-01

     Raskaasta rockista ja metallista on tullut tänä päivänä Suomessa ainoana maana maailmassa valtavirtamusiikkia. Metallimusiikin saama suosio on tapahtunut niin nopeasti, että akateeminen maailma on vasta hiljattain havahtunut tutkimaan itse musiikkia ja ilmiötä, ja niissäkin harvoissa tapauksissa tutkimus on yleensä keskittynyt musiikin ääripäiden viittauksista ja mahdollisista yhteyksistä satanismiin tai väkivaltaiseen käytökseen. Englanninkielistä ns. ei-saatanallista metalli...

  7. Mark LeVine, Heavy Metal Islam: Rock, Resistance, and the Struggle for the Soul of Islam

    OpenAIRE

    Pieslak, Jonathan

    2015-01-01

    Few people could carry out such a study as this. Among negotiating the different countries, the different practices of Islam, the languages, finding and interviewing the musicians, and not getting into serious trouble with the local governments along the way, Mark LeVine has written a book that few could indeed compose. LeVine’s Heavy Metal Islam is a valuable insiders guide to metal in the Muslim world, representing what I wish would happen in more studies of music. Namely, an in-depth engag...

  8. Society and the Soldier’s Soul: Is the Warrior’s Purification Ritual Needed or Possible in Modern America

    Science.gov (United States)

    2013-12-01

    religions and to place value on separation of church and state, found his experience in combat clashed with what he’d been taught when his company ...blogging offers a new type of ceremonial storytelling that can be seen “as enhancing community-building and as decreasing the social and moral gap...close, communal relationship between religion and society. Furthermore, as Usbeck explains, military blogging has the force of ritualized storytelling

  9. Inca of the blood, Inca of the soul: embodiment, emotion, and racialization in the Peruvian mystical tourist industry.

    Science.gov (United States)

    Hill, Michael

    2008-01-01

    In the context of the globalizing New Age movement and of the "turismo mistico" (mystical tourism) industry emanating from Peru, white and mestizo New Age practitioners and tourists fashion ideologies emphasizing the spiritual energy which supposedly resides in Quechua bodies, even as they freely appropriate Quechua cosmology and ritual for a hybridized New Age Andean spirituality. This case shows how racialized structural inequalities are expressed and experienced by tourists and New Age movement leaders through particular, essentialist representations of the body and through a common repertoire of emotional responses to inequality, commodification, and privilege. The paper provides an ethnographic account of how racialization may be perpetuated, negotiated, and resisted through religious systems, particularly through the work of constructing ideologies and experiences of the body and of emotional subjectivity.

  10. Marine omega-3 fatty acids and mood disorders--linking the sea and the soul. 'Food for Thought' I.

    Science.gov (United States)

    Hegarty, B D; Parker, G B

    2011-07-01

    While there has long been interest in any nutritional contribution to the onset and treatment of mood disorders, there has been increasing scientific evaluation of several candidate nutritional and dietary factors in recent years. In this inaugural study of our 'Food for Thought' series, we will overview the evidence for any role of omega-3 fatty acids (FA) in regulating mood. Relevant literature was identified through online database searches and cross-referencing. Plausible mechanisms exist by which omega-3 FA may influence neuronal function and mood. Cross-sectional studies demonstrate an association between omega-3 fatty acid deficiency and both depressive and bipolar disorders. Studies investigating the efficacy of omega-3 fatty acid supplementation for mood disorders have however provided inconsistent results. The proportion of treatment studies showing a significant advantage of omega-3 supplementation has dropped over the last 5 years. However, the vast heterogeneity of the trials in terms of constituent omega-3 FAs, dose and length of treatment makes comparisons of these studies difficult. More research is required before omega-3 supplementation can be firmly recommended as an effective treatment for mood disorders. Whereas increased omega-3 FA intake may alleviate depressive symptoms, there is little evidence of any benefit for mania. © 2011 John Wiley & Sons A/S.

  11. Care to the human "soul" in contemporary theological theory formation. From "kerygmatics" to "fortigenetics" in a pastoral anthropology

    National Research Council Canada - National Science Library

    Louw, D.J

    2010-01-01

    The core problem: whether a theological paradigm in theory formation for a pastoral anthropology, derived from, and coming from the very positivistic stance of orthodoxy, is appropriate for counselling people within...

  12. Deploying Myths through Facts and Fictions in the Struggle for Tanzanians' National Soul in Ebrahim N. Hussein's Kinjeketile

    Directory of Open Access Journals (Sweden)

    S. O. Solanke

    2013-06-01

    Full Text Available Creating myths and mythologies out of facts and fictions has been known to man for a long time. The practice of using them for freedom struggle is something very recent, amongst the many situations they are intended for. This position, taken to a higher level, is predominant in Ebrahim N. Hussein’s Kinjeketile: creating new myths from the old to fight a pressing national societal dilemma. The Tanzanians, in unbundling the shackles of the Germans in the late 19th century to the early 20th century, had to recreate and utilize the myths of unity and inner strength through a prophet-seer, Kinjeketile. He became a rallying point through his divinely given gifts of water and fly-whisk. For him and the freedom of the nation, the people went to war. This paper, therefore, sees the possibility of a conquered, separated and disunited people becoming a whole and unified nation in the face of an enemy: freedom is achievable with the remaking of the old myths to suit, serve and fight new social problems as they arise.

  13. In search of the soul in science: medical ethics' appropriation of philosophy of science in the 1970s.

    Science.gov (United States)

    Aronova, Elena

    2009-01-01

    This paper examines the deployment of science studies within the field of medical ethics. For a short time, the discourse of medical ethics became a fertile ground for a dialogue between philosophically minded bioethicists and the philosophers of science who responded to Thomas Kuhn's challenge. In their discussion of the validity of Kuhn's work, these bioethicists suggested a distinct interpretation of Kuhn, emphasizing the elements in his account that had been independently developed by Michael Polanyi, and propelling a view of science that retreated from idealizations of scientific method without sacrificing philosophical realism. Appropriating Polanyi, they extended his account of science to biology and medicine. The contribution of Karl Popper to the debate on the applicability of philosophy of science to the issues of medical ethics provides the opportunity to discuss the ways in which political agendas of different epistemologies of science intertwined with questions of concern to medical ethics.

  14. Notes et hypothèses sur les soulèvements en Tunisie et en Égypte.

    OpenAIRE

    Hass, Catherine

    2011-01-01

    International audience; Mon propos est de tenter d'analyser quelques aspects qui m'ont frappée quant à ce qui a eu lieu en Tunisie et en Égypte. Ces aspects, outre la bascule irréversible qu'ils opèrent dans ces pays, inscrivent, selon moi, ces révoltes nationales internes ("Le peuple tunisien est indépendant" ou "Nous sommes un peuple libre dans un pays libre") dans le contemporain des configurations étatiques. Nous verrons que cela écarte d'emblée une analyse en termes post-coloniaux ou de ...

  15. René Descartes, the Robots and the Soul in the debate between Tommaso Ceva and Guido Grandi

    Directory of Open Access Journals (Sweden)

    Alfredo Serrai

    2016-05-01

    Full Text Available Descartes outlined human intelligence as a divine gift, albeit in a system governed by universal laws of physics and mathematics. In the eighteenth century the camaldolite Guido Grandi and Tommaso Ceva, both mathematicians, had a dispute about the interpretation of the Cartesian model of human intelligence. This case provides an opportunity to retrace the path of a speculative techno-philosophical question concerning the human possibility to equipping robots with the ability to experience a self-consciousness.

  16. The Battle for the Soul of Management Denmark-The Shaping of the Danish Versions of Business Process Reengineering

    DEFF Research Database (Denmark)

    Koch, Christian; Vogelius, Peter

    1997-01-01

    it might be possible to find new ways of handling the development of labour. Although not as powerful as their rhetoric, the concepts do have impact on the development of the organisation and labour. Thus the fads and the concepts is societally facilitating new visions and theories on the development......Managerial theory distilled into tidy concepts is continually and almost ritually launched into the international and national management audiences. The paper discuss the contemporary exemplar of such management concepts: Business Process Reengineering (BPR). By taking the management fads serious...... at central elements between Danish BPR-promoters. They occurred on the issues of employment effects, change management, employee participation, the role of IT, and radical change. On the other hand convergence occurred on the cross functional process view and the silencing of the work-visions formulated...

  17. Is Comfort Food Really Good for the Soul? A Replication of Troisi and Gabriel’s (2011 Study 2

    Directory of Open Access Journals (Sweden)

    Lay See eOng

    2015-04-01

    Full Text Available We report the results of three high-powered replications of Troisi and Gabriel’s (2011 idea that writing about comfort food reduces feelings of loneliness amongst securely attached individuals after a belongingness threat. We conducted our studies amongst a large group of participants (Total N = 649 amongst American (MTurk, Dutch (Tilburg University; TiU, and Singaporean (Singapore Management University; SMU samples. Participants first completed an attachment style scale, followed by writing two essays for manipulating a sense of belongingness and salience of comfort food, and then reporting their loneliness levels. We did not confirm the overall effect over all three countries. However, exploratory results provide the preliminary suggestion that 1 the comfort food explanation likely holds amongst the American samples (including Troisi & Gabriel’s, but not amongst the TiU and SMU samples, and potentially that 2 the TiU and SMU participants self-regulate through warmer (vs. colder temperature foods. Both of these should be regarded with great caution as these analyses were exploratory, and because the Ns for the different temperature foods were small. We suspect we have uncovered first cross-cultural differences in self-regulation through food, but further confirmatory work is required to understand the cultural significance of comfort food for self-regulation.

  18. Windows to the soul: vision science as a tool for studying biological mechanisms of information processing deficits in schizophrenia.

    Science.gov (United States)

    Yoon, Jong H; Sheremata, Summer L; Rokem, Ariel; Silver, Michael A

    2013-10-31

    Cognitive and information processing deficits are core features and important sources of disability in schizophrenia. Our understanding of the neural substrates of these deficits remains incomplete, in large part because the complexity of impairments in schizophrenia makes the identification of specific deficits very challenging. Vision science presents unique opportunities in this regard: many years of basic research have led to detailed characterization of relationships between structure and function in the early visual system and have produced sophisticated methods to quantify visual perception and characterize its neural substrates. We present a selective review of research that illustrates the opportunities for discovery provided by visual studies in schizophrenia. We highlight work that has been particularly effective in applying vision science methods to identify specific neural abnormalities underlying information processing deficits in schizophrenia. In addition, we describe studies that have utilized psychophysical experimental designs that mitigate generalized deficit confounds, thereby revealing specific visual impairments in schizophrenia. These studies contribute to accumulating evidence that early visual cortex is a useful experimental system for the study of local cortical circuit abnormalities in schizophrenia. The high degree of similarity across neocortical areas of neuronal subtypes and their patterns of connectivity suggests that insights obtained from the study of early visual cortex may be applicable to other brain regions. We conclude with a discussion of future studies that combine vision science and neuroimaging methods. These studies have the potential to address pressing questions in schizophrenia, including the dissociation of local circuit deficits vs. impairments in feedback modulation by cognitive processes such as spatial attention and working memory, and the relative contributions of glutamatergic and GABAergic deficits.

  19. If Leviathan Has a Face, Does Gaia Have a Soul?: Incorporating Environmental Education in Marine Eco-tourism Programs.

    Science.gov (United States)

    Forestell, Paul H.

    1993-01-01

    Presents a model for structuring marine eco-tourism programs to capitalize on a range of cognitive states experienced by tourists in a novel marine environment setting. The model is demonstrated in the context of a whalewatch trip in Hawaii. Discusses questions about the suitability and effectiveness of the model. (Author/MDH)

  20. Protein (Cyanobacteria): 496702237 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available rane protein insertion efficiency factor Raphidiopsis brookii MKKLFIWPIQGYRLFISPLFPPSCRFQPTCSMYAIEAIERFGVFRGSWMALGRILRCHPFHPGGYDPVPEKTEKSP ... WP_009343780.1 ... 1117:21902 ... 1161:3859 ... 1162:2697 244599:1669 668331:1669 ... memb

  1. Kindlustussektorit häirib riigi sekkumine / Stan Nahkor

    Index Scriptorium Estoniae

    Nahkor, Stan

    2011-01-01

    Neli tippjuhti viiest peab riigipoolset ülereguleerimist kindlustussektori kriitiliseks probleemiks. PwC ja CSFI uuring näitab, et kindlustussektori jaoks on seaduste ülemäärane regulatsioon kahe aastaga suurenenud olulisimaks riskiallikaks

  2. Molecular investigations on grain filling rate under terminal heat ...

    African Journals Online (AJOL)

    Molecular investigations on grain filling rate under terminal heat stress in bread wheat (Triticum aestivum L.) Girish Chandra Pandey, Jagadish Rane, Sindhu Sareen, Priyanka Siwach, NK Singh, Ratan Tiwari ...

  3. Ameerika pidu saab läbi / Hans-Werner Sinn

    Index Scriptorium Estoniae

    Sinn, Hans-Werner, 1948-

    2008-01-01

    Ilmunud ka: Delovõje Vedomosti 26. märts lk. 33. Jooksevkonto defitsiit, ülemäärane tarbimine ja katteta laenud USA-s on toonud lõpu ebatavaliselt pikale majanduskasvu perioodile maailmamajanduses

  4. Dvenadtsat muzhtshin ohhotjatsja za lvom / Vladimir Barsegjan

    Index Scriptorium Estoniae

    Barsegjan, Vladimir

    2007-01-01

    Režissöör Nikita Mihhalkov osaleb Veneetsia 64. filmifestivalil oma uue filmiga "12", mis on Sidney Lumet' kuulsa filmi "12 vihast meest" ("12 Angry Men" : Ameerika Ühendriigid 1957) omapärane uusversioon

  5. Experiment list: SRX100887 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ranes were collected from women who underwent planned cesarean delivery at term, before labor and without ru...an || cell description=chorion cells (outermost of two fetal membranes), fetal membranes were collected from women

  6. Finantsvõimenduse mõju ehitusettevõtete majandustulemustele kriisiperioodil / Indrek Golberg

    Index Scriptorium Estoniae

    Golberg, Indrek

    2006-01-01

    Finantsvõimenduse taseme mõjust ettevõtte majandustulemustele olukorras, kus tavapärane majandusolukord on järsult halvenenud. Eestis oli selliseks situatsiooniks eelmise kümnendi majanduslangus. Tabelid. Graafikud

  7. Altruism in Taras Shevchenko’ poetic philosophical creation

    Directory of Open Access Journals (Sweden)

    O. B. Feldman

    2015-02-01

    The word «soul» extends and deepens  the symbolic value of altruism, specifies him: soul­love, soul­suffering, soul­mercy, soul­sympathy. In poems and stories Mr. Shevchenko’s altruistic displays have appearance of kobza­player.

  8. Parima ulmeteose kirjutas Kivirähk

    Index Scriptorium Estoniae

    2008-01-01

    Ulmeauhind Stalker 2008 - tõlkeromaan: Martin, George R. R. Troonide mäng / tlk. Mario Kivistik; tõlkejutt: Card, Orson Scott. Kuninglik liha; algupärane raamat: Kivirähk, Andrus. Mees, kes teadis ussisõnu; algupärane jutt: Veskimees, Siim. Keskpäevapimedus; parim eesti autori jutt: Risto, Taivo. Laatsaruse rahamasin. Vt. ka Looming, 2008, nr. 8, lk. 1271

  9. Soul hands clap in the 60s: history and African American poetryDOI:10.5007/2175-8026.2010n59p84

    Directory of Open Access Journals (Sweden)

    Brenda Flanagan

    2010-03-01

    Full Text Available Just as the modern Civil Rights Movement differed from previous ones in style and substance, the poetry of the 1960s, and especially the late 60s, offered a new way of talking, an especially noticeable sea change in mood, that was, I argue, a consequence of two sets of significant events: one, the 1966 "Black power" speech of Stokely Carmichael ( Kwame Toure in Greenwood, Mississippi, and, in tandem, the deaths of Medgar Evers (1963, Malcolm X (1965, and the Rev. Dr. Martin Luther King, Jr. (1968.

  10. A bridge between a lonely soul and the surrounding world: A study on existential consequences of being closely related to a person with aphasia.

    Science.gov (United States)

    Nyström, Maria

    2011-01-01

    This study illuminates existential consequences of being closely related to a person suffering from aphasia. Seventeen close relatives were interviewed and their narratives were interpreted with inspiration from Ricoeur, Levinas, Husserl, Winnicot, and Maurice Merleau-Ponty. The emerging interpretations resulted in four themes that illuminate a life characterized by lost freedom, staying, a new form of relationship, and growing strong together with others. An overarching theme suggests that a life together with an aphasic person means being used as a bridge between the aphasic person and the surrounding world. Moreover, it illuminates that a close relative to a person with aphasia is a person who does not leave, despite a heavy burden of lonely responsibility. It is concluded that community services need to fulfill their responsibility of providing support to informal caregivers as suggested by the Swedish lawmakers.

  11. Salt in the soul, steel in the eye and caution towards the winds: a mariner's guide for navigating a new academic psychiatry department.

    Science.gov (United States)

    Looi, Jeffrey Cl; Bonner, Daniel; Maguire, Paul; Parige, Raj; Tedeschi, Michael; Cubis, Jeffrey C; Cartledge, Bjorn; Keightley, Philip; Reay, Rebecca E; Craigie, Peggy

    2017-09-01

    This paper describes principles and advice regarding the development of a new academic psychiatry department within a medical school for aspiring academic psychiatrists. We describe general principles based on the experience of the foundation of the Academic Unit of Psychiatry and Addiction Medicine at the Australian National University Medical School. Perspicacious leadership and organisation are the foundation for an academic psychiatry department which delivers teaching, research and broader intellectual engagement with the medical and broader community.

  12. Scared to Death? Generalized Anxiety Disorder and Cardiovascular Events in Patients With Stable Coronary Heart Disease The Heart and Soul Study

    NARCIS (Netherlands)

    Martens, Elisabeth J.; de Jonge, Peter; Na, Beeya; Cohen, Beth E.; Lett, Heather; Whooley, Mary A.

    Context: Anxiety is common in patients with coronary heart disease (CHD), but studies examining the effect of anxiety on cardiovascular prognosis and the role of potential mediators have yielded inconsistent results. Objectives: To evaluate the effect of generalized anxiety disorder (GAD) on

  13. A bridge between a lonely soul and the surrounding world: A study on existential consequences of being closely related to a person with aphasia

    Science.gov (United States)

    Nyström, Maria

    2011-01-01

    This study illuminates existential consequences of being closely related to a person suffering from aphasia. Seventeen close relatives were interviewed and their narratives were interpreted with inspiration from Ricoeur, Levinas, Husserl, Winnicot, and Maurice Merleau-Ponty. The emerging interpretations resulted in four themes that illuminate a life characterized by lost freedom, staying, a new form of relationship, and growing strong together with others. An overarching theme suggests that a life together with an aphasic person means being used as a bridge between the aphasic person and the surrounding world. Moreover, it illuminates that a close relative to a person with aphasia is a person who does not leave, despite a heavy burden of lonely responsibility. It is concluded that community services need to fulfill their responsibility of providing support to informal caregivers as suggested by the Swedish lawmakers. PMID:22114621

  14. Heart and/or soul : reality and fiction in the association between the two strongest contributors to the global burden of disease - ischemic heart disease and depression

    NARCIS (Netherlands)

    de Jonge, Peter

    Depression and heart disease are the strongest contributors to the global burden of disease and are often intertwined: depression is a risk factor for heart disease and vice versa. Moreover, depression in patients with established heart disease is associated with cardiovascular disease progression.

  15. Diabetes, glycemic control, and new-onset heart failure in patients with stable coronary artery disease : data from the heart and soul study

    NARCIS (Netherlands)

    van Melle, J.P.; Bot, M.; de Jonge, P.; de Boer, R.A.; van Veldhuisen, D.J.; Whooley, M.A.

    2010-01-01

    OBJECTIVE Diabetes is a predictor of both coronary artery disease (CAD) and heart failure. It is unknown to what extent the association between diabetes and heart failure is influenced by other risk factors for heart failure. RESEARCH DESIGN AND METHODS We evaluated the association of diabetes and

  16. "Souls of the ancestor that knock us out" and other tales. A qualitative study to identify demand-side factors influencing malaria case management in Cambodia.

    Science.gov (United States)

    O'Connell, Kathryn A; Samandari, Ghazaleh; Phok, Sochea; Phou, Mean; Dysoley, Lek; Yeung, Shunmay; Allen, Henrietta; Littrell, Megan

    2012-10-05

    Appropriate case management of suspected malaria in Cambodia is critical given anti-malarial drug resistance in the region. Improving diagnosis and the use of recommended malarial treatments is a challenge in Cambodia where self-treatment and usage of drug cocktails is widespread, a notable difference from malaria treatment seeking in other countries. This qualitative study adds to the limited evidence base on Cambodian practices, aiming to understand the demand-side factors influencing treatment-seeking behaviour, including the types of home treatments, perceptions of cocktail medicines and reasons for diagnostic testing. The findings may help guide intervention design. The study used in-depth interviews (IDIs) (N = 16) and focus group discussions (FGDs) (N = 12) with Cambodian adults from malaria-endemic areas who had experienced malaria fever in the previous two weeks. Data were analysed using NVivo software. Findings suggest that Cambodians initially treat suspected malaria at home with home remedies and traditional medicines. When seeking treatment outside the home, respondents frequently reported receiving a cocktail of medicines from trusted providers. Cocktails are perceived as less expensive and more effective than full-course, pre-packaged medicines. Barriers to diagnostic testing include a belief in the ability to self-diagnose based on symptoms, cost and reliance on providers to recommend a test. Factors that facilitate testing include recommendation by trusted providers and a belief that anti-malarial treatment for illnesses other than malaria can be harmful. Treatment-seeking behaviour for malaria in Cambodia is complex, driven by cultural norms, practicalities and episode-related factors. Effective malaria treatment programmes will benefit from interventions and communication materials that leverage these demand-side factors, promoting prompt visits to facilities for suspected malaria and challenging patients' misconceptions about the effectiveness of cocktails. Given the importance of the patient-provider interaction and the pivotal role that providers play in ensuring the delivery of appropriate malaria care, future research and interventions should also focus on the supply side factors influencing provider behaviour.

  17. Souls of the ancestor that knock us out” and other tales. A qualitative study to identify demand-side factors influencing malaria case management in Cambodia

    Directory of Open Access Journals (Sweden)

    O’Connell Kathryn A

    2012-10-01

    Full Text Available Abstract Background Appropriate case management of suspected malaria in Cambodia is critical given anti-malarial drug resistance in the region. Improving diagnosis and the use of recommended malarial treatments is a challenge in Cambodia where self-treatment and usage of drug cocktails is widespread, a notable difference from malaria treatment seeking in other countries. This qualitative study adds to the limited evidence base on Cambodian practices, aiming to understand the demand-side factors influencing treatment-seeking behaviour, including the types of home treatments, perceptions of cocktail medicines and reasons for diagnostic testing. The findings may help guide intervention design. Methods The study used in-depth interviews (IDIs (N = 16 and focus group discussions (FGDs (N = 12 with Cambodian adults from malaria-endemic areas who had experienced malaria fever in the previous two weeks. Data were analysed using NVivo software. Results Findings suggest that Cambodians initially treat suspected malaria at home with home remedies and traditional medicines. When seeking treatment outside the home, respondents frequently reported receiving a cocktail of medicines from trusted providers. Cocktails are perceived as less expensive and more effective than full-course, pre-packaged medicines. Barriers to diagnostic testing include a belief in the ability to self-diagnose based on symptoms, cost and reliance on providers to recommend a test. Factors that facilitate testing include recommendation by trusted providers and a belief that anti-malarial treatment for illnesses other than malaria can be harmful. Conclusions Treatment-seeking behaviour for malaria in Cambodia is complex, driven by cultural norms, practicalities and episode-related factors. Effective malaria treatment programmes will benefit from interventions and communication materials that leverage these demand-side factors, promoting prompt visits to facilities for suspected malaria and challenging patients’ misconceptions about the effectiveness of cocktails. Given the importance of the patient-provider interaction and the pivotal role that providers play in ensuring the delivery of appropriate malaria care, future research and interventions should also focus on the supply side factors influencing provider behaviour.

  18. Śmierć Sokratesa. Śmierć jako oddzielenie ciała i duszy (Socrates' Death. Death as Separation of Body and Soul

    Directory of Open Access Journals (Sweden)

    Eberhard Jungel

    2006-06-01

    Full Text Available Der Tod des Sokrates. Der Tod als Trennung von Leib und Seele (ZusammenfassungIm hier übersetztem Fragment präsentiert der Autor die platonische Vorstellung des Todes (und ihrem Zusammenbund mit der Erkenntnis, insbesondere mit der Selbsterkenntnis. Er Tut das auf Grund der letzten Tage Sokrates, beschriebenen vor allem im Dialog Fedon. Diese Vorstellung stellt er nächst dem biblischen Verständnis des Todes gegenüber. Der Autor betont, daβ Platonismus, sehr stark Einfluss hattend auf das Christentum, das biblische Verständnis über das Ende des Lebens entstellte. Als eine teologische Aufgabe verbleibt die Entplatonisierung des Christentums und Belebung des ursprünglichen, enthalten im Alten und Neuen Testament, Verständnisses des Todes.

  19. A bridge between a lonely soul and the surrounding world: A study on existential consequences of being closely related to a person with aphasia

    Directory of Open Access Journals (Sweden)

    Maria Nyström

    2011-11-01

    Full Text Available This study illuminates existential consequences of being closely related to a person suffering from aphasia. Seventeen close relatives were interviewed and their narratives were interpreted with inspiration from Ricoeur, Levinas, Husserl, Winnicot, and Maurice Merleau-Ponty. The emerging interpretations resulted in four themes that illuminate a life characterized by lost freedom, staying, a new form of relationship, and growing strong together with others. An overarching theme suggests that a life together with an aphasic person means being used as a bridge between the aphasic person and the surrounding world. Moreover, it illuminates that a close relative to a person with aphasia is a person who does not leave, despite a heavy burden of lonely responsibility. It is concluded that community services need to fulfill their responsibility of providing support to informal caregivers as suggested by the Swedish lawmakers.

  20. "We are the soul, pearl and beauty of Hindu Kush Mountains": exploring resilience and psychological wellbeing of Kalasha, an ethnic and religious minority group in Pakistan.

    Science.gov (United States)

    Choudhry, Fahad Riaz; Park, Miriam Sang-Ah; Golden, Karen; Bokharey, Iram Zehra

    2017-12-01

    The Kalasha are a marginalized ethnic and religious minority group in northern Pakistan. The Kalasha minority is known for their divergent polytheistic beliefs, and represents the outliers of the collectively monotheistic Muslim population of Pakistan. This study aimed to explore the psychological resilience beliefs and lived experiences of the Kalasha and to identify cultural protective factors and indigenous beliefs that help them maintain psychological wellbeing and resilience. Seven semi-structured interviews and two focus-group discussions were conducted. The total sample consisted of 6 women and 8 men, aged 20-58 years (Mage = 36.29, SD = 12.58). The Interpretative Phenomenological Analysis qualitative method was chosen. Study findings identified that factors contributing to the wellbeing, happiness and resilience enhancement beliefs of Kalasha included five main themes, all influenced by their unique spirituality: contentment, pride in social identity, tolerance, gender collaboration and gratitude. The study also revealed the Kalasha's perception of their marginalization related to challenges and threats. The Kalasha emphasized bringing these resilience enhancement beliefs into practice, as a mean to buffer against challenges. In conclusion, this study revealed Kalasha's wellbeing and resilience enhancement factors, which they believed in and practiced as an element of their indigenous culture and religion.

  1. Yeast: the soul of beer's aroma--a review of flavour-active esters and higher alcohols produced by the brewing yeast.

    Science.gov (United States)

    Pires, Eduardo J; Teixeira, José A; Brányik, Tomás; Vicente, António A

    2014-03-01

    Among the most important factors influencing beer quality is the presence of well-adjusted amounts of higher alcohols and esters. Thus, a heavy body of literature focuses on these substances and on the parameters influencing their production by the brewing yeast. Additionally, the complex metabolic pathways involved in their synthesis require special attention. More than a century of data, mainly in genetic and proteomic fields, has built up enough information to describe in detail each step in the pathway for the synthesis of higher alcohols and their esters, but there is still place for more. Higher alcohols are formed either by anabolism or catabolism (Ehrlich pathway) of amino acids. Esters are formed by enzymatic condensation of organic acids and alcohols. The current paper reviews the up-to-date knowledge in the pathways involving the synthesis of higher alcohols and esters by brewing yeasts. Fermentation parameters affecting yeast response during biosynthesis of these aromatic substances are also fully reviewed.

  2. Relation of Beta Blocker Use With Frequency of Hospitalization for Heart Failure in Patients With Left Ventricular Diastolic Dysfunction (From the Heart and Soul Study)

    OpenAIRE

    Smith, Dustin T.; Farzaneh-Far, Ramin; Ali, Sadia; Na, Beeya; Whooley, Mary A.; Schiller, Nelson B.

    2010-01-01

    Heart failure (HF) is a common public health problem, and many new cases are now recognized to occur in patients with preserved left ventricular (LV) ejection fraction. Beta blockers improve outcomes in patients with known LV systolic dysfunction, but whether beta blockers provide similar protection in patients with LV diastolic dysfunction is unclear. We studied the association between the use of beta blockers and subsequent hospitalization for HF in patients with diastolic dysfunction and s...

  3. Moderators of Intervention Dose Effects on Diet Quality and Physical Activity Changes in a Church-Based, Multicomponent, Lifestyle Study: Delta Body and Soul III

    Science.gov (United States)

    Thomson, J. L.; Zoellner, J. M.; Tussing-Humphreys, L. M.; Goodman, M. H.

    2016-01-01

    Many community-based lifestyle interventions targeting African Americans have reported positive effects on participants' dietary choices and physical activity habits. However, these effects vary and not all participants will have outcome changes. Moderation analysis can help explain differential effects observed, but are not often reported. Hence,…

  4. Will My Soul Go to Heaven If They Take My Brain? Beliefs and Worries About Brain Donation Among Four Ethnic Groups.

    Science.gov (United States)

    Boise, Linda; Hinton, Ladson; Rosen, Howard J; Ruhl, Mary

    2017-08-01

    Studying the brain through autopsy is an essential component of Alzheimer's disease research. Racial and ethnic minorities are underrepresented in Alzheimer's research generally and, in particular, in the number of completed brain autopsies. We explored beliefs about and attitudes toward brain donation among African American, Chinese, Caucasian, and Latino research subjects and their family members through focus groups at 4 NIH-funded Alzheimer's Disease Centers. Eighteen focus groups were conducted with 61 research subjects and 34 family members. Because the primary purpose of the focus groups was to identify the range of considerations that may influence the decision to participate in brain donation, data from focus groups were pooled and then analyzed. We found that many of the concerns, attitudes, and beliefs about brain donation were similar across the 4 ethnic groups. Concerns and attitudes fell into 3 categories: (a) concerns and misconceptions about brain research and the process of brain removal, (b) religious beliefs, and (c) the role of the family. Our findings suggest that interventions to enhance enrollment in brain donation that target factors identified in this study are likely to be relevant to people from a broad range of backgrounds and ethnicities. Nonetheless, we observed some potential differences among racial/ethnic groups that may affect how research volunteers and their families approach a decision about donating their brain for research. Further study is warranted to explore these and other possible culturally distinct attitudes and beliefs about brain donation.

  5. Cafe de la Soul jätkab superdiivadega. Mutant ja Bashment juhatavad sisse tantsumuusika-festivali. Bonboni pidu Pärnus

    Index Scriptorium Estoniae

    2002-01-01

    Võimsahäälne tantsumuusika-diiva Michelle Weeks Club-Hollywoodis 12. juulil. Juulikuine "Mutant Disco" ja "Bashment" on kuulutatud Sun Dance Music Festivali ametlikuks eelpeoks 12. juulil Von Krahlis. Tallinlane Bonbon korraldab Pärnu klubis Sunset suvise peo

  6. Self-Actualization: The Heart and Soul of a Potential-Based Life Skills Program for a Child with Multiple Disabilities

    Science.gov (United States)

    Croft, Gillian; Boyer, Wanda; Hett, Geoffrey

    2009-01-01

    Although every child with disabilities may come to self-actualization by different means and measurements it is, nevertheless, an important goal. The child with disabilities may be guided toward her goal of self-actualization by being encouraged to find her individual strengths and capacities, and by being assisted to successfully interact with…

  7. [19.-21. juulini korraldas Eesti Ulmeühing viiendat korda Eesti ulmehuviliste kokkutuleku "Estcon 2002". Tehti teatavaks ka aastaauhinnad Stalker laureaadid

    Index Scriptorium Estoniae

    2002-01-01

    Stalkeri laureaadid. Parim tõlkeromaan Roger Zelazny "Üksildane oktoobriöö" (Varrak, tlk. Juhan Habicht); parim kogumik Norman Spinradi "Suur lõõsk" (Skarabeus, tlk., koost. ja toim. Arvi Nikkarev); parim tõlkejutt "Katkuaastate päevikud" samast raamatust; parim algupärane raamat Indrek Hargla (õieti Marat Faizijev) kogumik "Pan Grpowski üheksa juhtumit" (Kuldsulg); parimaks algupärane jutustus Marat Faizijevi "Väendru" (Algernon, 2001, dets.); parim lühijutt Erkki Kõlu "Õnn kaalule, vana!" (Algernon, 2001, dets.)

  8. Analogues of Euler and Poisson summation formulae

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 113; Issue 3. Analogues of Euler and Poisson Summation Formulae. Vivek V Rane. Volume 113 Issue 3 ... Keywords. Abel's summation formula; Euler summation formula; Euler–Maclaurin summation formula; Poisson's summation formula; Fourier series.

  9. Eestlanna armukadeduse antidoodina Off-Off- Broadwayl / Mardi Valgemäe

    Index Scriptorium Estoniae

    Valgemäe, Mardi, 1935-

    2007-01-01

    pikemat aega New Yorgi teatrites tegutsenud eesti soost näitlejatari Reet Roos Värniku rollist Fernand Crommelyncki komöödias "Suurepärane sarvekandja" New Yorgi Off-Off Broadway rühmitises East Rives Commedia, mida esitatakse Connelly teatris

  10. Ebaseadusliku riigiabi saaja usalduse kaitstavus riigiabi tagasinõudmise korral / Sandor Elias

    Index Scriptorium Estoniae

    Elias, Sandor

    2014-01-01

    Riigiabi tagasinõudmise kohustus ja selle täitmine. Riigiabi saaja õiguspärane ootus riigiabi tagasinõudmise haldusakti andmisel. Artikkel põhineb autori 29. mail 2014 kaitstud magistritööl, mille teemaks oli „Riigiabi saaja õiguskaitsevahendid ebaseadusliku riigiabi tagastamise kohustuse korral“

  11. Guidelines Manual: Post Accident Procedures for Chemicals and Propellants.

    Science.gov (United States)

    1983-01-01

    or may not be the sane one that handles 4. Bom rane shuld ot e slwed product transfer. This primarily de-~4.Bom cans houd otbe leed pends upon the...DATA Stability -Will react with many inorganic and organic oosinus. seL"IY with an evolution of heat. ICompatibility-Material: Selo " 230 degree F

  12. Ilon Wiklandi Imedemaa muudab tagasi lapseks / Janar Ala

    Index Scriptorium Estoniae

    Ala, Janar, 1979-

    2009-01-01

    Haapsalus avati 1. juulil 2009. a. lastepärane teemakeskus Iloni Imedemaa, kus saab tutvuda raamatuillustraatori Ilon Wiklandi kujutatud tegelastega. Avamisel viibis ka proua Evelin Ilves koos tütre Kadri Keiuga. Samal teemal ka "Pildi sisse: Iloni Imedemaa avab tee kunstniku loomingusse" lk. 1. Fotod sündmusest vt. ka: Postimees : Arter 4. juuli 2009, lk. 16, pealk.: Imedemaa Haapsalus

  13. Jaapanist mõeldes / Tiina Tammet

    Index Scriptorium Estoniae

    Tammet, Tiina, 1971-

    2003-01-01

    Keraami Annika Tedre jaapanipärane ridamaja aed Tallinna aedlinnas loob majaga (arhitekt Martin Aunin, sisearhitekt Enn Kivi) hästisobiva koosluse. Maja on viimistletud läbikumava sinisega toonitud kuusevineeriga. Aiakujundaja Liina Rehepapp. Siseruumist, bonsai-mändidest, kividest, veest, taimedest. 15 ill

  14. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Unprecedented hetero-geometric discrete copper(II) complexes: Crystal structure and bio-mimicking of Catecholase activity · ABHRANIL DE DHANANJAY DEY HARE RAM YADAV MILAN MAJI VINAYAK RANE R M KADAM ANGSHUMAN ROY CHOUDHURY BHASKAR BISWAS · More Details Abstract Fulltext PDF.

  15. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. S D Katore. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 227-237 Research Articles. Magnetized cosmological models in bimetric theory of gravitation · S D Katore R S Rane · More Details Abstract Fulltext PDF. Bianchi type-III ...

  16. Mormoonid võõrustavad olümpiat / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2002-01-01

    Taliolümpiamängude linn Salt Lake City on pooleteise sajandiga kasvanud väikesest mormoonide asulast kümne miljoni mormooni maailmapealinnaks. Kaart : Utah osariik. Lisa : Markus Larsson. Toretsev, salapärane ja võimas usulahk

  17. Prof dr Pasquale Pistone soovitab direktiive vahetult kohaldada / Pasquale Pistone ; interv. Erki Uustalu

    Index Scriptorium Estoniae

    Pistone, Pasquale

    2005-01-01

    Intervjuu Salerno Ülikooli teaduskonna dotsendiga, kes õpetas Eesti ametnikele Euroopa Kohtu pretsedendiõigust otseste maksude valdkonnas. Lisatud kommentaarid: Reimer, Ekkehart. Euroopa maksutaeva tõusev täht ; Uustalu, Erki. Särav isiksus, suurepärane suhtleja ; Pahapill Helen. Väljapaistev õigusteadlane ja hinnatud õppejõud. Lisatud ka Pasquale Pristone elulugu

  18. Diktator ishtshet druzei / Thomas Rozer

    Index Scriptorium Estoniae

    Rozer, Thomas

    2005-01-01

    Valgevene president Anatoli Lukashenko kurtis telekanalile TV-Tsentr antud intervjuus avameelselt üksinduse ja sõprade vähesuse üle, presidenti paneb muretsema ka ebamäärane majanduslik olukord, mis ootab teda presidendi ametist lahkumisel

  19. Influence of argon plasma treatment on polyethersulphone surface

    Indian Academy of Sciences (India)

    N L Singh1 S M Pelagade1 R S Rane2 S Mukherjee2 U P Deshpande3 V Ganeshan3 T Shripathi3. Department of Physics, M.S. University of Baroda, Vadodara 390 002, India; FCIPT, Institute for Plasma Research, Gandhinagar 382 044, India; UGC-DAE-CSR, University Campus, Khandawa Road, Indore 452 017, India ...

  20. Sherlock Holmes - esteedist härrasmees või kokaiinisõltlasest rusikakangelane? / Martin Saar

    Index Scriptorium Estoniae

    Saar, Martin

    2010-01-01

    Autor poleemiseerib Margit Adorfi kriitilise artikli "Härrast rusikakangelaseks" (Eesti Ekspress: TV Ekspress, 2010, 15.-21. jaan., lk. 3 ) teemadel. Võrdluses on Arthur Conan Doyle' poolt loodud tegelaskuju ja tema tõepärane kujutamine Guy Ritchie filmis "Sherlock Holmes" (Inglise-Austraalia-USA 2009)

  1. Minnaert ئ Utrechti Ülikooli uus õppehoone / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    1998-01-01

    Professor Minnaerti auks nimetatud füüsika ja astronoomia teaduskondade uus õppehoone on osa Koolhaasi arhitektuuribüroo OMA koostatud Utrechti Ülikooli uuendusprojektist. Arhitekt Willem Jan Neutelings. Ebakorrapärane kastikujuline maja on terrakotapunase fassaadiga. Teisel korrusel olevast omapärasest kogunemis-suhtlemishallist.

  2. A spiral-like chain from a hydrogen-bonded cyclic dichloride contain ...

    Indian Academy of Sciences (India)

    TECS

    A spiral-like chain from a hydrogen-bonded cyclic dichloride contain- ing a water dimer in a quaternary diammonium dichloride trihydrate. #. BIKSHANDARKOIL R SRINIVASAN,1,* RATHAN G MHALSIKAR,1 KOYAR S RANE,1. CHRISTIAN NÄTHER2 and WOLFGANG BENSCH2. 1Department of Chemistry, Goa University ...

  3. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. P Y Sawant. Articles written in Bulletin of Materials Science. Volume 24 Issue 3 June 2001 pp 323-330 Chemical Beneficiation. Dielectric behaviour of MgFe2O4 prepared from chemically beneficiated iron ore rejects · K S Rane V M S Verenkar P Y Sawant · More Details ...

  4. Standardization of the Denver Developmental Screening Test on Infants from Yucatan, Mexico.

    Science.gov (United States)

    Solomons, Hope C.

    1982-01-01

    Standardization of the Denver Developmental Screening Test (DDST) on 288 babies raning in age from two to 54 weeks in Yucatan, Mexico, yielded such findings as that subtest scores increased with age, and that the DDST failed to identify a "questionable" 16 or 17 babies with borderline scores on the Bayley Motor Scale. (Author/MC)

  5. Hea maine avab südameid / Aune Past

    Index Scriptorium Estoniae

    Past, Aune, 1954-

    2008-01-01

    Autor selgitab, et suhtekorraldus on pidev ja plaanipärane tegevus, mille tulemusena lähenevad organisatsiooni soovitud imago ja avalik kuvand teineteisele. Suhtekorraldus ei tähenda kehvast asjast hästi rääkimist, vaid tõel ja faktidel põhineva loo jutustamist

  6. Tänavune provintsiteatripäev soovis Koidulaulikule õnne sünnipäevaks / Ene Kallas

    Index Scriptorium Estoniae

    Kallas, Ene

    2008-01-01

    Muljeid Saaremaa 11. provintsiteatripäevalt, mis pühendatud Lydia Koidula 165. sünniaastapäevale. Kuus näiteseltskonda esitas Koidula näidendid "Kosjakased", "Säärane mulk ehk Sada vakka tangusoola", "Saaremaa onupoeg" ja Tõnis Kipperi versiooni näidendist "Kosjaviinad" ning luulekompositsiooni "Mu isamaa on minu arm"

  7. Martela näitus Milanos

    Index Scriptorium Estoniae

    2008-01-01

    Soome mööblitootja Martela korraldab Milano mööblimessil näituse "under THE tree", kus esitleb uute toodete seas Geir Saetveiti tooli "Skybar", Rane Vaskivuori sohvat "Movie" ja Olli Mannermaa tooli "Kilta" (toodetakse 1955. aastast). Näitus on nime saanud Eero Aarnio loodud ruumijagaja "The Tree", mida messil tutvustatakse, järgi

  8. Läti piim ja Leedu leib trügivad Eesti värvesse / Hindrek Riikoja

    Index Scriptorium Estoniae

    Riikoja, Hindrek

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 16. märts lk. 8. Põhjustest, miks Eesti toidutööstuse ettevõtted toovad poelettidele välimuselt küll kodumaiseid, kuid tegelikult Lätis ja Leedus toodetud kaupu. Lisa: Salapärane private label

  9. Haematological and anti-oxidant changes associated with ...

    African Journals Online (AJOL)

    Anti-oxidant and heamatological indices in mice passaged with quinine resistant Plasmodium berghei treated with chloroquine co-administered with flavonoid rich anti-plasmodial fraction of Moringa oleifera leaves were determined in this study. Using Rane's test, 60 male albino mice were randomized into 10 groups of six ...

  10. Unprecedented hetero-geometric discrete copper (II) complexes ...

    Indian Academy of Sciences (India)

    Unprecedented hetero-geometric discrete copper(II) complexes: Crystal structure and bio-mimicking of Catecholase activity. ABHRANIL DE DHANANJAY DEY HARE RAM YADAV MILAN MAJI VINAYAK RANE R M KADAM ANGSHUMAN ROY CHOUDHURY BHASKAR BISWAS. Regular Article Volume 128 Issue 11 ...

  11. "Mul ei ole aega paksuks minna, ma ei tunne hirmu ka vanaduse ees!" / Janika Mölder ; interv. Kaja Roomets

    Index Scriptorium Estoniae

    Mölder, Janika, 1970-

    2003-01-01

    Janika Mölder tõestas eile rahvusvahelisel iluvõimlemisvõistlusel Tartus, et pärast kümneaastast vaheaega on tema sportlik vorm suurepärane. Vestlus iluvõimlejaga. Lisa: "Miss Valentine 2003" tulemused

  12. RosUkrEnergo lubas piiluda rahamasina hämarasse sisemusse / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2006-01-01

    Ukrainasse gaasi vahendava RosUkrEnergo omanikke hoiti viimase ajani saladuses, nüüd on omanikering avalikustatud. Firmat seostatakse Venemaa väidetava esikurjategijaga. Briti mõttekoda Global Witness kutsub oma raportis Ukraina valitsust firmat põhjalikult uurima. Lisa: Salapärane miljardär ja gaasimängud

  13. Martin S. Kulli fenomen / Arno Oja

    Index Scriptorium Estoniae

    Oja, Arno, 1950-

    2011-01-01

    Kriitik Arno Oja küsib, kes on salapärane romaanikangelane ja harrastusajaloolane Martin S. Kull (kas Ervin Õunapuu?) ning annab hinnangu tema raamatutele "Tartu koonduslaager", "Tapva hämaruse päevaraamat" ja "Elmar Ilp. Veri mu kätel"

  14. USA võtab hoogu maha / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2010-01-01

    Pärast riiklike soodustuste lõppu koduostjatele on USA-s vähenenud kinnisvara soetamine, jaemüüjate käive langes juunis võrreldes maiga 0,5%. USA keskpanga presidendi Ben Bernanke hinnangul on USA majandus ebatavaliselt ebamäärane

  15. Pärimuslik ajalugu ja Fr. R. Kreutzwald / Tiiu Jaago

    Index Scriptorium Estoniae

    Jaago, Tiiu, 1960-

    2005-01-01

    Pärimuslik ajalugu kui rahvapärane ajalookäsitus, mida saab uurida folkloorse jutustamise kaudu. Fr. R. Kreutzwaldi ja F. K. H. Kruse sõnavõttudest Aruküla koobaste päritolu kohta ajakirjas "Das Inland" aastast 1844

  16. Use of beverages in the administration of artemether lumefantrin in ...

    African Journals Online (AJOL)

    This study determined changes in blood chemistry and parasitaemia of Plasmodium passaged mice treated with artemether lumefantrin administered with selected locally consumed beverages. Using Rane's test, 40 albino mice inoculated with quinine resistant Q (N1923) Plasmodium berghei were randomized into eight ...

  17. Muusika valib Tristan Priimägi / Tristan Priimägi

    Index Scriptorium Estoniae

    Priimägi, Tristan, 1976-

    2003-01-01

    Heliplaatidest: Nathan Haines "Squire For Hire", Little Louie Vega "Soul Heaven - London Ibiza", Chalice "Ühendatud inimesed", DJ Spinna & Bobbito "The Wonder Of Stevie", Basement Jaxx "Kish Kash", Marcus Intalex "Soul:ution Volume 1"

  18. Archetypal Depth Criticism and Melville.

    Science.gov (United States)

    Maud, Ralph

    1983-01-01

    Applies psychologist James Hillman's idea of soul-making to literary studies. Uses the works of Melville to discuss the terms (1) depth, (2) image, and (3) archetype as they relate to the concept of soul-making. (MM)

  19. On the notion of geometry over $\\F_1$

    OpenAIRE

    Connes, Alain; Consani, Caterina

    2008-01-01

    We refine the notion of variety over the "field with one element" developed by C. Soul\\'e by introducing a grading in the associated functor to the category of sets, and show that this notion becomes compatible with the geometric viewpoint developed by J. Tits. We then solve an open question of C. Soul\\'e by proving, using results of J. Tits and C. Chevalley, that Chevalley group schemes are examples of varieties over a quadratic extension of the above "field".

  20. ‘He has a life, a soul, a meaning that extends far deeper than his medical assessment … .’: The role of reflective diaries in enhancing reflective practice during a rural community physiotherapy placement

    Directory of Open Access Journals (Sweden)

    Hellen Myezwa

    2017-07-01

    Full Text Available Background. The Department of Physiotherapy at the University of the Witwatersrand, Johannesburg, South Africa has a programme that allows 4th-year physiotherapy students to experience learning about public health in a rural setting. This experience is assessed using a portfolio. To date, the portfolios have only been assessed in terms of the students achieving the learning objectives. The process has not been evaluated for its effectiveness in promoting a reflective learner. A reflective learner is considered as one who will develop critical thinking and better accountability for their own learning. Objective. To analyse the level of reflective practice attained by the students. Methods. A qualitative approach was used to analyse evidence of reflective practice in student reflective diaries. Guided content analysis, using a framework compiled from the literature, was used to code the data. The coding framework outlined the levels of reflective practice – from the lowest level, identifying learning outcomes, to the highest level, i.e. abstract concept formation. Results. Forty-eight portfolios with reflective diaries were available for analysis. Data saturation was obtained after eight reflective diaries were analysed. The majority of the student diaries (6 of 8 reflected a low level of reflective practice, with only a few attaining a high level. Conclusion. This study showed that physiotherapy students who experienced learning in a rural setting achieved low levels of reflective practice. A minority of students were able to progress in their reflection to reveal elements of critical thought, reflective thinking and, further still, abstract concept formation.

  1. Entre Napoleón y Jesucristo: las peripecias del “alma rusa” en la obra de Dostoievski / Between Napoleon and Jesus Christ: The adventures of the "Russian soul" in Dostoevsky's work

    Directory of Open Access Journals (Sweden)

    Tatiana Bubnova

    2011-11-01

    Full Text Available RESUMEN: Dos componentes del “alma rusa” que se destacan en la obra de Dostoievski – el napoleonismo y la cristología — resultan de la interacción de la cultura rusa con la historia y la civilización occidental. Paradójicamente, la evolución de las dos líneas en las novelas del gran escritor ruso conduce a una determinada, en algunos aspectos, de los dos tipos, en particular, en El idiota. La revisión del manoseado tópico del “alma rusa” a la luz de las recientes investigaciones de los especialistas rusos pone de manifiesto nuevasintertextualidades y abre la obra a un diálogo renovado acerca de la identidad. El trabajo se inspira en la antropología filosófica y la filosofía del lenguaje de M. M. Bajtín. ABSTRACT: This is an analysis of the two components of the “Russian soul” highlighted in the Dostoevsky’s novels: Napoleonism and Christology. The origins of both of them can be found in the Western history and civilization. There is a certain paradox in the fact that the evolution of these two lines in the oeuvre of the great Russian writer arrives to an approachof the two types, the Napoleonic one and that of the follower of Christ, especially in The Idiot. A revision of the “Russian soul” under the light of the most recent interpretations of Russian critics discovers new intertexts and opens Dostoevsky’s text to a renewed identity dialogue. This paper is influenced by Bakhtin’s philosophical anthropology and philosophy of language.

  2. El alma en venta: Apuntes para un debate teórico sobre el trabajo de cuello blanco en empresas multinacionales Souls on Sale: Notes for a Theoretical Debate about White Collar work in Multinacional Enterprises

    Directory of Open Access Journals (Sweden)

    Diego Szlechter

    2011-06-01

    Full Text Available La Segunda Guerra mundial provoca la desaparición de viejos estilos de vida en el mundo occidental. Una de las causas de este fenómeno se compone de drásticos cambios en la estructura ocupacional de occidente, especialmente en EEUU, que resultaron en una nueva clase media de administradores surgidos de los college devenidos muchos de ellos gerentes de las grandes corporaciones. La emergencia de los gerentes como asalariados pone en cuestión la idea de una clase asalariada homogénea al estilo marxista debido a la expansión de actores tales como burócratas, profesionales, que no se agotan en una explicación dualista o dicotómica de la sociedad. Los estudios acerca del trabajo gerencial se enmarcan dentro de los debates acerca de la transición del llamado "fordismo" hacia el "posfordismo" o de producción en masa a la producción flexible. Estas discusiones suelen soslayar o relegar a un papel secundario la cuestión de las transformaciones en la identidad y la subjetividad dentro del espacio de trabajo. Sostenemos en este trabajo que el espacio laboral ocupa un rol fundamental en la conformación de la identidad. Este supuesto se opone a los pronósticos más optimistas del llamado posfordismo que consideran que la esfera extralaboral es la que imprime su sello sobre el mundo del trabajo. La intención de este artículo es indagar, por un lado, cómo abordan las Ciencias Sociales en general y los debates sobre las Clases Medias, la Sociología del Trabajo y la Sociología de las Organizaciones en particular, la cuestión del trabajo gerencial y por otro, qué aportes realiza la bibliografía en este campo para intentar esclarecer qué tipo de subjetividad propician las empresas para con sus mandos gerenciales y qué implicancias conlleva en la práctica laboral concreta de éstos. Es así como se presentarán 3 debates fundamentales que han surcado el camino para acercarnos a dilucidar esta cuestión: la discusión sobre calificación y competencias, la perspectiva de la cultura laboral y, por último, la teoría del capital humano.Second World War caused the disappearing of older life styles in western world. One of the reasons of this phenomen relies on drastic changes in the occupational structure in western world, especially in the US, which result in a new middle class of managers that emerged from colleges who became big bosses in corporate America. Those salaried managers questioned the idea of a homogeneous salaried class in the Marxist way due to the expansion of players such as bureaucrats, professionals, who doesn´t deplete in a dualist or dichotomist explanation of society. Labor studies about managers are framed into the debates around the transition from fordism to posfordism or from mass production to lean production. These discussions used to relegate to a secondary roll the issue of the transformations in the identity and subjectivity at work. We stress in this article that work engage a fundamental roll in the configuration of identity. This postulation opposes to most optimistic forecasts of the so called posfordism, which regard the world outside work as one that outweighs world of labor. The intention of this article is to inquire, on one side, the way Social Sciences in general and the debates around Middle Classes, Sociology of Work and Organizational Sociology in particular, the issue of managerial work and on the other side, which contributions make bibliography in this field in order to clear up what kind of subjectivity corporations promote to their middle management and what implications carry on their everyday work. Therefore, we introduce 3 fundamental debates who have plowed the road to try to elucidate this issue: the debate about qualification and competences, the labor culture perspective and human capital theory.

  3. Marketing a Healthy Mind, Body, and Soul: An Analysis of How African American Men View the Church as a Social Marketer and Health Promoter of Colorectal Cancer Risk and Prevention

    Science.gov (United States)

    Lumpkins, Crystal Y.; Vanchy, Priya; Baker, Tamara A.; Daley, Christine; Ndikum-Moffer, Florence; Greiner, K. Allen

    2016-01-01

    The Centers for Disease Control and Prevention ranks colorectal cancer (CRC) as the third most commonly diagnosed cancer among men in the United States; African American (AA) men are at even greater risk. The present study was from a larger study that investigates the church's role as a social marketer of CRC risk and prevention messages, and…

  4. Alma, corpo e a antiga civilização grega: as primeiras observações do funcionamento cerebral e das atividades mentais Soul, body and the ancient greek civilization: the first observations of brain functioning and mental activities

    Directory of Open Access Journals (Sweden)

    Fabiano S. Castro

    2011-01-01

    Full Text Available Muitos dos conceitos existentes na neurociência moderna possuem suas origens nas especulações elaboradas pelos antigos filósofos e médicos gregos. Questões centrais sobre a fonte dos pensamentos humanos, o mecanismo da atividade cognitiva, e a natureza das emoções, percepção e movimento voluntário, por exemplo, foram levantadas pelos pensadores gregos. É a partir desta civilização que surgem as observações mais sistemáticas sobre a estrutura e o funcionamento do corpo, da mente e a relação entre estas duas entidades. Assim, o presente trabalho pretende observar as principais tentativas iniciais gregas em vincular estruturas do corpo (tais como o cérebro ou o coração e atividades mentais, ao longo das diversas especulações gregas sobre a natureza, a filosofia, a psicologia e a medicina.Many of the existing concepts in modern neuroscience have their origins in the speculations made by ancient Greek philosophers and physicians. Core questions about the source of human thought, the mechanism of cognitive activity as well as the nature of emotions, perceptions and voluntary movements, for example, were raised by Greek thinkers. It is from this civilization that arise more systematic observations on the structure and functioning of body, mind and relationship between these two entities. The present paper intends to adhere to the first Greek attempts to link structures of the body (such as the brain or the heart and mental activities regarding various Greek speculations about the nature, philosophy, psychology and medicine.

  5. La puerta del alma: el color de ojos y de cabello como forma discursiva de dominación (The doors of soul: the color hairs and eyes as a discursive instrument of domination

    Directory of Open Access Journals (Sweden)

    Korstanje, Maximiliano

    2010-06-01

    Full Text Available Resumen: El nacimiento de un hijo es un evento único e irremplazable para todos aquellos que han tenido la experiencia. Para otros, es una oportunidad de asenso social sobre todo sí por ese juego de los genes la criatura se asemeja al estereotipo indoeuropeo nórdico. Por ese motivo, los padres parecen interesados en que sus hijos tengan ojos claros y cabellos rubios tomando esa característica como cualitativamente positiva. Por ese motivo, no resulta extraño que las diferentes imágenes en publicidades de artículos para bebes enfatice en los “ojos azules y los cabellos rubios” como tipos ideales a seguir. La presente investigación ha demostrado que no sólo que los estereotipos dominantes se multiplican sino también se interiorizan generando un diálogo que tiende a reforzar la hegemonía. Por lo demás, se ha observado que discursivamente la claridad es simbolizada como sinónimo de felicidad, armonía, afecto, bondad y seguridad entre otros mientras la oscuridad adquiere categorías semánticas opuestas. Para los padres, que sus hijos tengan ojos “claros” o cabellos “rubios” significa un verdadero asenso social abstracto. Por lo pronto, no cobrarán un canon adicional por traer a la vida a un hijo rubio, pero los acerca notablemente más a las características de los grupos dominantes reforzando así el auto-desprecio por sí mismos.Abstract: Even a memorable moment as the birth of a son can be subject to a much broader pervasive experience. For some people, this event become in an opportunity to social upward wherein convergence genetic and eugenicist thoughts with concentration in Norse phenotype. For that reason, parents are concerned in their sons have bight eyes and blondes hairs. This is based on the postmodern advertising and marketing efforts to emphasize on these features. Under this context, this present research showed not only that dominant phenotypes are divulged thanks to the advertising but also create a bridge between the hegemony and sentiment of inferiority. Discursively, parents who had children with bright eyes will be paid of an additional Fee, this represents a sociological and psychological need for social upward. This issue reflects that they are hermeneutically close-up to dominant elites.

  6. Innovaciones melódico-armónicas en la improvisación jazzística. Un recorrido a través del body and soul. 1935-1945

    OpenAIRE

    Cachinero-Zagalaz, Juan

    2013-01-01

    A lo largo de la Historia, la percepción y expresión del arte musical han ido cambiando, acordes con las épocas que las han visto deslizarse por el tiempo. Una investigación histórico – musical precisa del regreso a otras etapas con el fin de buscar aquellas respuestas a los interrogantes que surgen en el momento actual. La misión de la historiografía es preservar todo aquello que contuvo una esencia artística; y por esta magia vale la pena...

  7. Marketing a Healthy Mind, Body, and Soul: An Analysis of How African American Men View the Church as a Social Marketer and Health Promoter of Colorectal Cancer Risk and Prevention.

    Science.gov (United States)

    Lumpkins, Crystal Y; Vanchy, Priya; Baker, Tamara A; Daley, Christine; Ndikum-Moffer, Florence; Greiner, K Allen

    2016-08-01

    The Centers for Disease Control and Prevention ranks colorectal cancer (CRC) as the third most commonly diagnosed cancer among men in the United States; African American (AA) men are at even greater risk. The present study was from a larger study that investigates the church's role as a social marketer of CRC risk and prevention messages, and whether religiously targeted and tailored health promotion materials will influence screening outcome. We used an integrated theoretical approach to explore participants' perceptions of CRC risk and prevention and how promotion messages should be developed and socially marketed by the church. Six focus groups were conducted with men from predominately AA churches in the Midwest. Themes from focus group discussions showed participants lacked knowledge about CRC, feared cancer diagnosis, and feared the procedure for screening. Roles of masculinity and the mistrust of physicians were also emergent themes. Participants did perceive the church as a trusted marketer of CRC but believed that promotional materials should be cosponsored and codeveloped by reputable health organizations. Employing the church as a social marketer of CRC screening promotion materials may be useful in guiding health promotions and addressing barriers that are distinct among African American men. © 2015 Society for Public Health Education.

  8. Percent weight reduction required to achieve minimal clinically important improvements in health-related quality of life among African Americans: A secondary analysis of the fit body and soul study.

    Science.gov (United States)

    Garvin, Jane T; Williams, Lovoria B; Joshua, Thomas V; Looney, Stephen W; Marion, Lucy N

    2017-08-01

    To calculate the percent weight reduction required to achieve minimal clinically important improvement (MCII) in health-related quality of life (HRQOL). Secondary data analysis from the longitudinal cohort of a single-blinded, cluster-randomized community trial to test the efficacy of the faith-based adaptation of the Diabetes Prevention Program. African-American churches. This study included 472 congregants with a body mass index of ≥25 and fasting plasma glucose<126mg/dl. Percent weight reduction required to achieve the MCII in HRQOL measured by two instruments, SF-12 and EQ-5D, one year following baseline. The percent weight reduction required to achieve established MCII in SF-12 Physical Component Summary (PCS), SF-12 Mental Component Summary (MCS), and EQ-5D Health Status (HS) at one-year follow-up were calculated using fitted linear regression models. In addition to models for the total sample, we generated models, stratified by baseline BMI, PCS, and HS, to calculate the percent weight reduction required to achieve MCII in HRQOL for those most in need of weight reduction and those in need of improved HRQOL. The percent weight reduction was a significant predictor of improvement in the SF-12PCS and the EQ-5DHS but not SF-12MCS. To achieve a MCII in SF-12PCS and EQ-5DHS, 18% and 30% weight reductions were required, respectively. A smaller percent weight reduction was required when the baseline BMI was ≥40. Improvements in HRQOL among African-American congregants seeking weight reduction required more than the 3-5% weight reduction associated with improvements in physical health. Copyright © 2017 Elsevier Inc. All rights reserved.

  9. The sin in the aetiological concept of Johann Christian August Heinroth (1773-1843). Part 1: Between theology and psychiatry. Heinroth's concepts of 'whose being', 'freedom', 'reason' and 'disturbance of the soul'.

    Science.gov (United States)

    Steinberg, Holger

    2004-09-01

    Throughout his work Johann Christian August Heinroth regarded sin to be the cause of mental illness. The present two-part paper investigates what exactly Heinroth understood by sin. Based on a thorough analysis of his own texts, this study shows that on the one hand Heinroth referred to sin in a Christian-Protestant sense. On the other, however, a moral-ethical code of conduct was also involved. Thus, Heinroth did not regard sin as a singular event, but rather as a life conducted in a wrong way for years or even decades, by which he meant a steady striving towards earthly, bodily satisfaction.

  10. «Тruth and unity with zealots are in the soul» Letters of the monkmartyr archimandrite Neophyte (Osipov the hieromartyr archbishop Seraphim (Samoilovich, 1927±1928

    Directory of Open Access Journals (Sweden)

    Khailova Ol'ga

    2015-12-01

    Full Text Available This is the first publication of letters of st. monkmartyr archimandrite Neop hyte (Osipov to st. hieromartyr archbishop Seraphim (Samoylovich, to since Маy, 1927 till October, 1928. Archimandrite Neophyte was the personal secretary of St. Patriarch Tikhon. These letters were found in the PSTGU archive of to hieromartyr Seraphim (Samoylovich in the handwriting original and handwritting copy.

  11. Eelkõige Aronofsky / Erkki Luuk

    Index Scriptorium Estoniae

    Luuk, Erkki, 1971-

    2001-01-01

    Pimedate Ööde Filmifestivali filme : "Reekviem unistusele" ("Requiem For A Dream") : režissöör Darren Aronofsky : Ameerika Ühendriigid 2001, "Lahe ja pöörane" ("Cool and Crazy") : režissöör Knut Erik Jensen : Norra 2001 ja "Buųel ja kuningas Saalomoni laud" ("Buųel And King Solomon's Table") : režissöör Carlos Saura : Hispaania 2001

  12. Teadus harib mõistust, plastilised kunstid ilutunnet, muusika südant : kuus pilku muusikaraamatukogundusele / Katre Riisalu

    Index Scriptorium Estoniae

    Riisalu, Katre, 1966-

    2015-01-01

    Üleriigiline muusika-aasta on suurepärane võimalus ka raamatukogul end nähtavamaks ja kuuldavamaks teha, esitledes oma kogudest muusikaga seonduvat. Rahvusraamatukogu muusikakogu tutvustavate näituste ja väljapanekute kavandamisel oli soov näidata kogude mitmekülgsust ja unikaalsust, tutvustada meie muusika loojaid ja esitajaid, kel muusika-aastal tähtpäevad ning innustada muusikahuvi korral külastama ka raamatukogu

  13. Gazpromil tuleb rahast puudus kätte / Karin Volmer

    Index Scriptorium Estoniae

    Volmer, Karin

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 16. juuli, lk. 7.Venemaa president Vladimir Putin ja Prantsusmaa president Nicolas Sarkozy leppisid kokku, et Gazpromi partneriks seni suurimate veealuste maagaasivarude kaevandamisel Barentsi meres asuval Shtokmani leiukohal saab Prantsuse firma Total. Lisa: Kas teate? Vt. samas: Jürgen Tamme. Läänemere põhja plaanitava gaasijuhtme tulevik on ebamäärane

  14. Vingerpussid Juku ja Juhani palgaga / Ülo Ennuste

    Index Scriptorium Estoniae

    Ennuste, Ülo, 1932-

    2004-01-01

    Majandusprofessor Ülo Ennuste võrdleb 5000 ja 50 000 kroonise palga 5-10%-list tõusu ja järeldab, et ebavõrdsete majanduste puhul ei saa iga lõppeva aasta kohta teha mõistlike majanduslikku edukuse võrdlusi kasvutempode ja valemite alusel. Autor rõhutab, et tõepärane tulevikuarvutus peab olema tõenäosuslik

  15. Mali president kaotaks surmanuhtluse / Allan Espenberg

    Index Scriptorium Estoniae

    Espenberg, Allan

    2007-01-01

    Mali president Amadou Tourmani Toure pöördus riigi iseseisvuse väljakuulutamise 47. aastapäeva puhul rahva poole läkitusega, kus teatas surmanuhtluse likvideerimise seaduseelnõu parlamenti saatmisest. Presidendi säärane initsiatiiv pole aga meeltmööda Mali moslemivaimulikele. Praeguseks on Amnesty Internationali andmetel umbes pooled maailma riikidest surmanuhtluse tühistanud

  16. Zeki võpolnjali zakazõ dlja doma direktora tjurmõ / Risto Berendson

    Index Scriptorium Estoniae

    Berendson, Risto, 1975-

    2008-01-01

    Kinnipeetav Peeter Paalberg väitis, et ta oli 2007. aastal Ämari vangla juhi Arvi Laide majapidamise jaoks vangla töökojas tellimustöid teinud. Justiitsministeerium leidis, et kõik on seaduspärane. Lisatud: Arvi Laide kaebas Postimehe Pressinõukokku ; vanglajuht lubas elektriauto vendadele Paalbergidele ; ministeerium: kontrollisime süüdistusi põhjalikult

  17. Operation, Maintenance and Performance Evaluation of the Potomac Estuary Experimental Water Treatment Plant. Appendix. Volume 2.

    Science.gov (United States)

    1983-09-01

    D.T. detention time ECD electron capture detector EEWTP Estuary Experimental Water Treatment Plant EPA Environmental Protection Agency ERL Environmental...36 .0047 - .0093 .0062 - .013 Phthalates 31 (2-ethYl hexy ) hthal ate Me. of Times Detected / No. of Samples 0 / 9 0 / a 1 / 9 0 / 9 Ranse of...Concentrations NO ND .204 ND Diethyl phthalate No. of Times Detected / No. of Samples 1 / 9 0 / a 0 / 9 0 / 9 Rane of Concentrations .429 ND ND ND Dtbutyl

  18. Scientific Presentations on High Temperature Superconductivity and Cryogenic Power Research from 2005-2013

    Science.gov (United States)

    2013-11-01

    J.W. Kell, B.C. Harrison, C. Varanasi, T. Haugan, I. Maartense, N. Pearce, E. Stinzianni, K. Dunn, M. Rane, F. Ramos Nanoparticulate Flux...Burke A comparison of YBCO pinning by minute dopants and nanoparticulates and coated conductor ac loss reduction 1-Nov-06 wt-25- inv invited...Varanasi YBCO Pinning by Nanoparticulate Dispersions Apr-07 APS 󈧋 A. Lucarelli, R. Yang, G. Luepke, F. Grilli, T. Haugan, G. Levin, and P

  19. Yeast Interacting Proteins Database: YIL109C, YGR057C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available cargo selection and autophagy; required for the binding of the Sec13 complex to ER membranes; homologous to ...icle coat; involved in ER to Golgi transport, cargo selection and autophagy; required for the binding of the Sec13 complex to ER memb...ranes; homologous to Lst1p and Lss1p Rows with this bait as bait (1) Rows with this

  20. De Anima Arystotelesa oczami Franza Brentana. Budowa ludzkiej duszy na podstawie Die Psychologie des Aristoteles, insbesondere seine Lehre vom nous poietikos oraz w kontekście pozostałych prac ze zbioru Aristotelica**

    Directory of Open Access Journals (Sweden)

    Sonia Kamińska

    2016-02-01

    Full Text Available This paper is a part of a project devoted to Brentano’s Aristotelian writings. I concentrate on his habilitation about Aristotle’s psychology, and especially on how he understood Aristotle’s division of mental life into three levels as well as the functions typical for these levels. I analyze two notions that Brentano introduces in his account: Zwischenglieder, meaning intermediary “levels” within the soul enabling smooth passages between the vegetative soul and sensory soul and between the latter and intellectual soul; and Gottverwandtschaft, i.e. human kinship with God, which is possible thanks to the noblest part of the soul. I also introduce two metaphors of the soul: cake-metaphor and fabric-metaphor.

  1. Parmenides. życie jest snem bytu (Parmenides: Life Is a Dream of Being

    Directory of Open Access Journals (Sweden)

    Adam Drozdek

    2011-03-01

    Full Text Available Death is not a departure of the soul from the body – in can be so only in the road ofopinion – but a departure of the body from the soul, as it were, that is, the rectificationof cognition, having the mind to rely completely on the road of truth, wherebythe opinions fall off and all the illusions they bring into the soul disappear as well.However, to retain the true monistic character of the system, the immortality ofthe soul has to be denied. Humans are temporarily brought into being as thoughtsof Being or as its dream, and eventually disappear since what is important, is theunity of Being.

  2. Anatomy and the Body in Renaissance Protestant Psychology.

    Science.gov (United States)

    Cellamare, Davide

    2014-01-01

    This article addresses the use of anatomical knowledge in Renaissance works on the soul produced at northern European universities, as well as the notions of 'body' and 'soul' that emerge from them. It examines specifically Philip Melanchthon's and Rudolph Snell van Royen's treatises on the soul. This analysis shows that a number of Protestant professors of arts and medicine generally considered the anatomical study of the body--which they conceived of as a teleologically organised machina (machine)--to be instrumental in studying the human soul. This article will, however, also document that the reasons motivating this conception were not uniform.

  3. Editorial

    Indian Academy of Sciences (India)

    And though they are with you yet they belong not to you. You may give them your love but not your thoughts,. For they have their own thoughts. You may house their bodies but not their souls,. For their souls dwell in the house of tomorrow, which you cannot visit, not even in your dreams. ______ .AA~AAA _ _ - -_ _ _ _. 2.

  4. The Value of Infused Love

    NARCIS (Netherlands)

    Sarot, M.

    2014-01-01

    Aquinas distinguishes between love as a passion of the soul and love as a theological virtue. The distinction between both forms of love lies not in the objects of love, as if love for men was a passion of the soul, love for God a theological virtue. Love as a theological virtue comprises both love

  5. spiritually sensitive social work: a missing link in zimbabwe

    African Journals Online (AJOL)

    Mugumbate

    prison, more days in school, more days on the job, fewer suicides; and less spouse, child, and elderly abuse. But by cutting ourselves off from our spiritual roots and purpose, we have dehumanized ourselves and our clients. We create a living hell when we cut ourselves off from our souls and we deny the souls of our clients.

  6. Reading the Song of Songs through a spiritual direction lens

    African Journals Online (AJOL)

    2015-08-13

    Aug 13, 2015 ... as 'the ideal model for a good spiritual director' because he recognised his subordinate role as 'the ... of 'three blind guides who can draw [the soul] off the road: the spiritual director, the devil, and the soul .... 'pure lyric without a didactic spelling out of historical referents' (Fisch [1988] 1990:86). This 'pure ...

  7. divine illumination: the unity of explanation in neo-platonic thoughts

    African Journals Online (AJOL)

    OYELAKIN

    For instance, four centuries before Christ, Pythagoras of. Samons and his followers had expressed belief in transmigration of soul as a result of which they never ate animal flesh believing that the souls of one‟s friends might be inhabiting the body of the animals killed for foods. 15. The Christian Bible contains texts that ...

  8. Profit vs. Purpose

    DEFF Research Database (Denmark)

    Strand, Robert

    2017-01-01

    Money helps us meet our basic needs, but what about our need for meaning? Businesses will profit — not just financially — by finding their souls.......Money helps us meet our basic needs, but what about our need for meaning? Businesses will profit — not just financially — by finding their souls....

  9. The Mind of the Ancient Physical Philosophers

    OpenAIRE

    Joan Torello

    2015-01-01

    Although this conception of the soul belonged to an ancient tradition expressed already in Homer and Orphism, the thesis of Anaximenes that conceived air as a physical substrate of the human soul, which was continued by Heraclitus, Democritus and Diogenes of Apollonia, was considered the first theory of antiquity on the human psyche in science and philosophy. It is presented here.

  10. Lecture 19: May 17, 1921

    Science.gov (United States)

    Montessori, Maria

    2016-01-01

    Montessori discusses the importance of the calm inner life (the soul) of the very young child. She stresses the importance of the soul's self-management, the child knowing what he needs to do, and of course, being allowed to do what he needs to do. The child can repeat the exercise or move ahead according to minimal clear and precise guidance from…

  11. Prečo dlhoval Sókratés Asklépiovi kohúta? Skeptická interpretácia posledných Sokratových slov z dialógu Faidón (Why Socrates owed the Cock to Asclepius? Skeptical Interpretation of Socrates’ Last Words in the Phaedo

    Directory of Open Access Journals (Sweden)

    František Škvrnda

    2013-03-01

    Full Text Available This study argues for skeptical interpretation of Socrates’ last words in the dialogue Phaedo. Author analyses two passages, concerning health of the soul and concludes, that Plato’s position towards the immortality of soul can not be evaluated as dogmatic. Socrates’ last words remain therefore a puzzle with twofold meaning, connoting skeptic position.

  12. Hidden Variables and Placebo Effects

    Science.gov (United States)

    Goradia, Shantilal

    2006-03-01

    God's response to prayers and placebo leads to a question. How does He respond deterministically? He may be controlling at least one of the two variables of the uncertainty principle by extending His invisible soul to each body particle locally. Amazingly, many Vedic verses support this answer. One describes the size of the soul as arithmetically matching the size of the nucleons as if a particle is a soul. One gives a name meaning particle soul (anu-atma), consistent with particle's indeterministic behavior like that of (soulful) bird’s flying in any directions irrespective of the direction of throw. One describes souls as eternal consistent with the conservation of baryon number. One links the souls to the omnipresent (param- atma) like Einstein Rosen bridges link particles to normal spacetime. One claims eternal coexistence of matter and soul as is inflationary universe in physics/0210040 V2. The implicit scientific consistency of such verses makes the relationship of particle source of consciousness to the omnipresent Supreme analogous to the relationship of quantum source of gravitons in my gr-qc/0507130 to normal spacetime This frees us from the postulation of quantum wormholes and quantum foam. Dr. Hooft's view in ``Does God play dice,'' Physicsword, Dec 2005 seems consistent with my progressive conference presentations in Russia, Europe, India, and USA (Hindu University) in 2004/05. I see implications for nanoscience.

  13. Asude Bahar Ülkesine Yolculuk Olan Ölümün Şair Biyografilerinde İfade Edilmesi In Poet Biographies Expression Of Death A Passage To The Peaceful Spring Country

    Directory of Open Access Journals (Sweden)

    Abdullah AYDIN

    2013-09-01

    Full Text Available Collection of biographies of poets the sources of Classic TurkishLiterature inform about the poets’ life, character, literal personality andworks. Though the number of collection of biographies in TurkishLiterature has risen to forty, it will increase in number by newresearches possibly. There are both books and articles about how somespecific subjects are held on these works that involve the biographies ofpoets. Along with the informations about the poet’s character, physicalappearance, family, educational background, job, marriage, children,date of birth, place of birth, place of death there are information abouthis poesy.In this study, how the death of the poets are expressed isresearched inspring especially from the writers’ acting responsiblytowards indicating the date of death. The distinctness is formed byexamining former published works and identifying the samples whichwill complete them. Apart from the cause and time of death the wordsand word groups preferred for death knell are examined in terms ofstyle. While the death of poets are expressed by some simple sentencesas “died, expired, slaughtered” sometimes it is expressed in moreartistic ways related to poet’s name, nickname, job and lifestyle.Especially the tenth topic with its under titles is important in terms ofrevealing new styles of expression.Death which we regard ordinary by saying “all livings born, liveand die” and which is expressed in wholy Koran as “Külli nefsinzâikatü'l-mevt”, namely “every soul shall have a taste of death” is holdsometimes sadly but mostly in terms of its beauty. The writers havedeveloped a literary pleasure on death. Klasik Türk Edebiyatının kaynak eserlerinden Şair Tezkireleri şairlerin hayatı, mizacı, edebî kişiliği ve eserleri hakkında bilgi vermektedir. Türk Edebiyatında tezkire sayısı kırka ulaşmış olmakla beraber yeni araştırmalarla bu sayının artması muhtemeldir. Şair biyografilerini kapsayan

  14. PROTUPRAVNOST INTERVENCIJE I ANEKSIJE U MEĐUNARODNOM PRAVU: SLUČAJ KRIMA

    OpenAIRE

    Miloglav, Hrvoje; Tomaš, Pasko

    2017-01-01

    Ruska Federacija iskoristila je političku krizu u Ukrajini krajem 2013. godine, nastalu u povodu nepotpisivanja Sporazuma o stabilizaciji i pridruživanju s Europskom unijom kako bi dodatno destabilizirala Ukrajinu, izazivajući nemire na unutarnjem planu, napetosti među tamošnjim etničkim grupama i organizirajući oružane skupine na krimskom poluotoku. Time su se otvorile stare rane i sjećanja na povijesne sukobe te komplicirane i složene odnose između dvaju naroda – ruskog i ukrajinskog. Tada ...

  15. Modifikacija klizno-rotirajućeg režnja napravljenog 1950. godine

    OpenAIRE

    Knežević, Predrag; Vuletić, Marko; Blivajs, Igor; Dediol, Emil; Macan, Darko; Virag, Mišo

    2017-01-01

    Rane tehnike zatvaranja rascjepa usne uključuju linearnu ili druge oblike geometrijskih linija (trokutasta ili četvrtasta zatvaranja). Prekretnica u operaciji rascjepa usana počela je 1955. godine kada je, na Prvom međunarodnom kongresu za plastičnu kirurgiju u Stockholmu, dr. Millard predstavio svoju metodu – klizno-rotirajuću tehniku ili režanj. Danas tu tehniku diljem svijeta, s modifikacijama ili bez njih, primjenjuje više od 85 posto kirurga za rascjepe. predstavljamo pacijenta s po...

  16. Fire Control Simulation Requirements. Volume III.

    Science.gov (United States)

    1980-05-01

    4OT SPOT TPACK SIMULATION MOUULE To IEGIN EXECUTION AT TT4E 1M.1sOOcO0On CURRENT CP TIME 1; 14..At WHICH IS 4.978 SECONDS INTO THE VP1 OVERLAY...TOOK .031 ;P SE:ON3S AID 26 WP;DS WFE INPUT T3 I1. S=~......f..s......................... .......... *......... ............... NOT SPOT TPACK ...NO. 3 IS AT AN ALTITUDE OF 51. AN) RAN(E FROM RADAR OF 4141 NO. OF T-u-S PULSES x 2 SFUNCTIONAL MODULE TPACK WHILE jAN E.A0E3 AT CP TIME 19.553

  17. Psycho-oncology: Searching for practical wisdom?

    Science.gov (United States)

    Butlin, Helen

    2015-10-01

    The debate is vigorous in psycho-oncology about whether spiritual, existential, and psychosocial are the most comprehensive terms for academic research discourses investigating meaning and purpose. A call-to-action email from the International Society of Psycho-Oncology included the term soul. The current essay highlights the historical and contemporary uses of "soul" to suggest that the re-emergent soul signifies a tacit quest for an "intangible" that seems missing in current constructs of clinical domains reflected in the vigor of the debates. It is suggested that the re-emergence of the pre-Medieval meaning(s) of the notion of soul affirms a growing need for integrative paradigms on "being human" to guide psycho-oncology practitioners and their research. As a paradigmatic example, a clinical support group entitled Soul Medicine is described as employing the term soul to open up the more marginal discourses about experiences of illness arising from philosophical reflection, arts, humanities, and spirituality within a clinical oncology context. A link between soul and wisdom is suggested for further exploration with the view that phronesis ("the virtue of practical wisdom"), an emerging concept in health professional education research, is of ultimate value to the people psycho-oncology seeks to serve. This group holds that garnering wisdom from the expertise of those living with cancer should be a central aim of our field.

  18. Fiches pratiques: "Oui, je viens de Taiwan"; L'habit ne fait pas le moine; Objets inanimes avez-vous donc une ame?; La Bourse et la voix (Practical Ideas: "Yes, I Come from Taiwan"; The Clothes Don't Make the Man; Inanimate Objects, Do You Have a Soul?; The Stock Exchange and the Voice).

    Science.gov (United States)

    Durbant, Jean-Claude; And Others

    1988-01-01

    Four ideas for classroom instruction are presented, including an approach to teaching foreign nationals or immigrants, a lesson in clothing and its terminology, an explanation of the symbolism and language of the French Revolution, and a description of how to use radio programs about economics. (MSE)

  19. Alimentos, palavras e saúde (da alma e do corpo, em sermões de pregadores brasileiros do século XVII Food, words, and health (of soul and body in sermons by seventeenth-century preachers in Brazil

    Directory of Open Access Journals (Sweden)

    Marina Massimi

    2006-06-01

    Full Text Available Este artigo analisa alguns sermões pregados entre os séculos XVII e XVIII no Brasil, baseados em metáforas alimentares. O uso das metáforas, recorrente nos sermões do período colonial, fundamenta-se em dois alicerces: 1 na teoria aristotélica do conhecimento, em que o sensorial ocupa um papel prioritário, como porta de acesso para a compreensão das idéias mais abstratas e para a mobilização dos afetos e da vontade visando à modificação do comportamento dos ouvintes; 2 na doutrina platônica sobre a importância das imagens para conservar a memória das idéias. A oratória sagrada do período desperta interesse para a história cultural, uma vez que os sermões constituíram-se numa importantíssima fonte de transmissão de doutrinas e de modelagem dos comportamentos numa sociedade em que a oralidade era a principal forma de difusão dos conhecimentos.The article analyzes a number of sermons employing food metaphors, preached in Brazil during the seventeenth and eighteenth centuries. The use of metaphors drawn from listeners' daily lives was common in sermons during the colonial period, underpinned by two theoretical considerations: 1 the Aristotelian theory of knowledge, where the senses play a primary role as an access way to comprehension of more abstract ideas and as a means for urging listeners to change their behavior patterns by affecting their emotions and their wills; 2 the Platonic doctrine, where images are important in preserving our memory of ideas. The sacred oratory of the colonial period is of major interest to cultural history, since these sermons served as an invaluable way of transmitting doctrine and of shaping behavior in a society where orality was the chief method for spreading knowledge.

  20. A concepção de alma em Avicena: não apesar de Aristóteles e, sim, através de Aristóteles = Avicenna’s concept of the soul: not despite Aristotle, but rather through Aristotle

    Directory of Open Access Journals (Sweden)

    Genz, Antonio Carlos de Madalena

    2014-01-01

    Full Text Available No artigo, analisa-se a concepção de alma de Avicena (Ibn Sina, apresentada no Livro da alma, com particular atenção ao experimento do Homem Suspenso no Espaço (HSE e as questões derivadas a partir do mesmo. Essas dizem respeito ao vínculo de Avicena com o aristotelismo ou o neoplatonismo, as duas principais influências filosóficas sobre o autor. Embora utilize principalmente conceitos aristotélicos, com o mencionado experimento Avicena rompe com a concepção aristotélica da alma, afirmando a estrita substancialidade dessa última. No artigo, busca-se mostrar que, não obstante a noção de substancialidade ser estranha ao quadro aristotélico, ainda assim Avicena é mais bem compreendido, quanto à doutrina da alma, se visto pela ótica aristotélica, e não por uma ótica neoplatônica

  1. Alma e destino do povo português: o fado como identidade nacional lusa no limiar do estado novo (1927–1933 = Portuguese people’s soul and destiny: the fado as lusitanian national identity on the threshold of the estado novo (1927–1933

    Directory of Open Access Journals (Sweden)

    Gasparotto, Lucas André

    2014-01-01

    Full Text Available O fado, gênero musical considerado canção nacional em Portugal, apresenta trajetória histórica cuja origem remonta ao início da segunda metade do século XIX. Desde pelo menos o último terço dos oitocentos, observa-se, nas primeiras obras dedicadas à história do fado, o aparecimento de um debate acerca do status de símbolo nacional atribuído ao gênero. É, contudo, no final dos anos 1920 e início dos 1930 que se observa uma série de elementos responsáveis por atribuir carga simbólica e identitária ao fado, capaz de consolidá-lo como identidade nacional portuguesa. Através de conjunto de fontes que contempla legislação, obras literárias e jornalísticas e jornais de temática específica, este trabalho analisa as características do cenário musical fadista em Portugal durante o período de 1927 a 1933, destacando um processo de ritualização das práticas artísticas que objetivava dignificar o gênero mediante às diversas camadas da sociedade. A pesquisa sustenta-se na discussão em torno dos conceitos de nação e identidade nacional, a fim de definir o fado como alma e destino do povo português, enquanto canção popular com status de canção nacional capaz de credenciá-lo como uma cultura comum

  2. The nature of water: Greek thought from Homer to Acusilaos.

    Science.gov (United States)

    De Santo, Rosa Maria; Bisaccia, Carmela; Cirillo, Massimo; Pollastro, Rosa Maria; Raiola, Ilaria; De Santo, Luca Salvatore

    2009-01-01

    Greek philosophy finds its roots in the myth of Homer's and Hesiod's poems and especially in Orphism which introduced the concept of a soul separated from the body with an independent principle, psiche (soul), to be rewarded or punished after death. Orphism was an important step in Greek culture. It introduced the divine into man, the soul which does not die with the body and reincarnates. From Orphism started the need of rituals capable of separating the spirit from the body. From Homer to Acusilaos, water was a very important element which connected humans and gods, long before Thales of Miletus defined it the arche.

  3. „(A) nasze dusze smutne mają pyski.leżą na dywanie. wyją. nie dają żyć” (J. Mansztajn, O duszy) – leksem dusza w najnowszej poezji polskiej

    OpenAIRE

    Karina Stempel-Gancarczyk

    2016-01-01

    “(Y)et the faces of our souls are sad. lying on the carpet. howling. tormenting us.” (J. Mansztajn, O duszy) – the lexeme dusza (soul) in contemporary Polish poetry The article concerns the occurrences of the lexeme soul in contemporary Polish poetry. Due to the extensive amount of material available for analysis, it concentrates on volumes that were awarded or nominated in the selected Polish poetry contests in 2010–2015 (Wisława Szymborska Award, “Nike” Literary Award, “Silesius” Wrocła...

  4. Consumers' Preferences for a Local Food Product: The Case of a New Carnaroli Rice Product in Lombardy.

    Science.gov (United States)

    Ferrazzi, Giovanni; Ventura, Vera; Ratti, Sabrina; Balzaretti, Claudia

    2017-04-13

    Italy, with a cultivated area of 218,000 ha, is a European leader of rice production. In particular Lombardy region accounts for 40% of total rice cultivation and the case study in object accounts for 3.2% of Lombardy total rice area (2773 ha). Starting from 2012, through a regional project titled Buono, Sano e Vicino (good, healthy and close), Riso e Rane rural district supported local rice farmers in developing innovation in rice production and promoting an alternative supply chain to increase farmers bargaining power and promote new market strategies. More specifically, the innovation introduced is a new biotech method for variety certification, named DNA controllato (DNA tested). In the first step of the project, the attention was focused on an Italian traditional variety of rice: Carnaroli rice. Thanks to a commercial agreement with one of the most important large retailers in Lombardy, the Riso e Rane rice is offered for sale both in the traditional and wholegrain version. In this context, this work aims to evaluate the determinants of consumer's quality perception of this product, through a preference study of the commercial rice package. Preliminary results reveal that consumers perceive information about origin, local food-system and tradition more easily than DNA tested certification. In conclusion, this work contributes to evaluate the role of bio economy applications to the food sector and offers new insights for the debate about the relationships between tradition and innovation.

  5. What Should a Consciousness-Mind-Brain Theory be Like? Reducing the Secret of the Rainbow to the Colours of a Prism

    National Research Council Canada - National Science Library

    Sultan Tarlaci

    .... At that time therefore, the appropriate term was soul-body. Later, although the concept of mind-body duality was developed, this expression is wrong, because the location of the mind is not the...

  6. Pop / Marek Kallin

    Index Scriptorium Estoniae

    Kallin, Marek

    2002-01-01

    Heliplaatidest Mobb Deep "Infamy". Hilmar Örn Hilmarsson & Sigur Ros "Angels Of The Universe". Simple Minds"The Best of". Angie Stone "Mahogany Soul". Cypress Hill "Stoned Raiders". Bebel Gilberto "Tanto Tempo Remixes". Roots Manuva "Run Come Save Me"

  7. Uued plaadid / Marko Tiidelepp

    Index Scriptorium Estoniae

    Tiidelepp, Marko

    2007-01-01

    Heliplaatidest: Akon "Konvicted. Platinum Edition", 50 Cent "Curtis", James Blunt "All The Lost Souls", KT Tunstall "Drastic Fantastic", The Simpsons "Testify", Plain White T's "Every Second Counts", Kanye West "Graduation", "Ultimate R&B 2007"

  8. Pop / Erik Morna

    Index Scriptorium Estoniae

    Morna, Erik, 1969-

    2003-01-01

    Heliplaatidest: Swayzak "Dirty Dancing", De La Soul "Best Of", David Sylvian "Blemish", Evanescence "Fallen", Macy Gray "The Trouble With Being Myself", Audio Bullys "Ego War", Eesti Raadio laululapsed "Maasikad. Reinuvaderi ja Karuoti laulud"

  9. 13-EEASA-Vol 22.indd

    African Journals Online (AJOL)

    jenny

    2006-02-22

    Feb 22, 2006 ... ... by the attention given to indigenous concepts and practices in the search ... by the contributions of Lungi Goduka, Soul Shava, Clayton Zazu, Jones .... application of indigenous systems to solve modern-day problems we ...

  10. Idea řádu a metodologie Suárezovy psychologie

    Czech Academy of Sciences Publication Activity Database

    Heider, Daniel

    2015-01-01

    Roč. 12, Supplementum 2 (2015), s. 103-117 ISSN 1214-8407 Institutional support: RVO:67985955 Keywords : Suárez * De anima * hierarchical order * neoplatonism * indivisibility of soul * sensory appetite Subject RIV: AA - Philosophy ; Religion

  11. Pop / Raul Ranne

    Index Scriptorium Estoniae

    Ranne, Raul

    2004-01-01

    Heliplaatidest: Genialistid "Genialistid", Roy Ayers "Mahogany Vibe", John Tejada "Logic Memory Center", Joss Stone "Mind, Body & Soul", Fatboy Slim "Palookaville", Soulwax "Any Minute Now", Erinevad esitajad "Super Discount 2"

  12. Introduction to probability and measure

    CERN Document Server

    Parthasarathy, K R

    2005-01-01

    According to a remark attributed to Mark Kac 'Probability Theory is a measure theory with a soul'. This book with its choice of proofs, remarks, examples and exercises has been prepared taking both these aesthetic and practical aspects into account.

  13. Music: R&B Serenity Now

    National Research Council Canada - National Science Library

    Wood, Mikael

    2010-01-01

    .... Kelly, Ne-Yo, Jazmine Sullivan, Charlie Wilson, Faith Evans and El DeBarge. Although most these albums have been overshadowed by newer popular artists, they reflect the industry's belief in a robust soul-music market...

  14. Siim Nestor soovitab : Lühidalt kõigest (peaaegu)! / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2002-01-01

    27. dets Club Hollywoodis toimuvast peost "Caffe De La Soul", 28. dets. Tartus klubis Tallinn ansambli Velikije Luki esinemisest, 27. dets peost "Sünkoop" klubis Wimbledon ja Von Krahlis toimuvast aastavahetuse peost "Super Triple Masterclash 2002"

  15. Logos and Logoi in Plotinus. Their nature and Function

    Directory of Open Access Journals (Sweden)

    Brisson, Luc

    2009-06-01

    Full Text Available The universe is the result of a production that pertains not to craft, but to nature. This production does not involve either reasoning or concepts, but is the result of a power that acts on matter like an imprint. The Intellect transmits the intelligible forms it harbors, to the hypostasis Soul, where they become rational formulas (logoi. The hypostasis Soul then transmits these rational formulas to the world soul, which produces animate and inanimate beings, as if it had been ordered to do so. Yet since it is the lower part of the soul of the world that is responsible for these productions, its action, which depends on reasons that do not hold the first rank and are drawn from itself, manifests inferior quality, which explains imperfection and the presence of evil in the sensible universe, despite its government by Providence.

  16. Plaadid / Kaur Garshnek, Ave Randviir, Priit Pruul...[jt.

    Index Scriptorium Estoniae

    2007-01-01

    Uutest heliplaatidest Jaak Sooäär, Raul Vaigla, Tanel Ruben "No99 Jazzklubis", Black Strobe "Burn Your Own Church", The Quantic Soul Orchestra "Tropidelico", Uni "Kosmikud II", Bugge Wesseltoft "IM", Gabrielle "Always"

  17. Kinetin (N -furfuryladenine): Cytotoxicity against MCF-7 breast ...

    African Journals Online (AJOL)

    Jane

    2011-07-06

    ., 1994; Sharma et al. ... recognized as the first hormone-responsive breast cancer cell line (Soule et al., 1973). The usefulness ... constituents of the circulatory system and have many physiological functions. Binding to albumin ...

  18. Pop / Tõnu Pedaru

    Index Scriptorium Estoniae

    Pedaru, Tõnu

    2007-01-01

    Heliplaatidest: Milburn "These Are The Facts", Beirut "The Flying Club Cup", The Quantic Soul Orchestra "Tropidelico", Caribou "Andorra", Khillem "Vill", Einstürzende Neubauten "Alles Wider Offen", Arthur Verocai "Encore", Tunng "Good Arrows"

  19. Plaadid / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2002-01-01

    Uutest plaatidest Craig David "Slicker Than Your Avarage", Whitney Houston "Just Whitney", Christina Aguilera "Stripped", Shaggy "Lucky Day", Tolga Kashif "The Queen Symphony", Mark Knopfler "Ragpicker's Dream", Soul Milita "On The Rise", Vello Orumets "Sõbrale"

  20. Re-enchanted bodies: experiences of the sacred and healing

    DEFF Research Database (Denmark)

    Ostenfeld-Rosenthal, Ann

    2010-01-01

    patients' experiences of 'the sacred in the body' I want to argue that when bodily sensed spiritual experiences take on a personal meaning it opens a possibility for 'religious sceptics' to believe in the existence of a spiritual world playing an important role in relation to the healing process.......As a consequence of the Cartesian dualism body and soul have for a long time been conceived of as separate entities of a different nature. These notions of body and soul are changing. This is especially evident in New Age inspired concepts of body and soul, illness and healing as it is also...... reflected in my study of spiritual healing and patients with medically unexplained symptoms on which this paper is based. The paper will address the following questions: How do patients and healers conceptualize body and soul? What does it mean in relation to a healing process? Two concepts that aim...

  1. Survival and personal identity in orphism

    Directory of Open Access Journals (Sweden)

    Carlos Megino Rodríguez

    2016-10-01

    Full Text Available The aim of the article is to clarify the conditions which are fulfilled by the soul in orphism in order to base on it the possibility of self-survival. To this end, we study what the soul consists of in orphism, analyzing all orphic testimonies that allow us to draw conclusions in connection with the role of the soul in the orphic conception of personal identity. We also take into account the role played by other factors in orphism, like the body and memory, as possible criteria for personal identity. Finally, we conclude that the soul in orphism is the bearer of the personal identity, because it is a substantive, individual and independent entity, of a unique and permanent nature, immortal and the subject of a unique and untransferable vital history.

  2. 77 FR 16903 - National Day of Honor

    Science.gov (United States)

    2012-03-22

    ... languages and cultures, taking on new roles as diplomats and development experts to improve the communities... men and women are eternally bound; though we have laid them to rest, they will live on in the soul of...

  3. Plaadid / Katrin Malt, Mart Virkus, Virko Pirrus...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Uutest heliplaatidest Avantasia "The Scarecrow", Crematory "Pray", Black Comedy "Instigator", Behexen "My Soul For His Glory", Draconian "Turning Season Within", Earth "The Bees Made Honey in the Lion's Skull", Devotus Regnum "Centuries Conversely"

  4. Christian Contributions to Army Values

    National Research Council Canada - National Science Library

    D'Emma, Gregory

    2000-01-01

    .... The Army builds the soldier's heart, spirit, and soul by the values we instill. Over the years these values of loyalty, duty, respect, selfless service, honor, integrity, and personal courage have been trained and reinforced...

  5. Plaadid / Jüri F. Lotman

    Index Scriptorium Estoniae

    Lotman, Jüri F.

    2004-01-01

    Uutest plaatidest Lil Jon & The East Side Boys "Kings of Crunk", Tori Amos "Tales Of A librarian", rebekka Bakken "The Art Of How To Fall", Slow Train Soul "Illegal Cargo", Marcos Valle "Contrasts", The beatles "Let It Be...Naked"

  6. Plaadid / Heidi Purga

    Index Scriptorium Estoniae

    Purga, Heidy, 1975-

    2006-01-01

    Uutest heliplaatidest Gwen Stefani "The Sweet Escape", Errors "How Clean Is Your Acid House?", Cliff Richard "Two's Company", Jay-Z "Kingdom Come", Incubus "Light Grenades", Pogo Kreiner & Vienna Sound Orchestra "E"Magic Flute", Freddie Cruger "Soul Search"

  7. Abstract: Duke University School of Nursing's Impact on Nursing and ...

    African Journals Online (AJOL)

    Abstract: Duke University School of Nursing's Impact on Nursing and Midwifery Education in Rwanda. Patricia Moreland, Isabelle Soule, Linda Vanhook, Linda Baxter, Claire McKinley Yoder, Michael V Relf ...

  8. Fundamental(ist) attribution error: Protestants are dispositionally focused.

    Science.gov (United States)

    Li, Yexin Jessica; Johnson, Kathryn A; Cohen, Adam B; Williams, Melissa J; Knowles, Eric D; Chen, Zhansheng

    2012-02-01

    Attribution theory has long enjoyed a prominent role in social psychological research, yet religious influences on attribution have not been well studied. We theorized and tested the hypothesis that Protestants would endorse internal attributions to a greater extent than would Catholics, because Protestantism focuses on the inward condition of the soul. In Study 1, Protestants made more internal, but not external, attributions than did Catholics. This effect survived controlling for Protestant work ethic, need for structure, and intrinsic and extrinsic religiosity. Study 2 showed that the Protestant-Catholic difference in internal attributions was significantly mediated by Protestants' greater belief in a soul. In Study 3, priming religion increased belief in a soul for Protestants but not for Catholics. Finally, Study 4 found that experimentally strengthening belief in a soul increased dispositional attributions among Protestants but did not change situational attributions. These studies expand the understanding of cultural differences in attributions by demonstrating a distinct effect of religion on dispositional attributions.

  9. Juur ja Oja - Baltikumi suurimad naljahambad / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2004-01-01

    Refereeritakse prantsuse vasakpoolses päevalehes Liberation rubriigis "l'Europe a 25" avaldatud Veronique Soule'i artiklit satiirilise meelelahutussaate "Ärapanija" saatejuhtidest Mart Juurest ja Peeter Ojast

  10. Popmuusika / Valner Valme

    Index Scriptorium Estoniae

    Valme, Valner, 1970-

    2005-01-01

    Uutest heliplaatidest Starsailor "On The Outside", Alabama "The Essential", Sean Paul "The Trinity", Nils Landgren & Joe Sample "Creole Love Call", Millionaire "Paradisiac", Kashmir "No Balance Palace", Bonnie Raitt "Souls Alike"

  11. Liival etenduvad vangide elulood / Marika Raiski

    Index Scriptorium Estoniae

    Raiski, Marika

    2000-01-01

    Merle Karusoo 12 vangi elulugu käsitlevast dokumentaallavastusest "Save Our Souls", mis tuleb ettekandele 31. mail Tallinnas Liiva keskuses. Etenduses osalevad Vene Draamateatri ja Narva Teatri Ilmarine näitlejad. Eestvedajaks on VAT Teater

  12. Inmortalidad e Intelección según Tomás de Aquino

    Directory of Open Access Journals (Sweden)

    David Ezequiel Téllez Maqueo

    2013-11-01

    Full Text Available After a brief discussion and some conclusions on the meaning of the eternity and inmortality of the soul according to Aristotle, the paper tries to show some differences between Aristotle's and Aquinas's approaches to the subject,

  13. Viromarketing ehk Eesti Asja salaturundus / Jaana Liigand

    Index Scriptorium Estoniae

    Liigand, Jaana

    2004-01-01

    Marketingifirma SoulKool poolt korraldatud Türi Vodka varjatud viinakampaaniast. Viromarketingist ehk viirusturundusest. Vt. samas: USA kolledzhiõpilaste uus kultusjook; Mis teevad ühest naistekast tõelise naisteka? Aga loomulikult kingad!

  14. Ancestor worship – is it Biblical?

    African Journals Online (AJOL)

    p1243322

    ancestors. This synergy is also based on the underlying beliefs about death and the afterlife. In all three cases, death is not considered to be a barrier between ...... death, “And do not fear those who kill the body but cannot kill the soul; rather fear him who can destroy both soul and body in hell” (Mt 10:28; Lk 12:4-5;. RSV).

  15. 複製技術社会の民俗 : 近代の都市金沢における新色音論

    OpenAIRE

    小林, 忠雄

    1989-01-01

    How the Japanese view of their nacestors' soul has changed in these days when there are more and more households without ancestral tablets nor Buddhist altars, in particular in urban life? Instead, pictures of late persons are becoming more and more popular, which can be grasped as a characteristic phenomenon. In early years of our modernization, the pictures as portraits thus firmly established among the Japanese who had an idea that our soul can be transmitted from generation to generation ...

  16. An Application of Max Lusher's Theory of Colour Psychology in Forogh Farrokhzad's Poetry

    OpenAIRE

    M Alavi Moghaddam; S Poorshahram

    2010-01-01

    Colour is recognized as one of the criteria for personality analysis in modern psychology. Colours are a kind of energy and visible sounds which play an important role in one's life. Their influences on human's soul and mind are undeniable. In other words, colour can be considered as a reflection of one's mental and physical situation since colours have special influence on soul and body equally. Max Lusher's study of colours is among the most recent theories which deal with psychological ana...

  17. " LE ANIME SONO SANGUE " (REF. I 22, 5 = 340 USENER) UNA TESTIMONIANZA 'IPPOLITEA' SULLA PSICOLOGIA DI EPICURO *

    OpenAIRE

    Scalas, Giulia

    2015-01-01

    International audience; In this paper I aim at analysing one passage of the Refutatio omnium haeresium (I 22, 5 = 340 Usener) to understand whether it is consistent with the Epicurean doctrine of soul. First, I provide an account of the historical context of the Refutatio. Secondly, I provide a comparison between the content of the passage and the Epicurean psychology. As a result, the theory according to which " souls are blood " , which occurs in the passage, appears to be inconsistent with...

  18. Nõela all : Igakuine vinüülitutvustus / DJ Drummie

    Index Scriptorium Estoniae

    DJ Drummie

    1999-01-01

    Plaatidest Sandy Rivera feat. LT Brown "Come Into My Room", Deep Sensation "Somehow, Shomewhere (Soul Heaven)", Brothers of Soul "Eyes of Love", Dr.Gary Henry "'Faith", Royal Palm "Hecho En Inglaterra", La Cellule "Sweet Entourage EP", Antonio "Hyperfunk", DJ Paco & Terry Laird feat. MC Adrian "M.U.G. EP vol 1", DJ Brockie & Ed Solo "Represents/Shodown", Fresh and Vegas "Otto's Way/ Heatwave"

  19. Metode Pendidikan Ruhani Perspektif Al-qur'an

    OpenAIRE

    Akmansyah, M

    2013-01-01

    The Qur'an suggests the existence of several factorsthat influence the development of the soul: heredity,environment, and innate potential. Environment is notthe only factor affecting the development of the soul,as well as heredity. However, whole these factors alsoinfluence individual growth and mental development.Several methods offered the Qur'an in educating thesoul by strengthening faith and taqwa; assigningvarious religious obligation, giving encouragement tobe patient and remembering A...

  20. LEAD AND MERCURY EACH AS PRIME MATTER IN ALCHEMY

    OpenAIRE

    Mahdihassan, S.

    1988-01-01

    Prime Matter is matter-cum-energy. The first substance identified as such was lead. When gently heated it becomes red and redness means soul or energy so that lead was potentially red or soul-like and as such dual natured. Mercury also becomes red and can return to white metal. It was thus dual natured and was the second substance recognized as Prime Matter. First lead alone and then lead and mercury were considered as the source of all metals.

  1. Lead and mercury each as prime matter in alchemy.

    Science.gov (United States)

    Mahdihassan, S

    1988-01-01

    Prime Matter is matter-cum-energy. The first substance identified as such was lead. When gently heated it becomes red and redness means soul or energy so that lead was potentially red or soul-like and as such dual natured. Mercury also becomes red and can return to white metal. It was thus dual natured and was the second substance recognized as Prime Matter. First lead alone and then lead and mercury were considered as the source of all metals.

  2. Detsibill : Haige uudishimu. White label : Uma kiilsed mihed. Kuula / DJ Pickney Tiger

    Index Scriptorium Estoniae

    DJ Pickney Tiger, pseud., 1970-

    2006-01-01

    "Kollasest" ajakirjandusest. Heliplaadist Ilves, Pulk & Rahman "Murõt ei olõ". Heliplaatidest: Ro:Toro "Estonian Bagpipe", Tool "10.000days", Rise Against "The sufferer and the witness", "Hi Top Sampler: Fresh from Spain, Spain is Different. Vol 2", Lily Allen "Alright, Still", Stupid F "Nostalgilised helid", Los De Abajo "Los de Abajo vs. The Lunatics", Nuyorican Soul "Nuyorican Soul", Zutons "Tired of Hanging Araound", Razorlight "Razorlight", Ministry Of Sound "Dance Nation"

  3. Research Article Special Issue

    African Journals Online (AJOL)

    2016-05-15

    May 15, 2016 ... the one that ascends soul to the heaven; but it committed a sin and betrayed to the heart and soul gifted by God. She who finds her body stained with her beloved's lust, hates him and begs God to give her a new body and the love in which she understands the pure nature of the Truth and ascends her to the ...

  4. Immortality versus resurrection in the Christian tradition.

    Science.gov (United States)

    Murphy, Nancey

    2011-10-01

    For those in contemporary society who believe in an afterlife, there are a number of views available. The most common may be based on belief in an immortal soul. However, the early Christian account was, instead, bodily resurrection. As Christianity moved throughout the Mediterranean world, apologists and theologians adapted their teaching on human nature and the afterlife to Greek and Roman philosophies. By the time of Augustine (d. 430), the doctrines of body-soul dualism and immortality of the soul were firmly entrenched in Christian teaching. The incorporation of the concept of an immortal soul into Christian accounts of life after death produced a hybrid account. The body dies, the soul (at least of those who were to be saved) travels to heaven. At the end of history, there would be a general resurrection, and the souls would be reunited with their bodies, although the bodies would be in a transformed, indestructible state. This hybrid account of life after death went largely uncontested until the twentieth century. In this essay, I describe this history and argue for a return to the early Christian view of humans as a unity, not a duality, and for belief in resurrection of the body as the appropriate expectation for eternal life. This would not only be truer to Christian sources, but, valuable, I believe, in focusing Christian attention on the need to care for the environment. © 2011 New York Academy of Sciences.

  5. AirBase - A database of 160,000 aerial photos of Greenland 1930-1980s

    Science.gov (United States)

    Korsgaard, Niels; Weng, Willy L.; Kjær, Kurt H.

    2017-04-01

    . Mass balance of the Greenland ice sheet from 1958 to 2007. Geophys. Res. Lett. (2008. (5) Kjær, K.H., Khan, S.A., Korsgaard, N.J., Wahr, J., Bamber, J.L., Hurkmans, R., van den Broeke, M., Timm, L.H., Kjeldsen, K.K., Bjørk, A.A., Larsen, N.K., Jørgensen, L.T., Færch-Jensen, A. & Willerslev, E. Aerial Photographs Reveal Late-20th-Century Dynamic Ice Loss in Northwestern Greenland. Science 337 (2012). (6) Bjørk, A.A., Kjær, K.H., Korsgaard, N.J., Khan, S.A., Kjeldsen, K.K., Andresen, C.S., Box, J, Larsen, N.K. & Funder, S.V. An aerial view of 80 years of climate-related glacier fluctuations in southeast Greenland. Nat. Geosci. 5 (2012). (7) Kjeldsen, K.K., Korsgaard, N.J., Bjørk, A.A., Khan, S.A., Box, J.E., Funder, S., Larsen, N.K., Bamber, J.L., Colgan, W., van den Broeke, M., Siggaard-Andersen, M.-L., Nuth, C., Schomacker, A., Andresen, C.S., Willerslev, E. & Kjær, K.H. Spatial and temporal distribution of mass loss from the Greenland Ice Sheet since AD 1900. Nature 528 (2015). (8) Korsgaard, N.J., Nuth, C., Khan, S.A., Kjeldsen, K.K., Bjørk, A.A., Schomacker A. & Kjær, K.H. Digital elevation model and orthophotographs of Greenland based on aerial photographs from 1978-1987. Sci. Data 3:160032 (2016).

  6. The role of common toads in the winter diet of recolonising Eurasian otters (Lutra lutra

    Directory of Open Access Journals (Sweden)

    Pablo García-Díaz

    2011-02-01

    Full Text Available Importanza del rospo comune nella dieta invernale di una popolazione di lontra (Lutra lutra in espansione.
    Tramite analisi dei resti fecali, abbiamo evidenziato il ruolo fondamentale degli anfibi nella dieta invernale della lontra Lutra lutra in stagni artificiali della Spagna nord-occidentale. I numerosi “laghi di cava” presenti nell’area umida di Ribeiras do Louro e Gandaras de Budiño sono stati monitorati nel 2007-2009. Il rospo comune (Bufo bufo era la principale preda della lontra, costituendo l’88% della biomassa consumata, mentre il gambero americano Procambarus clarkii e i pesci erano prede secondarie. I nostri risultati contrastano con la ben nota preferenza della lontra per le rane rispetto al rospo. Il mantenimento della popolazione di lontra nel bacino del fiume Louro dipende strettamente dalla corretta gestione degli stagni artificiali.

  7. Underwater Inspection of Fleet Moorings.

    Science.gov (United States)

    1979-07-01

    Sl.pin,,~. Phi ladel phia PA: RO I ( ( . I llniract’.. (‘rane IN S-A S I -Al I \\( ,( O’sI - P.A( 1)15 K s ) (od e 11( 1 . Pearl Hark.r. HI: ( ode 2...114 i Mr 114am). Pearl Hath.r HI: ( tide 31t2 RI) I A I - Pe.,rl Flarkir Ill . Commander . Pe ir l HlurI14’r. HI 5.5 5 I -At I- N(,( 1 )51 SI)) Ill l...Monlerdy (A : J. Garrison Monterey (.A S -AA I’IIIIt ,AS E ( 1 ) . ,A CH 2 N1,rf,Clk . V A : ( ode SI! Norfolk V A : Harbo r Clearance Enit i w o

  8. La traduzione dei petrarchisti

    Directory of Open Access Journals (Sweden)

    Ljiljana Avirović

    2000-12-01

    Full Text Available In occasione del convegno internazionale dal titolo Tasso e i croati, svoltosi a Dubrovnik nel dicembre 1995, Tomasovié ha presentato il suo: Torquato Tasso: ljuvene rane/Le piaghe d'amore , un'antologia, con testo originale a fronte, delle migliori traduzioni in croato del vasto opus tassiano dal1580 ai giorni nostri in cui figurano traduttori (che sono a loro volta poeti, scrittori e teorici della letteratura come Dominko Zlatarié, Ivan Gundulié, August Senoa, Ivan Mazuranié, Vladimir Nazor, Frano Cale, Ivan Slaming, Nikola Milicevié, Luko Paljetak e lo stesso Tomasovié. Si tratta di un volume in cui l'autore ha inteso raccogliere il fior fiore della traduzione croata, il cui fervore, a detta di Tomasovié, non conosce equivalenti in Europa.

  9. The spirituality of human consciousness: a Catholic evaluation of some current neuro-scientific interpretations.

    Science.gov (United States)

    McGoldrick, Terence A

    2012-09-01

    Catholic theology's traditional understanding of the spiritual nature of the human person begins with the idea of a rational soul and human mind that is made manifest in free will--the spiritual experience of the act of consciousness and cause of all human arts. The rationale for this religion-based idea of personhood is key to understanding ethical dilemmas posed by modern research that applies a more empirical methodology in its interpretations about the cause of human consciousness. Applications of these beliefs about the body/soul composite to the theory of evolution and to discoveries in neuroscience, paleoanthropology, as well as to recent animal intelligence studies, can be interpreted from this religious and philosophical perspective, which argues for the human soul as the unifying cause of the person's unique abilities. Free will and consciousness are at the nexus of the mutual influence of body and soul upon one another in the traditional Catholic view, that argues for a spiritual dimension to personality that is on a par with the physical metabolic processes at play. Therapies that affect consciousness are ethically problematic, because of their implications for free will and human dignity. Studies of resilience, as an example, argue for the greater, albeit limited, role of the soul's conscious choices in healing as opposed to metabolic or physical changes to the brain alone.

  10. Academic psychology or the lost meaning of psychology as praxis

    Directory of Open Access Journals (Sweden)

    Todorović Milorad V.

    2013-01-01

    Full Text Available Academic psychology has interpreted the development of neuro-biological sciences, especially neurobiological psychology, as the death of the soul and the disappearance of its hermeneutic dimension. One could ask maliciously why the need to look so deeply for the meaning sought by the Soul and "speech-being", at a time when the secrets of neurons are successfully decoded, as well as their chemical and electrical activity. It would be a huge mistake to think, by following the achievements of the so-called empirical research in psychology and works that can be published only in Serbian journal Psihologija, that the same cognitive schemes can equally well explaine the behavior of individual cells and individual behavior. Fortunately, the subject’s soul, which is believed to have been banished from the "real", "true" science, and biological theories, returns even under the banner of cognitivism. Academic psychology would still have to ask what has always been its primary objective: what constitutes the soul; what types of ideas, what kind of logical diversity constitutes the soul. Psychology does not have to know the answer, but it must be noted that only dynamic psychology seeks one. So, for the sake of psychology as praxis, dynamic psychology should be a syllabus in the education of future psychologists, who would not imitate otorhinolaryngologists or ophthalmologists.

  11. Quantum Consciousness - The Road to Reality

    Science.gov (United States)

    Goradia, Shantilal

    Per Einstein's theory mass tells space how to curve and space tells mass how to move. How do they tell\\x9D? The question boils down to information created by quantum particles blinking ON and OFF analogous to 'Ying and Yang' or some more complex ways that may include dark matter. Consciousness, dark matter, quantum physics, uncertainty principle, constants of nature like strong coupling, fine structure constant, cosmological constant introduced by Einstein, information, gravitation etc. are fundamentally consequences of that ONE TOE. Vedic philosophers, who impressed Schrodinger so much, called it ATMA split in the categories of AnuAtma (particle soul), JivAtma (life soul) and ParamAtma (Omnipresent soul) which we relate to quantum physics, biology and cosmology. There is no separate TOE (Theory of Everything) for any one thing.

  12. Theocentrism in Edith Stein’s (St. Teresa Benedicta of the Cross’s Late Anthropology

    Directory of Open Access Journals (Sweden)

    Jadwiga Guerrero van der Meijden

    2014-09-01

    Full Text Available This article proposes the thesis that Edith Stein’s late anthropology has a theocentric orientation. The threefold structure of a human being consisting of a body, soul and spirit is examined in order to validate the thesis. First of all, the finitude of a human being points out to the eternal being and – consequently – human beings are not conceivable by themselves, without the context of God. Moreover, the hylomorphic union of the body and soul adopted from Aristotelian and Thomistic philosophy is enriched in Stein’s anthropology by the concept of spirit. This results in a threefold structure and is reason enough to suggest man’s iconic similarity to the Trinity. Furthermore, Stein takes over St. Teresa of Avila’s concept of an internal center of the soul, which can be a meeting point between a person and God. The analysis of the soul’s center supports the main thesis.

  13. The methodology of natural sciences in antiquity and the second book of Galen’s De placitis Hippocratis et Platonis

    Directory of Open Access Journals (Sweden)

    Koptseva, Natalia

    2015-01-01

    Full Text Available In this article, based on the second book of Galen’s De placitis Hippocratis et Platonis, we analyze scientific method of the famous anatomist and philosopher. We discuss experimental, logical and philosophical argumentation that Galen employs in his proof that the rational part of the soul situated in human brain. We study his polemics with Chrysippus, who declares that the rational part of the soul is located in the heart, and conclude that the treatise by Galen sets the standards of scientific studies in antiquity, which combines medical, philosophical and moral components.

  14. YAVUZ BAHADIROĞLU'S VALUES IN CHILD'S STUDIES EDUCATION

    OpenAIRE

    Katı, Yasemin

    2015-01-01

    Literature, which nourish the soul and educate the people, is one of the branch of art. Yavuz Bahadıroğlu is one of the literateur of our time who wri-tes stories appealing the children’s soul and contributing to the education.In his stories, abstract concepts are used; themes such as love, friendship, co-operation, helping, health etc were examined. The love of family, friends and school, cooperation, helping each other and topics like them were chosen. The writer wrote his books with a plai...

  15. The phenomenon of the self-identification in ancient eastern traditions

    Directory of Open Access Journals (Sweden)

    O. O. Stoiano

    2015-04-01

    By majority of ancient Indian sages (in the Vedas, the Upanishads the Self was conceived as invariant and unchanging core of essence of the soul (Atman, the managing body and which is the organic part of the universal whole (Brahman. In Buddhist philosophy, the concept of ‘I’ is movable, unknowable, because it is a continuous process of choosing vital values, reincarnations and suffering on the way to finding the true Self in Nirvana. Like Buddhism, Taoism conceives the Self as a set of states of the soul and body, but unlike Buddhism, asserts the possibility of self­knowledge, at least on an intuitive level.

  16. [The image of Man and his care in the hygiene-dietetic tratises of the XVII and XVIII centuries].

    Science.gov (United States)

    Gonzalez de Pablo, A

    1993-01-01

    This work presents a study of the traditional hygienc-dietetic treatises of the XVII and XVIII centuries. Two characteristics define these treatises: the following of Aristotelian and Galenic postulates in their theoretical conception and, in the practical section, the preponderance of the care of the soul in relation to that of the body. This work firstly cover their theoretical foundation (the vision of Man derived from their conception of the body, their notion of the soul and the dynamic relationship established between both); and, secondly, the practical application derived from these concepts (the care of Man on both his planes; the corporal and the psychic).

  17. SPIRITUALITY AND SINCERITY AS BASIC "EXISTENTIALS" OF HUMAN EXISTENCE: THE PEDAGOGICAL CONTEXT

    OpenAIRE

    Yu. N. Sinitsyn; A. G. Hentonen

    2015-01-01

    The article presents the philosophical-pedagogical and psychological analysis of the categories of "spirit," "soul" and "body", different views on the concepts of "spirituality", "sincerity" and "physicality." The "spirit" and "spirituality" is considered from the perspective of the unity of the three fundamental values of human existence (Truth, Goodness, Beauty), highlighting three areas of spiritual activity - knowledge, art, morality. "Soul" and "sincerity" are associated with the interna...

  18. РАСШИРЕНИЕ <<Я>>И ОБРАЗ УСАДЬБЫ В ТВОРЧЕСТВЕ ЧЕХОВА

    OpenAIRE

    郡, 伸哉; Синъя, КОРИ; 中京大学; Унив. Тюкио

    1995-01-01

    The fantasies which the heroes of The Black Monk and The Sea Gull are obsessed with - the fantasy of a black monk who wanders all over the universe and that of the World Soul which contains all the souls in the universe - show the heroes' desire to assimilate infinite space and time, i.e. a desire for the maximal expansion of the ego. These megalomaniac dreams are accompanied by rapture of love. They are products of the heroes' wish to get out of loneliness and out of the consciousness of the...

  19. Nursing...focused on tasks or people?

    Science.gov (United States)

    McCarver, Pamala K

    2011-01-01

    Through being a patient, this nurse experienced healthcare professionals can be limited regarding the deeper issues within a patient's soul. Nurses cannot give what they do not have; but responding to personal spiritual needs equips nurses to meet patients' soul needs. The biblical account of sisters Mary and Martha (Luke 10:38-42) provides insight on the importance of Christian discipleship and dilegent work, suggesting Christian nurses may need to be like Mary--sitting at Jesus' feet, and Martha--working for Christ.

  20. THE SYMBOLS OF CREATIVE ENERGY IN THE LITERATURE ON MYSTICSM AND ON ALCHEMY

    OpenAIRE

    Mahdihassan, S.

    1989-01-01

    Alchemy as art tries to imitate creation such as spontaneous generation. The magic wands of creation, of Chinese origin, would be a compass and a triangular carpenter's square. Creation is represented by the dual-natured soul, comprising of the spirit (Ruh) and “the” soul (Nafs). The ultimate source is creative energy which emanates form the Divine word of command. Creative energy, in its non-manifest form, would be ultrasonic energy, which can be represented by a humming sourd. This would be...