WorldWideScience

Sample records for ran shi bo

  1. Výzkum církve a náboženského života v raně novověkých městech

    Czech Academy of Sciences Publication Activity Database

    Mikulec, Jiří

    2013-01-01

    Roč. 32, č. 2 (2013), s. 139-151 ISSN 0231-7443. [Města ve středověku a raném novověku jako badatelské téma posledních dvou desetiletí. Praha, 10.10.2011-11.10.2011] Institutional support: RVO:67985963 Keywords : Early Modern period * towns * church * religious life Subject RIV: AB - History

  2. YUAN-BO SUN

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. YUAN-BO SUN. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 173-178 RESEARCH ARTICLE. Investigating multiple dysregulated pathways in rheumatoid arthritis based on pathway interaction network · XIAN-DONG SONG XIAN-XU SONG GUI-BO LIU ...

  3. Women stereotypes in Shi Zhecun's short stories.

    Science.gov (United States)

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  4. Dr. Shi Hanzhang's Experience in Treating Andropathy

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  5. Inter-cellular transport of ran GTPase.

    Directory of Open Access Journals (Sweden)

    Deepak Khuperkar

    Full Text Available Ran, a member of the Ras-GTPase superfamily, has a well-established role in regulating the transport of macromolecules across the nuclear envelope (NE. Ran has also been implicated in mitosis, cell cycle progression, and NE formation. Over-expression of Ran is associated with various cancers, although the molecular mechanism underlying this phenomenon is unclear. Serendipitously, we found that Ran possesses the ability to move from cell-to-cell when transiently expressed in mammalian cells. Moreover, we show that the inter-cellular transport of Ran is GTP-dependent. Importantly, Ran displays a similar distribution pattern in the recipient cells as that in the donor cell and co-localizes with the Ran binding protein Nup358 (also called RanBP2. Interestingly, leptomycin B, an inhibitor of CRM1-mediated export, or siRNA mediated depletion of CRM1, significantly impaired the inter-cellular transport of Ran, suggesting a function for CRM1 in this process. These novel findings indicate a possible role for Ran beyond nucleo-cytoplasmic transport, with potential implications in inter-cellular communication and cancers.

  6. Civil Engineering for the SHiP facility

    CERN Document Server

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  7. Radiation protection studies for the SHiP facility

    CERN Document Server

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  8. Dicty_cDB: SHI251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  9. Dicty_cDB: SHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  10. Dicty_cDB: SHI777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  11. Dark matter at the SHiP experiment

    International Nuclear Information System (INIS)

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  12. Tackling complex turbulent flows with transient RANS

    NARCIS (Netherlands)

    Kenjeres, S.; Hanjalic, K.

    2009-01-01

    This article reviews some recent applications of the transient-Reynoldsaveraged Navier–Stokes (T-RANS) approach in simulating complex turbulent flows dominated by externally imposed body forces, primarily by thermal buoyancy and the Lorentz force. The T-RANS aims at numerical resolving unsteady

  13. The SHiP physics program

    Science.gov (United States)

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  14. Why investors shy away from coal

    International Nuclear Information System (INIS)

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  15. The SHiP project at CERN

    Science.gov (United States)

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  16. The SHiP experiment at CERN

    Science.gov (United States)

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  17. Higher-order RANS turbulence models for separated flows

    Data.gov (United States)

    National Aeronautics and Space Administration — Higher-order Reynolds-averaged Navier-Stokes (RANS) models are developed to overcome the shortcomings of second-moment RANS models in predicting separated flows....

  18. BoA Venus is Back

    Institute of Scientific and Technical Information of China (English)

    田梦园

    2010-01-01

    暌违韩国歌坛五年.BoA终于带着自己的六辑回到韩国的歌谣舞台。经历了日本.美国歌坛的洗礼,BoA以更加成熟,更具实力的形象回到自己的主场.让我们一起迎接Venus的回归。

  19. Evaluation of energy and cost savings in mobile Cloud RAN

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Christiansen, Henrik Lehrmann; Berger, Michael Stübert

    2013-01-01

    , is sub optimal, comparing to a novel, cloud based architecture called Cloud Radio Access Network (C-RAN). In C-RAN a group of cells shares processing resources, and hence benefit from statistical multiplexing gain is expected. In this paper, the energy and cost savings in C-RAN are evaluated numerically...

  20. Brothers or Rivals? Iran and the Shi'a of Iraq

    National Research Council Canada - National Science Library

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  1. Extraction and beam transfer for the SHiP facility

    CERN Document Server

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  2. BoA The Best is Coming

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    成功进军美国歌坛,迈向全新阶段的BoA,化身为双面歌姬,发行了专辑《BEST&USA》将“日文精选辑”与“美国出道专辑”2张作品结合为9年来,从韩国到日本再到美国,BoA的成长令人无法忽视。

  3. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Science.gov (United States)

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  4. A SHiP to explore new routes

    CERN Multimedia

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  5. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    International Nuclear Information System (INIS)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  6. Algorithmes de couplage RANS et ecoulement potentiel

    Science.gov (United States)

    Gallay, Sylvain

    -decrochage. L'algorithme de couplage a ete compare a des donnees de plus haute fidelite sur des configurations issues de la litterature. Un modele de fuselage base sur des relations empiriques et des simulations RANS a ete teste et valide. Les coefficients de portance, de trainee et de moment de tangage ainsi que les coefficients de pression extraits le long de l'envergure ont montre un bon accord avec les donnees de soufflerie et les modeles RANS pour des configurations transsoniques. Une configuration a geometrie hypersustentatoire a permis d'etudier la modelisation des surfaces hypersustentees de la methode d'ecoulement potentiel, demontrant que la cambrure peut etre prise en compte uniquement dans les donnees visqueuses.

  7. Cloud RAN for Mobile Networks - a Technology Overview

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Christiansen, Henrik Lehrmann; Yan, Ying

    2014-01-01

    Cloud Radio Access Network (C-RAN) is a novel mobile network architecture which can address a number of challenges the operators face while trying to support growing end-user’s needs. The main idea behind C-RAN is to pool the Baseband Units (BBUs) from multiple base stations into centralized BBU...

  8. $\\mu$-flux measurements for SHiP using NA61/SHINE

    CERN Document Server

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  9. Calibrating the SHiP muon-flux using NA61/SHINE

    CERN Document Server

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  10. The contribution of lexical access speed to RAN and reading

    DEFF Research Database (Denmark)

    Poulsen, Mads

    and reading speed in the older age group was still strong after controlling for general speed of processing, but controlling for confrontation picture naming speed reduced the contribution of RAN to only marginally significant. Conclusions: We conclude that RAN-objects relationship with reading speed......Purpose: The study investigated why and when rapid automatised naming is a predictor of reading. Specifically, we tested the hypotheses that (1) RAN-objects predicts reading because it is a measure of lexical (e.g. phonological) access speed, but (2) that RAN only becomes a predictor of reading...... development once a certain level of phonological recoding proficiency has been reached. Method: Forty Danish students without reading difficulties were administered tests of reading speed and accuracy, phoneme awareness, RAN-objects, timed confrontation picture naming, and visio-motor reaction time...

  11. Clostridium botulinum strains producing BoNT/F4 or BoNT/F5.

    Science.gov (United States)

    Raphael, Brian H; Bradshaw, Marite; Kalb, Suzanne R; Joseph, Lavin A; Lúquez, Carolina; Barr, John R; Johnson, Eric A; Maslanka, Susan E

    2014-05-01

    Botulinum neurotoxin type F (BoNT/F) may be produced by Clostridium botulinum alone or in combination with another toxin type such as BoNT/A or BoNT/B. Type F neurotoxin gene sequences have been further classified into seven toxin subtypes. Recently, the genome sequence of one strain of C. botulinum (Af84) was shown to contain three neurotoxin genes (bont/F4, bont/F5, and bont/A2). In this study, eight strains containing bont/F4 and seven strains containing bont/F5 were examined. Culture supernatants produced by these strains were incubated with BoNT/F-specific peptide substrates. Cleavage products of these peptides were subjected to mass spectral analysis, allowing detection of the BoNT/F subtypes present in the culture supernatants. PCR analysis demonstrated that a plasmid-specific marker (PL-6) was observed only among strains containing bont/F5. Among these strains, Southern hybridization revealed the presence of an approximately 242-kb plasmid harboring bont/F5. Genome sequencing of four of these strains revealed that the genomic backgrounds of strains harboring either bont/F4 or bont/F5 are diverse. None of the strains analyzed in this study were shown to produce BoNT/F4 and BoNT/F5 simultaneously, suggesting that strain Af84 is unusual. Finally, these data support a role for the mobility of a bont/F5-carrying plasmid among strains of diverse genomic backgrounds.

  12. BoA ONLY ONE ONLY DREAM

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    <正>说到韩流先驱者,一定不能不提到BoA,她就像一颗恒星,在夜空中持续发光发热,不仅能让人时时刻刻都看到自己,也为后辈们照出了一条光明的道路。如今的她,已经不能仅仅被称作偶像,她已经是个能够给我们带来洗涤灵魂的音乐的专业歌者。BoA成功艺人13岁,对于很多人来说只是青春的开始,心智刚开始发育,是接受新鲜事物最快的年纪,也是最可爱的年纪。而这个年纪的BoA已经踏上了舞台,成为了一名歌手。小小年纪就作为SOLO歌手出道,是一件十分需要勇气的事情,而公司的力捧也

  13. SHI induced irradiation effect on Mo/Si interface

    International Nuclear Information System (INIS)

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  14. A framework for resources allocation in virtualised C-RAN

    DEFF Research Database (Denmark)

    Al-Samman, Imad; Artuso, Matteo; Christiansen, Henrik Lehrmann

    2016-01-01

    the performance gains of different resource allocation schemes in legacy LTE air interface virtualization. Moreover Cloud — based mobile networks are anticipated to play a significant role for next generation mobile networks. This paper investigates the potential deployment benefits of a novel resource...... virtualization algorithm (Traffic Aware Joint Scheduling) in Cloud-RANs (C-RAN). Air interface resources are coordinated and allocated dynamically by a hypervisor among different virtual operators (VOs). Three distinctive schemes are proposed and evaluated against standard Round Robin (RR) C-RAN scheduling...

  15. Cloud RAN for Mobile Networks - a Technology Overview

    OpenAIRE

    Checko, Aleksandra; Christiansen, Henrik Lehrmann; Yan, Ying; Scolari, Lara; Kardaras, Georgios; Berger, Michael Stübert; Dittmann, Lars

    2014-01-01

    Cloud Radio Access Network (C-RAN) is a novel mobile network architecture which can address a number of challenges the operators face while trying to support growing end-user’s needs. The main idea behind C-RAN is to pool the Baseband Units (BBUs) from multiple base stations into centralized BBU Pool for statistical multiplexing gain, while shifting the burden to the high-speed wireline transmission of In-phase and Quadrature (IQ) data. C-RAN enables energy efficient network operation and pos...

  16. Search for New Physics in SHiP and at future colliders

    CERN Document Server

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  17. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    CERN Document Server

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  18. Interaction and conflict between Sufism and Shi`ism during Safavid era

    Directory of Open Access Journals (Sweden)

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  19. Expression of RAN, ZHX-2, and CHC1L genes in multiple myeloma patients and in myeloma cell lines treated with HDAC and Dnmts inhibitors

    Czech Academy of Sciences Publication Activity Database

    Legartová, Soňa; Harničarová, Andrea; Bártová, Eva; Hájek, R.; Pour, L.; Kozubek, Stanislav

    2010-01-01

    Roč. 57, č. 5 (2010), s. 482-487 ISSN 0028-2685 R&D Projects: GA MŠk ME 919; GA ČR(CZ) GAP302/10/1022 Grant - others:GA MŠk(CZ) LC06027; GA MŠk(CZ) LC535 Program:LC; LC Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : multiple myeloma * RAN * ZHX-2 Subject RIV: BO - Biophysics Impact factor: 1.449, year: 2010

  20. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Science.gov (United States)

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  1. 5th Symposium on Hybrid RANS-LES Methods

    CERN Document Server

    Haase, Werner; Peng, Shia-Hui; Schwamborn, Dieter

    2015-01-01

    This book gathers the proceedings of the Fifth Symposium on Hybrid RANS-LES Methods, which was held on March 19-21 in College Station, Texas, USA. The different chapters, written by leading experts, reports on the most recent developments in flow physics modelling, and gives a special emphasis to industrially relevant applications of hybrid RANS-LES methods and other turbulence-resolving modelling approaches. The book addresses academic researchers, graduate students, industrial engineers, as well as industrial R&D managers and consultants dealing with turbulence modelling, simulation and measurement, and with multidisciplinary applications of computational fluid dynamics (CFD), such as flow control, aero-acoustics, aero-elasticity and CFD-based multidisciplinary optimization. It discusses in particular advanced hybrid RANS-LES methods. Further topics include wall-modelled Large Eddy Simulation (WMLES) methods, embedded LES, and a comparison of the LES methods with both hybrid RANS-LES and URANS methods. ...

  2. Envisioning Spectrum Management in Virtualised C-RAN

    OpenAIRE

    Al-Samman, Imad; Artuso, Matteo; Christiansen, Henrik Lehrmann; Doufexi, Angela; Beach, Mark

    2017-01-01

    Cloud Radio Access Network (C-RAN) has attracted a worldwide attention in both academia and industry. This network architecture re-forming has been considered as a potential solution to meet the increasing capacity demands for future mobile data traffic. In addition, Network Virtualisation is a promising technique for efficient resource utilisation. This paper proposes a customisable resource virtualisation algorithm for multi user data scheduling in a Long Term Evolution (LTE) C- RAN deploym...

  3. Performance Analysis of Several Functional Splits in C-RAN

    OpenAIRE

    Duan , Jialong; Lagrange , Xavier; Guilloud , Frédéric

    2016-01-01

    International audience; Centralized/Cloud Radio Access Network (C-RAN) is a promising future mobile network architecture, which can potentially increase the capacity of mobile network meanwhile reducing operators' cost. In standard C-RAN, frequency shifting is made in Remote Radio Heads (RRHs), which are close to the antennas. Signal processing and upper layers are made in Baseband Unit (BBU) pool for multiple base stations. However, this results in high burden on the optical transport networ...

  4. Poenostavljen sistem za samodejno bočno parkiranje

    OpenAIRE

    ŠTROS, MATIC

    2014-01-01

    Diplomsko delo prikazuje poenostavljen sistem bočnega parkiranja na modelu vozila. Sistemi za bočno parkiranje se že pojavljajo v avtomobilski industriji in so zmožni detekcije praznega parkirnega mesta ter vožnje v parkirni prostor. Prednost takega sistema, vgrajenega v vozilo, je v tem, da lajša bočno parkiranje, ki ga mnogi neizkušeni vozniki ne obvladajo.

  5. La journée de Bo

    CERN Document Server

    Treille, Daniel

    2014-01-01

    Après le départ de ses collègues, retournés à l’Institut, Bo se retrouve seul dans l’Observatoire, installé à très haute altitude dans un cadre grandiose, quelque part en Asie centrale, maître d’un stupéfiant champ d’antennes tournées vers le cosmos, qui scrutent l’espace à la recherche des premières sources de lumière de l’univers. Il a alors tout loisir de donner libre cours à ses pensées, laissant vagabonder son esprit au fil des événements qui l’ont amené là et des impressions qu’il retrouve. Daniel Treille nous propose de l’accompagner le temps d’une journée de travail, qui commence comme d'autres, mais va s’achever d'une manière bien singulière. Mêlant souvenirs personnels, expériences de sa vie professionnelle et regards sur le monde actuel, sa méditation prend aussi et surtout la forme d’une réflexion sur la modernité technologique, la science, la transmission du savoir, sur fond d’observations géopolitiques, faisant ainsi de La Journée de Bo u...

  6. Botulinum toxin (BoNT) and back pain.

    Science.gov (United States)

    Porta, Mauro; Maggioni, G

    2004-02-01

    Myofascial pain syndrome is defined as subacute or chronic pain with sensory, motor and autonomic symptoms referred from active trigger points with associated painful dysfunctions. Authors present the usefulness of botulinum toxin A or B (BoNT/A or BoNT/B) injected into target muscles since the toxin is capable of controlling not only the muscular spasm but mostly the pain by alternative mechanisms of action, which are discussed. Posology of BoNT, technical aspects and results are presented. BoNT represents an interesting and useful tool for an adequate management of patients with myofascial pain.

  7. Synthetic lipophilic antioxidant BO-653 suppresses HCV replication.

    Science.gov (United States)

    Yasui, Fumihiko; Sudoh, Masayuki; Arai, Masaaki; Kohara, Michinori

    2013-02-01

    The influence of the intracellular redox state on the hepatitis C virus (HCV) life cycle is poorly understood. This study demonstrated the anti-HCV activity of 2,3-dihydro-5-hydroxy-2,2-dipentyl-4,6-di-tert-butylbenzofuran (BO-653), a synthetic lipophilic antioxidant, and examined whether BO-653's antioxidant activity is integral to its anti-HCV activity. The anti-HCV activity of BO-653 was investigated in HuH-7 cells bearing an HCV subgenomic replicon (FLR3-1 cells) and in HuH-7 cells infected persistently with HCV (RMT-tri cells). BO-653 inhibition of HCV replication was also compared with that of several hydrophilic and lipophilic antioxidants. BO-653 suppressed HCV replication in FLR3-1 and RMT-tri cells in a concentration-dependent manner. The lipophilic antioxidants had stronger anti-HCV activities than the hydrophilic antioxidants, and BO-653 displayed the strongest anti-HCV activity of all the antioxidants examined. Therefore, the anti-HCV activity of BO-653 was examined in chimeric mice harboring human hepatocytes infected with HCV. The combination treatment of BO-653 and polyethylene glycol-conjugated interferon-α (PEG-IFN) decreased serum HCV RNA titer more than that seen with PEG-IFN alone. These findings suggest that both the lipophilic property and the antioxidant activity of BO-653 play an important role in the inhibition of HCV replication. Copyright © 2012 Wiley Periodicals, Inc.

  8. Search for hidden particles with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  9. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Science.gov (United States)

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  10. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Science.gov (United States)

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  11. RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

    OpenAIRE

    Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike

    2001-01-01

    We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

  12. Muon-flux measurements for SHiP at H4

    CERN Document Server

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  13. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Science.gov (United States)

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  14. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Directory of Open Access Journals (Sweden)

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  15. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    CERN Document Server

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  16. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  17. The SHiP experiment at CERN SPS

    CERN Document Server

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  18. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  19. Neutrino physics with the SHiP experiment

    CERN Document Server

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  20. Nízkoteplotní plazma v hojení ran

    Czech Academy of Sciences Publication Activity Database

    Kubinová, Šárka; Závišková, Kristýna; Lunov, Oleg; Churpita, Olexandr; Zablotskyy, Vitaliy A.; Dejneka, Alexandr

    2016-01-01

    Roč. 2016, č. 1 (2016), s. 20-21 ISSN 1214-231X R&D Projects: GA TA ČR(CZ) TA04010449 Institutional support: RVO:68378041 Keywords : low-temperature plasma * wound healing * chronic wounds * dermatology * diabetic foot Subject RIV: BO - Biophysics OBOR OECD: Biochemical research methods

  1. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Directory of Open Access Journals (Sweden)

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  2. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Science.gov (United States)

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  3. Real-life C-RAN deployment considerations

    DEFF Research Database (Denmark)

    Hansen, Line Maria Pyndt; Ruepp, Sarah Renée; Christiansen, Henrik Lehrmann

    2017-01-01

    procedures and best practices for roll out are yet to be established. This work provides a case study, where a small but densely populated part of the network owned by the Danish mobile network operator, TDC, is evaluated for C-RAN deployment. A roadmap is provided which uses traffic data as input...

  4. Evaluation of Packet Preemption over C-RAN Fronthaul Networks

    DEFF Research Database (Denmark)

    Yan, Ying; Zhou, Zifan; Ruepp, Sarah Renée

    2017-01-01

    The Cloud Radio Access Network (C-RAN) is viewed as a new solution with benefits of reduced cost by sharing resources. This is achieved by the separation of the radio part and the radio processing part, where the transport network between them is referred to as front-haul. It is essential to meet...

  5. Hybrid RANS-LES using high order numerical methods

    Science.gov (United States)

    Henry de Frahan, Marc; Yellapantula, Shashank; Vijayakumar, Ganesh; Knaus, Robert; Sprague, Michael

    2017-11-01

    Understanding the impact of wind turbine wake dynamics on downstream turbines is particularly important for the design of efficient wind farms. Due to their tractable computational cost, hybrid RANS/LES models are an attractive framework for simulating separation flows such as the wake dynamics behind a wind turbine. High-order numerical methods can be computationally efficient and provide increased accuracy in simulating complex flows. In the context of LES, high-order numerical methods have shown some success in predictions of turbulent flows. However, the specifics of hybrid RANS-LES models, including the transition region between both modeling frameworks, pose unique challenges for high-order numerical methods. In this work, we study the effect of increasing the order of accuracy of the numerical scheme in simulations of canonical turbulent flows using RANS, LES, and hybrid RANS-LES models. We describe the interactions between filtering, model transition, and order of accuracy and their effect on turbulence quantities such as kinetic energy spectra, boundary layer evolution, and dissipation rate. This work was funded by the U.S. Department of Energy, Exascale Computing Project, under Contract No. DE-AC36-08-GO28308 with the National Renewable Energy Laboratory.

  6. Nonempirical calculations of the LiBO molecule

    International Nuclear Information System (INIS)

    Nemukhin, A.V.; Stepanov, N.F.

    1987-01-01

    Problems of nonempirical calculations of molecule energies, related to the use of limited basis AO set and configurations were considered taking the LiBO molecule as an example. The version of optimizing parameters of basis functions of the base of the concept of ''atoms in molecules'' was suggested. It is shown that correct description of the potential surface of LiBO molecule is impossible without consideration of electron correlation; main contributions to correlation corrections were distinguished

  7. Envisioning Spectrum Management in Virtualised C-RAN

    DEFF Research Database (Denmark)

    Al-Samman, Imad; Artuso, Matteo; Christiansen, Henrik Lehrmann

    2017-01-01

    Cloud Radio Access Network (C-RAN) has attracted a worldwide attention in both academia and industry. This network architecture re-forming has been considered as a potential solution to meet the increasing capacity demands for future mobile data traffic. In addition, Network Virtualisation...... is a promising technique for efficient resource utilisation. This paper proposes a customisable resource virtualisation algorithm for multi user data scheduling in a Long Term Evolution (LTE) C- RAN deployment. The algorithm is based on the hypervisor specific assignment of air resources allocation between...... the virtual operators (VOs) dynamically, based on either joint scheduling or per cell schemes. The objective is to improve the resource allocation mechanism based on traffic conditions and a database of pre-defined services priorities. Two distinctive scenarios are considered and evaluated against standard...

  8. Hybrid RANS/LES applied to complex terrain

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Sørensen, Niels N.

    2011-01-01

    Large Eddy Simulation (LES) of the wind in complex terrain is limited by computational cost. The number of computational grid points required to resolve the near-ground turbulent structures (eddies) are very high. The traditional solution to the problem has been to apply a wall function...... aspect ratio in the RANS layer and thereby resolve the mean near-wall velocity profile. The method is applicable to complex terrain and the benefits of traditional LES are kept intact. Using the hybrid method, simulations of the wind over a natural complex terrain near Wellington in New Zealand...... that accounts for the whole near-wall region. Recently, a hybrid method was proposed in which the eddies close to the ground were modelled in a Reynolds-averaged sense (RANS) and the eddies above this region were simulated using LES. The advantage of the approach is the ability to use shallow cells of high...

  9. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Directory of Open Access Journals (Sweden)

    Azamat Aslanukov

    2006-10-01

    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  10. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Science.gov (United States)

    Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A

    2006-10-01

    The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  11. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Science.gov (United States)

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  12. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    CERN Document Server

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  13. TianShuiShi space breeding current situation and developing trend

    International Nuclear Information System (INIS)

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  14. AVHRR GAC SST Reanalysis Version 1 (RAN1

    Directory of Open Access Journals (Sweden)

    Alexander Ignatov

    2016-04-01

    Full Text Available In response to its users’ needs, the National Oceanic and Atmospheric Administration (NOAA initiated reanalysis (RAN of the Advanced Very High Resolution Radiometer (AVHRR Global Area Coverage (GAC; 4 km sea surface temperature (SST data employing its Advanced Clear Sky Processor for Oceans (ACSPO retrieval system. Initially, AVHRR/3 data from five NOAA and two Metop satellites from 2002 to 2015 have been reprocessed. The derived SSTs have been matched up with two reference SSTs—the quality controlled in situ SSTs from the NOAA in situ Quality Monitor (iQuam and the Canadian Meteorological Centre (CMC L4 SST analysis—and analyzed in the NOAA SST Quality Monitor (SQUAM online system. The corresponding clear-sky ocean brightness temperatures (BT in AVHRR bands 3b, 4 and 5 (centered at 3.7, 11, and 12 µm, respectively have been compared with the Community Radiative Transfer Model simulations in another NOAA online system, Monitoring of Infrared Clear-sky Radiances over Ocean for SST (MICROS. For some AVHRRs, the time series of “AVHRR minus reference” SSTs and “observed minus model” BTs are unstable and inconsistent, with artifacts in the SSTs and BTs strongly correlated. In the official “Reanalysis version 1” (RAN1, data from only five platforms—two midmorning (NOAA-17 and Metop-A and three afternoon (NOAA-16, -18 and -19—were included during the most stable periods of their operations. The stability of the SST time series was further improved using variable regression SST coefficients, similarly to how it was done in the NOAA/NASA Pathfinder version 5.2 (PFV5.2 dataset. For data assimilation applications, especially those blending satellite and in situ SSTs, we recommend bias-correcting the RAN1 SSTs using the newly developed sensor-specific error statistics (SSES, which are reported in the product files. Relative performance of RAN1 and PFV5.2 SSTs is discussed. Work is underway to improve the calibration of AVHRR/3s and

  15. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Science.gov (United States)

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  16. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Science.gov (United States)

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  17. Transparência: Bacen versus BoE

    Directory of Open Access Journals (Sweden)

    Eduardo de Carvalho Andrade

    2005-12-01

    Full Text Available Transparency: Bacen versus BoE. The aim of this paper is to compare the degree of transparency of the Brazilian Central Bank (Bacen with the one verified in the Bank of England (BoE. In order to accomplish this objective, an indicator of transparency is built based on the information that each central bank provides to the public about its monetary policy, its expectation about the future of the economy, its intervention in the financial market, and if there are clear limits and restrictions to the release of information to the general public. The analysis suggests that the Bacen is less transparent and has a less individualistic Monetary Policy Committee in comparison with the BoE. Moreover, it indicates some procedures that could be adopted by the Bacen in order to make its monetary policy more transparent.

  18. Kinesin-1 and mitochondrial motility control by discrimination of structurally equivalent but distinct subdomains in Ran-GTP-binding domains of Ran-binding protein 2.

    Science.gov (United States)

    Patil, Hemangi; Cho, Kyoung-in; Lee, James; Yang, Yi; Orry, Andrew; Ferreira, Paulo A

    2013-03-27

    The pleckstrin homology (PH) domain is a versatile fold that mediates a variety of protein-protein and protein-phosphatidylinositol lipid interactions. The Ran-binding protein 2 (RanBP2) contains four interspersed Ran GTPase-binding domains (RBD(n = 1-4)) with close structural homology to the PH domain of Bruton's tyrosine kinase. The RBD2, kinesin-binding domain (KBD) and RBD3 comprise a tripartite domain (R2KR3) of RanBP2 that causes the unfolding, microtubule binding and biphasic activation of kinesin-1, a crucial anterograde motor of mitochondrial motility. However, the interplay between Ran GTPase and R2KR3 of RanBP2 in kinesin-1 activation and mitochondrial motility is elusive. We use structure-function, biochemical, kinetic and cell-based assays with time-lapse live-cell microscopy of over 260,000 mitochondrial-motility-related events to find mutually exclusive subdomains in RBD2 and RBD3 towards Ran GTPase binding, kinesin-1 activation and mitochondrial motility regulation. The RBD2 and RBD3 exhibit Ran-GTP-independent, subdomain and stereochemical-dependent discrimination on the biphasic kinetics of kinesin-1 activation or regulation of mitochondrial motility. Further, KBD alone and R2KR3 stimulate and suppress, respectively, multiple biophysical parameters of mitochondrial motility. The regulation of the bidirectional transport of mitochondria by either KBD or R2KR3 is highly coordinated, because their kinetic effects are accompanied always by changes in mitochondrial motile events of either transport polarity. These studies uncover novel roles in Ran GTPase-independent subdomains of RBD2 and RBD3, and KBD of RanBP2, that confer antagonizing and multi-modal mechanisms of kinesin-1 activation and regulation of mitochondrial motility. These findings open new venues towards the pharmacological harnessing of cooperative and competitive mechanisms regulating kinesins, RanBP2 or mitochondrial motility in disparate human disorders.

  19. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Science.gov (United States)

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  20. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    African Journals Online (AJOL)

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  1. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  2. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    Directory of Open Access Journals (Sweden)

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  3. Aggresome formation is regulated by RanBPM through an interaction with HDAC6

    Directory of Open Access Journals (Sweden)

    Louisa M. Salemi

    2014-05-01

    Full Text Available In conditions of proteasomal impairment, the build-up of damaged or misfolded proteins activates a cellular response leading to the recruitment of damaged proteins into perinuclear aggregates called aggresomes. Aggresome formation involves the retrograde transport of cargo proteins along the microtubule network and is dependent on the histone deacetylase HDAC6. Here we show that ionizing radiation (IR promotes Ran-Binding Protein M (RanBPM relocalization into discrete perinuclear foci where it co-localizes with aggresome components ubiquitin, dynein and HDAC6, suggesting that the RanBPM perinuclear clusters correspond to aggresomes. RanBPM was also recruited to aggresomes following treatment with the proteasome inhibitor MG132 and the DNA-damaging agent etoposide. Strikingly, aggresome formation by HDAC6 was markedly impaired in RanBPM shRNA cells, but was restored by re-expression of RanBPM. RanBPM was found to interact with HDAC6 and to inhibit its deacetylase activity. This interaction was abrogated by a RanBPM deletion of its LisH/CTLH domain, which also prevented aggresome formation, suggesting that RanBPM promotes aggresome formation through an association with HDAC6. Our results suggest that RanBPM regulates HDAC6 activity and is a central regulator of aggresome formation.

  4. Growth and characterization of acentric BaHf(BO{sub 3}){sub 2} and BaZr(BO{sub 3}){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Mączka, Mirosław, E-mail: m.maczka@int.pan.wroc.pl [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Szymborska-Małek, Katarzyna; Gągor, Anna [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Majchrowski, Andrzej [Institute of Applied Physics, Military University of Technology, 2 Kaliskiego Str., 00-908 Warszawa (Poland)

    2015-05-15

    Growth, single crystal X-ray diffraction, polarized Raman and infrared (IR) studies of BaHf(BO{sub 3}){sub 2} are presented. Raman and IR spectra of polycrystalline BaZr(BO{sub 3}){sub 2} are also reported to facilitate assignment of modes. BaHf(BO{sub 3}){sub 2} borate crystallizes in trigonal system, space group R3c, with lattice parameters: a=5.1540(4) Å, c=33.901(3) Å. It accommodates dolomite-like structure doubled in the c direction, which is built of alternating layers of HfO{sub 6} octahedra and BaO{sub 6} distorted trigonal prisms that are connected through borate groups. The obtained structural as well as spectroscopic data show that BaHf(BO{sub 3}){sub 2} is isostructural with BaZr(BO{sub 3}){sub 2} and the deviations from centrosymmetry is small. - Graphical abstract: Arrangement of BO{sub 3} groups in BaHf(BO{sub 3}){sub 2} along the c direction in one unit cell. Dark and light blue denote different borate groups. - Highlights: • BaHf(BO{sub 3}){sub 2} single crystals were grown. • X-ray diffraction showed that this borate crystallizes in the acentric R3c structure. • Raman and IR spectra were measured for BaHf(BO{sub 3}){sub 2} and BaZr(BO{sub 3}){sub 2}, respectively. • Assignment of modes is proposed.

  5. Role of bovine herpesvirus type 5 (BoHV-5) in diseases of cattle. Recent findings on BoHV-5 association with genital disease

    Science.gov (United States)

    Favier, P.A.; Marin, M.S.; Pérez, S.E.

    2012-01-01

    Bovine herpesvirus type 5 (BoHV-5) belongs to the family Herpesviridae, subfamily Alphaherpesvirinae, genus Varicellovirus. This virus is a major causative agent of non-suppurative meningoencephalitis in young cattle. It was first isolated in 1962 from a neurological disease outbreak in Australia. BoHV-5 is genetically and antigenically related to bovine herpesvirus type 1 (BoHV-1), a highly prevalent virus responsible for respiratory and genital disease in cattle. Initially, BoHV-5 was considered a subtype of BoHV-1 (BoHV-1.3). However, the exclusive presentation of outbreaks of neurological disease suggested that the virus was a new agent with characteristics of neuropathogenicity. Even though both are neurotropic viruses, only BoHV-5 is capable of replicating extensively in the central nervous system and inducing neurological disease. Occasionally, encephalitis caused by BoHV-1 has been reported. Like other alpha-herpesviruses, BoHV-5 can establish latency in nervous ganglia and, by stress factors or glucocorticoid treatment, latent virus can be reactivated. During episodes of reactivation, the virus is excreted in nasal, ocular and genital secretions and transmitted to other susceptible hosts. Recently, BoHV-5 has been associated with infection of the reproductive tract. The virus has been isolated and the presence of viral DNA has been demonstrated in semen samples from Brazil and Australia and natural transmission of the virus through contaminated semen has also been described. Embryos and oocytes are permissive for BoHV-5 infection and BoHV-5 DNA has been detected in the central nervous system of aborted fetuses. The objective of this review is to compile the limited information on the recent association between BoHV-5 and reproductive disorders in cattle. PMID:26623291

  6. Design of a detector to study associated charm production in the SHiP beam dump facility

    CERN Document Server

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  7. Maximum Throughput in a C-RAN Cluster with Limited Fronthaul Capacity

    OpenAIRE

    Duan , Jialong; Lagrange , Xavier; Guilloud , Frédéric

    2016-01-01

    International audience; Centralized/Cloud Radio Access Network (C-RAN) is a promising future mobile network architecture which can ease the cooperation between different cells to manage interference. However, the feasibility of C-RAN is limited by the large bit rate requirement in the fronthaul. This paper study the maximum throughput of different transmission strategies in a C-RAN cluster with transmission power constraints and fronthaul capacity constraints. Both transmission strategies wit...

  8. Power Optimization With BLER Constraint for Wireless Fronthauls in C-RAN

    OpenAIRE

    Vu, Thang Xuan; Nguyen, Thang Van; Quek, Tony Q.S.

    2016-01-01

    Cloud radio access network (C-RAN) is a novel architecture for future mobile networks to sustain the exponential traffic growth thanks to the exploitation of centralized processing. In C-RAN, one data processing center or baseband unit (BBU) communicates with users via distributed remote radio heads (RRHs), which are connected to the BBU via high capacity, low latency fronthaul links. In this letter, we study C-RAN with wireless fronthauls due to their flexibility in deployment and management...

  9. Knockdown of Ran GTPase expression inhibits the proliferation and migration of breast cancer cells.

    Science.gov (United States)

    Sheng, Chenyi; Qiu, Jian; Wang, Yingying; He, Zhixian; Wang, Hua; Wang, Qingqing; Huang, Yeqing; Zhu, Lianxin; Shi, Feng; Chen, Yingying; Xiong, Shiyao; Xu, Zhen; Ni, Qichao

    2018-05-03

    Breast cancer is the second leading cause of cancer‑associated mortality in women worldwide. Strong evidence has suggested that Ran, which is a small GTP binding protein involved in the transport of RNA and protein across the nucleus, may be a key cellular protein involved in the metastatic progression of cancer. The present study investigated Ran gene expression in breast cancer tissue samples obtained from 140 patients who had undergone surgical resection for breast cancer. Western blot analysis of Ran in breast cancer tissues and paired adjacent normal tissues showed that expression of Ran was significantly increased in breast cancer tissues. Immunohistochemistry analyses conducted on formalin‑fixed paraffin‑embedded breast cancer tissue sections revealed that Ran expression was associated with tumor histological grade, nerve invasion and metastasis, vascular metastasis and Ki‑67 expression (a marker of cell proliferation). Kaplan‑Meier survival analysis showed that increased Ran expression in patients with breast cancer was positively associated with a poor survival prognosis. Furthermore, in vitro experiments demonstrated that highly migratory MDA‑MB‑231 cancer cells treated with Ran‑si‑RNA (si‑Ran), which knocked down expression of Ran, exhibited decreased motility in trans‑well migration and wound healing assays. Cell cycle analysis of Ran knocked down MDA‑MB‑231 cells implicated Ran in cell cycle arrest and the inhibition of proliferation. Furthermore, a starvation and re‑feeding (CCK‑8) assay was performed, which indicated that Ran regulated breast cancer cell proliferation. Taken together, the results provide strong in vitro evidence of the involvement of Ran in the progression of breast cancer and suggest that it could have high potential as a therapeutic target and/or marker of disease.

  10. General and Specific Contributions of RAN to Reading and Arithmetic Fluency in First Graders: A Longitudinal Latent Variable Approach

    OpenAIRE

    Caroline Hornung; Romain Martin; Michel Fayol; Michel Fayol

    2017-01-01

    In the present study, we opted for a longitudinal design and examined rapid automatized naming (RAN) performance from two perspectives. In a first step, we examined the structure of RAN performance from a general cognitive perspective. We investigated whether rapid naming measures (e.g., digit RAN and color RAN) reflect a mainly domain-general factor or domain-specific factors. In a second step, we examined how the best fitting RAN model was related to reading and arithmetic outcomes, assesse...

  11. Encephalomyocarditis virus Leader protein hinge domain is responsible for interactions with Ran GTPase

    Energy Technology Data Exchange (ETDEWEB)

    Bacot-Davis, Valjean R., E-mail: bacotdavis@wisc.edu [Institute for Molecular Virology, University of Wisconsin-Madison, R.M. Bock Laboratories, 1525 Linden Dr. Madison, WI 53706 (United States); Palmenberg, Ann C., E-mail: acpalmen@wisc.edu [Institute for Molecular Virology, University of Wisconsin-Madison, R.M. Bock Laboratories, 1525 Linden Dr. Madison, WI 53706 (United States); Department of Biochemistry, University of Wisconsin-Madison, R.M. Bock Laboratories, 1525 Linden Dr. Madison, WI 53706 (United States)

    2013-08-15

    Encephalomyocarditis virus (EMCV), a Cardiovirus, initiates its polyprotein with a short 67 amino acid Leader (L) sequence. The protein acts as a unique pathogenicity factor, with anti-host activities which include the triggering of nuclear pore complex hyperphosphorylation and direct binding inhibition of the active cellular transport protein, Ran GTPase. Chemical modifications and protein mutagenesis now map the Ran binding domain to the L hinge-linker region, and in particular, to amino acids 35–40. Large deletions affecting this region were shown previously to diminish Ran binding. New point mutations, especially K35Q, D37A and W40A, preserve the intact L structure, abolish Ran binding and are deficient for nucleoporin (Nup) hyperphosphorylation. Ran itself morphs through multiple configurations, but reacts most effectively with L when in the GDP format, preferably with an empty nucleotide binding pocket. Therefore, L:Ran binding, mediated by the linker-hinge, is a required step in L-induced nuclear transport inhibition. - Highlights: • The hinge domain provides critical residues in Cardiovirus L:Ran complex formation. • Leader prefers to bind Ran in a nucleotide free, GDP-conformation. • L-induced Nup62 phosphorylation is reduced with Ran-deficient binding mutations.

  12. Essential role of the small GTPase Ran in postnatal pancreatic islet development.

    Directory of Open Access Journals (Sweden)

    Fang Xia

    Full Text Available The small GTPase Ran orchestrates pleiotropic cellular responses of nucleo-cytoplasmic shuttling, mitosis and subcellular trafficking, but whether deregulation of these pathways contributes to disease pathogenesis has remained elusive. Here, we generated transgenic mice expressing wild type (WT Ran, loss-of-function Ran T24N mutant or constitutively active Ran G19V mutant in pancreatic islet β cells under the control of the rat insulin promoter. Embryonic pancreas and islet development, including emergence of insulin(+ β cells, was indistinguishable in control or transgenic mice. However, by one month after birth, transgenic mice expressing any of the three Ran variants exhibited overt diabetes, with hyperglycemia, reduced insulin production, and nearly complete loss of islet number and islet mass, in vivo. Deregulated Ran signaling in transgenic mice, adenoviral over-expression of WT or mutant Ran in isolated islets, or short hairpin RNA (shRNA silencing of endogenous Ran in model insulinoma INS-1 cells, all resulted in decreased expression of the pancreatic and duodenal homeobox transcription factor, PDX-1, and reduced β cell proliferation, in vivo. These data demonstrate that a finely-tuned balance of Ran GTPase signaling is essential for postnatal pancreatic islet development and glucose homeostasis, in vivo.

  13. General and Specific Contributions of RAN to Reading and Arithmetic Fluency in First Graders: A Longitudinal Latent Variable Approach.

    Science.gov (United States)

    Hornung, Caroline; Martin, Romain; Fayol, Michel

    2017-01-01

    In the present study, we opted for a longitudinal design and examined rapid automatized naming (RAN) performance from two perspectives. In a first step, we examined the structure of RAN performance from a general cognitive perspective. We investigated whether rapid naming measures (e.g., digit RAN and color RAN) reflect a mainly domain-general factor or domain-specific factors. In a second step, we examined how the best fitting RAN model was related to reading and arithmetic outcomes, assessed several months later. Finally in a third step we took a clinical perspective and investigated specific contributions of RAN measures to reading and arithmetic outcomes. While RAN has emerged as a promising predictor of reading, the relationship between RAN and arithmetic has been less examined in the past. Hundred and twenty-two first graders completed seven RAN tasks, each comprising visually familiar stimuli such as digits, vowels, consonants, dice, finger-numeral configurations, objects, and colors. Four months later the same children completed a range of reading and arithmetic tasks. From a general descriptive perspective, structural equation modeling supports a one-dimensional RAN factor in 6- to -7-year-old children. However, from a clinical perspective, our findings emphasize the specific contributions of RANs. Interestingly, alphanumeric RANs (i.e., vowel RAN) were most promising when predicting reading skills and number-specific RANs (i.e., finger-numeral configuration RAN) were most promising when predicting arithmetic fluency. The implications for clinical and educational practices will be discussed.

  14. Francis-99 turbine numerical flow simulation of steady state operation using RANS and RANS/LES turbulence model

    Science.gov (United States)

    Minakov, A.; Platonov, D.; Sentyabov, A.; Gavrilov, A.

    2017-01-01

    We performed numerical simulation of flow in a laboratory model of a Francis hydroturbine at three regimes, using two eddy-viscosity- (EVM) and a Reynolds stress (RSM) RANS models (realizable k-ɛ, k-ω SST, LRR) and detached-eddy-simulations (DES), as well as large-eddy simulations (LES). Comparison of calculation results with the experimental data was carried out. Unlike the linear EVMs, the RSM, DES, and LES reproduced well the mean velocity components, and pressure pulsations in the diffusor draft tube. Despite relatively coarse meshes and insufficient resolution of the near-wall region, LES, DES also reproduced well the intrinsic flow unsteadiness and the dominant flow structures and the associated pressure pulsations in the draft tube.

  15. ν{sub τ}-physics with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  16. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    DEFF Research Database (Denmark)

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  17. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    CERN Document Server

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  18. Study of nu-tau properties with the SHiP experiment

    CERN Document Server

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  19. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Directory of Open Access Journals (Sweden)

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  20. Assessment of RANS CFD modelling for pressurised thermal shock analysis

    International Nuclear Information System (INIS)

    Sander M Willemsen; Ed MJ Komen; Sander Willemsen

    2005-01-01

    Full text of publication follows: The most severe Pressurised Thermal Shock (PTS) scenario is a cold water Emergency Core Coolant (ECC) injection into the cold leg during a LOCA. The injected ECC water mixes with the hot fluid present in the cold leg and flows towards the downcomer where further mixing takes place. When the cold mixture comes into contact with the Reactor Pressure Vessel (RPV) wall, it may lead to large temperature gradients and consequently to high stresses in the RPV wall. Knowledge of these thermal loads is important for RPV remnant life assessments. The existing thermal-hydraulic system codes currently applied for this purpose are based on one-dimensional approximations and can, therefore, not predict the complex three-dimensional flows occurring during ECC injection. Computational Fluid Dynamics (CFD) can be applied to predict these phenomena, with the ultimate benefit of improved remnant RPV life assessment. The present paper presents an assessment of various Reynolds Averaged Navier Stokes (RANS) CFD approaches for modeling the complex mixing phenomena occurring during ECC injection. This assessment has been performed by comparing the numerical results obtained using advanced turbulence models available in the CFX 5.6 CFD code in combination with a hybrid meshing strategy with experimental results of the Upper Plenum Test Facility (UPTF). The UPTF was a full-scale 'simulation' of the primary system of the four loop 1300 MWe Siemens/KWU Pressurised Water Reactor at Grafenrheinfeld. The test vessel upper plenum internals, downcomer and primary coolant piping were replicas of the reference plant, while other components, such as core, coolant pump and steam generators were replaced by simulators. From the extensive test programme, a single-phase fluid-fluid mixing experiment in the cold leg and downcomer was selected. Prediction of the mixing and stratification is assessed by comparison with the measured temperature profiles at several locations

  1. Ran GTPase promotes cancer progression via Met receptor-mediated downstream signaling

    Science.gov (United States)

    Yuen, Hiu-Fung; Chan, Ka-Kui; Platt-Higgins, Angela; Dakir, El-Habib; Matchett, Kyle B.; Haggag, Yusuf Ahmed; Jithesh, Puthen V.; Habib, Tanwir; Faheem, Ahmed; Dean, Fennell A.; Morgan, Richard; Rudland, Philip S.; El-Tanani, Mohamed

    2016-01-01

    It has been shown previously that cancer cells with an activated oncogenic pathway, including Met activation, require Ran for growth and survival. Here, we show that knockdown of Ran leads to a reduction of Met receptor expression in several breast and lung cancer cell lines. This, in turn suppressed HGF expression and the Met-mediated activation of the Akt pathway, as well as cell adhesion, migration, and invasion. In a cell line model where Met amplification has previously been shown to contribute to gefitinib resistance, Ran knockdown sensitized cells to gefitinib-mediated inhibition of Akt and ERK1/2 phosphorylation and consequently reduced cell proliferation. We further demonstrate that Met reduction-mediated by knockdown of Ran, occurs at the post-transcriptional level, probably via a matrix metalloproteinase. Moreover, the level of immunoreactive Ran and Met are positively associated in human breast cancer specimens, suggesting that a high level of Ran may be a pre-requisite for Met overexpression. Interestingly, a high level of immunoreactive Ran dictates the prognostic significance of Met, indicating that the co-overexpression of Met and Ran may be associated with cancer progression and could be used in combination as a prognostic indicator. PMID:27716616

  2. Juristocracy in Brazil Ran Hirschl's Perspective About Judicial Empowerment

    Directory of Open Access Journals (Sweden)

    Claudia Maria Barbosa

    2015-12-01

    Full Text Available Within the classical view of separation of powers, the judiciary originally occupied the weaker position. What is observed today, however, is a displacement of power from representative institutions to the judiciary, erecting a new kind of political regime that the Canadian political scientist Ran Hirschl called juristocracy. This paper intends to discuss this movement basing on the idea of hegemonic preservation, presented by Hirschl in his work Towards Juristocracy whose central hypothesis is that the political, economic and social elites voluntarily transfer power to the judiciary, when threatened of losing their hegemony in the political sphere. In Brazil, the 1988 Constitution turned the Supreme Court into one of the world's most powerful courts, which works at the same time as constitutional court, court of appeals and criminal court, responsible for deciding the most fundamental issues for brazilian society. We present at first, the examples used by Hirschl to illustrate his thesis about the judicial empowerment through constitutionalization, analyzing the political and economic changes in recent history of Israel, Canada, New Zealand and South Africa, followed by an analysis of the phenomenon in Brazil. We conclude that it is not possible to determine, in principle, the occurrence of hegemonic preservation in Brazil, but that Hirschl's analysis that offers an answer that challenges the traditional view on the judicialization of politics, contributes to the discussion and analysis of the phenomenon in Brazil.

  3. Temperature dependent luminescence Cr3+doped GdAl3(BO3)4 and YAl3(BO3)4

    NARCIS (Netherlands)

    Malysa, B.; Meijerink, A; Jüstel, Thomas

    Chromium activated YAl3(BO3)4 (YAB) and GdAl3(BO3)4 (GAB) were synthesized and show efficient broad band near infrared emission under excitation in the UV, blue and orange spectral regions. Temperature dependent luminescence measurements for GAB:1%Cr3+ and YAB:1%Cr3+ reveal high quenching

  4. Activation of Ran GTPase by a Legionella effector promotes microtubule polymerization, pathogen vacuole motility and infection.

    Directory of Open Access Journals (Sweden)

    Eva Rothmeier

    2013-09-01

    Full Text Available The causative agent of Legionnaires' disease, Legionella pneumophila, uses the Icm/Dot type IV secretion system (T4SS to form in phagocytes a distinct "Legionella-containing vacuole" (LCV, which intercepts endosomal and secretory vesicle trafficking. Proteomics revealed the presence of the small GTPase Ran and its effector RanBP1 on purified LCVs. Here we validate that Ran and RanBP1 localize to LCVs and promote intracellular growth of L. pneumophila. Moreover, the L. pneumophila protein LegG1, which contains putative RCC1 Ran guanine nucleotide exchange factor (GEF domains, accumulates on LCVs in an Icm/Dot-dependent manner. L. pneumophila wild-type bacteria, but not strains lacking LegG1 or a functional Icm/Dot T4SS, activate Ran on LCVs, while purified LegG1 produces active Ran(GTP in cell lysates. L. pneumophila lacking legG1 is compromised for intracellular growth in macrophages and amoebae, yet is as cytotoxic as the wild-type strain. A downstream effect of LegG1 is to stabilize microtubules, as revealed by conventional and stimulated emission depletion (STED fluorescence microscopy, subcellular fractionation and Western blot, or by microbial microinjection through the T3SS of a Yersinia strain lacking endogenous effectors. Real-time fluorescence imaging indicates that LCVs harboring wild-type L. pneumophila rapidly move along microtubules, while LCVs harboring ΔlegG1 mutant bacteria are stalled. Together, our results demonstrate that Ran activation and RanBP1 promote LCV formation, and the Icm/Dot substrate LegG1 functions as a bacterial Ran activator, which localizes to LCVs and promotes microtubule stabilization, LCV motility as well as intracellular replication of L. pneumophila.

  5. Activation of Ran GTPase by a Legionella Effector Promotes Microtubule Polymerization, Pathogen Vacuole Motility and Infection

    Science.gov (United States)

    Rothmeier, Eva; Pfaffinger, Gudrun; Hoffmann, Christine; Harrison, Christopher F.; Grabmayr, Heinrich; Repnik, Urska; Hannemann, Mandy; Wölke, Stefan; Bausch, Andreas; Griffiths, Gareth; Müller-Taubenberger, Annette; Itzen, Aymelt; Hilbi, Hubert

    2013-01-01

    The causative agent of Legionnaires' disease, Legionella pneumophila, uses the Icm/Dot type IV secretion system (T4SS) to form in phagocytes a distinct “Legionella-containing vacuole” (LCV), which intercepts endosomal and secretory vesicle trafficking. Proteomics revealed the presence of the small GTPase Ran and its effector RanBP1 on purified LCVs. Here we validate that Ran and RanBP1 localize to LCVs and promote intracellular growth of L. pneumophila. Moreover, the L. pneumophila protein LegG1, which contains putative RCC1 Ran guanine nucleotide exchange factor (GEF) domains, accumulates on LCVs in an Icm/Dot-dependent manner. L. pneumophila wild-type bacteria, but not strains lacking LegG1 or a functional Icm/Dot T4SS, activate Ran on LCVs, while purified LegG1 produces active Ran(GTP) in cell lysates. L. pneumophila lacking legG1 is compromised for intracellular growth in macrophages and amoebae, yet is as cytotoxic as the wild-type strain. A downstream effect of LegG1 is to stabilize microtubules, as revealed by conventional and stimulated emission depletion (STED) fluorescence microscopy, subcellular fractionation and Western blot, or by microbial microinjection through the T3SS of a Yersinia strain lacking endogenous effectors. Real-time fluorescence imaging indicates that LCVs harboring wild-type L. pneumophila rapidly move along microtubules, while LCVs harboring ΔlegG1 mutant bacteria are stalled. Together, our results demonstrate that Ran activation and RanBP1 promote LCV formation, and the Icm/Dot substrate LegG1 functions as a bacterial Ran activator, which localizes to LCVs and promotes microtubule stabilization, LCV motility as well as intracellular replication of L. pneumophila. PMID:24068924

  6. BoA 全盛时代

    Institute of Scientific and Technical Information of China (English)

    2015-01-01

    在准备这次专辑封面拍摄的期间,不仅你自己非常努力,你的工作团队部似乎非常团结呢!BoA:不是我刻意去创造这样的氛围(笑),不迟到,努力工作,一直一起协力到最后,工作人员失误也会减少,似乎能配合得很好。

  7. Boécio e o problema dos futuros contingentes

    Directory of Open Access Journals (Sweden)

    William de Siqueira Piauí

    2010-09-01

    Full Text Available Esse artigo representa nossa crença de que é possível introduzir o pensamento de Boécio a partir de um dos problemas mais recorrentes da filosofia, o problema dos futuros contingentes, explicitando, a partir daquela problemática é claro, quais as ligações mais fundamentais entre três de suas obras, seus dois comentários ao De Interpretatione de Aristóteles e sua Consolaçáo da Filosofia, e, de forma bastante resumida evidentemente, como o alcance do pensamento contido nessas obras chega até pelo menos a filosofia kantiana.

  8. The RanGTP pathway: from nucleo-cytoplasmic transport to spindle assembly and beyond

    Directory of Open Access Journals (Sweden)

    Tommaso eCavazza

    2016-01-01

    Full Text Available The small GTPase Ran regulates the interaction of transport receptors with a number of cellular cargo proteins. The high affinity binding of the GTP-bound form of Ran to import receptors promotes cargo release, whereas its binding to export receptors stabilizes their interaction with the cargo. This basic mechanism linked to the asymmetric distribution of the two nucleotide-bound forms of Ran between the nucleus and the cytoplasm generates a switch like mechanism controlling nucleo-cytoplasmic transport. Since 1999, we have known that after nuclear envelope breakdown (NEBD Ran and the above transport receptors also provide a local control over the activity of factors driving spindle assembly and regulating other aspects of cell division. The identification and functional characterization of RanGTP mitotic targets is providing novel insights into mechanisms essential for cell division. Here we review our current knowledge on the RanGTP system and its regulation and we focus on the recent advances made through the characterization of its mitotic targets. We then briefly review the novel functions of the pathway that were recently described. Altogether, the RanGTP system has moonlighting functions exerting a spatial control over protein interactions that drive specific functions depending on the cellular context.

  9. Boundary layers affected by different pressure gradients investigated computationally by a zonal RANS-LES method

    International Nuclear Information System (INIS)

    Roidl, B.; Meinke, M.; Schröder, W.

    2014-01-01

    Highlights: • Reformulated synthetic turbulence generation method (RSTGM) is applied. • Zonal RANS-LES method is applied to boundary layers at pressure gradients. • Good agreement with the pure LES and other reference data is obtained. • The RSTGM is applicable to pressure gradient flows without modification. • RANS-to-LES boundary should be located where -1·10 6 6 is satisfied. -- Abstract: The reformulated synthetic turbulence generation (RSTG) method is used to compute by a fully coupled zonal RANS-LES approach turbulent non-zero-pressure gradient boundary layers. The quality of the RSTG method, which is based on the same shape functions and length scale distributions as in zero-pressure gradient flow, is discussed by comparing the zonal RANS-LES findings with pure LES, pure RANS, direct numerical simulation (DNS), and experimental data. For the favorable pressure gradient (FPG) simulation the RANS-to-LES transition occurs in the accelerated flow region and for the adverse pressure gradient (APG) case it is located in the decelerated flow region. The results of the time and spanwise averaged skin-friction distributions, velocity profiles, and Reynolds stress distributions of the zonal RANS-LES simulation show a satisfactory to good agreement with the pure LES, reference DNS, and experimental data. The quality of the findings shows that the rigorous formulation of the synthetic turbulence generation makes the RSTG method applicable without a priori knowledge of the flow properties but those determined by the RANS solution and without using additional control planes to regulate the shear stress budget to a wide range of Reynolds numbers and pressure gradients. The method is a promising approach to formulate embedded RANS-to-LES boundaries in flow regions where the Pohlhausen or acceleration parameter satisfies -1·10 -6 ⩽K⩽2·10 -6

  10. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Science.gov (United States)

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  11. RANS Simulation of the Separated Flow over a Bump with Active Control

    Science.gov (United States)

    Iaccarino, Gianluca; Marongiu, Claudio; Catalano, Pietro; Amato, Marcello

    2003-01-01

    The objective of this paper is to investigate the accuracy of Reynolds-Averaged Navier- Stokes (RANS) techniques in predicting the effect of steady and unsteady flow control devices. This is part of a larger effort in applying numerical simulation tools to investigate of the performance of synthetic jets in high Reynolds number turbulent flows. RANS techniques have been successful in predicting isolated synthetic jets as reported by Kral et al. Nevertheless, due to the complex, and inherently unsteady nature of the interaction between the synthetic jet and the external boundary layer flow, it is not clear whether RANS models can represent the turbulence statistics correctly.

  12. Optimizing Cloud-RAN Deployments in Real-life Scenarios Using Microwave Radio

    DEFF Research Database (Denmark)

    Al-obaidi, Rami; Checko, Aleksandra; Holm, Henrik

    2015-01-01

    Cloud Radio Access Network (C-RAN) is a new architecture designed to be the candidate for enabling future mobile networks. However, it will be deployed only if it is economically viable. In this paper we investigate the technological options of C-RAN deployments. By using analytical methods we...... derive engineering guidelines for minimizing the CAPital EXpenditure (CAPEX) of C-RAN deployment. We show for which population density and span of BBU Pool coverage usage of Microwave Radio (MWR) links is viable. For larger scale deployment we recommend to divide the area into multiple BBU Pools....

  13. 40 CFR 721.3032 - Boric acid (H3BO2), zinc salt.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Boric acid (H3BO2), zinc salt. 721... Substances § 721.3032 Boric acid (H3BO2), zinc salt. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as boric acid (H3BO2), zinc salt (PMN P-97-553...

  14. SHiP: a new facility to search for heavy neutrinos and study $\

    CERN Document Server

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  15. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Science.gov (United States)

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  16. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    African Journals Online (AJOL)

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  17. Mixed alkali neodymium orthoborates: K_9Li_3Nd_3(BO_3)_7 and A_2LiNd(BO_3)_2 (A = Rb, Cs)

    International Nuclear Information System (INIS)

    Chen, Pengyun; Xia, Mingjun; Li, Rukang

    2016-01-01

    Crystals of mixed alkali neodymium orthoborates, K_9Li_3Nd_3(BO_3)_7 and A_2LiNd(BO_3)_2 (A = Rb, Cs) were obtained by spontaneous crystallization. K_9Li_3Nd_3(BO_3)_7 crystallizes in space group P2/c with cell parameters of a = 11.4524(7) Aa, b = 10.1266(6) Aa, c = 12.3116 (10) Aa, β = 122.0090(10) . In the structure, NdO_8 polyhedra share corners and connect with planer BO_3 groups to form infinite [Nd_3B_3O_2_1]_n chains. These chains are linked by additional BO_3 groups to produce a double layer of [Nd_6B_6O_3_8]_n blocks in the ac plane with K and Li ions filled into the cavities. A_2LiNd(BO_3)_2 (A = Rb, Cs) crystallizes in space group Pbcm, with cell parameters of a = 7.113(2) Aa, b = 9.691(3) Aa and c = 10.135(3) Aa for Rb_2LiNd(BO_3)_2, and a = 7.2113(3) Aa, b = 9.9621(4) Aa, and c = 10.3347(4) Aa for Cs_2LiNd(BO_3)_2. In the structure, NdO_8 polyhedra are corner-sharing with each other and further interlinked by BO_3 groups to comprise the infinite [Nd_4B_4O_2_4] sheets in the bc plane, with Rb/Cs and Li ions occupying the interlayered space. The compounds show effective near-IR emission and their associated lifetimes are obtained by fluorescence spectra. (Copyright copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. Crystal structure and magnetic properties of Mn substituted ludwigite Co 3O 2BO 3

    Science.gov (United States)

    Knyazev, Yu. V.; Ivanova, N. B.; Kazak, N. V.; Platunov, M. S.; Bezmaternykh, L. N.; Velikanov, D. А.; Vasiliev, А. D.; Ovchinnikov, S. G.; Yurkin, G. Yu.

    2012-03-01

    The needle shape single crystals Co3-x MnxO2BO3 with ludwigite structure have been prepared. According to the X-ray diffraction data the preferable character of distinct crystallographic positions occupation by Mn ions is established. Magnetization field and temperature dependencies are measured. Paramagnetic Curie temperature value Θ=-100 K points out the predominance of antiferromagnetic interactions. Spin-glass magnetic ordering takes the onset at TN=41 K. The crystallographic and magnetic properties of Co3O2BO3:Mn are compared with the same for the isostructural analogs Co3O2BO3 and CoO2BO3:Fe.

  19. The light subunit of system bo,+ is fully functional in the absence of the heavy subunit

    OpenAIRE

    Reig, Núria; Chillarón, Josep; Bartoccioni, Paola; Fernández, Esperanza; Bendahan, Annie; Zorzano, Antonio; Kanner, Baruch; Palacín, Manuel; Bertran, Joan

    2002-01-01

    The heteromeric amino acid transporters are composed of a type II glycoprotein and a non-glycosylated polytopic membrane protein. System bo,+ exchanges dibasic for neutral amino acids. It is composed of rBAT and bo,+AT, the latter being the polytopic membrane subunit. Mutations in either of them cause malfunction of the system, leading to cystinuria. bo,+AT-reconstituted systems from HeLa or MDCK cells catalysed transport of arginine that was totally dependent on the presence of one of the bo...

  20. Charge ordering and multiferroicity in Fe{sub 3}BO{sub 5} and Fe{sub 2}MnBO{sub 5} oxyborates

    Energy Technology Data Exchange (ETDEWEB)

    Maignan, A., E-mail: antoine.maignan@ensicaen.fr [Laboratoire CRISMAT, UMR 6508 CNRS/ENSICAEN/UNICAEN, 6 bd du Maréchal Juin, 14050 CAEN Cedex 4 (France); Lainé, F.; Guesdon, A.; Malo, S. [Laboratoire CRISMAT, UMR 6508 CNRS/ENSICAEN/UNICAEN, 6 bd du Maréchal Juin, 14050 CAEN Cedex 4 (France); Damay, F. [Laboratoire Léon Brillouin, UMR 12, LLB-Saclay, 91191 GIF-SUR-YVETTE Cedex (France); Martin, C. [Laboratoire CRISMAT, UMR 6508 CNRS/ENSICAEN/UNICAEN, 6 bd du Maréchal Juin, 14050 CAEN Cedex 4 (France)

    2017-02-15

    The comparison of Fe{sub 3}BO{sub 5} and Fe{sub 2}MnBO{sub 5} reveals that the 2Fe{sup 2+}: Fe{sup 3+} charge ordering of the former is suppressed in the latter. Spin dynamics probed by ac susceptibility are strongly affected by the substitution, inducing superparamagnetism at low temperature in Fe{sub 2}MnBO{sub 5}. Interestingly, for both oxyborates, glassiness is observed in the dielectric properties at low temperature, but only Fe{sub 3}BO{sub 5} shows a magnetodielectric effect close to its lower magnetic transition. A change in the electrical polarization, measured by pyroelectric current integration, is observed in Fe{sub 3}BO{sub 5} and is even more pronounced in Fe{sub 2}MnBO{sub 5}. Such results suggest that these oxyborates behave like antiferromagnetic relaxor ferroelectrics. These features are proposed to be related to the distribution of the species (Fe{sup 3+}, Fe{sup 2+} and Mn{sup 2+}) over the four transition metal sites forming the ludwigite structure. - Graphical abstract: 90 K [010] electron diffraction patterns of Fe{sub 3}BO{sub 5}. The yellow arrows in the pattern indicate the extra-spots corresponding to the superstructure induced by the charge ordering. - Highlights: • The TEM (ED) study of the Fe{sub 3}BO{sub 5} oxyborate at 90 K reveals a superstructure related to a Fe{sup 2+}/Fe{sup 3+} ordering. • The Fe{sub 2}MnBO{sub 5}, Mn-substituted counterpart, does not show such ordering. • Our magnetic and electric measurements demonstrate that these magnetic ferrites exhibit glassiness in their charges (relaxor-type) with additional superparamagnetism at low T for Fe{sub 2}MnBO{sub 5} and magnetodielectric coupling near T{sub N2}=72 K in Fe{sub 3}BO{sub 5}. • The pyroelectric measurements confirm the existence of a ferroelectric behavior in these antiferromagnets. Accordingly, our results open the route to the study of other large class of the M{sub 2}{sup 2+}M’{sup 3+}BO{sub 5} ludwigites and to their complex magnetism and its

  1. Synthesis, structure and magnetic properties of Fe-Gd nanocapsules coated with B2O3/H3BO3 and Fe3BO5+GdBO3

    International Nuclear Information System (INIS)

    Si, P.Z.; Brueck, E.; Zhang, Z.D.; Tegus, O.; Buschow, K.H.J.; Zhang, W.S.; Klaasse, J.C.P.; Boer, F.R. de

    2004-01-01

    Nanocapsules consisting of B 2 O 3 /H 3 BO 3 encapsulating Fe-Gd cores have been synthesized by an arc-discharge process using metal-boron alloys as cathode. Most of the nanocapsules have a well-constructed shell/core structure with a uniform B 2 O 3 /H 3 BO 3 shell. Heat-treatment induces reactions between the shell and the core, resulting in the formation of a Fe 3 BO 5 +GdBO 3 matrix embedded with Fe nanoparticles, reduction of the metallic-core size and decrease of the blocking temperature T B . Above T B , the magnetization curves plotted vs. H/T overlap and show zero coercivity. Below T B , the coercivity shows a linear dependence when plotted vs. T 1/2 . However, the coercivity-T 1/2 curve below 60 K has a different slope from that above 60 K, indicating the existence of two different magnetic phases in the nanocapsules. Different from bulk Fe 3 BO 5 , nanoscale Fe 3 BO 5 particles have a lower transition temperature to the weak-ferromagnetic state, and magnetic hysteresis is absent due to size effects

  2. General and Specific Contributions of RAN to Reading and Arithmetic Fluency in First Graders: A Longitudinal Latent Variable Approach

    Directory of Open Access Journals (Sweden)

    Caroline Hornung

    2017-10-01

    Full Text Available In the present study, we opted for a longitudinal design and examined rapid automatized naming (RAN performance from two perspectives. In a first step, we examined the structure of RAN performance from a general cognitive perspective. We investigated whether rapid naming measures (e.g., digit RAN and color RAN reflect a mainly domain-general factor or domain-specific factors. In a second step, we examined how the best fitting RAN model was related to reading and arithmetic outcomes, assessed several months later. Finally in a third step we took a clinical perspective and investigated specific contributions of RAN measures to reading and arithmetic outcomes. While RAN has emerged as a promising predictor of reading, the relationship between RAN and arithmetic has been less examined in the past. Hundred and twenty-two first graders completed seven RAN tasks, each comprising visually familiar stimuli such as digits, vowels, consonants, dice, finger-numeral configurations, objects, and colors. Four months later the same children completed a range of reading and arithmetic tasks. From a general descriptive perspective, structural equation modeling supports a one-dimensional RAN factor in 6- to -7-year-old children. However, from a clinical perspective, our findings emphasize the specific contributions of RANs. Interestingly, alphanumeric RANs (i.e., vowel RAN were most promising when predicting reading skills and number-specific RANs (i.e., finger-numeral configuration RAN were most promising when predicting arithmetic fluency. The implications for clinical and educational practices will be discussed.

  3. Mesh Generation and Adaption for High Reynolds Number RANS Computations, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposal offers to provide NASA with an automatic mesh generator for the simulation of aerodynamic flows using Reynolds-Averages Navier-Stokes (RANS) models....

  4. Mesh Generation and Adaption for High Reynolds Number RANS Computations, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposal offers to provide NASA with an automatic mesh generator for the simulation of aerodynamic flows using Reynolds-Averages Navier-Stokes (RANS) models....

  5. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Science.gov (United States)

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  6. Energy Efficient Precoding C-RAN Downlink with Compression at Fronthaul

    OpenAIRE

    Nguyen, Kien-Giang; Vu, Quang-Doanh; Juntti, Markku; Tran, Le-Nam

    2017-01-01

    This paper considers a downlink transmission of cloud radio access network (C-RAN) in which precoded baseband signals at a common baseband unit are compressed before being forwarded to radio units (RUs) through limited fronthaul capacity links. We investigate the joint design of precoding, multivariate compression and RU-user selection which maximizes the energy efficiency of downlink C-RAN networks. The considered problem is inherently a rank-constrained mixed Boolean nonconvex program for w...

  7. Tuning a RANS k-e model for jet-in-crossflow simulations.

    Energy Technology Data Exchange (ETDEWEB)

    Lefantzi, Sophia; Ray, Jaideep; Arunajatesan, Srinivasan; DeChant, Lawrence Justin

    2013-09-01

    We develop a novel calibration approach to address the problem of predictive ke RANS simulations of jet-incrossflow. Our approach is based on the hypothesis that predictive ke parameters can be obtained by estimating them from a strongly vortical flow, specifically, flow over a square cylinder. In this study, we estimate three ke parameters, C%CE%BC, Ce2 and Ce1 by fitting 2D RANS simulations to experimental data. We use polynomial surrogates of 2D RANS for this purpose. We conduct an ensemble of 2D RANS runs using samples of (C%CE%BC;Ce2;Ce1) and regress Reynolds stresses to the samples using a simple polynomial. We then use this surrogate of the 2D RANS model to infer a joint distribution for the ke parameters by solving a Bayesian inverse problem, conditioned on the experimental data. The calibrated (C%CE%BC;Ce2;Ce1) distribution is used to seed an ensemble of 3D jet-in-crossflow simulations. We compare the ensemble's predictions of the flowfield, at two planes, to PIV measurements and estimate the predictive skill of the calibrated 3D RANS model. We also compare it against 3D RANS predictions using the nominal (uncalibrated) values of (C%CE%BC;Ce2;Ce1), and find that calibration delivers a significant improvement to the predictive skill of the 3D RANS model. We repeat the calibration using surrogate models based on kriging and find that the calibration, based on these more accurate models, is not much better that those obtained with simple polynomial surrogates. We discuss the reasons for this rather surprising outcome.

  8. SHiP: a new multipurpose beam-dump experiment at the SPS.

    CERN Document Server

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  9. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Science.gov (United States)

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  10. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Science.gov (United States)

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  11. An Enhanced OFDM Resource Allocation Algorithm in C-RAN Based 5G Public Safety Network

    Directory of Open Access Journals (Sweden)

    Lei Feng

    2016-01-01

    Full Text Available Public Safety Network (PSN is the network for critical communication when disaster occurs. As a key technology in 5G, Cloud-Radio Access Network (C-RAN can play an important role in PSN instead of LTE-based RAN. This paper firstly introduces C-RAN based PSN architecture and models the OFDM resource allocation problem in C-RAN based PSN as an integer quadratic programming, which allows the trade-off between expected bitrates and allocating fairness of PSN Service User (PSU. However, C-RAN based PSN needs to improve the efficiency of allocating algorithm because of a mass of PSU-RRH associations when disaster occurs. To deal with it, the resources allocating problem with integer variables is relaxed into one with continuous variables in the first step and an algorithm based on Generalized Bender’s Decomposition (GBD is proposed to solve it. Then we use Feasible Pump (FP method to get a feasible integer solution on the original OFDM resources allocation problem. The final experiments show the total throughput achieved by C-RAN based PSN is at most higher by 19.17% than the LTE-based one. And the average computational time of the proposed GBD and FP algorithm is at most lower than Barrier by 51.5% and GBD with no relaxation by 30.1%, respectively.

  12. Association between Genes BoLA-DRB3.2*8 and BoLA-DRB3.2*12 with Resistance and BoLA-DRB3.2*16 with Susceptibility to Infection by Bovine Leukemia Virus

    Directory of Open Access Journals (Sweden)

    C Úsuga-Monroy*, JJ Echeverri Zuluaga and A López-Herrera

    2016-11-01

    Full Text Available The Bovine Leukemia Virus (BLV is a retrovirus that affects the immune system of cattle as their target cells are B lymphocytes. Some polymorphisms at the BoLA-DRB 3.2 gene have been associated with resistance/susceptibility to diseases. The objective of this research was to determine the polymorphisms at the BoLA-DRB 3.2 gene and associate them with resistance (R, neutrality (N or susceptibility (S to BLV in a Holstein cow population.500 blood samples were taken. Nested PCR was performed for detecting BLV virus and PCR-RFLP was performed to identify alleles of gene BoLA-DRB 3.2. Susceptibility was determined using odds ratio (OR and P value. According to their genotype, cows were classified in homozygous (R/R, N/N, or S/S and heterozygous (R/N, R/S, N/S. BLV molecular prevalence was 44%. The most frequent allele was BoLA-DRB3.2*22 (16.8%, alleles associated with resistance to BLV were BoLA-DRB3.2*8 (OR=1.489; P<0.10 and BoLA-DRB3.2*12 (OR=3.897; P<0.10 and allele BoLA-DRB3.2*16 (OR=0.710; P<0.10 was associated with susceptibility. Allele BoLA-DRB3.2*8 had the highest allelic frequency for negative cows (0.19. 63.7% of cows with genotype RN and 70% of cows with genotype RR were resistant to infection by BLV. Alleles R and S have a dominant effect on allele N (P<0.05. The use of reliable diagnostic techniques in conjunction with identification of resistant or susceptible animals can monitor the progress of the disease in dairy herds. Alleles BoLA-DRB3.2*8 and *12 were positively related to the disease and therefore cows have low risk of infection, unlike allele BoLA-DRB3.2*16 which was negatively related and animals have high risk for the disease.

  13. Vortical structures and pressure pulsations in draft tube of a Francis-99 turbine at part load: RANS and hybrid RANS/LES analysis

    International Nuclear Information System (INIS)

    Gavrilov, A.A.; Sentyabov, A.V.; Dekterev, A.A.; Hanjalić, K.

    2017-01-01

    Highlights: • Simulations showed the formation of spiralling coherent vortices in the draft tube. • Both hybrid RANS-LES and Re-stress models reproduced well the measured fluctuations. • Re-stress model resolved the precessing vortex core and coherent spiralling vortices. - Abstract: Recognizing the limitations of the conventional linear-eddy-viscosity (LEVM) Reynolds-averaged Navier–Stokes (RANS) models to reproduce complex three-dimensional unsteady flows in hydraulic machinery, we performed a comparative assessment of a second-moment (Re-stress model, RSM) RANS closure and a hybrid RANS/LES method in capturing the flow and vortical structures in the draft tube of a Francis hydroturbine at off-design conditions. Considered is a case of part load (PL) at a flow rate of only 35% of the best efficiency point (BEP) characterised by multiple unsteady vortex systems. Despite some remaining uncertainties in generating the inflow conditions, both approaches reproduced reasonably well the measured mean velocity and the rms of its fluctuations, as well as the pressure spectrum with peaks detecting the precessing vortex core. In contrast to the common LEVMs, the Re-stress closure showed sufficient receptivity to intrinsic unsteadiness and reproduced well the overall flow and vortical patterns as well as the associated pressure pulsations in accord with the experiments. The hybrid RANS/LES method gave similar predictions as the RSM, but resolving a wider range of scales, which however, showed no significant effect on the dynamics of the dominant processing vortex core and the pressure pulsations.

  14. The Cellular Distribution of RanGAP1 Is Regulated by CRM1-Mediated Nuclear Export in Mammalian Cells.

    Directory of Open Access Journals (Sweden)

    Keith Cha

    Full Text Available The Ran GTPase activating protein RanGAP1 plays an essential role in nuclear transport by stimulating RanGTP hydrolysis in the cytoplasmic compartment. In mammalian cells, unmodified RanGAP1 is predominantly cytoplasmic, whereas modification by small ubiquitin-related modifier protein (SUMO targets RanGAP1 to the cytoplasmic filaments of nuclear pore complex (NPC. Although RanGAP1 contains nine putative nuclear export signals and a nuclear localization signal, little is known if RanGAP1 shuttles between the nuclear and cytoplasmic compartments and how its primary localization in the cytoplasm and at the NPC is regulated. Here we show that inhibition of CRM1-mediated nuclear export using RNAi-knockdown of CRM1 and inactivation of CRM1 by leptomycin B (LMB results in nuclear accumulation of RanGAP1. LMB treatment induced a more robust redistribution of RanGAP1 from the cytoplasm to the nucleoplasm compared to CRM1 RNAi and also uniquely triggered a decrease or loss of RanGAP1 localization at the NPC, suggesting that LMB treatment is more effective in inhibiting CRM1-mediated nuclear export of RanGAP1. Our time-course analysis of LMB treatment reveals that the NPC-associated RanGAP1 is much more slowly redistributed to the nucleoplasm than the cytoplasmic RanGAP1. Furthermore, LMB-induced nuclear accumulation of RanGAP1 is positively correlated with an increase in levels of SUMO-modified RanGAP1, suggesting that SUMOylation of RanGAP1 may mainly take place in the nucleoplasm. Lastly, we demonstrate that the nuclear localization signal at the C-terminus of RanGAP1 is required for its nuclear accumulation in cells treated with LMB. Taken together, our results elucidate that RanGAP1 is actively transported between the nuclear and cytoplasmic compartments, and that the cytoplasmic and NPC localization of RanGAP1 is dependent on CRM1-mediated nuclear export.

  15. A novel UV-emitting phosphor: LiSr4(BO3)3: Pb2+

    International Nuclear Information System (INIS)

    Pekgözlü, İlhan

    2013-01-01

    Pure and Pb 2+ doped LiSr 4 (BO 3 ) 3 materials were prepared by a solution combustion synthesis method. The phase analysis of all synthesized materials were determined using the powder XRD. The synthesized materials were investigated using spectrofluorometer at room temperature. The excitation and emission bands of LiSr 4 (BO 3 ) 3 : Pb 2+ were observed at 284 and 328 nm, respectively. The dependence of the emission intensity on the Pb 2+ concentration for the LiSr 4 (BO 3 ) 3 were studied in detail. It was observed that the concentration quenching of Pb 2+ in LiSr 4 (BO 3 ) 3 is 0.005 mol. The Stokes shifts of LiSr 4 (BO 3 ) 3 : Pb 2+ phosphor was calculated to be 4723 cm –1 . -- Highlights: • A novel UV-emitting phosphor: LiSr 4 (BO 3 ) 3 : Pb 2+ ” synthesized for the first time. • The emission band of LiSr 4 (BO 3 ) 3 : Pb 2+ was observed at 328 nm upon excitation with 284 nm. • LiSr 4 (BO 3 ) 3 : Pb 2+ is a good phosphor for broadband UV application

  16. Anomalous property of Ag(BO2)2 hyperhalogen: does spin-orbit coupling matter?

    Science.gov (United States)

    Chen, Hui; Kong, Xiang-Yu; Zheng, Weijun; Yao, Jiannian; Kandalam, Anil K; Jena, Puru

    2013-10-07

    Hyperhalogens were recently identified as a new class of highly electronagative species which are composed of metals and superhalogens. In this work, high-level theoretical calculations and photoelectron spectroscopy experiments are systematically conducted to investigate a series of coinage-metal-containing hyperhalogen anions, Cu(BO(2))(2)(-), Ag(BO(2))(2)(-), and Au(BO(2))(2)(-). The vertical electron detachment energy (VDE) of Ag(BO(2))(2)(-) is anomalously higher than those of Au(BO(2))(2)(-) and Cu(BO(2))(2)(-). In quantitative agreement with the experiment, high-level ab initio calculations reveal that spin-orbit coupling (SOC) lowers the VDE of Au(BO(2))(2)(-) significantly. The sizable magnitude of about 0.5 eV of SOC effect on the VDE of Au(BO(2))(2)(-) demonstrates that SOC plays an important role in the electronic structure of gold hyperhalogens. This study represents a new paradigm for relativistic electronic structure calculations for the one-electron-removal process of ionic Au(I)L(2) complexes, which is characterized by a substantial SOC effect. Copyright © 2013 WILEY‐VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Science.gov (United States)

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  18. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Science.gov (United States)

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  19. First reliability test of a surface micromachined microengine using SHiMMeR

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  20. Determination of Scaled Wind Turbine Rotor Characteristics from Three Dimensional RANS Calculations

    International Nuclear Information System (INIS)

    Burmester, S; Gueydon, S; Make, M

    2016-01-01

    Previous studies have shown the importance of 3D effects when calculating the performance characteristics of a scaled down turbine rotor [1-4]. In this paper the results of 3D RANS (Reynolds-Averaged Navier-Stokes) computations by Make and Vaz [1] are taken to calculate 2D lift and drag coefficients. These coefficients are assigned to FAST (Blade Element Momentum Theory (BEMT) tool from NREL) as input parameters. Then, the rotor characteristics (power and thrust coefficients) are calculated using BEMT. This coupling of RANS and BEMT was previously applied by other parties and is termed here the RANS-BEMT coupled approach. Here the approach is compared to measurements carried out in a wave basin at MARIN applying Froude scaled wind, and the direct 3D RANS computation. The data of both a model and full scale wind turbine are used for the validation and verification. The flow around a turbine blade at full scale has a more 2D character than the flow properties around a turbine blade at model scale (Make and Vaz [1]). Since BEMT assumes 2D flow behaviour, the results of the RANS-BEMT coupled approach agree better with the results of the CFD (Computational Fluid Dynamics) simulation at full- than at model-scale. (paper)

  1. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Science.gov (United States)

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  2. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Directory of Open Access Journals (Sweden)

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  3. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    International Nuclear Information System (INIS)

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  4. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  5. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  6. Ran GTPase protein promotes human pancreatic cancer proliferation by deregulating the expression of Survivin and cell cycle proteins

    International Nuclear Information System (INIS)

    Deng, Lin; Lu, Yuanyuan; Zhao, Xiaodi; Sun, Yi; Shi, Yongquan; Fan, Hongwei; Liu, Changhao; Zhou, Jinfeng; Nie, Yongzhan; Wu, Kaichun; Fan, Daiming; Guo, Xuegang

    2013-01-01

    Highlights: •Overexpression of Ran in pancreatic cancer was correlated with histological grade. •Downregulation of Ran could induce cell apoptosis and inhibit cell proliferation. •The effects were mediated by cell cycle proteins, Survivin and cleaved Caspase-3. -- Abstract: Ran, a member of the Ras GTPase family, has important roles in nucleocytoplasmic transport. Herein, we detected Ran expression in pancreatic cancer and explored its potential role on tumour progression. Overexpressed Ran in pancreatic cancer tissues was found highly correlated with the histological grade. Downregulation of Ran led to significant suppression of cell proliferation, cell cycle arrest at the G1/S phase and induction of apoptosis. In vivo studies also validated that result. Further studies revealed that those effects were at least partly mediated by the downregulation of Cyclin A, Cyclin D1, Cyclin E, CDK2, CDK4, phospho-Rb and Survivin proteins and up regulation of cleaved Caspase-3

  7. Does ability to establish sound-symbol pairings mediate the RAN reading relationship?

    DEFF Research Database (Denmark)

    Poulsen, Mads; Juul, Holger; Elbro, Carsten

    for animals in a paired associate learning task. These animals were then used in a rapid naming task. Results Preliminary results show that reading correlated with the amount of training required for learning the animal names (r=-.19, p=.06). RAN speed with the same animals did not correlate with reading......Performance on tests to rapidly name letters and digits has been shown to correlate with reading. One possible reason is that these tests probe the ability to learn and automatise symbol-sound associations. However, most studies have not controlled for the amount of experience with the RAN......-items, so it is unclear whether it is the experience or the ability to take advantage of the experience that is responsible for the correlation between RAN and reading. Paired associate learning tasks have been shown to differentiate dyslexics from controls, and to correlate with reading in unselected...

  8. RCC1 regulates inner centromeric composition in a Ran-independent fashion.

    Science.gov (United States)

    Zhang, Michael Shaofei; Furuta, Maiko; Arnaoutov, Alexei; Dasso, Mary

    2018-01-01

    RCC1 associates to chromatin dynamically within mitosis and catalyzes Ran-GTP production. Exogenous RCC1 disrupts kinetochore structure in Xenopus egg extracts (XEEs), but the molecular basis of this disruption remains unknown. We have investigated this question, utilizing replicated chromosomes that possess paired sister kinetochores. We find that exogenous RCC1 evicts a specific subset of inner KT proteins including Shugoshin-1 (Sgo1) and the chromosome passenger complex (CPC). We generated RCC1 mutants that separate its enzymatic activity and chromatin binding. Strikingly, Sgo1 and CPC eviction depended only on RCC1's chromatin affinity but not its capacity to produce Ran-GTP. RCC1 similarly released Sgo1 and CPC from synthetic kinetochores assembled on CENP-A nucleosome arrays. Together, our findings indicate RCC1 regulates kinetochores at the metaphase-anaphase transition through Ran-GTP-independent displacement of Sgo1 and CPC.

  9. Hybrid RANS/LES method for wind flow over complex terrain

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Sørensen, Niels N.

    2010-01-01

    for flows at high Reynolds numbers. To reduce the computational cost of traditional LES, a hybrid method is proposed in which the near-wall eddies are modelled in a Reynolds-averaged sense. Close to walls, the flow is treated with the Reynolds-averaged Navier-Stokes (RANS) equations (unsteady RANS...... rough walls. Previous attempts of combining RANS and LES has resulted in unphysical transition regions between the two layers, but the present work improves this region by using a stochastic backscatter model. To demonstrate the ability of the proposed hybrid method, simulations are presented for wind...... the turbulent kinetic energy, whereas the new method captures the high turbulence levels well but underestimates the mean velocity. The presented results are for a relative mild configuration of complex terrain, but the proposed method can also be used for highly complex terrain where the benefits of the new...

  10. Performance assessment of the RANS turbulence models in nuclear fuel rod bundles

    International Nuclear Information System (INIS)

    In, Wang Kee; Chun, Tae Hyun; Oh, Dong Seok; Shin, Chang Hwan

    2005-02-01

    The three experiments for turbulent flow in a rod bundle geometry were simulated in this CFD analysis using various RANS models. The CFD predictions were compared with the experimental and DNS results. The RANS models used here are the nonlinear quadratic/cubic κ-ε models and the second-order closure models (SSG, LRR, RSM-ω). The anisotropic models predicted the secondary flow and showed a significantly improved agreement with the measurements from the standard κ-ε model. In particular, the SSG model resulted in the best performance showing the closest agreement with the experimental results. However, the RANS models could not predict the very high anisotropy observed in a rod bundle with a small pitch-to-diameter ratio

  11. Assessment of unsteady-RANS approach against steady-RANS approach for predicting twin impinging jets in a cross-flow

    Directory of Open Access Journals (Sweden)

    Zhiyin Yang

    2014-12-01

    Full Text Available A complex flow field is created when a vertical/short take-off and landing aircraft is operating near ground. One major concern for this kind of aircraft in ground effect is the possibility of ingestion of hot gases from the jet engine exhausts back into the engine, known as hot gas ingestion, which can increase the intake air temperature and also reduce the oxygen content in the intake air, potentially leading to compressor stall, low combustion efficiency and causing a dramatic loss of lift. This flow field can be represented by the configuration of twin impinging jets in a cross-flow. Accurate prediction of this complicated flow field under the Reynolds averaged Navier–Stokes (RANS approach (current practise in industry is a great challenge as previous studies suggest that some important flow features cannot be captured by the Steady-RANS (SRANS approach even with a second-order Reynolds stress model (RSM. This paper presents a numerical study of this flow using the Unsteady-RANS (URANS approach with a RSM and the results clearly indicate that the URANS approach is superior than the SRANS approach but still the predictions of Reynolds stress are not accurate enough.

  12. Home birth and hospital birth trends in Bo, Sierra Leone.

    Science.gov (United States)

    Jacobsen, Kathryn H; Abdirahman, Hafsa A; Ansumana, Rashid; Bockarie, Alfred S; Bangura, Umaru; Jimmy, David Henry; Malanoski, Anthony P; Sundufu, Abu James; Stenger, David A

    2012-06-01

    As of April 2010, all maternity care at government healthcare facilities in Sierra Leone is provided at no cost to patients. In late 2010, we conducted a community health census of 18 sections of the city of Bo (selected via randomized cluster sampling from 68 total sections). Among the 3421 women with a history of pregnancy who participated in the study, older women most often reported having a history of both home and hospital deliveries, while younger women showed a preference for hospital births. The proportion of lastborn children delivered at a healthcare facility increased from 71.8% of offspring 10-14 years old to 81.1% of those one to nine years old and 87.3% of infants born after April 2010. These findings suggest that the new maternal healthcare initiative has accelerated an existing trend toward a preference for healthcare facility births, at least in some urban parts of Sierra Leone. © 2012 The Authors Acta Obstetricia et Gynecologica Scandinavica© 2012 Nordic Federation of Societies of Obstetrics and Gynecology.

  13. Optimal Assignment of Cells in C-RAN Deployments with Multiple BBU Pools

    DEFF Research Database (Denmark)

    Holm, Henrik; Checko, Aleksandra; Al-obaidi, Rami

    2015-01-01

    Cloud Radio Access Network (C-RAN) is receiving increasing attention not only within the research community but also from operators and standardization bodies. However, even a good technology will be deployed only if it is economically viable. In our previous work, for larger scale deployment we...... recommend to divide the area into multiple BBU Pools. In this paper we show how to optimally assign cells to different BBU Pools in such a scenario. By using Integer Linear Programming (ILP) method we derive engineering guidelines for minimizing the CAPital EXpenditure (CAPEX) of C-RAN deployment....

  14. RANS-based simulation of turbulent wave boundary layer and sheet-flow sediment transport processes

    DEFF Research Database (Denmark)

    Fuhrman, David R.; Schløer, Signe; Sterner, Johanna

    2013-01-01

    A numerical model coupling the horizontal component of the incompressible Reynolds-averaged Navier–Stokes (RANS) equationswith two-equation k−ω turbulence closure is presented and used to simulate a variety of turbulent wave boundary layer processes. The hydrodynamic model is additionally coupled...... with bed and suspended load descriptions, the latter based on an unsteady turbulent-diffusion equation, for simulation of sheet-flow sediment transport processes. In addition to standard features common within such RANS-based approaches, the present model includes: (1) hindered settling velocities at high...

  15. Combustion synthesis of red emitting borate host PDP phosphor YCaBO4: Eu3+

    International Nuclear Information System (INIS)

    Ingle, J.T.; Hargunani, S.P.; Sonekar, R.P.; Nagpure, P.A.; Omanwar, S.K.; Moharil, S.V.

    2012-01-01

    The red emitting borate host phosphor YCaBO 4 : Eu 3+ has been prepared by a novel solution combustion technique. The synthesis is based on the exothermic reaction between the fuel (Urea) and Oxidizer (Ammonium nitrate). The photoluminescence properties of the powder samples of YCaBO 4 : Eu 3+ has been investigated under UV and VUV excitation. The phosphor shows strong absorption in UV and VUV region and exhibits intense red emission upon excited by 254 nm UV and 173 nm VUV radiation. Under UV 254 nm excitation, YCaBO 4 : Eu 3+ exhibits intense red emission around 610 nm. Under VUV excitation of 173 nm, the phosphor emits intense red emission around 610 nm and few weak emissions. These weak emissions could be suppressed by annealing the sample repeatedly at proper temperature and the borate phosphor YCaBO 4 : Eu 3+ could be a good red emitting phosphor for PDP display and mercury free lamps. (author)

  16. Evidence that Na+-pumping occurs through the D-channel in Vitreoscilla cytochrome bo

    International Nuclear Information System (INIS)

    Kim, Seong K.; Stark, Benjamin C.; Webster, Dale A.

    2005-01-01

    The operon (cyo) encoding the Na + -pumping respiratory terminal oxidase (cytochrome bo) of the bacterium Vitreoscilla was transformed into Escherichia coli GV100, a deletion mutant of cytochrome bo. This was done for the wild type operon and five mutants in three conserved Cyo subunit I amino acids known to be crucial for H + transport in the E. coli enzyme, one near the nuclear center, one in the K-channel, and one in the D-channel. CO-binding, NADH and ubiquinol oxidase, and Na + -pumping activities were all substantially inhibited by each mutation. The wild type Vitreoscilla cytochrome bo can pump Na + against a concentration gradient, resulting in a transmembrane concentration differential of 2-3 orders of magnitude. It is proposed that Vitreoscilla cytochrome bo pumps four Na + through the D-channel to the exterior and transports four H + through the K-channel for the reduction of each O 2

  17. Yoga in cyberspace? The web pages of yoga studios in Turku/Åbo

    Directory of Open Access Journals (Sweden)

    Måns Broo

    2012-12-01

    Full Text Available In this article, I will offer some comments on the websites of the nine yoga schools which are active in the city of Turku/Åbo at the present moment (see sources for the links. This work is part of a larger, ongoing research project on yoga in this city within the PCCR or Post Secular Society and a Changing Religious Landscape Centre of Excellence research project at the Department of Comparative Religion, Åbo Akademi University.

  18. 40 CFR 721.3031 - Boric acid (H3BO3), zinc salt (2=3).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Boric acid (H3BO3), zinc salt (2=3). 721.3031 Section 721.3031 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT SIGNIFICANT NEW USES OF CHEMICAL SUBSTANCES Significant New Uses for Specific Chemical Substances § 721.3031 Boric acid (H3BO...

  19. Assessment of RANS and LES Turbulence Modeling for Buoyancy-Aided/Opposed Forced and Mixed Convection

    Science.gov (United States)

    Clifford, Corey; Kimber, Mark

    2017-11-01

    Over the last 30 years, an industry-wide shift within the nuclear community has led to increased utilization of computational fluid dynamics (CFD) to supplement nuclear reactor safety analyses. One such area that is of particular interest to the nuclear community, specifically to those performing loss-of-flow accident (LOFA) analyses for next-generation very-high temperature reactors (VHTR), is the capacity of current computational models to predict heat transfer across a wide range of buoyancy conditions. In the present investigation, a critical evaluation of Reynolds-averaged Navier-Stokes (RANS) and large-eddy simulation (LES) turbulence modeling techniques is conducted based on CFD validation data collected from the Rotatable Buoyancy Tunnel (RoBuT) at Utah State University. Four different experimental flow conditions are investigated: (1) buoyancy-aided forced convection; (2) buoyancy-opposed forced convection; (3) buoyancy-aided mixed convection; (4) buoyancy-opposed mixed convection. Overall, good agreement is found for both forced convection-dominated scenarios, but an overly-diffusive prediction of the normal Reynolds stress is observed for the RANS-based turbulence models. Low-Reynolds number RANS models perform adequately for mixed convection, while higher-order RANS approaches underestimate the influence of buoyancy on the production of turbulence.

  20. Eulerian–Lagrangian RANS Model Simulations of the NIST Turbulent Methanol Spray Flame

    NARCIS (Netherlands)

    Zhu, Shanglong; Roekaerts, Dirk; Pozarlik, Artur Krzysztof; van der Meer, Theodorus H.

    2015-01-01

    A methanol spray flame in a combustion chamber of the NIST was simulated using an Eulerian–Lagrangian RANS model. Experimental data and previous numerical investigations by other researchers on this flame were analyzed to develop methods for more comprehensive model validation. The inlet boundary

  1. Numerical prediction of a bulb turbine performance hill chart through RANS simulations

    International Nuclear Information System (INIS)

    Guénette, V; Houde, S; Ciocan, G D; Deschênes, C; Dumas, G; Huang, J

    2012-01-01

    Within the framework of an international research consortium on low-head hydraulic turbine flow dynamics, the predictive behavior of Reynolds Averaged Navier-Stokes (RANS) simulations of the efficiency (η) hill chart of a bulb turbine is investigated. The paper presents the impacts of the blade tip gap and the hub gaps on performance predictions.

  2. Mel-18 interacts with RanGAP1 and inhibits its sumoylation.

    Science.gov (United States)

    Zhang, Jie; Sarge, Kevin D

    2008-10-17

    Our previous results showed that the polycomb protein mel-18 binds to a protein called HSF2 and inhibits HSF2 sumoylation, thereby functioning as an anti-SUMO E3 factor. This study also suggested that mel-18 regulates the sumoylation of other cellular proteins, but the identities of these other proteins were unknown. Here we show that mel-18 interacts with the RanGAP1 protein and inhibits its sumoylation, and that these activities do not require the RING domain of mel-18. The results also show that RanGAP1 sumoylation is decreased during mitosis, and that this is associated with increased interaction between RanGAP1 and mel-18 during this stage of the cell cycle. Intriguingly, this regulatory relationship is the opposite of that found for mel-18 and HSF2, in which the interaction between these two proteins decreases during mitosis, resulting in elevated HSF2 sumoylation. The results of this study strengthen the conclusion that mel-18 functions as an anti-SUMO E3 factor, and extend its targets to include regulation of the sumoylation of the important cellular protein RanGAP1.

  3. Inadequacy representation of flamelet-based RANS model for turbulent non-premixed flame

    Science.gov (United States)

    Lee, Myoungkyu; Oliver, Todd; Moser, Robert

    2017-11-01

    Stochastic representations for model inadequacy in RANS-based models of non-premixed jet flames are developed and explored. Flamelet-based RANS models are attractive for engineering applications relative to higher-fidelity methods because of their low computational costs. However, the various assumptions inherent in such models introduce errors that can significantly affect the accuracy of computed quantities of interest. In this work, we develop an approach to represent the model inadequacy of the flamelet-based RANS model. In particular, we pose a physics-based, stochastic PDE for the triple correlation of the mixture fraction. This additional uncertain state variable is then used to construct perturbations of the PDF for the instantaneous mixture fraction, which is used to obtain an uncertain perturbation of the flame temperature. A hydrogen-air non-premixed jet flame is used to demonstrate the representation of the inadequacy of the flamelet-based RANS model. This work was supported by DARPA-EQUiPS(Enabling Quantification of Uncertainty in Physical Systems) program.

  4. OTN Transport of Baseband Radio Serial Protocols in C-RAN Architecture for Mobile Network Applications

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Kardaras, Georgios; Lanzani, Christian Fabio Alessandro

    This white paper presents a proof of concept implementation of digital baseband radio data transport over Optical Transport Network (OTN) compliant to 3GPP Long Term Evolution – Advanced (LTE-A) standard enabling Cloud Radio Access Network (C-RAN) architecture. The transport between the baseband ...

  5. Computing the flow past Vortex Generators : Comparison between RANS Simulations and Experiments

    NARCIS (Netherlands)

    Manolesos, M.; Sorensen, NN; Troldborg, N.; Florentie, L.; Papadakis, G; Voutsinas, S.

    2016-01-01

    The flow around a wind turbine airfoil equipped with Vortex Generators (VGs) is examined. Predictions from three different Reynolds Averaged Navier Stokes (RANS) solvers with two different turbulence models and two different VG modelling approaches are compared between them and with experimental

  6. Low Temperature Solid-State Synthesis and Characterization of LaBO3

    Directory of Open Access Journals (Sweden)

    Azmi Seyhun KIPÇAK

    2016-11-01

    Full Text Available Rare earth (lanthanide series borates, possess high vacuum ultraviolet (VUV transparency, large electronic band gaps, chemical and environmental stability and exceptionally large optical damage thresholds and used in the development of plasma display panels (PDPs. In this study the synthesis of lanthanum borates via solid-state method is studied. For this purpose, lanthanum oxide (La2O3 and boric acid (H3BO3 are used for as lanthanum and boron sources, respectively. Different elemental molar ratios of La to B (between 3:1 to 1:6 as La2O3:H3BO3 were reacted by solid-state method at the reaction temperatures between 500°C - 700°C with the constant reaction time of 4 h. Following the synthesis, characterizations of the synthesized products are conducted by X-ray diffraction (XRD, Fourier transform infrared spectroscopy (FT-IR, Raman spectroscopy and scanning electron microscope (SEM. From the results of the experiments, three types of lanthanum borates of; La3BO6, LaBO3 and La(BO23 were observed at different reaction parameters. Among these three types of lanthanum borates LaBO3 phase were obtained as a major phase.

  7. BoS: a large and diverse family of short interspersed elements (SINEs) in Brassica oleracea.

    Science.gov (United States)

    Zhang, Xiaoyu; Wessler, Susan R

    2005-05-01

    Short interspersed elements (SINEs) are nonautonomous non-LTR retrotransposons that populate eukaryotic genomes. Numerous SINE families have been identified in animals, whereas only a few have been described in plants. Here we describe a new family of SINEs, named BoS, that is widespread in Brassicaceae and present at approximately 2000 copies in Brassica oleracea. In addition to sharing a modular structure and target site preference with previously described SINEs, BoS elements have several unusual features. First, the head regions of BoS RNAs can adopt a distinct hairpin-like secondary structure. Second, with 15 distinct subfamilies, BoS represents one of the most diverse SINE families described to date. Third, several of the subfamilies have a mosaic structure that has arisen through the exchange of sequences between existing subfamilies, possibly during retrotransposition. Analysis of BoS subfamilies indicate that they were active during various time periods through the evolution of Brassicaceae and that active elements may still reside in some Brassica species. As such, BoS elements may be a valuable tool as phylogenetic makers for resolving outstanding issues in the evolution of species in the Brassicaceae family.

  8. BoHV-4-based vector delivering Ebola virus surface glycoprotein

    Directory of Open Access Journals (Sweden)

    Alfonso Rosamilia

    2016-11-01

    Full Text Available Abstract Background Ebola virus (EBOV is a Category A pathogen that is a member of Filoviridae family that causes hemorrhagic fever in humans and non-human primates. Unpredictable and devastating outbreaks of disease have recently occurred in Africa and current immunoprophylaxis and therapies are limited. The main limitation of working with pathogens like EBOV is the need for costly containment. To potentiate further and wider opportunity for EBOV prophylactics and therapies development, innovative approaches are necessary. Methods In the present study, an antigen delivery platform based on a recombinant bovine herpesvirus 4 (BoHV-4, delivering a synthetic EBOV glycoprotein (GP gene sequence, BoHV-4-syEBOVgD106ΔTK, was generated. Results EBOV GP was abundantly expressed by BoHV-4-syEBOVgD106ΔTK transduced cells without decreasing viral replication. BoHV-4-syEBOVgD106ΔTK immunized goats produced high titers of anti-EBOV GP antibodies and conferred a long lasting (up to 6 months, detectable antibody response. Furthermore, no evidence of BoHV-4-syEBOVgD106ΔTK viremia and secondary localization was detected in any of the immunized animals. Conclusions The BoHV-4-based vector approach described here, represents: an alternative antigen delivery system for vaccination and a proof of principle study for anti-EBOV antibodies generation in goats for potential immunotherapy applications.

  9. Spin-glass behavior of warwickite MgFeBO{sub 4} and CoFeBO{sub 4} crystals observed by Mössbauer spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lyubutin, I.S.; Korotkov, N. Yu.; Frolov, K.V. [Shubnikov Institute of Crystallography, RAS, 119333 Moscow (Russian Federation); Kazak, N.V.; Platunov, M.S. [Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Knyazev, Yu. V. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Bezmaternykh, L.N. [Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Ovchinnikov, S.G. [Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Siberian State Aerospace University, 660014 Krasnoyarsk (Russian Federation); Arauzo, A. [Servicio de Medidas Físicas, Universidad de Zaragoza, Pedro Cerbuna 12, 50009 Zaragoza (Spain); Bartolomé, J. [Instituto de Ciencia de Materiales de Aragón, CSIC-Universidad de Zaragoza and Departamento de Física de la Materia Condensada, 50009 Zaragoza (Spain)

    2015-09-05

    Highlights: • Spin-glass behavior of MgFeBO{sub 4} and CoFeBO{sub 4} observed by Mössbauer spectroscopy. • Transition temperature T{sub SG} increases strongly with Co substitution. • Dynamical scaling theory near T{sub SG} is fulfilled. • Spin-glass behavior is explained as due to short range correlations. • Inclusion of Co increases exchange interaction and magnetocrystalline anisotropy. - Abstract: Single crystals of MgFeBO{sub 4} and CoFeBO{sub 4} warwickites were obtained. The effects of charge ordering and magnetic properties were investigated by Mössbauer spectroscopy. Cation distribution over M1 and M2 nonequivalent sites and the average charge at the metal positions were established. Low temperature Mössbauer spectra reveal spin-glass behavior, with spin-freezing temperatures T{sub SG} of 15.2 and 33.2 K for Mg- and Co-warwickites, respectively, higher than that observed from the d.c. and a.c. magnetic susceptibility measurements. The difference is explained in terms of dynamical scaling theory. The specific shape of the Mössbauer spectra in the vicinity of the magnetic transition at T{sub SG} shows the difference between spin-glass and superparamagnetic behavior and demonstrates an overwhelming role of the exchange anisotropy in the properties of Mg-warwickite. In Co-warwickite the increase of magnetocrystalline anisotropy provokes an increase in magnetic viscosity.

  10. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    CERN Document Server

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  11. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  12. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  13. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  14. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Directory of Open Access Journals (Sweden)

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  15. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Directory of Open Access Journals (Sweden)

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  16. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Science.gov (United States)

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  17. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    International Nuclear Information System (INIS)

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  18. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    Science.gov (United States)

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  19. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Science.gov (United States)

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  20. arXiv Search for new physics with the SHiP experiment at CERN

    CERN Document Server

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  1. Zonal PANS: evaluation of different treatments of the RANS-LES interface

    Science.gov (United States)

    Davidson, L.

    2016-03-01

    The partially Reynolds-averaged Navier-Stokes (PANS) model can be used to simulate turbulent flows either as RANS, large eddy simulation (LES) or DNS. Its main parameter is fk whose physical meaning is the ratio of the modelled to the total turbulent kinetic energy. In RANS fk = 1, in DNS fk = 0 and in LES fk takes values between 0 and 1. Three different ways of prescribing fk are evaluated for decaying grid turbulence and fully developed channel flow: fk = 0.4, fk = k3/2tot/ɛ and, from its definition, fk = k/ktot where ktot is the sum of the modelled, k, and resolved, kres, turbulent kinetic energy. It is found that the fk = 0.4 gives the best results. In Girimaji and Wallin, a method was proposed to include the effect of the gradient of fk. This approach is used at RANS- LES interface in the present study. Four different interface models are evaluated in fully developed channel flow and embedded LES of channel flow: in both cases, PANS is used as a zonal model with fk = 1 in the unsteady RANS (URANS) region and fk = 0.4 in the LES region. In fully developed channel flow, the RANS- LES interface is parallel to the wall (horizontal) and in embedded LES, it is parallel to the inlet (vertical). The importance of the location of the horizontal interface in fully developed channel flow is also investigated. It is found that the location - and the choice of the treatment at the interface - may be critical at low Reynolds number or if the interface is placed too close to the wall. The reason is that the modelled turbulent shear stress at the interface is large and hence the relative strength of the resolved turbulence is small. In RANS, the turbulent viscosity - and consequently also the modelled Reynolds shear stress - is only weakly dependent on Reynolds number. It is found in the present work that it also applies in the URANS region.

  2. NH4 Be2 BO3 F2 and γ-Be2 BO3 F: Overcoming the Layering Habit in KBe2 BO3 F2 for the Next-Generation Deep-Ultraviolet Nonlinear Optical Materials.

    Science.gov (United States)

    Peng, Guang; Ye, Ning; Lin, Zheshuai; Kang, Lei; Pan, Shilie; Zhang, Min; Lin, Chensheng; Long, Xifa; Luo, Min; Chen, Yu; Tang, Yu-Huan; Xu, Feng; Yan, Tao

    2018-05-12

    KBe 2 BO 3 F 2 (KBBF) is still the only practically usable crystal that can generate deep-ultraviolet (DUV) coherent light by direct second harmonic generation (SHG). However, applications are hindered by layering, leading to difficulty in the growth of thick crystals and compromised mechanical integrity. Despite efforts, it is still a great challenge to discover new nonlinear optical (NLO) materials that overcome the layering while keeping the DUV SHG available. Now, two new DUV NLO beryllium borates have been successfully designed and synthesized, NH 4 Be 2 BO 3 F 2 (ABBF) and γ-Be 2 BO 3 F (γ-BBF), which not only overcome the layering but also can be used as next-generation DUV NLO materials with the shortest type I phase-matching second-harmonic wavelength down to 173.9 nm and 146 nm, respectively. Significantly, γ-BBF is superior to KBBF in all metrics and would be the most outstanding DUV NLO crystal. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. A new method for simultaneous detection and discrimination of Bovine herpesvirus types 1 (BoHV-1) and 5 (BoHV-5) using real time PCR with high resolution melting (HRM) analysis.

    Science.gov (United States)

    Marin, M S; Quintana, S; Leunda, M R; Recavarren, M; Pagnuco, I; Späth, E; Pérez, S; Odeón, A

    2016-01-01

    Bovine herpesvirus types 1 (BoHV-1) and 5 (BoHV-5) are antigenically and genetically similar. The aim of this study was to develop a simple and reliable one-step real time PCR assay with high resolution melting (HRM) analysis for the simultaneous detection and differentiation of BoHV-1 and BoHV-5. Optimization of assay conditions was performed with DNA from reference strains. Then, DNA from field isolates, clinical samples and tissue samples of experimentally infected animals were studied by real time PCR-HRM. An efficient amplification of real time PCR products was obtained, and a clear melting curve and appropriate melting peaks for both viruses were achieved in the HRM curve analysis for BoHV type identification. BoHV was identified in all of the isolates and clinical samples, and BoHV types were properly differentiated. Furthermore, viral DNA was detected in 12/18 and 7/18 samples from BoHV-1- and BoHV-5-infected calves, respectively. Real time PCR-HRM achieved a higher sensitivity compared with virus isolation or conventional PCR. In this study, HRM was used as a novel procedure. This method provides rapid, sensitive, specific and simultaneous detection of bovine alpha-herpesviruses DNA. Thus, this technique is an excellent tool for diagnosis, research and epidemiological studies of these viruses in cattle. Copyright © 2015 Elsevier B.V. All rights reserved.

  4. Evaluating C-RAN Fronthaul Functional Splits in Terms of Network Level Energy and Cost Savings

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Popovska Avramova, Andrijana; Berger, Michael Stübert

    2016-01-01

    The placement of the complete baseband processing in a centralized pool results in high data rate requirement and inflexibility of the fronthaul network, which challenges the energy and cost effectiveness of the cloud radio access network (C-RAN). Recently, redesign of the C-RAN through functional...... split in the baseband processing chain has been proposed to overcome these challenges. This paper evaluates, by mathematical and simulation methods, different splits with respect to network level energy and cost efficiency having in the mind the expected quality of service.The proposed mathematical...... model quantifies the multiplexing gains and the trade-offs between centralization and decentralization concerning the cost of the pool, fronthaul network capacity and resource utilization. The event-based simulation captures the influence of the traffic load dynamics and traffic type variation...

  5. Hybrid RANS/LES method for high Reynolds numbers, applied to atmospheric flow over complex terrain

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Sørensen, Niels N.; Johansen, Jeppe

    2007-01-01

      The use of Large-Eddy Simulation (LES) to predict wall-bounded flows has presently been limited to low Reynolds number flows. Since the number of computational grid points required to resolve the near-wall turbulent structures increase rapidly with Reynolds number, LES has been unattainable...... for flows at high Reynolds numbers. To reduce the computational cost of traditional LES a hybrid method is proposed in which the near-wall eddies are modelled in a Reynolds-averaged sense. Close to walls the flow is treated with the RANS-equations and this layer act as wall model for the outer flow handled...... by LES. The wellknown high Reynolds number two-equation k - ǫ turbulence model is used in the RANS layer and the model automatically switches to a two-equation k - ǫ subgrid-scale stress model in the LES region. The approach can be used for flow over rough walls. To demonstrate the ability...

  6. Simulation of wing-body junction flows with hybrid RANS/LES methods

    International Nuclear Information System (INIS)

    Fu Song; Xiao Zhixiang; Chen Haixin; Zhang Yufei; Huang Jingbo

    2007-01-01

    In this paper, flows past two wing-body junctions, the Rood at zero angle of attack and NASA TN D-712 at 12.5 o angle of attack, are investigated with two Reynolds-Averaged Navier-Stokes (RANS) and large eddy simulation (LES) hybrid methods. One is detached eddy simulation (DES) and the other is delayed-DES, both are based on a weakly nonlinear two-equation k-ω model. While the RANS method can predict the mean flow behaviours reasonably accurately, its performance for the turbulent kinetic energy and shear stress, as compared with available experimental data, is not satisfactory. DES, through introducing a length scale in the dissipation terms of the turbulent kinetic energy equation, delivers flow separation, a vortex or the onset of vortex breakdown too early. DDES, with its delayed effect, shows a great improvement in flow structures and turbulence characteristics, and agrees well with measurements

  7. Hybrid RANS/LES of flow and heat transfer in round impinging jets

    International Nuclear Information System (INIS)

    Kubacki, Slawomir; Dick, Erik

    2011-01-01

    Fluid flow and convective heat transfer predictions are presented of round impinging jets for several combinations of nozzle-plate distances H/D = 2, 6 and 13.5 (where D is the nozzle diameter) and Reynolds numbers Re = 5000, 23,000 and 70,000 with the newest version of the k-ω model of and three hybrid RANS/LES models. In the RANS mode of the hybrid RANS/LES models, the k-ω model is recovered. Three formulations are considered to activate the LES mode. The first model is similar to the hybrid models of and . The turbulent length scale is replaced by the grid size in the destruction term of the k-equation and in the definition of the RANS eddy viscosity. As grid size, a maximum measure of the hexahedral grid cell is used. The second model has the same k-equation, but the eddy viscosity is the minimum of the k-ω eddy viscosity and the Smagorinsky eddy viscosity, following a proposal by . The Smagorinsky eddy viscosity is formed with the cube root of the cell volume. The third model has, again, the same k-equation, but has an eddy viscosity which is an intermediate between the eddy viscosities of the first and second models. This is reached by using the cube root of the cell volume in the eddy viscosity formula of the first model. The simulation results are compared with experimental data for the high Reynolds number cases Re = 23,000 and Re = 70,000 and LES data for the low-Reynolds number case Re = 5000. The Reynolds numbers are defined with the nozzle diameter and the bulk velocity at nozzle outlet. At low nozzle-plate distance (the impingement plate is in the core of the jet), turbulent kinetic energy is overpredicted by RANS in the stagnation flow region. This leads to overprediction of the heat transfer rate along the impingement plate in the impact zone. At high nozzle-plate distance (the impingement plate is in the mixed-out region of the jet), the turbulence mixing is underpredicted by RANS in the shear layer of the jet which gives a too high length of

  8. A comparative study of manhole hydraulics using stereoscopic PIV and different RANS models.

    Science.gov (United States)

    Beg, Md Nazmul Azim; Carvalho, Rita F; Tait, Simon; Brevis, Wernher; Rubinato, Matteo; Schellart, Alma; Leandro, Jorge

    2017-04-01

    Flows in manholes are complex and may include swirling and recirculation flow with significant turbulence and vorticity. However, how these complex 3D flow patterns could generate different energy losses and so affect flow quantity in the wider sewer network is unknown. In this work, 2D3C stereo Particle Image Velocimetry measurements are made in a surcharged scaled circular manhole. A computational fluid dynamics (CFD) model in OpenFOAM ® with four different Reynolds Averaged Navier Stokes (RANS) turbulence model is constructed using a volume of fluid model, to represent flows in this manhole. Velocity profiles and pressure distributions from the models are compared with the experimental data in view of finding the best modelling approach. It was found among four different RANS models that the re-normalization group (RNG) k-ɛ and k-ω shear stress transport (SST) gave a better approximation for velocity and pressure.

  9. MiToBo - A Toolbox for Image Processing and Analysis

    Directory of Open Access Journals (Sweden)

    Birgit Möller

    2016-04-01

    Full Text Available MiToBo is a toolbox and Java library for solving basic as well as advanced image processing and analysis tasks. It features a rich collection of fundamental, intermediate and high-level image processing operators and algorithms as well as a couple of sophisticated tools for specific biological and biomedical applications. These tools include operators for elucidating cellular morphology and locomotion as well as operators for the characterization of certain intracellular particles and structures. MiToBo builds upon and integrates into the widely-used image analysis software packages ImageJ and Fiji [11, 10], and all of its operators can easily be run in ImageJ and Fiji via a generic operator runner plugin. Alternatively MiToBo operators can directly be run from command line, and using its functionality as a library for developing own applications is also supported. Thanks to the Alida library [8] forming the base of MiToBo all operators share unified APIs fostering reusability, and graphical as well as command line user interfaces for operators are automatically generated. MiToBo is available from its website http://www.informatik.uni-halle.de/mitobo, on Github, via an Apache Archiva Maven repository server, and it can easily be activated in Fiji via its own update site.

  10. ARA24/Ran enhances the androgen-dependent NH2- and COOH-terminal interaction of the androgen receptor

    International Nuclear Information System (INIS)

    Harada, Naoki; Ohmori, Yuji; Yamaji, Ryoichi; Higashimura, Yasuki; Okamoto, Kazuki; Isohashi, Fumihide; Nakano, Yoshihisa; Inui, Hiroshi

    2008-01-01

    The androgen receptor (AR) acts as an androgen-dependent transcription factor controlling the development of prostate tissue. Upon binding to androgen, AR undergoes a dynamic structural change leading to interaction between the NH 2 - and COOH-terminal regions of AR (N-C interaction). ARA24/Ran, which is a small GTPase, functions as an AR coactivator. Here, we report that ARA24/Ran enhances the N-C interaction of AR. The constitutively GTP- or GDP-bound form of ARA24/Ran repressed the AR N-C interaction. ARA24/Ran did not enhance the transcriptional activities of AR mutants that disrupt the N-C interaction. ARA24/Ran formed an endogenous protein complex with nuclear AR, but not cytoplasmic AR. Unlike SRC-1 with the positive activity for AR N-C interaction, ARA24/Ran did not enhance the transcriptional activity of the COOH-terminal domain-deleted AR mutant that is constitutively localized in the nucleus. These data demonstrate that ARA24/Ran increases AR transactivation by enhancing the AR N-C interaction in the nucleus

  11. On the use of (U)RANS and LES approaches for turbulent incompressible single phase flows in nuclear engineering applications

    Energy Technology Data Exchange (ETDEWEB)

    Benhamadouche, Sofiane, E-mail: sofiane.benhamadouche@edf.fr

    2017-02-15

    Highlights: • The paper deals with the use of (U)RANS and LES in nuclear engineering applications. • It gives some ideas and guidelines to run high quality computations. • Some perspectives are drawn concerning the development of (U)RANS and LES approaches in the future. - Abstract: The present paper gives some ideas and guidelines in order to run high quality (U)RANS or LES computations. The paper starts with (U)RANS approaches, advocating the use of Reynolds Stress Models for complex flows and recommending further work on modeling of turbulent heat fluxes, which remains today too basic in industry. The superiority of wall-resolved models vs. wall-modeled in RANS is recalled and the use of adaptive wall treatment is suggested. The concept of Unsteady RANS is finally questioned. Then, important issues around LES are raised. The mesh refinement criteria are recalled for wall-resolved LES and the use of wall models addressed. The production of DNS and wall-resolved LES calculations for flow understanding and RANS validation is encouraged.

  12. OTN Transport of Baseband Radio Serial Protocols in C-RAN Architecture for Mobile Network Applications

    OpenAIRE

    Checko, Aleksandra; Kardaras, Georgios; Lanzani, Christian Fabio Alessandro; Temple, Dan; Mathiasen, Carsten; Pedersen, Lars A.; Klaps, Bert

    2014-01-01

    This white paper presents a proof of concept implementation of digital baseband radio data transport over Optical Transport Network (OTN) compliant to 3GPP Long Term Evolution – Advanced (LTE-A) standard enabling Cloud Radio Access Network (C-RAN) architecture. The transport between the baseband module and a remote radio module is compliant to Common Public Radio Interface (CPRI) and to the OBSAI reference point 3 - 01 (RP3-01) interface protocols, respectively. The purpose is to demonstrate ...

  13. Statistical Multiplexing of Computations in C-RAN with Tradeoffs in Latency and Energy

    OpenAIRE

    Kalør, Anders E.; Agurto, Mauricio I.; Pratas, Nuno K.; Nielsen, Jimmy J.; Popovski, Petar

    2017-01-01

    In the Cloud Radio Access Network (C-RAN) architecture, the baseband signals from multiple remote radio heads are processed in a centralized baseband unit (BBU) pool. This architecture allows network operators to adapt the BBU’scomputational resources to the aggregate access load experienced at the BBU, which can change in every air-interface access frame. The degree of savings that can be achieved by adapting the resources is a tradeoff between savings, adaptation frequency, and increased qu...

  14. Computing the flow past Vortex Generators: Comparison between RANS Simulations and Experiments

    DEFF Research Database (Denmark)

    Manolesos, M.; Sørensen, Niels N.; Troldborg, Niels

    2016-01-01

    The flow around a wind turbine airfoil equipped with Vortex Generators (VGs) is examined. Predictions from three different Reynolds Averaged Navier Stokes (RANS) solvers with two different turbulence models and two different VG modelling approaches are compared between them and with experimental ...... data. The best results are obtained with the more expensive fully resolved VG approach. The cost efficient BAY model can also provide acceptable results, if grid related numerical diffusion is minimized and only force coefficient polars are considered....

  15. Benchmarking LES with wall-functions and RANS for fatigue problems in thermal–hydraulics systems

    Energy Technology Data Exchange (ETDEWEB)

    Tunstall, R., E-mail: ryan.tunstall@manchester.ac.uk [School of MACE, The University of Manchester, Manchester M13 9PL (United Kingdom); Laurence, D.; Prosser, R. [School of MACE, The University of Manchester, Manchester M13 9PL (United Kingdom); Skillen, A. [Scientific Computing Department, STFC Daresbury Laboratory, Warrington WA4 4AD (United Kingdom)

    2016-11-15

    Highlights: • We benchmark LES with blended wall-functions and low-Re RANS for a pipe bend and T-Junction. • Blended wall-laws allow the first cell from the wall to be placed anywhere in the boundary layer. • In both cases LES predictions improve as the first cell wall spacing is reduced. • Near-wall temperature fluctuations in the T-Junction are overpredicted by wall-modelled LES. • The EBRSM outperforms other RANS models for the pipe bend. - Abstract: In assessing whether nuclear plant components such as T-Junctions are likely to suffer thermal fatigue problems in service, CFD techniques need to provide accurate predictions for wall temperature fluctuations. Though it has been established that this is within the capabilities of wall-resolved LES, its high computational cost has prevented widespread usage in industry. In the present paper the suitability of LES with blended wall-functions, that allow the first cell to be placed in any part of the boundary layer, is assessed. Numerical results for the flows through a 90° pipe bend and a T-Junction are compared against experimental data. Both test cases contain areas where equilibrium laws are violated in practice. It is shown that reducing the first cell wall spacing improves agreement with experimental data by limiting the extent from the wall in which the solution is constrained to an equilibrium law. The LES with wall-function approach consistently overpredicts the near-wall temperature fluctuations in the T-Junction, suggesting that it can be considered as a conservative approach. We also benchmark a range of low-Re RANS models. EBRSM predictions for the 90° pipe bend are in significantly better agreement with experimental data than those from the other models. There are discrepancies from all RANS models in the case of the T-Junction.

  16. Propeller Analysis Using RANS/BEM Coupling Accounting for Blade Blockage

    Science.gov (United States)

    2015-07-04

    are taken into account. It has been implemented using the open source RANS solver OpenFOAM ® and the BEM propeller code PROCAL developed by...Each of these is available in the OpenFOAM mesh data structures. 2.2 Implementation in OpenFOAM In the SIMPLE algorithm as implemented in OpenFOAM ...in OpenFOAM , the source term + must be added to the momentum equations and the source term − to the pressure equation. To apply

  17. The Inner Nuclear Membrane Protein Nemp1 Is a New Type of RanGTP-Binding Protein in Eukaryotes.

    Directory of Open Access Journals (Sweden)

    Takashi Shibano

    Full Text Available The inner nuclear membrane (INM protein Nemp1/TMEM194A has previously been suggested to be involved in eye development in Xenopus, and contains two evolutionarily conserved sequences in the transmembrane domains (TMs and the C-terminal region, named region A and region B, respectively. To elucidate the molecular nature of Nemp1, we analyzed its interacting proteins through those conserved regions. First, we found that Nemp1 interacts with itself and lamin through the TMs and region A, respectively. Colocalization of Nemp1 and lamin at the INM suggests that the interaction with lamin participates in the INM localization of Nemp1. Secondly, through yeast two-hybrid screening using region B as bait, we identified the small GTPase Ran as a probable Nemp1-binding partner. GST pulldown and co-immunoprecipitation assays using region B and Ran mutants revealed that region B binds directly to the GTP-bound Ran through its effector domain. Immunostaining experiments using transfected COS-7 cells revealed that full-length Nemp1 recruits Ran near the nuclear envelope, suggesting a role for Nemp1 in the accumulation of RanGTP at the nuclear periphery. At the neurula-to-tailbud stages of Xenopus embryos, nemp1 expression overlapped with ran in several regions including the eye vesicles. Co-knockdown using antisense morpholino oligos for nemp1 and ran caused reduction of cell densities and severe eye defects more strongly than either single knockdown alone, suggesting their functional interaction. Finally we show that Arabidopsis thaliana Nemp1-orthologous proteins interact with A. thaliana Ran, suggesting their evolutionally conserved physical and functional interactions possibly in basic cellular functions including nuclear transportation. Taken together, we conclude that Nemp1 represents a new type of RanGTP-binding protein.

  18. Data-free and data-driven spectral perturbations for RANS UQ

    Science.gov (United States)

    Edeling, Wouter; Mishra, Aashwin; Iaccarino, Gianluca

    2017-11-01

    Despite recent developments in high-fidelity turbulent flow simulations, RANS modeling is still vastly used by industry, due to its inherent low cost. Since accuracy is a concern in RANS modeling, model-form UQ is an essential tool for assessing the impacts of this uncertainty on quantities of interest. Applying the spectral decomposition to the modeled Reynolds-Stress Tensor (RST) allows for the introduction of decoupled perturbations into the baseline intensity (kinetic energy), shape (eigenvalues), and orientation (eigenvectors). This constitutes a natural methodology to evaluate the model form uncertainty associated to different aspects of RST modeling. In a predictive setting, one frequently encounters an absence of any relevant reference data. To make data-free predictions with quantified uncertainty we employ physical bounds to a-priori define maximum spectral perturbations. When propagated, these perturbations yield intervals of engineering utility. High-fidelity data opens up the possibility of inferring a distribution of uncertainty, by means of various data-driven machine-learning techniques. We will demonstrate our framework on a number of flow problems where RANS models are prone to failure. This research was partially supported by the Defense Advanced Research Projects Agency under the Enabling Quantification of Uncertainty in Physical Systems (EQUiPS) project (technical monitor: Dr Fariba Fahroo), and the DOE PSAAP-II program.

  19. Present state and future of CFD based on three-dimensional RANS analysis

    International Nuclear Information System (INIS)

    Kim, Kwang Yong

    2004-01-01

    Computational Fluid Dynamics (CFD) based on Navier-Stokes equations has been developed rapidly for several decades with the developments of high speed computers and numerical algorithms, and presently is regarded as an essential analysis tool in the engineering applications containing fluid flow and convective heat transfer. It is known that for turbulent flow the Navier-Stokes equations can be calculated precisely by Direct Numerical Simulation (DNS). However, DNS needs huge computing time even for simple low-Reynolds number flows, and thus is not practical. Large Eddy Simulation (LES) can be an alternative. But, LES also needs considerable computing time for the analysis of engineering flows, and have some problem in the methods. Therefore, the analysis methods using Reynolds-averaged Navier-stokes equations (RANS) and turbulence closure models are still regarded as the major techniques for the analysis of turbulent flows in spite of the inaccuracy of the prediction. In this presentation, the present state and the prospect of CFD based on three-dimensional RANS analysis are introduced for physical models and numerical algorithms with the engineering examples. Especially, for the analysis of two-phase flows in nuclear reactor, the recently developed techniques are also introduced. And, the presentation includes the methods of design optimization using RANS analysis and numerical optimization techniques with variety of the applications

  20. Nuclear size is sensitive to NTF2 protein levels in a manner dependent on Ran binding

    Science.gov (United States)

    Vuković, Lidija D.; Jevtić, Predrag; Zhang, Zhaojie; Stohr, Bradley A.; Levy, Daniel L.

    2016-01-01

    ABSTRACT Altered nuclear size is associated with many cancers, and determining whether cancer-associated changes in nuclear size contribute to carcinogenesis necessitates an understanding of mechanisms of nuclear size regulation. Although nuclear import rates generally positively correlate with nuclear size, NTF2 levels negatively affect nuclear size, despite the role of NTF2 (also known as NUTF2) in nuclear recycling of the import factor Ran. We show that binding of Ran to NTF2 is required for NTF2 to inhibit nuclear expansion and import of large cargo molecules in Xenopus laevis egg and embryo extracts, consistent with our observation that NTF2 reduces the diameter of the nuclear pore complex (NPC) in a Ran-binding-dependent manner. Furthermore, we demonstrate that ectopic NTF2 expression in Xenopus embryos and mammalian tissue culture cells alters nuclear size. Finally, we show that increases in nuclear size during melanoma progression correlate with reduced NTF2 expression, and increasing NTF2 levels in melanoma cells is sufficient to reduce nuclear size. These results show a conserved capacity for NTF2 to impact on nuclear size, and we propose that NTF2 might be a new cancer biomarker. PMID:26823604

  1. Assessment of brain activation regulation in first graders via RAN / RAS test

    Directory of Open Access Journals (Sweden)

    Tatiana V. Akhutina

    2015-03-01

    Full Text Available RAN / RAS test (Rapid Automatized Naming / Rapid Alternating Stimulus has been used successfully used by many psychologists, primarily to predict the risk of dyslexia, as it includes a language component and requires good visual-verbal connections. However, The research demonstrates that the low speed of naming is an effective indicator of neurocognitive problems of information processing as a whole (learning difficulties in general, not just reading difficulties. This can be explained in two ways: disturbance of executive mental control and the difficulties of automatization: the difficulties of the transition from a controlled energy-consuming assignment to a less energy-consuming one. The second interpretation describes the problems of energy resources of cognitive functioning. It is similar to weak maintenance of cortical structures activation. However, using the test mentioned herewith for assessing functions of activation regulation has not been described previously. In terms of the Luria’s three functional units of the brain theory the RAN / RAS test can be considered as sensitive to the weakness of the first unit, whose function is to maintain the activity of cortical structures. So the aim of the research is to prove the possibility of assessing the activation regulation using the RAN / RAS test. This issue is relevant because neuropsychological tools for determining the weakness of Unit I functions are not quite sufficient, while the problem of “energetic” unit ranks first in the frequency of occurrence in children with learning disabilities.

  2. Identification and expression analysis of BoMF25, a novel polygalacturonase gene involved in pollen development of Brassica oleracea.

    Science.gov (United States)

    Lyu, Meiling; Liang, Ying; Yu, Youjian; Ma, Zhiming; Song, Limin; Yue, Xiaoyan; Cao, Jiashu

    2015-06-01

    BoMF25 acts on pollen wall. Polygalacturonase (PG) is a pectin-digesting enzyme involved in numerous plant developmental processes and is described to be of critical importance for pollen wall development. In the present study, a PG gene, BoMF25, was isolated from Brassica oleracea. BoMF25 is the homologous gene of At4g35670, a PG gene in Arabidopsis thaliana with a high expression level at the tricellular pollen stage. Collinear analysis revealed that the orthologous gene of BoMF25 in Brassica campestris (syn. B. rapa) genome was probably lost because of genome deletion and reshuffling. Sequence analysis indicated that BoMF25 contained four classical conserved domains (I, II, III, and IV) of PG protein. Homology and phylogenetic analyses showed that BoMF25 was clustered in Clade F. The putative promoter sequence, containing classical cis-acting elements and pollen-specific motifs, could drive green fluorescence protein expression in onion epidermal cells. Quantitative RT-PCR analysis suggested that BoMF25 was mainly expressed in the anther at the late stage of pollen development. In situ hybridization analysis also indicated that the strong and specific expression signal of BoMF25 existed in pollen grains at the mature pollen stage. Subcellular localization showed that the fluorescence signal was observed in the cell wall of onion epidermal cells, which suggested that BoMF25 may be a secreted protein localized in the pollen wall.

  3. BoALMT1, an Al-Induced Malate Transporter in Cabbage, Enhances Aluminum Tolerance in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Lei Zhang

    2018-01-01

    Full Text Available Aluminum (Al is present in approximately 50% of the arable land worldwide and is regarded as the main limiting factor of crop yield on acidic soil. Al-induced root malate efflux plays an important role in the Al tolerance of plants. Here, the aluminum induced malate transporter BoALMT1 (KF322104 was cloned from cabbage (Brassica oleracea. BoALMT1 showed higher expression in roots than in shoots. The expression of BoALMT1 was specifically induced by Al treatment, but not the trivalent cations lanthanum (La, cadmium (Cd, zinc (Zn, or copper (Cu. Subcellular localization studies were performed in onion epidermal cells and revealed that BoALMT1 was localized at the plasma membrane. Scanning Ion-selective Electrode Technique was used to analyze H+ flux. Xenopus oocytes and Arabidopsis thaliana expressing BoALMT1 excreted more H+ under Al treatment. Overexpressing BoALMT1 in transgenic Arabidopsis resulted in enhanced Al tolerance and increased malate secretion. The results suggested that BoALMT1 functions as an Al-resistant gene and encodes a malate transporter. Expressing BoALMT1 in Xenopus oocytes or A. thaliana indicated that BoALMT1 could increase malate secretion and H+ efflux to resist Al tolerance.

  4. Hydrothermal Formation of the Head-to-Head Coalesced Szaibelyite MgBO2(OH Nanowires

    Directory of Open Access Journals (Sweden)

    Zhu Wancheng

    2009-01-01

    Full Text Available Abstract The significant effect of the feeding mode on the morphology and size distribution of the hydrothermal synthesized MgBO2(OH is investigated, which indicates that, slow dropping rate (0.5 drop s−1 and small droplet size (0.02 mL d−1 of the dropwise added NaOH solution are favorable for promoting the one-dimensional (1D preferential growth and thus enlarging the aspect ratio of the 1D MgBO2(OH nanostructures. The joint effect of the low concentration of the reactants and feeding mode on the hydrothermal product results in the head-to-head coalesced MgBO2(OH nanowires with a length of 0.5–9.0 μm, a diameter of 20–70 nm, and an aspect ratio of 20–300 in absence of any capping reagents/surfactants or seeds.

  5. Synthesis and crystal structure of the rare earth borogermanate EuGeBO{sub 5}

    Energy Technology Data Exchange (ETDEWEB)

    Chi, Yang; Zhuang, Yan; Guo, Sheng-Ping [Yangzhou Univ., Jiangsu (China). College of Chemistry and Chemical Engineering

    2017-03-01

    The synthesis and crystal structure of the rare earth borogermanate EuGeBO{sub 5} are reported. It is synthesized by high-temperature solid-state reaction and crystallizes in the monoclinic space group P2{sub 1}/c (no. 14) with the unit cell parameters a=4.8860(5), b=7.5229(8), c=9.9587(10) Aa, and β=91.709(3) . Its crystal structure features a polyanion-type layer (GeBO{sub 5}){sup 3-} constructed by BO{sub 4} and GeO{sub 4} tetrahedra connected alternatingly. Eu{sup 3+} ions are located in cavities and are coordinated by eight O atoms. Various structures of the related compounds REMM'O{sub 5} (RE=rare earth metal; M=Si, Ge, and Sn; M'=B, Al, and Ga) are also discussed.

  6. Role of Asp544 in subunit I for Na+ pumping by Vitreoscilla cytochrome bo

    International Nuclear Information System (INIS)

    Chung, Yeon T.; Stark, Benjamin C.; Webster, Dale A.

    2006-01-01

    The conserved Glu540 in subunit I of Escherichia coli cytochrome bo (a H + pump) is replaced by Asp544 in the Vitreoscilla enzyme (a Na + pump). Site-directed mutagenesis of the Vitreoscilla cytochrome bo operon changed this Asp to Glu, and both wild type and mutant cyo's were transformed into E. coli strain GV100, which lacks cytochrome bo. Compared to the wild type transformant the Asp544Glu transformant had decreased ability to pump Na + as well as decreased stimulation in respiratory activity in the presence of Na + . Preliminary experiments indicated that this mutant also had increased ability to pump protons, suggesting that this single change may provide cation pumping specificity in this group of enzymes

  7. A RANS knock model to predict the statistical occurrence of engine knock

    International Nuclear Information System (INIS)

    D'Adamo, Alessandro; Breda, Sebastiano; Fontanesi, Stefano; Irimescu, Adrian; Merola, Simona Silvia; Tornatore, Cinzia

    2017-01-01

    Highlights: • Development of a new RANS model for SI engine knock probability. • Turbulence-derived transport equations for variances of mixture fraction and enthalpy. • Gasoline autoignition delay times calculated from detailed chemical kinetics. • Knock probability validated against experiments on optically accessible GDI unit. • PDF-based knock model accounting for the random nature of SI engine knock in RANS simulations. - Abstract: In the recent past engine knock emerged as one of the main limiting aspects for the achievement of higher efficiency targets in modern spark-ignition (SI) engines. To attain these requirements, engine operating points must be moved as close as possible to the onset of abnormal combustions, although the turbulent nature of flow field and SI combustion leads to possibly ample fluctuations between consecutive engine cycles. This forces engine designers to distance the target condition from its theoretical optimum in order to prevent abnormal combustion, which can potentially damage engine components because of few individual heavy-knocking cycles. A statistically based RANS knock model is presented in this study, whose aim is the prediction not only of the ensemble average knock occurrence, poorly meaningful in such a stochastic event, but also of a knock probability. The model is based on look-up tables of autoignition times from detailed chemistry, coupled with transport equations for the variance of mixture fraction and enthalpy. The transported perturbations around the ensemble average value are based on variable gradients and on a local turbulent time scale. A multi-variate cell-based Gaussian-PDF model is proposed for the unburnt mixture, resulting in a statistical distribution for the in-cell reaction rate. An average knock precursor and its variance are independently calculated and transported; this results in the prediction of an earliest knock probability preceding the ensemble average knock onset, as confirmed by

  8. The role of BoFLC2 in cauliflower (Brassica oleracea var. botrytis L.) reproductive development.

    Science.gov (United States)

    Ridge, Stephen; Brown, Philip H; Hecht, Valérie; Driessen, Ronald G; Weller, James L

    2015-01-01

    In agricultural species that are sexually propagated or whose marketable organ is a reproductive structure, management of the flowering process is critical. Inflorescence development in cauliflower is particularly complex, presenting unique challenges for those seeking to predict and manage flowering time. In this study, an integrated physiological and molecular approach was used to clarify the environmental control of cauliflower reproductive development at the molecular level. A functional allele of BoFLC2 was identified for the first time in an annual brassica, along with an allele disrupted by a frameshift mutation (boflc2). In a segregating F₂ population derived from a cross between late-flowering (BoFLC2) and early-flowering (boflc2) lines, this gene behaved in a dosage-dependent manner and accounted for up to 65% of flowering time variation. Transcription of BoFLC genes was reduced by vernalization, with the floral integrator BoFT responding inversely. Overall expression of BoFT was significantly higher in early-flowering boflc2 lines, supporting the idea that BoFLC2 plays a key role in maintaining the vegetative state. A homologue of Arabidopsis VIN3 was isolated for the first time in a brassica crop species and was up-regulated by two days of vernalization, in contrast to findings in Arabidopsis where prolonged exposure to cold was required to elicit up-regulation. The correlations observed between gene expression and flowering time in controlled-environment experiments were validated with gene expression analyses of cauliflowers grown outdoors under 'natural' vernalizing conditions, indicating potential for transcript levels of flowering genes to form the basis of predictive assays for curd initiation and flowering time. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  9. Three enzymatically active neurotoxins of Clostridium botulinum strain Af84: BoNT/A2, /F4, and /F5.

    Science.gov (United States)

    Kalb, Suzanne R; Baudys, Jakub; Smith, Theresa J; Smith, Leonard A; Barr, John R

    2014-04-01

    Botulinum neurotoxins (BoNTs) are produced by various species of clostridia and are potent neurotoxins which cause the disease botulism, by cleaving proteins needed for successful nerve transmission. There are currently seven confirmed serotypes of BoNTs, labeled A-G, and toxin-producing clostridia typically only produce one serotype of BoNT. There are a few strains (bivalent strains) which are known to produce more than one serotype of BoNT, producing either both BoNT/A and /B, BoNT/A and /F, or BoNT/B and /F, designated as Ab, Ba, Af, or Bf. Recently, it was reported that Clostridium botulinum strain Af84 has three neurotoxin gene clusters: bont/A2, bont/F4, and bont/F5. This was the first report of a clostridial organism containing more than two neurotoxin gene clusters. Using a mass spectrometry based proteomics approach, we report here that all three neurotoxins, BoNT/A2, /F4, and /F5, are produced by C. botulinum Af84. Label free MS(E) quantification of the three toxins indicated that toxin composition is 88% BoNT/A2, 1% BoNT/F4, and 11% BoNT/F5. The enzymatic activity of all three neurotoxins was assessed by examining the enzymatic activity of the neurotoxins upon peptide substrates, which mimic the toxins' natural targets, and monitoring cleavage of the substrates by mass spectrometry. We determined that all three neurotoxins are enzymatically active. This is the first report of three enzymatically active neurotoxins produced in a single strain of Clostridium botulinum.

  10. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Science.gov (United States)

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  11. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Science.gov (United States)

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing

    2014-02-12

    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  12. The nucleoporin MEL-28 promotes RanGTP-dependent γ-tubulin recruitment and microtubule nucleation in mitotic spindle formation.

    Science.gov (United States)

    Yokoyama, Hideki; Koch, Birgit; Walczak, Rudolf; Ciray-Duygu, Fulya; González-Sánchez, Juan Carlos; Devos, Damien P; Mattaj, Iain W; Gruss, Oliver J

    2014-01-01

    The GTP-bound form of the Ran GTPase (RanGTP), produced around chromosomes, drives nuclear envelope and nuclear pore complex (NPC) re-assembly after mitosis. The nucleoporin MEL-28/ELYS binds chromatin in a RanGTP-regulated manner and acts to seed NPC assembly. Here we show that, upon mitotic NPC disassembly, MEL-28 dissociates from chromatin and re-localizes to spindle microtubules and kinetochores. MEL-28 directly binds microtubules in a RanGTP-regulated way via its C-terminal chromatin-binding domain. Using Xenopus egg extracts, we demonstrate that MEL-28 is essential for RanGTP-dependent microtubule nucleation and spindle assembly, independent of its function in NPC assembly. Specifically, MEL-28 interacts with the γ-tubulin ring complex and recruits it to microtubule nucleation sites. Our data identify MEL-28 as a RanGTP target that functions throughout the cell cycle. Its cell cycle-dependent binding to chromatin or microtubules discriminates MEL-28 functions in interphase and mitosis, and ensures that spindle assembly occurs only after NPC breakdown.

  13. Gauging the Auditory Dimensions of Dysarthric Impairment: Reliability and Construct Validity of the Bogenhausen Dysarthria Scales (BoDyS)

    Science.gov (United States)

    Ziegler, Wolfram; Staiger, Anja; Schölderle, Theresa; Vogel, Mathias

    2017-01-01

    Purpose: Standardized clinical assessment of dysarthria is essential for management and research. We present a new, fully standardized dysarthria assessment, the Bogenhausen Dysarthria Scales (BoDyS). The measurement model of the BoDyS is based on auditory evaluations of connected speech using 9 scales (traits) assessed by 4 elicitation methods.…

  14. Synthesis and photoluminescence properties of GdBO3:Ln3+ (Ln = Eu, Tb) nanofibers by electrospinning

    International Nuclear Information System (INIS)

    Shen, Hongzhi; Feng, Shuo; Wang, Ying; Gu, Yipeng; Zhou, Jing; Yang, Hang; Feng, Guanlin; Li, Liang; Wang, Wenquan; Liu, Xiaoyang; Xu, Dapeng

    2013-01-01

    Highlights: ► GdBO 3 :Ln 3+ nanofibers were synthesized successfully by electrospinning. ► The samples have the average diameter of 150 nm and the flexible morphology. ► The GdBO 3 : Eu 3+ nanofibers have the stronger orange emission. ► The luminescence properties are different from the reported bulk material. ► We describe the energy transform process of GdBO 3 :Ln 3+ system. - Abstract: GdBO 3 :Ln 3+ (Ln = Eu, Tb) nanofibers were synthesized using electrospinning combined with heat treatment. The synthesized nanofibers were characterized by X-ray diffraction, Raman spectroscopy, field emission-scanning electron microscopy, thermogravimetric and differential thermal analyses, and photoluminescence. The experimental results show that the flexible synthesized nanofibers have an average diameter of approximately 150 nm. The nanofibers consist of crystalline grains with diameters of about 40 nm and have a vaterite-type structure of GdBO 3 . The GdBO 3 :Eu 3+ nanofibers exhibit strong orange and weak red emissions with a low ratio of red to orange emission intensities, which is different from those of the reported bulk materials and nanoparticles. The luminescence properties of the synthesized GdBO 3 :Tb 3+ nanofibers are essentially consistent with those of the synthesized GdBO 3 :Tb 3+ powders by solid-state reaction.

  15. Structure, electronic properties, luminescence and chromaticity investigations of rare earth doped KMgBO{sub 3} phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Jianghui; Cheng, Qijin [School of Energy Research, Xiamen University, Xiamen 361005 (China); Wu, Shunqing [Department of Physics, Xiamen University, Xiamen, 361005 (China); Zhuang, Yixi [College of Materials, Xiamen University, Xiamen 361005 (China); Guo, Ziquan; Lu, Yijun [Department of Electronic Science, Fujian Engineering Research Center for Solid-state Lighting, Xiamen University, Xiamen 361005 (China); Chen, Chao, E-mail: cchen@xmu.edu.cn [School of Energy Research, Xiamen University, Xiamen 361005 (China); Department of Physics, Xiamen University, Xiamen, 361005 (China); Department of Electronic Science, Fujian Engineering Research Center for Solid-state Lighting, Xiamen University, Xiamen 361005 (China)

    2015-09-01

    In this work, the optimization of the geometry and the electronic properties of the host matrix KMgBO{sub 3} were investigated using density functional theory, and the comprehensive photoluminescence and chromaticity properties on five rare earth ion-doped (RE = Ce{sup 3+}, Tm{sup 3+}, Tb{sup 3+}, Eu{sup 3+}, Dy{sup 3+}) KMgBO{sub 3} phosphors were also studied. By introducing RE ions into the KMgBO{sub 3} host, excellent purple, blue, green, red and white emitting light could be obtained under the near-ultraviolet light excitation. The results suggest that rare earth doped KMgBO{sub 3} phosphors are potential luminescence materials for the application in the near-ultraviolet white light-emitting diodes. - Highlights: • The electronic properties of the host matrix KMgBO{sub 3} were investigated. • The PL properties on rare earth ions doped KMgBO{sub 3} phosphors were studied. • The chromaticity properties on rare earth ions doped KMgBO{sub 3} samples were studied. • Tm{sup 3+} and Eu{sup 3+} doped KMgBO{sub 3} samples show higher color purity than commercial phosphors.

  16. Ivan Rančić: A forgotten painter of flowers and landscapes

    Directory of Open Access Journals (Sweden)

    Marković Kamenko M.

    2014-01-01

    Full Text Available Ivan Rančić was born in the Kraljevo village, in eastern Serbia to a family of farmers on 19th, February, 1906. Very little data about him has been preserved, therefore, this paper is an attempt to make a reconstruction of his life and work. He attended primary school in his birth place, lower secondary school he finished in Knjazevac and Military Academy in Belgrade. After completing the National Academy in 1934, he was sent to Zagreb where he got his first post. He lived there with his wife and his son until the capitulation of the country in 1941. A few months after the collapse of the country, he was arrested and sent to Ljubljana and three months later to a concentration camp in Austria. He spent about fifteen months in that camp in during which time he intensively studied painting. He fled from the camp to Switzerland and stayed there until his death in 1987. According to some letters he sent to his wife in Nis, some of his paintings he created during his time in the camp, ne took to Switzerland where he eventually sold them. He did the toughest jobs there in order to survive and painted extensively. After World War II he graduated from the School of Fine Arts in Lausanne. Later on he had two exhibitions at the New Gallery of Modern Art. Ivan Rančić came a long way from an unknown beginner to a respected prominent artist. He left behind about 350 works, many of which he sold during his life, mainly landscapes and still life in oil, watercolor and pastel. He was neither concerned about styles and trends nor did he believe in the old and the new. If he came to a certain specific manner of painting, it is because at one point it was imposed on him as the only proper way of expression. The analysis of Rančić's paintings leads to the conclusion that his creation had gone through four phases. The first one (started in the concentration camp in Austria during which he painted still lifes without full sketches, previous studies, and the use

  17. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Directory of Open Access Journals (Sweden)

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  18. Thermodynamic study of gaseous CsBO2 by Knudsen effusion mass spectrometry

    Science.gov (United States)

    Nakajima, K.; Takai, T.; Furukawa, T.; Osaka, M.

    2017-08-01

    One of the main chemical forms of cesium in the gas phase during severe light-water reactor accidents is expected to be cesium metaborate, CsBO2, according to thermodynamic equilibrium calculations considering its reaction with boron. However, the accuracy of the thermodynamic data of the gaseous metaborate, CsBO2(g), has been judged as poor. Thus, Knudsen effusion mass spectrometric measurements of CsBO2 were carried out to obtain reliable thermodynamic data. The evaluated values of the standard enthalpy of formation of CsBO2(g), obtained by the 2nd and 3rd-law treatments, are -700.7 ± 10.7 kJ/mol and -697.0 ± 10.6 kJ/mol, respectively, and agree with each other within the experimental errors, which indicates that our data are reliable. Furthermore, it was found that the existing data of the Gibbs energy function and the standard enthalpy of formation agreed well with the values evaluated in this study, which indicates that the existing thermodynamic data are also reliable.

  19. Liberální matka Božena Němcová?

    Czech Academy of Sciences Publication Activity Database

    Bahenská, Marie

    2012-01-01

    Roč. 99, č. 3 (2012), s. 307-318 ISSN 0009-0794 Institutional support: RVO:67985921 Keywords : Němcová, Božena * biography Subject RIV: AB - History Impact factor: 0.094, year: 2012 http://www.jstor.org/stable/42640493

  20. Prevalence and gene frequencies of A1A2BO and Rh(D) blood ...

    African Journals Online (AJOL)

    Ruqaiya Hussain

    2012-08-03

    Aug 3, 2012 ... Human Genetics and Toxicology Lab, Section of Genetics, Department of Zoology ... alence and gene frequencies of A1A2BO and Rh(D) blood groups among the Muslim populations of ..... The principal bio-clinical significance of the erythrocytic ... (CST), UP, which funded the major project, titled '' Genomic.

  1. Hana Bořkovcová, Záznamy z Wohlau

    Czech Academy of Sciences Publication Activity Database

    Kosák, Michal

    2010-01-01

    Roč. 25, č. 81 (2010), s. 209-220 ISSN 1210-2881 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Bořkovcová, Hana * holocaust Subject RIV: AJ - Letters, Mass-media, Audiovision

  2. Mapping Boron Dioxide (BO2) Light Emission During Ballistic Initiation of Boron

    Science.gov (United States)

    2016-03-03

    cameras (Vision Research, Inc.) looking through a glass plate beam splitter ( Edward Scientific) along a common line of sight. The cameras were run...Research Laboratory (US); 1992. Report No.: BRL-TR-3387. 17. Snowden BS Jr. The emission spectrum of the BO2 molecule [thesis 64-4757]. [Nashville

  3. Interferon-τ increases BoLA-I for implantation during early pregnancy in dairy cows.

    Science.gov (United States)

    Zhu, Zhe; Li, Binbin; Wu, Yue; Wang, Xiao; Deng, GanZhen

    2017-11-10

    Interferon-τ (IFN-τ) signals pregnancy recognition in ruminants. We investigated the effects of IFN-τ produced by embryo trophoblastic cells (ETCs) on expression of bovine leukocyte antigen-I (BoLA-I), a bovine analogue of human MHC-I, in endometrial luminal epithelial cells (EECs) during early pregnancy in dairy cows. Expression of IFN-τ and BoLA-I was increased in endometrial tissues during early pregnancy. Expression of the anti-inflammatory cytokine IL-10 was increased in endometrial tissues, while expression of the pro-inflammatory cytokine IL-6 was decreased, indicating immunosuppression. Progesterone increased IFN-τ expression in EECs. IFN-τ increased p-STAT1 and p-STAT3 levels in EECs, but reduced TRAF3 levels. In addition, IFN-τ increased expression of BoLA-I and IL-10, but decreased expression of IL-6 in EECs. These results indicate that IFN-τ enables stable implantation in dairy cows by increasing expression of BoLA-I, and by immunosuppression mediated by increased IL-10 and decreased IL-6 expression.

  4. Transgenic tobacco plants expressing BoRS1 gene from Brassica ...

    Indian Academy of Sciences (India)

    Water stress is by far the leading environmental stress limiting crop yields worldwide. Genetic engineering techniques hold great promise for developing crop cultivars with high tolerance to water stress. In this study, the Brassica oleracea var. acephala BoRS1 gene was transferred into tobacco through ...

  5. Centers of sustainable co-created products by BoP: Development inspired by social entrepreneurs.

    NARCIS (Netherlands)

    Jauregui Becker, Juan Manuel; Franco Garcia, Maria Maria; Groen, Arend J.

    2012-01-01

    This paper frames the main components required to set-up Product Co-Creation Centers (PC3) within (rural or urban) BoP environments as a method to (1) identify creative and entrepreneur individuals; (2) aid the process of generating new ideas; (3) support the co-creation of products and services as

  6. TanZamBo Capacity Building for HIV Prevention Research Network ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This grant will support the development of HIV/AIDS prevention trial expertise in Botswana, Tanzania and Zambia using existing collaborations between Africa, Canada and the United States. The Botswana-Tanzania-Zambia Capacity Building Network (TanZamBo) is composed of two African institutions with fairly well ...

  7. Scientific Drilling with the Sea Floor Drill Rig MeBo

    Directory of Open Access Journals (Sweden)

    Gerold Wefer

    2007-09-01

    Full Text Available In March 2007 the sea floor drill rig MeBo (short for “Meeresboden-Bohrgerät”, ‘sea floor drill rig’ in German returned from a 17-day scientific cruise with the new German research vessel Maria S. Merian. Four sites between 350 m and 1700 m water depth were sampled at the continental slope off Morocco by push coring and rotary drilling. Up to 41.5-m-long sediment cores were recovered from Miocene, Pliocene, and Pleistocene marls. MeBo bridges the gapbetween conventional sampling methods from standard multipurpose research vessels (gravity corer, piston corer, dredges and drill ships. Most bigger research vessels will be able to support deployment of the MeBo. Since the drill system can be easily transported within 20-ft containers, worldwide operation from vessels of opportunity is possible. With the MeBo a new system is available for marine geosciences that allows the recovery of high quality samples from soft sediments and hard rock from the deep sea withoutrelying on the services of expensive drilling vessels.

  8. RANS Analyses of Turbofan Nozzles with Internal Wedge Deflectors for Noise Reduction

    Science.gov (United States)

    DeBonis, James R.

    2009-01-01

    Computational fluid dynamics (CFD) was used to evaluate the flow field and thrust performance of a promising concept for reducing the noise at take-off of dual-stream turbofan nozzles. The concept, offset stream technology, reduces the jet noise observed on the ground by diverting (offsetting) a portion of the fan flow below the core flow, thickening and lengthening this layer between the high-velocity core flow and the ground observers. In this study a wedge placed in the internal fan stream is used as the diverter. Wind, a Reynolds averaged Navier-Stokes (RANS) code, was used to analyze the flow field of the exhaust plume and to calculate nozzle performance. Results showed that the wedge diverts all of the fan flow to the lower side of the nozzle, and the turbulent kinetic energy on the observer side of the nozzle is reduced. This reduction in turbulent kinetic energy should correspond to a reduction in noise. However, because all of the fan flow is diverted, the upper portion of the core flow is exposed to the freestream, and the turbulent kinetic energy on the upper side of the nozzle is increased, creating an unintended noise source. The blockage due to the wedge reduces the fan mass flow proportional to its blockage, and the overall thrust is consequently reduced. The CFD predictions are in very good agreement with experimental flow field data, demonstrating that RANS CFD can accurately predict the velocity and turbulent kinetic energy fields. While this initial design of a large scale wedge nozzle did not meet noise reduction or thrust goals, this study identified areas for improvement and demonstrated that RANS CFD can be used to improve the concept.

  9. İRAN VE REJİM İSTİKRARI

    Directory of Open Access Journals (Sweden)

    Özgür ÜŞENMEZ

    2015-07-01

    Full Text Available ÖZ: Bu çalışma, İran rejiminin son yıllarda Orta Doğu'yu sarsan isyanlar ve istikrarsızlıklara-Batı'daki beklentilerin aksine- geçmişten, özellikle 1979'daki devrimden miras kalan sosyal yapı ve politikaların etkisiyle direnebildiğini iddia ediyor. Tunus ve Mısır'daki halk isyanları, temel aktör olan alt sınıflar ve onların neo-liberal ekonomik politikalara muhalefetiyle yayılırken, İran’da devrim sonrası gelişen sosyal devlet mekanizması hala halk ile rejimin tamamen birbirine yabancılaşmasını önlemekte. Ancak son yıllarda ortaya çıkan yeni gerilimler ve İran'ın uyguladığı ekonomi politikaları rejimin krizini derinleştirebilir. Bu nedenledir ki Orta Doğu'yu ve özelde İran'ı anlamak için hegemonik blokların tarihsel değişimini inceleyen ucu açık bir analiz elzemdir. ABSTRACT: This article argues that contrary to the expectations of the Western World, Iranian regime successfully resisted the revolutionary tides of the Arab Spring. Most important determinant of this process for Iran was the legacy of the 1979 revolution and it's associated structures that relatively protects the most vulnerable parts of the population against the wide spread neo-liberal economic policies in the Middle East. So with that feature Iran differs from the Tunisian and the Egyptian examples. In order to understand these features further this essay adapts a historical analysis of changes in hegemonic blocs in Iran since 1979.

  10. RANS modeling for particle transport and deposition in turbulent duct flows: Near wall model uncertainties

    International Nuclear Information System (INIS)

    Jayaraju, S.T.; Sathiah, P.; Roelofs, F.; Dehbi, A.

    2015-01-01

    Highlights: • Near-wall modeling uncertainties in the RANS particle transport and deposition are addressed in a turbulent duct flow. • Discrete Random Walk (DRW) model and Continuous Random Walk (CRW) model performances are tested. • Several near-wall anisotropic model accuracy is assessed. • Numerous sensitivity studies are performed to recommend a robust, well-validated near-wall model for accurate particle deposition predictions. - Abstract: Dust accumulation in the primary system of a (V)HTR is identified as one of the foremost concerns during a potential accident. Several numerical efforts have focused on the use of RANS methodology to better understand the complex phenomena of fluid–particle interaction at various flow conditions. In the present work, several uncertainties relating to the near-wall modeling of particle transport and deposition are addressed for the RANS approach. The validation analyses are performed in a fully developed turbulent duct flow setup. A standard k − ε turbulence model with enhanced wall treatment is used for modeling the turbulence. For the Lagrangian phase, the performance of a continuous random walk (CRW) model and a discrete random walk (DRW) model for the particle transport and deposition are assessed. For wall bounded flows, it is generally seen that accounting for near wall anisotropy is important to accurately predict particle deposition. The various near-wall correlations available in the literature are either derived from the DNS data or from the experimental data. A thorough investigation into various near-wall correlations and their applicability for accurate particle deposition predictions are assessed. The main outcome of the present work is a well validated turbulence model with optimal near-wall modeling which provides realistic particle deposition predictions

  11. Numerical study comparing RANS and LES approaches on a circulation control airfoil

    International Nuclear Information System (INIS)

    Rumsey, Christopher L.; Nishino, Takafumi

    2011-01-01

    Highlights: → RANS compared with LES for circulation control airfoil. → RANS turbulence models need to account for streamline curvature. → RANS models yield higher lift than LES in spite of predicting similar jet separation. - Abstract: A numerical study over a nominally two-dimensional circulation control airfoil is performed using a large-eddy simulation code and two Reynolds-averaged Navier-Stokes codes. Different Coanda jet blowing conditions are investigated. In addition to investigating the influence of grid density, a comparison is made between incompressible and compressible flow solvers. The incompressible equations are found to yield negligible differences from the compressible equations up to at least a jet exit Mach number of 0.64. The effects of different turbulence models are also studied. Models that do not account for streamline curvature effects tend to predict jet separation from the Coanda surface too late, and can produce non-physical solutions at high blowing rates. Three different turbulence models that account for streamline curvature are compared with each other and with large eddy simulation solutions. All three models are found to predict the Coanda jet separation location reasonably well, but one of the models predicts specific flow field details near the Coanda surface prior to separation much better than the other two. All Reynolds-averaged Navier-Stokes computations produce higher circulation than large eddy simulation computations, with different stagnation point location and greater flow acceleration around the nose onto the upper surface. The precise reasons for the higher circulation are not clear, although it is not solely a function of predicting the jet separation location correctly.

  12. Numerical study comparing RANS and LES approaches on a circulation control airfoil

    Energy Technology Data Exchange (ETDEWEB)

    Rumsey, Christopher L., E-mail: c.l.rumsey@nasa.gov [Computational AeroSciences Branch, NASA Langley Research Center, Hampton, VA 23681-2199 (United States); Nishino, Takafumi [Advanced Supercomputing Division, NASA Ames Research Center, Moffett Field, CA 94035-1000 (United States)

    2011-10-15

    Highlights: > RANS compared with LES for circulation control airfoil. > RANS turbulence models need to account for streamline curvature. > RANS models yield higher lift than LES in spite of predicting similar jet separation. - Abstract: A numerical study over a nominally two-dimensional circulation control airfoil is performed using a large-eddy simulation code and two Reynolds-averaged Navier-Stokes codes. Different Coanda jet blowing conditions are investigated. In addition to investigating the influence of grid density, a comparison is made between incompressible and compressible flow solvers. The incompressible equations are found to yield negligible differences from the compressible equations up to at least a jet exit Mach number of 0.64. The effects of different turbulence models are also studied. Models that do not account for streamline curvature effects tend to predict jet separation from the Coanda surface too late, and can produce non-physical solutions at high blowing rates. Three different turbulence models that account for streamline curvature are compared with each other and with large eddy simulation solutions. All three models are found to predict the Coanda jet separation location reasonably well, but one of the models predicts specific flow field details near the Coanda surface prior to separation much better than the other two. All Reynolds-averaged Navier-Stokes computations produce higher circulation than large eddy simulation computations, with different stagnation point location and greater flow acceleration around the nose onto the upper surface. The precise reasons for the higher circulation are not clear, although it is not solely a function of predicting the jet separation location correctly.

  13. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    International Nuclear Information System (INIS)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  14. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Science.gov (United States)

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  15. Layered Downlink Precoding for C-RAN Systems with Full Dimensional MIMO

    OpenAIRE

    Kang, Jinkyu; Simeone, Osvaldo; Kang, Joonhyuk; Shamai, Shlomo

    2015-01-01

    The implementation of a Cloud Radio Access Network (C-RAN) with Full Dimensional (FD)-MIMO is faced with the challenge of controlling the fronthaul overhead for the transmission of baseband signals as the number of horizontal and vertical antennas grows larger. This work proposes to leverage the special low-rank structure of FD-MIMO channel, which is characterized by a time-invariant elevation component and a time-varying azimuth component, by means of a layered precoding approach, so as to r...

  16. Cost-effective resource allocation in C-RAN with mobile cloud

    OpenAIRE

    Wang, Kezhi; Yang, Kun; Wang, Xinhou; Magurawalage, Chathura Sarathchandra

    2016-01-01

    Taking full advantages of two cloud-based techniques, i.e., cloud radio access network (C-RAN) and mobile cloud computing (MCC), mobile operators will be able to provide the good service to the mobile user as well as increasing their revenue. This paper aims to minimize the mobile operator's cost while at the same time, meet the task time constraints of the mobile users. In particular, we assume that the mobile cloud first completes the tasks for the mobile user and then transmits the results...

  17. Enhancing LTE with Cloud-RAN and Load-Controlled Parasitic Antenna Arrays

    DEFF Research Database (Denmark)

    Artuso, Matteo; Boviz, Dora; Checko, Aleksandra

    2016-01-01

    Cloud radio access network systems, consisting of remote radio heads densely distributed in a coverage area and connected by optical fibers to a cloud infrastructure with large computational capabilities, have the potential to meet the ambitious objectives of next generation mobile networks. Actual...... presented for the fronthaul enables flexibility and elasticity in resource allocation to support BS virtualization. A layered design of information control for the proposed end-to-end solution is presented. The feasibility and effectiveness of such an LCPAA-enabled C-RAN system setup has been validated...

  18. Statistical Multiplexing of Computations in C-RAN with Tradeoffs in Latency and Energy

    DEFF Research Database (Denmark)

    Kalør, Anders Ellersgaard; Agurto Agurto, Mauricio Ignacio; Pratas, Nuno

    2017-01-01

    frame duration, then this may result in additional access latency and limit the energy savings. In this paper we investigate the tradeoff by considering two extreme time-scales for the resource multiplexing: (i) long-term, where the computational resources are adapted over periods much larger than...... the access frame durations; (ii) short-term, where the adaption is below the access frame duration.We develop a general C-RAN queuing model that models the access latency and show, for Poisson arrivals, that long-term multiplexing achieves savings comparable to short-term multiplexing, while offering low...

  19. Investigation on hydrodynamic performance of a marine propeller in oblique flow by RANS computations

    Directory of Open Access Journals (Sweden)

    Jianxi Yao

    2015-01-01

    Full Text Available This paper presents a numerical study on investigating on hydrodynamic characteristics of a marine propeller in oblique flow. The study is achieved by RANS simulations on an open source platform - OpenFOAM. A sliding grid approach is applied to compute the rotating motion of the propeller. Total force and moment acting on blades, as well as average force distributions in one revolution on propeller disk, are obtained for 70 cases of com- binations of advance ratios and oblique angles. The computed results are compared with available experimental data and discussed.

  20. Ran Involved in the Development and Reproduction Is a Potential Target for RNA-Interference-Based Pest Management in Nilaparvata lugens.

    Directory of Open Access Journals (Sweden)

    Kai-Long Li

    Full Text Available Ran (RanGTPase in insects participates in the 20-hydroxyecdysone signal transduction pathway in which downstream genes, FTZ-F1, Krüppel-homolog 1 (Kr-h1 and vitellogenin, are involved. A putative Ran gene (NlRan was cloned from Nilaparvata lugens, a destructive phloem-feeding pest of rice. NlRan has the typical Ran primary structure features that are conserved in insects. NlRan showed higher mRNA abundance immediately after molting and peaked in newly emerged female adults. Among the examined tissues ovary had the highest transcript level, followed by fat body, midgut and integument, and legs. Three days after dsNlRan injection the NlRan mRNA abundance in the third-, fourth-, and fifth-instar nymphs was decreased by 94.3%, 98.4% and 97.0%, respectively. NlFTZ-F1 expression levels in treated third- and fourth-instar nymphs were reduced by 89.3% and 23.8%, respectively. In contrast, NlKr-h1 mRNA levels were up-regulated by 67.5 and 1.5 folds, respectively. NlRan knockdown significantly decreased the body weights, delayed development, and killed >85% of the nymphs at day seven. Two apparent phenotypic defects were observed: (1 Extended body form, and failed to molt; (2 The cuticle at the notum was split open but cannot completely shed off. The newly emerged female adults from dsNlRan injected fifth-instar nymphs showed lower levels of NlRan and vitellogenin, lower weight gain and honeydew excretion comparing with the blank control, and no offspring. Those results suggest that NlRan encodes a functional protein that was involved in development and reproduction. The study established proof of concept that NlRan could serve as a target for dsRNA-based pesticides for N. lugens control.

  1. Characterization of the regulatory network of BoMYB2 in controlling anthocyanin biosynthesis in purple cauliflower.

    Science.gov (United States)

    Chiu, Li-Wei; Li, Li

    2012-10-01

    Purple cauliflower (Brassica oleracea L. var. botrytis) Graffiti represents a unique mutant in conferring ectopic anthocyanin biosynthesis, which is caused by the tissue-specific activation of BoMYB2, an ortholog of Arabidopsis PAP2 or MYB113. To gain a better understanding of the regulatory network of anthocyanin biosynthesis, we investigated the interaction among cauliflower MYB-bHLH-WD40 network proteins and examined the interplay of BoMYB2 with various bHLH transcription factors in planta. Yeast two-hybrid studies revealed that cauliflower BoMYBs along with the other regulators formed the MYB-bHLH-WD40 complexes and BobHLH1 acted as a bridge between BoMYB and BoWD40-1 proteins. Different BoMYBs exhibited different binding activity to BobHLH1. Examination of the BoMYB2 transgenic lines in Arabidopsis bHLH mutant backgrounds demonstrated that TT8, EGL3, and GL3 were all involved in the BoMYB2-mediated anthocyanin biosynthesis. Expression of BoMYB2 in Arabidopsis caused up-regulation of AtTT8 and AtEGL3 as well as a subset of anthocyanin structural genes encoding flavonoid 3'-hydroxylase, dihydroflavonol 4-reductase, and leucoanthocyanidin dioxygenase. Taken together, our results show that MYB-bHLH-WD40 network transcription factors regulated the bHLH gene expression, which may represent a critical feature in the control of anthocyanin biosynthesis. BoMYB2 together with various BobHLHs specifically regulated the late anthocyanin biosynthetic pathway genes for anthocyanin biosynthesis. Our findings provide additional information for the complicated regulatory network of anthocyanin biosynthesis and the transcriptional regulation of transcription factors in vegetable crops.

  2. Facile controlled synthesis different morphologies of LuBO3:Ln3+ (Ln = Eu, Tb) phosphors and tunable luminescent properties

    International Nuclear Information System (INIS)

    Leng, Zhihua; Xiong, Hailong; Li, Linlin; Zhang, Nannan; Liu, Yali; Gan, Shucai

    2015-01-01

    Sphere-like and cauliflower-like hexagonal-vaterite LuBO 3 have been successfully synthesized for the first time via a chemical conversion route using Lu(OH)CO 3 colloid spheres as sacrificial precursor and H 3 BO 3 as boron source without any additional surfactant. FTIR analysis provides an additional evidence of the formation of vaterite-type LuBO 3 in this method. It was found that, an appropriate amount ethanol in the hydrothermal process has a great effect on the products' morphology and crystallinity. Time-dependent experiments indicate that the formation of LuBO 3 crystals went through a two-stage growth process, which involves a fast nucleation of primary particles followed by a slow aggregation and crystallization of primary particles. An investigation on the photoluminescence (PL) properties of LuBO 3 :Eu 3+ phosphors with different morphologies indicates that their PL intensity are dependent on their crystallinity. The effect of Eu 3+ and Tb 3+ doping concentration on PL intensity were also investigated and the quenching concentration of LuBO 3 :Eu 3+ and LuBO 3 :Tb 3+ is 0.25 and 0.20, respectively. Moreover, for Eu 3+ /Tb 3+ doped LuBO 3 phosphors, the color tones can be tuned from green, through green–yellow and yellow, and then to red by simply adjusting the relative doping concentrations of the Tb 3+ and Eu 3+ ions. - Highlights: • Sphere-like and cauliflower-like LuBO 3 were obtained by a conversion route. • This method used Lu(OH)CO 3 and H 3 BO 3 as the precursors for the first time. • Ethanol can control the products' morphology, crystallinity and PL intensity. • The emitting color tones vary with Tb 3+ /Eu 3+ doped concentration

  3. Ultraviolet and near-infrared luminescence of LaBO3:Ce3+,Yb3+

    Science.gov (United States)

    Wei, Heng-Wei; Shao, Li-Ming; Jiao, Huan; Jing, Xi-Ping

    2018-01-01

    Ce3+ or Yb3+ singly doped LaBO3 and Ce3+-Yb3+ co-doped LaBO3 were prepared by conventional solid state reactions at 1100 °C and their photoluminescence (PL) properties were investigated. The emission spectrum of LaBO3:Ce3+,Yb3+ contains both the Ce3+ ultraviolet (UV) emissions (355 nm and 380 nm) and the Yb3+ near infrared (NIR) emission (975 nm) when excited by the UV light at 270 nm. By using the data of the Ce3+ decay curves and the PL intensities of both Ce3+ and Yb3+, the energy transfer efficiency (η) from Ce3+ to Yb3+, the actual energy transfer efficiency (AE) and the quantum efficiency (Q) of the Yb3+ emission were calculated. In the Ce3+-Yb3+ co-doped LaBO3, Ce3+ can transfer its absorbed energy to Yb3+ efficiently (η can be over 60%), and Yb3+ shows the Q value over 50% when it accepts the energy from Ce3+, which results in the low AE value ∼30%. The energy transfer process from Ce3+ to Yb3+ may be understood by the charge transfer mechanism: Ce3+ + Yb3+ ↔ Ce4+ + Yb2+. Particularly the Ce3+-Yb3+ co-doped LaBO3 phosphor gives the emissions mainly in the UV range and the NIR range with a portion of visible emissions in eye-insensitive range. This unique property may be suitable for applications in anti-counterfeiting techniques and public security affairs.

  4. In situ SUMOylation analysis reveals a modulatory role of RanBP2 in the nuclear rim and PML bodies

    International Nuclear Information System (INIS)

    Saitoh, Noriko; Uchimura, Yasuhiro; Tachibana, Taro; Sugahara, Satoko; Saitoh, Hisato; Nakao, Mitsuyoshi

    2006-01-01

    SUMO modification plays a critical role in a number of cellular functions including nucleocytoplasmic transport, gene expression, cell cycle and formation of subnuclear structures such as promyelocytic leukemia (PML) bodies. In order to identify the sites where SUMOylation takes place in the cell, we developed an in situ SUMOylation assay using a semi-intact cell system and subsequently combined it with siRNA-based knockdown of nucleoporin RanBP2, also known as Nup358, which is one of the known SUMO E3 proteins. With the in situ SUMOylation assay, we found that both nuclear rim and PML bodies, besides mitotic apparatuses, are major targets for active SUMOylation. The ability to analyze possible SUMO conjugation sites would be a valuable tool to investigate where SUMO E3-like activities and/or SUMO substrates exist in the cell. Specific knockdown of RanBP2 completely abolished SUMOylation along the nuclear rim and dislocated RanGAP1 from the nuclear pore complexes. Interestingly, the loss of RanBP2 markedly reduced the number of PML bodies, in contrast to other, normal-appearing nuclear compartments including the nuclear lamina, nucleolus and chromatin, suggesting a novel link between RanBP2 and PML bodies. SUMOylation facilitated by RanBP2 at the nuclear rim may be a key step for the formation of a particular subnuclear organization. Our data imply that SUMO E3 proteins like RanBP2 facilitate spatio-temporal SUMOylation for certain nuclear structure and function

  5. Validation of Heat Transfer and Film Cooling Capabilities of the 3-D RANS Code TURBO

    Science.gov (United States)

    Shyam, Vikram; Ameri, Ali; Chen, Jen-Ping

    2010-01-01

    The capabilities of the 3-D unsteady RANS code TURBO have been extended to include heat transfer and film cooling applications. The results of simulations performed with the modified code are compared to experiment and to theory, where applicable. Wilcox s k-turbulence model has been implemented to close the RANS equations. Two simulations are conducted: (1) flow over a flat plate and (2) flow over an adiabatic flat plate cooled by one hole inclined at 35 to the free stream. For (1) agreement with theory is found to be excellent for heat transfer, represented by local Nusselt number, and quite good for momentum, as represented by the local skin friction coefficient. This report compares the local skin friction coefficients and Nusselt numbers on a flat plate obtained using Wilcox's k-model with the theory of Blasius. The study looks at laminar and turbulent flows over an adiabatic flat plate and over an isothermal flat plate for two different wall temperatures. It is shown that TURBO is able to accurately predict heat transfer on a flat plate. For (2) TURBO shows good qualitative agreement with film cooling experiments performed on a flat plate with one cooling hole. Quantitatively, film effectiveness is under predicted downstream of the hole.

  6. Comparisons of LES and RANS Computations with PIV Experiments on a Cylindrical Cavity Flow

    Directory of Open Access Journals (Sweden)

    Wen-Tao Su

    2013-01-01

    Full Text Available A comparison study on the numerical computations by large eddy simulation (LES and Reynolds-averaged Navier-Stokes (RANS methods with experiment on a cylindrical cavity flow was conducted in this paper. Numerical simulations and particle image velocimetry (PIV measurement were performed for two Reynolds numbers of the flow at a constant aspect ratio of H/R = 2.4 (R is the radius of the cylindrical cavity, and H is liquid level. The three components of velocity were extracted from 100 sequential PIV measured velocity frames with averaging, in order to illustrate the axial jet flow evolution and circulation distribution in the radial direction. The results show that LES can reproduce well the fine structure inside the swirling motions in both the meridional and the horizontal planes, as well as the distributions of velocity components and the circulation, in good agreement with experimental results, while the RANS method only provided a rough trend of inside vortex structure. Based on the analysis of velocity profiles at various locations, it indicates that LES is more suitable for predicting the complex flow characteristics inside complicated three-dimensional geometries.

  7. Spalart–Allmaras model apparent transition and RANS simulations of laminar separation bubbles on airfoils

    International Nuclear Information System (INIS)

    Crivellini, Andrea; D’Alessandro, Valerio

    2014-01-01

    Highlights: • RANS simulation of laminar separation bubbles. • Spalart–Allamaras unexpected capability. • Straightforward implementation of our SA modifications. • Applications of a high order DG incompressible solver. - Abstract: The present paper deals with the Reynolds Averaged Navier–Stokes (RANS) simulation of Laminar Separation Bubble (LSB). This phenomenon is of large interest in several engineering fields, such as the study of wind turbines, unmanned aerial vehicles (UAV) and micro-air vehicles (MAV) characterized by a low operating Reynolds number. In such contexts a laminar boundary layer separation followed by a turbulent transition and afterwards by a turbulent reattachment may appear in the flow-field. The main novelty of this work is that an almost standard Spalart–Allmaras (SA) model, without additional equations for transition modeling, was successfully employed. The result achieved is very surprising being the model not developed for this purpose, but for fully-turbulent flows or for cases with imposed transition location. This result is of large interest, since the SA model is widely used in commercial, open-source and research codes. However, our approach cannot be advocated to predict natural transition within an attached boundary layer, indeed it is only able to deal with transitions triggered by a separated flow. The reliability and accuracy of our approach are here proved computing, by means of a high-order Discontinuous Galerkin (DG) incompressible solver, the flow-field over two airfoils at different flow regimes showing the formation of a LSB

  8. Application of a New Hybrid RANS/LES Modeling Paradigm to Compressible Flow

    Science.gov (United States)

    Oliver, Todd; Pederson, Clark; Haering, Sigfried; Moser, Robert

    2017-11-01

    It is well-known that traditional hybrid RANS/LES modeling approaches suffer from a number of deficiencies. These deficiencies often stem from overly simplistic blending strategies based on scalar measures of turbulence length scale and grid resolution and from use of isotropic subgrid models in LES regions. A recently developed hybrid modeling approach has shown promise in overcoming these deficiencies in incompressible flows [Haering, 2015]. In the approach, RANS/LES blending is accomplished using a hybridization parameter that is governed by an additional model transport equation and is driven to achieve equilibrium between the resolved and unresolved turbulence for the given grid. Further, the model uses an tensor eddy viscosity that is formulated to represent the effects of anisotropic grid resolution on subgrid quantities. In this work, this modeling approach is extended to compressible flows and implemented in the compressible flow solver SU2 (http://su2.stanford.edu/). We discuss both modeling and implementation challenges and show preliminary results for compressible flow test cases with smooth wall separation.

  9. Turbulence-induced heat transfer in PBMR core using LES and RANS

    International Nuclear Information System (INIS)

    Lee, Jung-Jae; Yoon, Su-Jong; Park, Goon-Cherl; Lee, Won-Jae

    2007-01-01

    This paper introduces the results of numerical simulations on flow fields and relevant heat transfer in the pebble bed reactor (PBR) core, since the coolant passes a highly complicated random flow path with a high Reynolds number, an appropriate treatment of the turbulence is required. A set of simple experiments for the flow over a circular cylinder with heat transfer was conducted to finally select the large eddy simulation (LES) and k-ω model among the considering Reynolds-averaged Navier-Stokes (RANS) models for PBR application. Using these models, the PBR cores, whose geometries were simplified to the body-centered cubical (BCC) and face-centered cubical (FCC) structures, were simulated. A larger pressure drop, a more random flow field, a higher vorticity magnitude and a higher temperature at the local hot spots on the pebble surface were found in the results of the LES than in those of RANS for both geometries. In cases of the LES, the flow structures were resolved up to the grid scales. Irregular distributions of the flow and local heat transfer were found in the BCC core, while relatively regular distributions for the FCC core. The turbulent nature of the coolant flow in the pebble core evidently affected the fuel surface temperature distribution. (author)

  10. Development of a Hybrid RANS/LES Method for Turbulent Mixing Layers

    Science.gov (United States)

    Georgiadis, Nicholas J.; Alexander, J. Iwan D.; Reshotko, Eli

    2001-01-01

    Significant research has been underway for several years in NASA Glenn Research Center's nozzle branch to develop advanced computational methods for simulating turbulent flows in exhaust nozzles. The primary efforts of this research have concentrated on improving our ability to calculate the turbulent mixing layers that dominate flows both in the exhaust systems of modern-day aircraft and in those of hypersonic vehicles under development. As part of these efforts, a hybrid numerical method was recently developed to simulate such turbulent mixing layers. The method developed here is intended for configurations in which a dominant structural feature provides an unsteady mechanism to drive the turbulent development in the mixing layer. Interest in Large Eddy Simulation (LES) methods have increased in recent years, but applying an LES method to calculate the wide range of turbulent scales from small eddies in the wall-bounded regions to large eddies in the mixing region is not yet possible with current computers. As a result, the hybrid method developed here uses a Reynolds-averaged Navier-Stokes (RANS) procedure to calculate wall-bounded regions entering a mixing section and uses a LES procedure to calculate the mixing-dominated regions. A numerical technique was developed to enable the use of the hybrid RANS-LES method on stretched, non-Cartesian grids. With this technique, closure for the RANS equations is obtained by using the Cebeci-Smith algebraic turbulence model in conjunction with the wall-function approach of Ota and Goldberg. The LES equations are closed using the Smagorinsky subgrid scale model. Although the function of the Cebeci-Smith model to replace all of the turbulent stresses is quite different from that of the Smagorinsky subgrid model, which only replaces the small subgrid turbulent stresses, both are eddy viscosity models and both are derived at least in part from mixing-length theory. The similar formulation of these two models enables the RANS

  11. A triple gene mutant of BoHV-1 administered intranasally in lambs replicates efficiently in the nasal epithelium and induces neutralizing antibody

    Science.gov (United States)

    Bovine herpes virus 1 (BoHV-1) causes respiratory infections and abortions in cattle, and is an important component of Bovine respiratory disease complex (BRDC). BoHV-1 has also been isolated from sheep with respiratory disorder. Experimentally, sheep and goats are infected productively with BoHV-1...

  12. Bo Xilai :China will honor its World Trade Organization(WTO) commitments. Banking and telecommunications market sectors would be opened in time

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ Minister of Commerce Bo Xilai promised on September 4 that China will honor its WTO commitments. At a ceremony to mark China's five-year WTO partnership, Bo Xilai promised this to commercial leaders of Europe present again. Bo said all market sectors would be opened in time, referring especially to banking and telecommunications.

  13. β-Y(BO{sub 2}){sub 3}. A new member of the β-Ln(BO{sub 2}){sub 3} (Ln = Nd, Sm, Gd-Lu) structure family

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, Martin K.; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie

    2017-07-01

    β-Y(BO{sub 2}){sub 3} was synthesized in a Walker-type multianvil module at 5.9 GPa/1000 C. The crystal structure has been elucidated through single-crystal X-ray diffraction. β-Y(BO{sub 2}){sub 3} crystallizes in the orthorhombic space group Pnma (no. 62) with the lattice parameters a = 15.886(2), b = 7.3860(6), and c = 12.2119(9) Aa. Its crystal structure will be discussed in the context of the isotypic lanthanide borates β-Ln(BO{sub 2}){sub 3} (Ln = Nd, Sm, Gd-Lu).

  14. Ran GTPase-activating protein 1 is a therapeutic target in diffuse large B-cell lymphoma.

    Directory of Open Access Journals (Sweden)

    Kung-Chao Chang

    Full Text Available Lymphoma-specific biomarkers contribute to therapeutic strategies and the study of tumorigenesis. Diffuse large B-cell lymphoma (DLBCL is the most common type of malignant lymphoma. However, only 50% of patients experience long-term survival after current treatment; therefore, developing novel therapeutic strategies is warranted. Comparative proteomic analysis of two DLBCL lines with a B-lymphoblastoid cell line (LCL showed differential expression of Ran GTPase-activating protein 1 (RanGAP1 between them, which was confirmed using immunoblotting. Immunostaining showed that the majority of DLBCLs (92%, 46/50 were RanGAP1(+, while reactive lymphoid hyperplasia (n = 12 was RanGAP1(+ predominantly in germinal centers. RanGAP1 was also highly expressed in other B-cell lymphomas (BCL, n = 180 with brisk mitotic activity (B-lymphoblastic lymphoma/leukemia: 93%, and Burkitt lymphoma: 95% or cell-cycle dysregulation (mantle cell lymphoma: 83%, and Hodgkin's lymphoma 91%. Interestingly, serum RanGAP1 level was higher in patients with high-grade BCL (1.71 ± 2.28 ng/mL, n = 62 than in low-grade BCL (0.75 ± 2.12 ng/mL, n = 52 and healthy controls (0.55 ± 1.58 ng/mL, n = 75 (high-grade BCL vs. low-grade BCL, p = 0.002; high-grade BCL vs. control, p < 0.001, Mann-Whitney U test. In vitro, RNA interference of RanGAP1 showed no effect on LCL but enhanced DLBCL cell death (41% vs. 60%; p = 0.035 and cell-cycle arrest (G0/G1: 39% vs. 49%, G2/M: 19.0% vs. 7.5%; p = 0.030 along with decreased expression of TPX2 and Aurora kinases, the central regulators of mitotic cell division. Furthermore, ON 01910.Na (Estybon, a multikinase inhibitor induced cell death, mitotic cell arrest, and hyperphosphorylation of RanGAP1 in DLBCL cell lines but no effects in normal B and T cells. Therefore, RanGAP1 is a promising marker and therapeutic target for aggressive B-cell lymphoma, especially DLBCL.

  15. Pressure-induced phase transitions in acentric BaHf(BO{sub 3}){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Mączka, Mirosław, E-mail: m.maczka@int.pan.wroc.pl [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Szymborska-Małek, Katarzyna [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Sousa Pinheiro, Gardenia de [Departamento de Física, Universidade Federal do Piauí, Teresina, PI 64049-550 (Brazil); Cavalcante Freire, Paulo Tarso [Departamento de Fisica, Universidade Federal do Ceara, Fortaleza CE-60455-970 (Brazil); Majchrowski, Andrzej [Institute of Applied Physics, Military University of Technology, 2 Kaliskiego Street, 00-908 Warszawa (Poland)

    2015-08-15

    High-pressure Raman scattering studies revealed that BaHf(BO{sub 3}){sub 2} is more compressible than calcite-type orthoborates and calcite, aragonite or dolomite carbonates. It undergoes a first-order reversible pressure-induced phase transition in the 3.9–4.4 GPa pressure range. Second structural change is observed at 9.2 GPa. The intermediate phase is most likely trigonal. However, Raman results suggest increase in the number of distinct BO{sub 3} groups from two in the ambient pressure phase to at least three in the intermediate phase. This intermediate phase is also strongly compressible and strong pressure dependence of the lattice modes proves that the main changes under pressure occur within the layers built from BaO{sub 6} and HfO{sub 6} octahedra. The second phase transition leads most likely to lowering of the trigonal symmetry, as evidenced by significant increase of the number of observed bands. The pressure coefficients of the Raman bands of the high-pressure phase are relatively small, suggesting more dense arrangement of the metal–oxygen polyhedra and BO{sub 3} groups in this phase. It is worth noting that the high-pressure phase was not reached in the second compression experiment up to 10 GPa. This behavior can be most likely attributed to worse hydrostatic conditions of the first experiment. - Graphical abstract: Raman spectra of BaHf(BO{sub 3}){sub 2} recorded at different pressures during compression showing onset of pressure-induced phase transitions. - Highlights: • High-pressure Raman spectra were measured for BaHf(BO{sub 3}){sub 2.} • BaHf(BO{sub 3}){sub 2} undergoes a reversible first-order phase transition at 3.9–4.4 GPa into a trigonal phase. • The intermediate trigonal phase is strongly compressible second structural transformation is observed at 9.2 GPa under non-perfect hydrostatic conditions.

  16. BoALMT1, an Al-Induced Malate Transporter in Cabbage, Enhances Aluminum Tolerance in Arabidopsis thaliana

    OpenAIRE

    Zhang, Lei; Wu, Xin-Xin; Wang, Jinfang; Qi, Chuandong; Wang, Xiaoyun; Wang, Gongle; Li, Mingyue; Li, Xingsheng; Guo, Yang-Dong

    2018-01-01

    Aluminum (Al) is present in approximately 50% of the arable land worldwide and is regarded as the main limiting factor of crop yield on acidic soil. Al-induced root malate efflux plays an important role in the Al tolerance of plants. Here, the aluminum induced malate transporter BoALMT1 (KF322104) was cloned from cabbage (Brassica oleracea). BoALMT1 showed higher expression in roots than in shoots. The expression of BoALMT1 was specifically induced by Al treatment, but not the trivalent catio...

  17. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Science.gov (United States)

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  18. ECN's torrefaction-based BO2-technology. From pilot to demo

    Energy Technology Data Exchange (ETDEWEB)

    Kiel, J.H.A. [ECN Biomass, Coal and Environmental Research, Petten (Netherlands)

    2011-02-15

    The contents of this PowerPoint presentation are: Torrefaction design challenges; Initial small-scale R and D; ECN's torrefaction-based BO2-technology; Pilot-scale testing; and Demonstration and market introduction. The conclusions state that Torrefaction potentially allows cost-effective production of 2nd generation biomass pellets from a wide range of biomass/waste feedstock with a high energy efficiency (>90%); Torrefaction pellets show: High energy density, Water resistance, No/Limited biological degradation and heating, Excellent grindability, and Good combustion and gasification properties; Torrefaction is a separate thermal regime and requires dedicated reactor/process design; Torrefaction development is in pilot/demo-phase and shows strong market pull for torrefaction plants and torrefaction pellets; For ECN's BO2-technology a demo-plant is in preparation and industrial partnership for world-wide market introduction is nearly established.

  19. [Bovine herpesvirus 4 (BoHV-4): general aspects of the biology and status in Argentina].

    Science.gov (United States)

    Morán, Pedro E; Pérez, Sandra E; Odeón, Anselmo C; Verna, Andrea E

    2015-01-01

    Bovine herpesvirus 4 (BoHV-4) has been isolated from cattle with respiratory infections, vulvovaginitis, mastitis, abortions, endometritis and from apparently healthy animals throughout the world. Although it has not yet been established as causal agent of a specific disease entity, it is primarily associated with reproductive disorders of cattle. This virus can infect a wide range of species, either in vivo or in vitro. Two groups of prototype strains were originated from the first isolates: the DN599-type strains (American group) and the Movar-type strains (European group). In Argentina, BoHV-4 was isolated and characterized in 2007 from vaginal discharge samples taken from cows that had aborted. So far, more than 40 isolates, mainly associated with aborting bovine females have been registered in our country. Copyright © 2014 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  20. Modulated magnetic structure of an inhomogeneous stressed single crystal FeBO3

    International Nuclear Information System (INIS)

    Sharipiv, M.Z.; Dzhuraev, D.R.; Sokolov, B.Yu.; Kurbanov, M.

    2010-01-01

    With the help of low-symmetry mechanical stresses, we induced an additional spatially inhomogeneous anisotropy in the basal plane of a single crystal FeBO 3 . By the magnetooptical method, we study the effect of an inhomogeneous magnetic anisotropy on the magnetic state of this easy-plane weak ferromagnetic. It is established that, at the magnetization of inhomogeneously stressed FeBO 3 in the basal plane near some separated direction, the crystal transits from the homogeneous state into a spatially modulated magnetic state. The latter can be represented in the form of a static spin wave, in which a local vector of ferromagnetism oscillates near the direction of the mean magnetization of a crystal, by remaining in the basal plane.

  1. Non collinear magnetic phase of the inhomogeneously stressed FeBO3 monocrystals

    International Nuclear Information System (INIS)

    Sharipov, M.Z.

    2011-01-01

    With the help of low-symmetry mechanical stresses, an additional spatially inhomogeneous anisotropy in the basal plane of a single crystal FeBO 3 has been induced. By the magnetooptical method, an effect of the inhomogeneous magnetic anisotropy on the magnetic state of this easy-plane weak ferromagnetic has been investigated. It is established that at the magnetization of inhomogeneously stressed FeBO 3 in the basal plane near the separated direction, the crystal turns from the homogeneous state into a spatially modulated magnetic state. The latter can be represented in the form of a static spin wave, in which a local vector of ferromagnetism oscillates near the direction of the mean magnetization of a crystal, remaining in the basal plane. (authors)

  2. Isolation of pathogenic Yersinia enterocolitica 1B/O:8 from Apodemus mice in Japan.

    Science.gov (United States)

    Oda, Shinya; Kabeya, Hidenori; Sato, Shingo; Shimonagane, Ai; Inoue, Kai; Hayashidani, Hideki; Takada, Nobuhiro; Fujita, Hiromi; Kawabata, Hiroki; Maruyama, Soichi

    2015-01-01

    Yersinia enterocolitica was isolated from 15.7% (88/560) of wild rodents captured in 15 prefectures in Japan. Prevalences by rodent species were 18.0% (70/388) in Japanese field mice (Apodemus speciosus), 20% (14/71) in small Japanese field mice (Apodemus argenteus), and 11% (4/38) in gray red-backed vole (Myodes rufocanus bedfordiae), suggesting that these rodent species are important reservoirs of Y. enterocolitica. Although most of the isolates were identified as biotype 1A, the pathogenic bioserotype 1B/O:8 was detected in one of the A. speciosus and in three of the A. argenteus captured in Aomori Prefecture. It is suggested that Apodemus mice may be an important reservoir of Y. enterocolitica, and that there are foci of the pathogenic bioserotype 1B/O:8 in Aomori Prefecture, because human sporadic cases by the serotype have been reported in this prefecture.

  3. Synthesis and photoluminescence of Sm3+ doped alkali alkaline earth borate hosts NaBa4 (BO3)3 and LiSr4(BO3)3

    International Nuclear Information System (INIS)

    Chauhan, A.V.; Nagpure, P.A.; Omanwar, S.K.

    2012-01-01

    In this paper we report the photoluminescence of Sm 3+ doped alkali alkaline borate hosts NaBa 4 (BO 3 ) 3 and LiSr 4 (BO 3 ) 3 . For the synthesis of alkali alkaline borate hosts NaBa 4 (BO 3 ) 3 and LiSr 4 (BO 3 ) 3 doped with different concentrations of Sm 3+ ions, we used the novel combustion technique. The phase purity of the hosts was confirmed by the powder XRD technique. The photoluminescence of the phosphors were carried out within 300 to 700 nm wavelength range. The phosphor shows intense orange red (602 nm) emission for near UV excitation. The FTIR spectra of the phase pure hosts have also been reported. (author)

  4. 3D Scrape-off layer modelling with BoRiS

    International Nuclear Information System (INIS)

    Riemann, J.; Borchardt, M.; Schneider, R.; Mutzke, A.

    2005-01-01

    The 3D fluid transport code BoRiS is applied to a hydrogen plasma and a neutral fluid in a stellarator-like geometry equipped with a poloidal ring limiter. The results demonstrate the capability of dealing with 3D effects which can be related to both the influence of the geometry and the plasma-neutral interaction as well. The setup used has similarities with a poloidal gas target in a fusion device

  5. Giorgio Agamben's inclusive exclusion of Étienne De la Boétie

    DEFF Research Database (Denmark)

    Flohr, Mikkel

    2017-01-01

    This paper analyzes the significance of Étienne de La Boétie’s appearance and subsequent disappearance in the introduction to Giorgio Agamben’s Homo Sacer: Sovereign Power and Bare Life. The introduction to the first installment of the Homo Sacer-series is a significant document, which establishes...... of Agamben’s political thought to be that of the sovereign exception....

  6. Small-molecule quinolinol inhibitor identified provides protection against BoNT/A in mice.

    Directory of Open Access Journals (Sweden)

    Padma Singh

    Full Text Available Botulinum neurotoxins (BoNTs, etiological agents of the life threatening neuroparalytic disease botulism, are the most toxic substances currently known. The potential for the use as bioweapon makes the development of small-molecule inhibitor against these deadly toxins is a top priority. Currently, there are no approved pharmacological treatments for BoNT intoxication. Although an effective vaccine/immunotherapy is available for immuno-prophylaxis but this cannot reverse the effects of toxin inside neurons. A small-molecule pharmacological intervention, especially one that would be effective against the light chain protease, would be highly desirable. Similarity search was carried out from ChemBridge and NSC libraries to the hit (7-(phenyl(8-quinolinylaminomethyl-8-quinolinol; NSC 84096 to mine its analogs. Several hits obtained were screened for in silico inhibition using AutoDock 4.1 and 19 new molecules selected based on binding energy and Ki. Among these, eleven quinolinol derivatives potently inhibited in vitro endopeptidase activity of botulinum neurotoxin type A light chain (rBoNT/A-LC on synaptosomes isolated from rat brain which simulate the in vivo system. Five of these inhibitor molecules exhibited IC(50 values ranging from 3.0 nM to 10.0 µM. NSC 84087 is the most potent inhibitor reported so far, found to be a promising lead for therapeutic development, as it exhibits no toxicity, and is able to protect animals from pre and post challenge of botulinum neurotoxin type A (BoNT/A.

  7. Polimorfisme Genetik DNA Mikrosatellite GEN BoLA Lokus DRB3 Pada Sapi Bali (Bos Indicus)

    OpenAIRE

    Puja , I Ketut; Wandia, I Nengah; Suastika, Putu; Sulabda, I Nyoman

    2011-01-01

    Tujuan penelitian ini adalah untuk mendapatkan informasi dasar mengenai distribusi frekuensi lokus DRB3 gen BoLa (bovine lymphocyte antigen) pada sapi Bali. Untuk isolasi DNA digunakan sampel darah sapi Bali yang diambil dari populasi sapi Bali yang berasal dari Bali dan sapi Bali yang berasal dari Nusa Penida. Jumlah sampel untuk sapi Bali yang berasal dari Bali adalah 22 ekor dan sapi yang berasal dari Nusa Penida 21 ekor. Jumlah allel lokus DRB3 pada sapi...

  8. Moessbauer diffraction study of the Neel phase transition in Fe3BO6 crystal

    International Nuclear Information System (INIS)

    Kovalenko, P.P.; Labushkin, V.G.; Sarkisov, Eh.R.; Tolpekin, I.G.

    1987-01-01

    Phase transitions in a 57 Fe 3 BO 6 monocrystal in the vicinity of the Neel point, T N =507.5 K were investigated by means of the Moessbauergraphy. For the first time the relaxation type of Moessbauer spectra was observed near the phase transition point. First in the Moessbauer diffraction spectrum of the crystal the simultaneous presence of a component resulted from magnetic ordering and a paramagnetic component was observed

  9. Magnetic and dielectric properties of Fe3BO6 nanoplates prepared through self-combustion method

    Directory of Open Access Journals (Sweden)

    Kalpana Kumari

    2017-12-01

    Full Text Available In the present investigation, a facile synthesis method is explored involving a self-combustion of a solid precursor mixture of iron oxide Fe2O3 and boric acid (H3BO3 using camphor (C10H16O as fuel in ambient air in order to form a single phase Fe3BO6 crystallites. X-ray diffraction (XRD, Field emission electron microscopy (FESEM, magnetic, and dielectric properties of as prepared sample are studied. From XRD pattern, a single phase compound is observed with an orthorhombic crystal structure (Pnma space group, with average crystallite size of 42nm. A reasonably uniform size distribution of the plates and self-assemblies is retained in the sample. A magnetic transition is observed in dielectric permittivity (at ∼445K and power loss (at ∼435K when plotted against temperature. A weak peak occurs near 330K due to the charge reordering in the sample. For temperatures above the transition temperature, a sharp increase of the dielectric loss is observed which occurs due to the presence of thermally activated charge carriers. A canted antiferromagnetic Fe3+ ordering in a Fe3BO6 lattice with a localized charge surface layer is an apparent source of exhibiting a ferroelectric feature in this unique example of a centrosymmetric compound. An induced spin current over the Fe sites thus could give rise to a polarization hysteresis loop. Due to the presence of both ferromagnetic as well as polarization ordering, Fe3BO6 behaves like a single phase multiferroic ceramics.

  10. The diffusion of cultural heritage through ICT: the case of the Boí valley portal

    Directory of Open Access Journals (Sweden)

    Piero Berni Millet

    2003-04-01

    Full Text Available The Boí valley portal is a joint project involving different museums, institutions and universities in Catalonia with the aim of creating a virtual environment to include all of the cultural heritage of this small valley in the Pyrenees. The portal is not only a potential resource for cultural tourism, but also an art and history resource for secondary schools and universities, as well as a means of communication for the local community.

  11. Seasonality of Yersinia enterocolitica bioserotype 1B/O:8 infections in Poland.

    Science.gov (United States)

    Rastawicki, W; Szych, J; Rokosz, N; Zacharczuk, K; Gierczyński, R

    2013-10-01

    Both serological and bacteriological investigations revealed a cyclic, seasonal pattern of Yersinia enterocolitica 1B/O8 infections in Poland during the years 2008–2011. A large increase in incidence was observed in the second quarter and a decrease in the third quarter of each year. Such seasonal changes were not seen in the case of infections caused by the other enteropathogenic Yersinia bioserotypes.

  12. GTPase Ran strongly accumulates at the kinetochores of somatic chromosomes in the spermatogonial mitoses of Acricotopus lucidus (Diptera, Chironomidae).

    Science.gov (United States)

    Staiber, Wolfgang

    2014-07-01

    Unequal chromosome segregation and spindle formation occurs in the last gonial mitosis in the germ line of the chironomid Acricotopus lucidus. During this differential mitosis, all germ line-limited chromosomes (=Ks) migrate undivided to only one pole of the cell, while the somatic chromosomes (=Ss) first remain in the metaphase plane, and with the arrival of the Ks at the pole, they then separate equally. The evolutionarily conserved GTPase Ran plays a crucial role in many cellular processes. This includes the regulation of microtubule nucleation and stabilisation at kinetochores and of spindle assembly during mitosis, which is promoted by a RanGTP concentration gradient that forms around the mitotic chromosomes (Kalab et al. in Science 295:2452-2456, 2002, Nature 440:697-701, 2006). In the present study, a strong accumulation of Ran was detected by immunofluorescence at the kinetochores of the Ss in normal gonial and differential gonial mitoses of males of A. lucidus. In contrast, no Ran accumulation was observed at the kinetochores of the Ss in the metaphases of brain ganglia mitoses or of aberrant spermatocytes or in metaphases I and II of spermatocyte meiotic divisions. Likewise, there was no accumulation at the kinetochores of Drosophila melanogaster mitotic chromosomes from larval brains. The specific accumulation of Ran at the kinetochores of the Ss in differential gonial mitoses of A. lucidus strongly suggests that Ran is involved in a mechanism acting in this exceptional mitosis, which retains the Ss at the metaphase plane and prevents a premature separation and unequal segregation of the Ss during monopolar migration of the Ks.

  13. Synchronization challenges in packet-based Cloud-RAN fronthaul for mobile networks

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Juul, Anders Christian; Christiansen, Henrik Lehrmann

    2015-01-01

    In this paper, we look at reusing existing packet-based network (e.g. Ethernet) to possibly decrease deployment costs of fronthaul Cloud Radio Access Network (C-RAN) network and cost of Baseband Unit (BBU) resources. The challenge of this solution is that it requires mobile traffic (until now...... transmitted over synchronous protocols) to traverse the asynchronous Ethernet without losing synchronization. We analyze synchronization requirements of mobile networks and present an overview of solutions that fulfill them in traditional mobile networks. Then we elaborate on challenges that packet-based...... fronthaul imposes. We analyze possible contributions to frequency and phase error. We verify the feasibility of using the IEEE 1588v2 also know as Precision Time Protocol (PTP) for providing accurate phase and frequency synchronization. The study is based on simulations made in OPNET modeler. Thereby we...

  14. Investigation on the wake evolution of contra-rotating propeller using RANS computation and SPIV measurement

    Directory of Open Access Journals (Sweden)

    Kwang-Jun Paik

    2015-05-01

    Full Text Available The wake characteristics of Contra-Rotating Propeller (CRP were investigated using numerical simulation and flow measurement. The numerical simulation was carried out with a commercial CFD code based on a Reynolds Averaged Navier-Stokes (RANS equations solver, and the flow measurement was performed with Stereoscopic Particle Image Velocimetry (SPIV system. The simulation results were validated through the comparison with the experiment results measured around the leading edge of rudder to investigate the effect of propeller operation under the conditions without propeller, with forward propeller alone, and with both forward and aft propellers. The evolution of CRP wake was analyzed through velocity and vorticity contours on three transverse planes and one longitudinal plane based on CFD results. The trajectories of propeller tip vortex core in the cases with and without aft propeller were also compared, and larger wake contraction with CRP was confirmed.

  15. RANS modeling of scalar dispersion from localized sources within a simplified urban-area model

    Science.gov (United States)

    Rossi, Riccardo; Capra, Stefano; Iaccarino, Gianluca

    2011-11-01

    The dispersion of a passive scalar downstream a localized source within a simplified urban-like geometry is examined by means of RANS scalar flux models. The computations are conducted under conditions of neutral stability and for three different incoming wind directions (0°, 45°, 90°) at a roughness Reynolds number of Ret = 391. A Reynolds stress transport model is used to close the flow governing equations whereas both the standard eddy-diffusivity closure and algebraic flux models are employed to close the transport equation for the passive scalar. The comparison with a DNS database shows improved reliability from algebraic scalar flux models towards predicting both the mean concentration and the plume structure. Since algebraic flux models do not increase substantially the computational effort, the results indicate that the use of tensorial-diffusivity can be promising tool for dispersion simulations for the urban environment.

  16. A Synthesis of Hybrid RANS/LES CFD Results for F-16XL Aircraft Aerodynamics

    Science.gov (United States)

    Luckring, James M.; Park, Michael A.; Hitzel, Stephan M.; Jirasek, Adam; Lofthouse, Andrew J.; Morton, Scott A.; McDaniel, David R.; Rizzi, Arthur M.

    2015-01-01

    A synthesis is presented of recent numerical predictions for the F-16XL aircraft flow fields and aerodynamics. The computational results were all performed with hybrid RANS/LES formulations, with an emphasis on unsteady flows and subsequent aerodynamics, and results from five computational methods are included. The work was focused on one particular low-speed, high angle-of-attack flight test condition, and comparisons against flight-test data are included. This work represents the third coordinated effort using the F-16XL aircraft, and a unique flight-test data set, to advance our knowledge of slender airframe aerodynamics as well as our capability for predicting these aerodynamics with advanced CFD formulations. The prior efforts were identified as Cranked Arrow Wing Aerodynamics Project International, with the acronyms CAWAPI and CAWAPI-2. All information in this paper is in the public domain.

  17. Flow field analysis of a pentagonal-shaped bridge deck by unsteady RANS

    Directory of Open Access Journals (Sweden)

    Md. Naimul Haque

    2016-01-01

    Full Text Available Long-span cable-stayed bridges are susceptible to dynamic wind effects due to their inherent flexibility. The fluid flow around the bridge deck should be well understood for the efficient design of an aerodynamically stable long-span bridge system. In this work, the aerodynamic features of a pentagonal-shaped bridge deck are explored numerically. The analytical results are compared with past experimental work to assess the capability of two-dimensional unsteady RANS simulation for predicting the aerodynamic features of this type of deck. The influence of the bottom plate slope on aerodynamic response and flow features was investigated. By varying the Reynolds number (2 × 104 to 20 × 104 the aerodynamic behavior at high wind speeds is clarified.

  18. Steady state RANS simulations of temperature fluctuations in single phase turbulent mixing

    International Nuclear Information System (INIS)

    Kickhofel, J.; Fokken, J.; Kapulla, R.; Prasser, H. M.

    2012-01-01

    Single phase turbulent mixing in nuclear power plant circuits where a strong temperature gradient is present is known to precipitate pipe failure due to thermal fatigue. Experiments in a square mixing channel offer the opportunity to study the phenomenon under simple and easily reproducible boundary conditions. Measurements of this kind have been performed extensively at the Paul Scherrer Inst. in Switzerland with a high density of instrumentation in the Generic Mixing Experiment (GEMIX). As a fundamental mixing phenomena study closely related to the thermal fatigue problem, the experimental results from GEMIX are valuable for the validation of CFD codes striving to accurately simulate both the temperature and velocity fields in single phase turbulent mixing. In the experiments two iso-kinetic streams meet at a shallow angle of 3 degrees and mix in a straight channel of square cross-section under various degrees of density, temperature, and viscosity stratification over a range of Reynolds numbers ranging from 5*10 3 to 1*10 5 . Conductivity measurements, using wire-mesh and wall sensors, as well as optical measurements, using particle image velocimetry, were conducted with high temporal and spatial resolutions (up to 2.5 kHz and 1 mm in the case of the wire mesh sensor) in the mixing zone, downstream of a splitter plate. The present paper communicates the results of RANS modeling of selected GEMIX tests. Steady-state CFD calculations using a RANS turbulence model represent an inexpensive method for analyzing large and complex components in commercial nuclear reactors, such as the downcomer and reactor pressure vessel heads. Crucial to real world applicability, however, is the ability to model turbulent heat fluctuations in the flow; the Turbulent Heat Flux Transport model developed by ANSYS CFX is capable, by implementation of a transport equation for turbulent heat fluxes, of readily modeling these values. Furthermore, the closure of the turbulent heat flux

  19. RANS simulation of cavitation and hull pressure fluctuation for marine propeller operating behind-hull condition

    Science.gov (United States)

    Paik, Kwang-Jun; Park, Hyung-Gil; Seo, Jongsoo

    2013-12-01

    Simulations of cavitation flow and hull pressure fluctuation for a marine propeller operating behind a hull using the unsteady Reynolds-Averaged Navier-Stokes equations (RANS) are presented. A full hull body submerged under the free surface is modeled in the computational domain to simulate directly the wake field of the ship at the propeller plane. Simulations are performed in design and ballast draught conditions to study the effect of cavitation number. And two propellers with slightly different geometry are simulated to validate the detectability of the numerical simulation. All simulations are performed using a commercial CFD software FLUENT. Cavitation patterns of the simulations show good agreement with the experimental results carried out in Samsung CAvitation Tunnel (SCAT). The simulation results for the hull pressure fluctuation induced by a propeller are also compared with the experimental results showing good agreement in the tendency and amplitude, especially, for the first blade frequency.

  20. RANS simulation of cavitation and hull pressure fluctuation for marine propeller operating behind-hull condition

    Directory of Open Access Journals (Sweden)

    Kwang-Jun Paik

    2013-12-01

    Full Text Available Simulations of cavitation flow and hull pressure fluctuation for a marine propeller operating behind a hull using the unsteady Reynolds-Averaged Navier-Stokes equations (RANS are presented. A full hull body submerged under the free surface is modeled in the computational domain to simulate directly the wake field of the ship at the propeller plane. Simulations are performed in design and ballast draught conditions to study the effect of cavitation number. And two propellers with slightly different geometry are simulated to validate the detectability of the numerical simulation. All simulations are performed using a commercial CFD software FLUENT. Cavitation patterns of the simulations show good agreement with the experimental results carried out in Samsung CAvitation Tunnel (SCAT. The simulation results for the hull pressure fluctuation induced by a propeller are also compared with the experimental results showing good agreement in the tendency and amplitude, especially, for the first blade frequency.

  1. Optimizing small cell deployment by the use of C-RANs

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Holm, Henrik Laumand; Christiansen, Henrik Lehrmann

    2014-01-01

    A Cloud Radio Access Network (C-RAN) is a novel mobile network architecture that has the potential to support extremely dense mobile network deployments enhancing the network capacity while offering cost savings on baseband resources. In this work we analyze cell traffic profiles and evaluate...... the conditions that impact the statistical multiplexing gain in the Baseband Unit (BBU) Pool. We conclude on the set of parameters that maximize the statistical multiplexing gain, leading to the highest potential cost savings. We then propose a packet based architecture that can adapt to changing traffic...... conditions. Furthermore, based on theoretical calculations and Network simulations we present considerations on deployment scenarios to optimize green field deployments in terms of Total Cost of Ownership (TCO). This involves optimizing the mix of cells with different traffic profiles and the BBU Pool...

  2. Crystal structure of a new polar borate Na{sub 2}Ce{sub 2}[BO{sub 2}(OH)][BO{sub 3}]{sub 2} · H{sub 2}O with isolated boron triangles

    Energy Technology Data Exchange (ETDEWEB)

    Topnikova, A. P.; Belokoneva, E. L., E-mail: elbel@geol.msu.ru; Dimitrova, O. V.; Volkov, A. S. [Moscow State University, Faculty of Geology (Russian Federation)

    2016-11-15

    Crystals of a new polar borate Na{sub 2}Ce{sub 2}[BO{sub 2}(OH)][BO{sub 3}]{sub 2} · H{sub 2}O were prepared by hydrothermal synthesis. The crystals are orthorhombic, a = 7.2295(7) Å, b = 11.2523(8) Å, c = 5.1285(6) Å, Z = 2, sp. gr. C2mm (Amm2), R = 0.0253. The formula of the compound was derived from the structure determination. The Ce and Na atoms are coordinated by nine and six O atoms, respectively. The Ce position is split, and a small amount of Ce is incorporated into the Na1 site with the isomorphous substitution for Na. The anionic moieties exist as isolated BO{sub 3} and BO{sub 2}(OH) triangles. The planes of the BO{sub 2}(OH) triangles with mm2 symmetry are parallel to the ab plane. The planes of the BO{sub 3} triangles with m symmetry are perpendicular to the ab plane and are rotated in a diagonal way. The splitting of the Ce positions and the polar arrangement of the BO{sub 2}(OH) triangles, water molecules, and Na atoms are observed along the polar a axis. The new structure is most similar to the new borate NaCa{sub 4}[BO{sub 3}]{sub 3} (sp. gr. Ama2), in which triangles of one type are arranged in a polar fashion along the c axis. Weak nonlinear-optical properties of both polar borates are attributed to the quenching of the second-harmonic generation due to the mutually opposite orientation of two-thirds of B triangles in the unit cell.

  3. Yb3+:Sr3Y2(BO3)4: A potential ultrashort pulse laser crystal

    International Nuclear Information System (INIS)

    Sun, Shijia; Xu, Jinlong; Wei, Qi; Lou, Fei; Huang, Yisheng; Yuan, Feifei; Zhang, Lizhen; Lin, Zhoubin; He, Jingliang; Wang, Guofu

    2015-01-01

    Highlights: • A Yb 3+ :Sr 3 Y 2 (BO 3 ) 4 crystal was grown successfully by Czochralski method. • The crystal has wide absorption and emission bandwidth. • 3.47 W continuous wave laser output with a slope efficiency of 29% was obtained. • The results show that the crystal is a promising ultrashort pulse laser material. - Abstract: A Yb 3+ :Sr 3 Y 2 (BO 3 ) 4 crystal was grown successfully by the Czochralski method. The polarized spectral properties and continuous wave laser output of this crystal were investigated in detail. The crystal has larger absorption and emission cross sections compared with many mature Yb 3+ -doped borate crystals. The full width at half maximum of the emission bands around 1023 nm are 69 nm (E//a), 61 nm (E//b) and 65 nm (E//c). 3.47 W continuous wave laser output with a slope efficiency of 29% and an optical conversion efficiency of 24% was obtained. The results reveal that Yb 3+ :Sr 3 Y 2 (BO 3 ) 4 crystal is an excellent candidate for ultrashort pulse laser crystal

  4. Moessbauer determination of magnetic structure of Fe3BO6 crystal

    International Nuclear Information System (INIS)

    Kovalenko, P.P.; Labushkin, V.G.; Ovsepyan, A.K.; Sarkisov, Eh.R.; Smirnov, E.V.; Prokopov, A.R.; Seleznev, V.N.

    1984-01-01

    The magnetic structure of a Fe 3 BO 6 crystal belonging to space group Dsub(2h)sup(16)(Psub(nma)) is determined by the Moessbauer γ-radiation diffraction. The bragg reflection (700) of Moessbauer 14.4 keV γ-quanta from the Fe 3 BO 6 monocrystal has been studied experimentally. A high sensitivity of the interference of γ-quantum diffraction scattering on Fe nuclei being in crystallographically non-equivalent 8d- and 4s-positions to the type of magnetic ordering in the crystal is used for determination of the magnetic structure. Agreement of the experimental results with the theoretical calculations, conducted for types of magnetic ordering resolved by the symmetry of the crystal, permitted to reliably determine the magnetic structure of this compound. The results obtained confirm the data of neutrondiffraction studies on magnetic ordering in Fe 3 BO 6 . Advantages of the Moessbauer-diffraction study, as compared to the magnetic neutrondiffraction method, in particular, for investigation of crystals, in which the hyperfine magnetic fields on Fe nuclei have different values, are revealed and discussed in detail

  5. Moessbauer determination of magnetic structure of Fe/sub 3/BO/sub 6/ crystal

    Energy Technology Data Exchange (ETDEWEB)

    Kovalenko, P.P.; Labushkin, V.G.; Ovsepyan, A.K.; Sarkisov, Eh.R.; Smirnov, E.V.; Prokopov, A.R.; Seleznev, V.N.

    1984-10-01

    The magnetic structure of a Fe/sub 3/BO/sub 6/ crystal belonging to space group Dsub(2h)sup(16)(Psub(nma)) is determined by the Moessbauer ..gamma..-radiation diffraction. The bragg reflection (700) of Moessbauer 14.4 keV ..gamma..-quanta from the Fe/sub 3/BO/sub 6/ monocrystal has been studied experimentally. A high sensitivity of the interference of ..gamma..-quantum diffraction scattering on Fe nuclei being in crystallographically non-equivalent 8d- and 4s-positions to the type of magnetic ordering in the crystal is used for determination of the magnetic structure. Agreement of the experimental results with the theoretical calculations, conducted for types of magnetic ordering resolved by the symmetry of the crystal, permitted to reliably determine the magnetic structure of this compound. The results obtained confirm the data of neutrondiffraction studies on magnetic ordering in Fe/sub 3/BO/sub 6/. Advantages of the Moessbauer-diffraction study, as compared to the magnetic neutrondiffraction method, in particular, for investigation of crystals, in which the hyperfine magnetic fields on Fe nuclei have different values, are revealed and discussed in detail.

  6. RANS-based CFD simulations of sodium fast reactor wire-wrapped pin bundles

    International Nuclear Information System (INIS)

    Pointer, W. D.; Thomas, J.; Fanning, T.; Fischer, P.; Siegel, A.; Smith, J.; Tokuhiro, A.

    2009-01-01

    In response to recent renewed interest in the development of advanced fast reactors, an effort is underway to develop a high-performance computational multi-physics simulation suite for the design and safety analysis of sodium cooled fast reactors. Within the multi-resolution thermal-hydraulics simulation component of this framework, high-resolution spectral large eddy simulation methods are used to improve turbulence models from coarser resolution Reynolds-averaged Navier-Stokes methods, and in turn, that data is used to improve or extend correlations used in traditional sub-channel tools. These ongoing studies provide the foundation for the development of the intermediate RANS-based resolution level. Prior work has focused on the benchmarking of flow field predictions on in 7-pin, 19-pin, and 37-pin fuel assemblies. The present work extends these studies to 217-pin assemblies in support of initial efforts to benchmark heat transfer predictions using the RANS models against conventional sub-channel models. In an effort to reduce the number of computational cells required to describe a 217-pin geometry, the effects of simplification of the geometric description of the contact point between the wire and the pin are investigated. The advantages of using polyhedral-based meshing methods rather than trimmed cell meshing methods have been demonstrated, and the effects of changes in axial mesh resolution in these meshes have been investigated. Results show that the geometric simplification has little impact on predicted flow fields, as does the use of a polyhedral mesh of comparable mesh density in place of the original trimmed cell mesh. While reducing axial mesh density has a notable impact on the velocity field, reducing predicted exchange velocities between adjacent subchannels by as much 25%, the impact on predicted temperature fields is negligible. (authors)

  7. Performance evaluation of RANS-based turbulence models in simulating a honeycomb heat sink

    Science.gov (United States)

    Subasi, Abdussamet; Ozsipahi, Mustafa; Sahin, Bayram; Gunes, Hasan

    2017-07-01

    As well-known, there is not a universal turbulence model that can be used to model all engineering problems. There are specific applications for each turbulence model that make it appropriate to use, and it is vital to select an appropriate model and wall function combination that matches the physics of the problem considered. Therefore, in this study, performance of six well-known Reynolds-Averaged Navier-Stokes ( RANS) based turbulence models which are the Standard k {{-}} ɛ, the Renormalized Group k- ɛ, the Realizable k- ɛ, the Reynolds Stress Model, the k- ω and the Shear Stress Transport k- ω and accompanying wall functions which are the standard, the non-equilibrium and the enhanced are evaluated via 3D simulation of a honeycomb heat sink. The CutCell method is used to generate grid for the part including heat sink called test section while a hexahedral mesh is employed to discretize to inlet and outlet sections. A grid convergence study is conducted for verification process while experimental data and well-known correlations are used to validate the numerical results. Prediction of pressure drop along the test section, mean base plate temperature of the heat sink and temperature at the test section outlet are regarded as a measure of the performance of employed models and wall functions. The results indicate that selection of turbulence models and wall functions has a great influence on the results and, therefore, need to be selected carefully. Hydraulic and thermal characteristics of the honeycomb heat sink can be determined in a reasonable accuracy using RANS- based turbulence models provided that a suitable turbulence model and wall function combination is selected.

  8. Capacity Bounds on the Downlink of Symmetric, Multi-Relay, Single-Receiver C-RAN Networks

    Directory of Open Access Journals (Sweden)

    Shirin Saeedi Bidokhti

    2017-11-01

    Full Text Available The downlink of symmetric Cloud Radio Access Networks (C-RANs with multiple relays and a single receiver is studied. Lower and upper bounds are derived on the capacity. The lower bound is achieved by Marton’s coding, which facilitates dependence among the multiple-access channel inputs. The upper bound uses Ozarow’s technique to augment the system with an auxiliary random variable. The bounds are studied over scalar Gaussian C-RANs and are shown to meet and characterize the capacity for interesting regimes of operation.

  9. RANS based CFD methodology for a real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Jae-Ho, E-mail: jhjeong@kaeri.re.kr [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of); Song, Min-Seop [Department of Nuclear Engineering, Seoul National University, 559 Gwanak-ro, Gwanak-gu, Seoul (Korea, Republic of); Lee, Kwi-Lim [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of)

    2017-03-15

    Highlights: • This paper presents a suitable way for a practical RANS based CFD methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR. • A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI function in a general-purpose commercial CFD code, CFX. • The RANS based CFD methodology is implemented with high resolution scheme and SST turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC and JNC. Furthermore, the RANS based CFD methodology can be successfully extended to the real scale 217-pin wire-wrapped fuel bundles of KAERI PGSFR. • Three-dimensional thermal-hydraulic characteristics have been also investigated briefly. - Abstract: This paper presents a suitable way for a practical RANS (Reynolds Averaged Navier-Stokes simulation) based CFD (Computational Fluid Dynamics) methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI (Korea Atomic Energy Research Institute) PGSFR (Prototype Gen-IV Sodium-cooled Fast Reactor). The main purpose of the current study is to support license issue for the KAERI PGSFR core safety and to elucidate thermal-hydraulic characteristics in a 217-pin wire-wrapped fuel assembly of KAERI PGSFR. A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI (General Grid Interface) function in a general-purpose commercial CFD code, CFX. The innovative grid generation method with GGI function can achieve to simulate a real wire shape with minimizing cell skewness. The RANS based CFD methodology is implemented with high resolution scheme in convection term and SST (Shear Stress Transport) turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC (Power reactor and Nuclear fuel

  10. A strong loss-of-function mutation in RAN1 results in constitutive activation of the ethylene response pathway as well as a rosette-lethal phenotype

    Science.gov (United States)

    Woeste, K. E.; Kieber, J. J.; Evans, M. L. (Principal Investigator)

    2000-01-01

    A recessive mutation was identified that constitutively activated the ethylene response pathway in Arabidopsis and resulted in a rosette-lethal phenotype. Positional cloning of the gene corresponding to this mutation revealed that it was allelic to responsive to antagonist1 (ran1), a mutation that causes seedlings to respond in a positive manner to what is normally a competitive inhibitor of ethylene binding. In contrast to the previously identified ran1-1 and ran1-2 alleles that are morphologically indistinguishable from wild-type plants, this ran1-3 allele results in a rosette-lethal phenotype. The predicted protein encoded by the RAN1 gene is similar to the Wilson and Menkes disease proteins and yeast Ccc2 protein, which are integral membrane cation-transporting P-type ATPases involved in copper trafficking. Genetic epistasis analysis indicated that RAN1 acts upstream of mutations in the ethylene receptor gene family. However, the rosette-lethal phenotype of ran1-3 was not suppressed by ethylene-insensitive mutants, suggesting that this mutation also affects a non-ethylene-dependent pathway regulating cell expansion. The phenotype of ran1-3 mutants is similar to loss-of-function ethylene receptor mutants, suggesting that RAN1 may be required to form functional ethylene receptors. Furthermore, these results suggest that copper is required not only for ethylene binding but also for the signaling function of the ethylene receptors.

  11. Random mutagenesis of BoNT/E Hc nanobody to construct a secondary phage-display library.

    Science.gov (United States)

    Shahi, B; Mousavi Gargari, S L; Rasooli, I; Rajabi Bazl, M; Hoseinpoor, R

    2014-08-01

    To construct secondary mutant phage-display library of recombinant single variable domain (VHH) against botulinum neurotoxin E by error-prone PCR. The gene coding for specific VHH derived from the camel immunized with binding domain of botulinum neurotoxin E (BoNT/E) was amplified by error-prone PCR. Several biopanning rounds were used to screen the phage-displaying BoNT/E Hc nanobodies. The final nanobody, SHMR4, with increased affinity recognized BoNT/E toxin with no cross-reactivity with other antigens especially with related BoNT toxins. The constructed nanobody could be a suitable candidate for VHH-based biosensor production to detect the Clostridium botulinum type E. Diagnosis and treatment of botulinum neurotoxins are important. Generation of high-affinity antibodies based on the construction of secondary libraries using affinity maturation step leads to the development of reagents for precise diagnosis and therapy. © 2014 The Society for Applied Microbiology.

  12. AHP 21: Architecture in The Bo, 'Brug Chu, and Co Ne Counties, Gannan Tibetan Autonomous Prefecture, Gansu

    Directory of Open Access Journals (Sweden)

    Chos dbyings rdo rje ཆོས་དབྱིངས་རྡོ་རྗེ།

    2012-12-01

    Full Text Available Thirty-nine images of architecture in The bo, 'Brug chu, and Co ne counties (Gannan Tibetan Autonomous Prefecture, Gansu Province, China are presented. The author also relates his experiences of travelling through the area in 2010.

  13. Analysis of associations between major histocompatibility complex (BoLA) class I haplotypes and subclinical mastitis of dairy cows

    DEFF Research Database (Denmark)

    Aarestrup, Frank Møller; Jensen, N. E.; Østergård, H.

    1995-01-01

    The associations between BoLA class I haplotypes and subclinical mastitis were investigated using information on 333 cows from three different breeds and crossbreeds from 14 dairy herds in Denmark. Somatic cell count and bacteriological status were used as markers for subclinical mastitis....... Associations between BoLA class I haplotypes and IMI status were also determined. The association between BoLA class I haplotypes and subclinical mastitis was weak. The A10(W50), A11, A12(A30), A16, A19(A6), A21, A26, and A31(A30) alleles were associated with different markers of subclinical mastitis....... Susceptibility or resistance to the two bacteria categories was associated with different alleles. This study indicated that BoLA antigens may be involved in resistance to mastitis and that resistance may be specific for a particular pathogen....

  14. Linear optical properties of Ca4EuO(BO3)3 and Eu3+ : Ca4GdO(BO3)3 crystals

    International Nuclear Information System (INIS)

    Antic-Fidancev, E.; Lemaitre-Blaise, M.; Porcher, P.; Caramanian, A.; Aka, G.

    1998-01-01

    Full text: The title compounds are now intensively studied due to their quadratic nonlinear properties in view of applications, e.g. high power laser frequency conversion. Rare earth calcium oxoborates, Ca 4 REO(BO 3 ) 3 , constitute an isostructural family along the rare earth series with RE = La - Lu, Y included. These compounds crystallize in the monoclinic biaxial crystal system with Cm (N 8) space group. They are isostructural to the calcium fluoroborate Ca 5 (BO 3 ) 3 F which is related to the fluoroapatite structure Ca 5 (PO 4 ) 3 F. The rare earth ions are located in the distorted octahedron with C s point site symmetry in the mirror plane. Two types of distorted octahedral sites exist for calcium ions. The existence of some disorder between calcium and rare earth atoms is suspected from the structural analysis. Good optical quality crystals of europium (or gadolinium) oxoborate, EuCOB (GdCOB) have been grown from the stoichiometric melt by the Czochralski pulling method. From the luminescence of the Eu 3+ doped gadolinium or in the europium stoichiometric compound very complex emission spectra have been obtained. It principally depends on the preparation method of studied samples: i) for a monocrystalline sample, a single phase with a single site is observed; ii) for a polycrystalline sample complex feature occurs. It is probably due to an expanded disorder between calcium and rare earth atoms. Practically, there is one principal site corresponding to the low symmetry site of the rare earth as expected from the structural investigation. Other minor sites are attributed to the local distortion created around the active rare earth ion. The intensity of the emission lines of Eu 3+ used as a local structural probe related to these minor sites increases when the gadolinium in Ca 4 GdO(BO 0 ) 3 is substituted by lanthanum or yttrium ions. It seems therefore evident that the synthesis of these rare earth calcium oxoborates must be realised carefully. The crystal

  15. BoLA class I polymorphism and in vitro immune response to M. bovis antigens.

    Science.gov (United States)

    Longeri, M; Polli, M; Ponti, W; Zanotti, M

    1993-01-12

    From a sample of 119 Friesian calves, serologically typed for BoLA class I, 47 subjects were chosen expressing 9 different MHC types (A6, A6.9, A10, A11, A14, A15, A30, W16, M103) with the same age and reared in the same farm conditions. The animals were s.c. injected with a water in oil suspension of killed M. bovis and the treatment was repeated two days later. Before the treatment and 21 days later, calves were bled and on PBM (peripheral blood mononuclear leucocytes) were performed the following tests: 1. Lymphocyte Stimulation with bovine and avian PPDs (Purified protein derivative of Mycobacterium bovis and Mycobacterium avium, respectively). 2. Phagocytic activity towards M. bovis. 3. Class II molecules expression on cell surface. 4. Percentage of leucocyte populations and subpopulations. In the in vitro Lymphocyte Stimulation test, all the animals and classes were responders. Animals bearing A10 BoLA class I presented c.p.m. (counts per minute) and index values higher than the other cattle; these values were significantly positively related both to bovine and avian PPDs (P celular de moleculas de clase II. 4. Porcentaje de poblaciones y de subpob-laciones de leucocitos. Todos los animales y todos los tipos de MHC dieron respuestas positivas en las pruebas de Stimulacion Lymphocitaria. Los animales que tenian la BoLA A10 presentaron valores de c.p.m. y indices mas altos de los demas animales. Estos valores se encontraron significativamente y positivamente relacionados sea a la PPD bovina que a la PPD avicola. Por medio de la analisis de varianzas se encontro que el tipo BoLA A14 muestraba una correlacion significativa y algo positiva con una mejor actividad fagocitaria. Los tipos de clase BoLA I no parecieron que influenzaran de manera appreciable el porcentaje de positividad por la clase II y el porcentaje de leucocitos en la sangre PBM. 1993 Blackwell Verlag GmbH.

  16. Luminescent properties of UV excitable blue emitting phosphors MSr4(BO3)3:Ce3+ (M = Li and Na)

    International Nuclear Information System (INIS)

    Guo Chongfeng; Ding Xu; Seo, Hyo Jin; Ren Zhaoyu; Bai Jintao

    2011-01-01

    Research highlights: → Novel blue emitting phosphors borate MSr 4 (BO 3 ) 3 (M = Li or Na) were prepared first. → Luminescent properties of phosphors borate MSr 4 (BO 3 ) 3 (M = Li or Na) were investigated extensively as candidates of blue emitting phosphor used for UV excited LED. → The optimal concentrations of dopant Ce 3+ ions in compound MSr 4 (BO 3 ) 3 (M = Li or Na) were determined as 0.05 for Li and x = 0.09 for Na excited by UV light respectively. - Abstract: A series of Ce 3+ doped novel borate phosphors MSr 4 (BO 3 ) 3 (M = Li or Na) were successfully synthesized by traditional solid-state reaction. The crystal structures and the phase purities of samples were characterized by powder X-ray diffraction. The optimal concentrations of dopant Ce 3+ ions in compound MSr 4 (BO 3 ) 3 (M = Li or Na) were determined through the measurements of photoluminescence spectra of phosphors. Ce 3+ doped phosphors MSr 4 (BO 3 ) 3 (M = Li or Na) show strong broad band absorption in UV spectral region and bright blue emission under the excitation of 345 nm light. In addition, the temperature dependences of emission spectra of M 1+x Sr 4-2x Ce x (BO 3 ) 3 (M = Li or Na) phosphors with optimal composition x = 0.05 for Li and x = 0.09 for Na excited under 355 nm pulse laser were also investigated. The experimental results indicate that the M 1+x Sr 4-2x Ce x (BO 3 ) 3 (M = Li or Na) phosphors are promising blue emitting phosphors pumped by UV light.

  17. RANS / LES coupling applied to high Reynolds number turbulent flows of the nuclear industry; Application du couplage RANS / LES aux ecoulements turbulents a haut nombre de Reynolds de l'industrie nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Benarafa, Y

    2005-12-15

    The main issue to perform a computational study of high Reynolds numbered turbulent flows consists on predicting their unsteadiness without implying a tremendous computational cost. First, the main drawbacks of large-eddy simulation with standard wall model on a coarse mesh for a plane channel flow are highlighted. To correct these drawbacks two coupling RANS/LES methods have been proposed. The first one relies on a sophisticated wall model (TBLE) which consists on solving Thin Boundary Layer Equations with a RANS type turbulent closure in the near wall region. The second one consists on a RANS/LES methods have been proposed. The second one consists on a RANS/LES coupling method using a forcing term approach. These various approaches have been implemented in the TRIO-U code developed at CEA (French Atomic Center) at Grenoble, France. The studied flow configurations are the fully developed plane channel flow and a flow around a surface-mounted cubical obstacle. Both approaches provide encouraging results and allow a surface-mounted cubical obstacle. Both approaches provide encouraging results and allow unsteady simulations for a low computational cost. (author)

  18. Hypersensitive detection and quantitation of BoNT/A by IgY antibody against substrate linear-peptide.

    Directory of Open Access Journals (Sweden)

    Tao Li

    Full Text Available Botulinum neurotoxin A (BoNT/A, the most acutely poisonous substance to humans known, cleave its SNAP-25 substrate with high specificity. Based on the endopeptidase activity, different methods have been developed to detect BoNT/A, but most lack ideal reproducibility or sensitivity, or suffer from long-term or unwanted interferences. In this study, we developed a simple method to detect and quantitate trace amounts of botulinum neurotoxin A using the IgY antibody against a linear-peptide substrate. The effects of reaction buffer, time, and temperature were analyzed and optimized. When the optimized assay was used to detect BoNT/A, the limit of detection of the assay was 0.01 mouse LD50 (0.04 pg, and the limit of quantitation was 0.12 mouse LD50/ml (0.48 pg. The findings also showed favorable specificity of detecting BoNT/A. When used to detect BoNT/A in milk or human serum, the proposed assay exhibited good quantitative accuracy (88% < recovery < 111%; inter- and intra-assay CVs < 18%. This method of detection took less than 3 h to complete, indicating that it can be a valuable method of detecting BoNT/A in food or clinical diagnosis.

  19. Characterization and mapping of LanrBo: a locus conferring anthracnose resistance in narrow-leafed lupin (Lupinus angustifolius L.).

    Science.gov (United States)

    Fischer, Kristin; Dieterich, Regine; Nelson, Matthew N; Kamphuis, Lars G; Singh, Karam B; Rotter, Björn; Krezdorn, Nicolas; Winter, Peter; Wehling, Peter; Ruge-Wehling, Brigitte

    2015-10-01

    A novel and highly effective source of anthracnose resistance in narrow-leafed lupin was identified. Resistance was shown to be governed by a single dominant locus. Molecular markers have been developed, which can be used for selecting resistant genotypes in lupin breeding. A screening for anthracnose resistance of a set of plant genetic resources of narrow-leafed lupin (Lupinus angustifolius L.) identified the breeding line Bo7212 as being highly resistant to anthracnose (Colletotrichum lupini). Segregation analysis indicated that the resistance of Bo7212 is inherited by a single dominant locus. The corresponding resistance gene was given the designation LanrBo. Previously published molecular anchor markers allowed us to locate LanrBo on linkage group NLL-11 of narrow-leafed lupin. Using information from RNAseq data obtained with inoculated resistant vs. susceptible lupin entries as well as EST-sequence information from the model genome Lotus japonicus, additional SNP and EST markers linked to LanrBo were derived. A bracket of two LanrBo-flanking markers allows for precise marker-assisted selection of the novel resistance gene in narrow-leafed lupin breeding programs.

  20. Integral Method for the Assessment of U-RANS Effectiveness in Non-Equilibrium Flows and Heat Transfer

    Science.gov (United States)

    Pond, Ian; Edabi, Alireza; Dubief, Yves; White, Christopher

    2015-11-01

    Reynolds Average Navier Stokes (RANS) modeling has established itself as a critical design tool in many engineering applications, thanks to its superior computational efficiency. The drawbacks of RANS models are well known, but not necessarily well understood: poor prediction of transition, non equilibrium flows, mixing and heat transfer, to name the ones relevant to our study. In the present study, we use a DNS of a reciprocating channel flow driven by an oscillating pressure gradient to test several low- and high-Reynolds RANS models. Temperature is introduced as a passive scalar to study heat transfer modeling. Low-Reynolds models manage to capture the overall physics of wall shear and heat flux well, yet with some phase discrepancies, whereas high Reynolds models fail. Under the microscope of the integral method for wall shear and wall heat flux, the qualitative agreement appears more serendipitous than driven by the ability of the models to capture the correct physics. The integral method is shown to be more insightful in the benchmarking of RANS models than the typical comparisons of statistical quantities. The authors acknowledges the support of NSF and DOE under grant NSF/DOE 1258697 (VT) and 1258702 (NH).

  1. Dynamic release of nuclear RanGTP triggers TPX2-dependent microtubule assembly during the apoptotic execution phase.

    Science.gov (United States)

    Moss, David K; Wilde, Andrew; Lane, Jon D

    2009-03-01

    During apoptosis, the interphase microtubule network is dismantled then later replaced by a novel, non-centrosomal microtubule array. These microtubules assist in the peripheral redistribution of nuclear fragments in the apoptotic cell; however, the regulation of apoptotic microtubule assembly is not understood. Here, we demonstrate that microtubule assembly depends upon the release of nuclear RanGTP into the apoptotic cytoplasm because this process is blocked in apoptotic cells overexpressing dominant-negative GDP-locked Ran (T24N). Actin-myosin-II contractility provides the impetus for Ran release and, consequently, microtubule assembly is blocked in blebbistatin- and Y27632-treated apoptotic cells. Importantly, the spindle-assembly factor TPX2 (targeting protein for Xklp2), colocalises with apoptotic microtubules, and siRNA silencing of TPX2, but not of the microtubule motors Mklp1 and Kid, abrogates apoptotic microtubule assembly. These data provide a molecular explanation for the assembly of the apoptotic microtubule network, and suggest important similarities with the process of RanGTP- and TPX2-mediated mitotic spindle formation.

  2. Mixture Growth Models of RAN and RAS Row by Row: Insight into the Reading System at Work over Time

    Science.gov (United States)

    Amtmann, Dagmar; Abbott, Robert D.; Berninger, V. W.

    2007-01-01

    Children (n = 122) and adults (n = 200) with dyslexia completed rapid automatic naming (RAN) letters, rapid automatic switching (RAS) letters and numbers, executive function (inhibition, verbal fluency), and phonological working memory tasks. Typically developing 3rd (n = 117) and 5th (n = 103) graders completed the RAS task. Instead of analyzing…

  3. Temperature-sensitive defects of the GSP1gene, yeast Ran homologue, activate the Tel1-dependent pathway

    International Nuclear Information System (INIS)

    Hayashi, Naoyuki; Murakami, Seishi; Tsurusaki, Susumu; Nagaura, Zen-ichiro; Oki, Masaya; Nishitani, Hideo; Kobayashi, Masahiko; Shimizu, Hiroko; Yamamoto, Ken-ichi; Nishimoto, Takeharu

    2007-01-01

    RanGTPase is involved in many cellular processes. It functions in nuclear-cytosolic transport and centrosome formation. Ran also localizes to chromatin as RCC1 does, its guanine nucleotide exchange factor, but Ran's function on chromatin is not known. We found that gsp1, a temperature-sensitive mutant of GSP1, a Saccharomyces cerevisiae Ran homologue, suppressed the hydroxyurea (HU) and ultra violet (UV) sensitivities of the mec1 mutant. In UV-irradiated mec1 gsp1 cells, Rad53 was phosphorylated despite the lack of Mec1. This suppression depended on the TEL1 gene, given that the triple mutant, mec1 gsp1 tel1, was unable to grow. The gsp1 mutations also suppressed the HU sensitivity of the rad9 mutant in a Tel1-dependent manner, but not the HU sensitivity of the rad53 mutant. These results indicated that Rad53 was activated by the Tel1 pathway in mec1 gsp1 cells, suggesting that Gsp1 helps regulate the role switching the ATM family kinases Mec1 and Tel1

  4. DNS, LES and RANS of turbulent heat transfer in boundary layer with suddenly changing wall thermal conditions

    International Nuclear Information System (INIS)

    Hattori, Hirofumi; Yamada, Shohei; Tanaka, Masahiro; Houra, Tomoya; Nagano, Yasutaka

    2013-01-01

    Highlights: • We study the turbulent boundary layer with heat transfer by DNS. • Turbulent boundary layers with suddenly changing wall thermal conditions are observed. • The detailed turbulent statistics and structures in turbulent thermal boundary layer are discussed. • Turbulence models in LES and RANS are evaluated using DNS results. • LES and RANS are almost in good agreement with DNS results. -- Abstract: The objectives of this study are to investigate a thermal field in a turbulent boundary layer with suddenly changing wall thermal conditions by means of direct numerical simulation (DNS), and to evaluate predictions of a turbulence model in such a thermal field, in which DNS of spatially developing boundary layers with heat transfer can be conducted using the generation of turbulent inflow data as a method. In this study, two types of wall thermal condition are investigated using DNS and predicted by large eddy simulation (LES) and Reynolds-averaged Navier–Stokes equation simulation (RANS). In the first case, the velocity boundary layer only develops in the entrance of simulation, and the flat plate is heated from the halfway point, i.e., the adiabatic wall condition is adopted in the entrance, and the entrance region of thermal field in turbulence is simulated. Then, the thermal boundary layer develops along a constant temperature wall followed by adiabatic wall. In the second case, velocity and thermal boundary layers simultaneously develop, and the wall thermal condition is changed from a constant temperature to an adiabatic wall in the downstream region. DNS results clearly show the statistics and structure of turbulent heat transfer in a constant temperature wall followed by an adiabatic wall. In the first case, the entrance region of thermal field in turbulence can be also observed. Thus, both the development and the entrance regions in thermal fields can be explored, and the effects upstream of the thermal field on the adiabatic region are

  5. BoHV-4-Based Vector Single Heterologous Antigen Delivery Protects STAT1(-/- Mice from Monkeypoxvirus Lethal Challenge.

    Directory of Open Access Journals (Sweden)

    Valentina Franceschi

    2015-06-01

    Full Text Available Monkeypox virus (MPXV is the etiological agent of human (MPX. It is an emerging orthopoxvirus zoonosis in the tropical rain forest of Africa and is endemic in the Congo-basin and sporadic in West Africa; it remains a tropical neglected disease of persons in impoverished rural areas. Interaction of the human population with wildlife increases human infection with MPX virus (MPXV, and infection from human to human is possible. Smallpox vaccination provides good cross-protection against MPX; however, the vaccination campaign ended in Africa in 1980, meaning that a large proportion of the population is currently unprotected against MPXV infection. Disease control hinges on deterring zoonotic exposure to the virus and, barring that, interrupting person-to-person spread. However, there are no FDA-approved therapies against MPX, and current vaccines are limited due to safety concerns. For this reason, new studies on pathogenesis, prophylaxis and therapeutics are still of great interest, not only for the scientific community but also for the governments concerned that MPXV could be used as a bioterror agent. In the present study, a new vaccination strategy approach based on three recombinant bovine herpesvirus 4 (BoHV-4 vectors, each expressing different MPXV glycoproteins, A29L, M1R and B6R were investigated in terms of protection from a lethal MPXV challenge in STAT1 knockout mice. BoHV-4-A-CMV-A29LgD106ΔTK, BoHV-4-A-EF1α-M1RgD106ΔTK and BoHV-4-A-EF1α-B6RgD106ΔTK were successfully constructed by recombineering, and their capacity to express their transgene was demonstrated. A small challenge study was performed, and all three recombinant BoHV-4 appeared safe (no weight-loss or obvious adverse events following intraperitoneal administration. Further, BoHV-4-A-EF1α-M1RgD106ΔTK alone or in combination with BoHV-4-A-CMV-A29LgD106ΔTK and BoHV-4-A-EF1α-B6RgD106ΔTK, was shown to be able to protect, 100% alone and 80% in combination, STAT1(-/- mice

  6. Assessment of Reynolds stresses tensor reconstruction methods for synthetic turbulent inflow conditions. Application to hybrid RANS/LES methods

    International Nuclear Information System (INIS)

    Laraufie, Romain; Deck, Sébastien

    2013-01-01

    Highlights: • Present various Reynolds stresses reconstruction methods from a RANS-SA flow field. • Quantify the accuracy of the reconstruction methods for a wide range of Reynolds. • Evaluate the capabilities of the overall process (Reconstruction + SEM). • Provide practical guidelines to realize a streamwise RANS/LES (or WMLES) transition. -- Abstract: Hybrid or zonal RANS/LES approaches are recognized as the most promising way to accurately simulate complex unsteady flows under current computational limitations. One still open issue concerns the transition from a RANS to a LES or WMLES resolution in the stream-wise direction, when near wall turbulence is involved. Turbulence content has then to be prescribed at the transition to prevent from turbulence decay leading to possible flow relaminarization. The present paper aims to propose an efficient way to generate this switch, within the flow, based on a synthetic turbulence inflow condition, named Synthetic Eddy Method (SEM). As the knowledge of the whole Reynolds stresses is often missing, the scope of this paper is focused on generating the quantities required at the SEM inlet from a RANS calculation, namely the first and second order statistics of the aerodynamic field. Three different methods based on two different approaches are presented and their capability to accurately generate the needed aerodynamic values is investigated. Then, the ability of the combination SEM + Reconstruction method to manufacture well-behaved turbulence is demonstrated through spatially developing flat plate turbulent boundary layers. In the mean time, important intrinsic features of the Synthetic Eddy method are pointed out. The necessity of introducing, within the SEM, accurate data, with regards to the outer part of the boundary layer, is illustrated. Finally, user’s guidelines are given depending on the Reynolds number based on the momentum thickness, since one method is suitable for low Reynolds number while the

  7. Nanoformulation of D-α-tocopheryl polyethylene glycol 1000 succinate-b-poly(ε-caprolactone-ran-glycolide) diblock copolymer for breast cancer therapy.

    Science.gov (United States)

    Huang, Laiqiang; Chen, Hongbo; Zheng, Yi; Song, Xiaosong; Liu, Ranyi; Liu, Kexin; Zeng, Xiaowei; Mei, Lin

    2011-10-01

    The purpose of this research was to develop formulation of docetaxel-loaded biodegradable TPGS-b-(PCL-ran-PGA) nanoparticles for breast cancer chemotherapy. A novel diblock copolymer, d-α-tocopheryl polyethylene glycol 1000 succinate-b-poly(ε-caprolactone-ran-glycolide) [TPGS-b-(PCL-ran-PGA)], was synthesized from ε-caprolactone, glycolide and d-α-tocopheryl polyethylene glycol 1000 succinate by ring-opening polymerization using stannous octoate as catalyst. The obtained copolymers were characterized by (1)H NMR, GPC and TGA. The docetaxel-loaded TPGS-b-(PCL-ran-PGA) nanoparticles were prepared and characterized. The data showed that the fluorescence TPGS-b-(PCL-ran-PGA) nanoparticles could be internalized by MCF-7 cells. The TPGS-b-(PCL-ran-PGA) nanoparticles achieved significantly higher level of cytotoxicity than commercial Taxotere®. MCF-7 xenograft tumor model on SCID mice showed that docetaxel formulated in the TPGS-b-(PCL-ran-PGA) nanoparticles could effectively inhibit the growth of tumor over a longer period of time than Taxotere® at the same dose. In conclusion, the TPGS-b-(PCL-ran-PGA) copolymer could be acted as a novel and potential biologically active polymeric material for nanoformulation in breast cancer chemotherapy. This journal is © The Royal Society of Chemistry 2011

  8. Parameters for MDBK cell growth on microcarriers and BoHV-1 virus production

    Directory of Open Access Journals (Sweden)

    Ethel C. Freitas

    2017-09-01

    Full Text Available Bovine herpes virus 1 (BoHV-1 is an important veterinary agent , which causes infectious bovine rhinotra-cheitis. This disease affects the respiratory tract or genitals, causing weight loss, reduced milk production and abor-tion. Several vaccines against BoHV-1 have been developed. In this paper, we study the parameters for MDBK growth on microcarriers (Cytodex 1 and for BoHV-1 virus production. The cell culture attached to microcarriers is an effi-cient method to enlarge the surface of cell growth and for large-scale cell production. Our studies reveal that MDBK adhered to MCs in 30 minutes and that initial agitation of culture did not influence on the efficiency of adhesion or cell growth. In our experiments, we detected no relevant influence of agitation on initial cell adhesion of MDBK to MCs. The maximum cell yield was similar to all initial conditions of agitation studied. The maximum yield obtained in culture started with 15, 20 and 30 cells / MC, was respectively.8.7 x105, 9.3 x105 and 9.8 x105 cells / ml . The cellular distribution on the MCs at the beginning of the culture was more heterogeneous in higher initial densities. After three medium exchanges during MDBK cell culture, the increase in the final yield was 100% higher than that from culture performed without medium change (0.93 x 106 cells / mL. Replacing 50% of the culture medium with fresh medium after 24 hours of growth, the concentration of glucose (5 mM and glutamine (1.8 mM were almost completely res-tored. In these studies, BoHV-1 infections of MDBK were performed after 48, 72 and 86 hours with daily exchanges of 50% of the medium. The increase in viral titer was proportional to the number of viable cells present at the time of infection. The best result of BoHV-1 production was achieved when the infection was performed from 86 hours of cell culture, reaching about 3.7 x108 (TCID50/ml after 24-48 hours of infection, being on average four times higher when compared to the

  9. RISET STRATEGI IMPLEMENTASI C-RAN DI TELKOMSEL MELALUI KOLABORASI JARINGAN NG-PON2 DI TELKOM AKSES MENGGUNAKAN PENDEKATAN METODE STRATEGIC SITUATION ANALYSIS

    Directory of Open Access Journals (Sweden)

    Tri Susanto

    2007-07-01

    Full Text Available Cloud Radio Access Network (C-RAN adalah teknologi akses radio yang diyakini mampu menekan biaya CAPEX dan OPEX dari mobile operator dan memberikan performansi yang lebih baik dibandingkan Radio Access Network (RAN tradisional. Salah satu faktor kunci sukses implementasi C-RAN adalah penyediaan jaringan fonthaul yang efektif. Tujuan penelitian ini adalah membuat strategi implementasi C-RAN di Telkomsel melalui kolaborasi jaringan NG-PON2 di Telkom Akses. Pada tulisan ini menggunakan metode analisis kualitatif dengan melakukan strategy situation analysis (SSA yaitu melakukan analisa data eksternal maupun internal dan selanjutnya diformulasikan sebagai dasar pembuatan strategi implementasi. Dari penelitian ini dihasilkan usulan strategi implementasi C-RAN di Telkomsel melalui kolaborasi jaringan NG-PON2 di Telkom Akses.

  10. Polimorfismos del gen BoLA-DRB3.2* en ganado criollo colombiano

    Directory of Open Access Journals (Sweden)

    Darwin Hernández H.

    2013-10-01

    Full Text Available Objetivo. Caracterizar el polimorfismo del gen BoLA-DRB3.2* en las razas bovinas criollas y colombianas. Materiales y métodos. En 360 muestras de ADN de ocho razas bovinas criollas (Blanco Orejinegro, Casanareño, Costeño con Cuernos, Chino Santandereano, Caqueteño, Hartón del Valle, Romosinuano y San Martinero, dos razas sintéticas Colombianas (Lucerna y Velásquez y dos razas foráneas (Brahman y Holstein se evaluó el polimorfismo del gen BoLA-DRB3.2 mediante técnicas moleculares (PCR-RFLP; se calculó el número promedio de alelos (NPA, las frecuencias, la heterocigocidad esperada (He y observada (Ho, el equilibrio de Hardy-Weinberg, la estructura genética y los valores de FST y FIS. Resultados. El NPA fue 14.6 ± 3.8 siendo Caqueteño la raza con mayor NPA (25 y el menor el Chino Santandereano (10. Se encontraron 41 alelos BoLA-DRB3.2* los más frecuentes fueron *28, *37, *24, *23, *20, *27, *8, *16, *39 (0.17, 0.11, 0.10, 0.09, 0.09, 0.07, 0.07 y 0.06 respectivamente. Se encontró alta diversidad genética (He = 0.878 con mayor valor en Caqueteño (0.96 y menor en San Martinero (0.81. Todas las razas se encontraron en equilibrio de Hardy-Weinberg, se encontraron valores altamente significativos de diferenciación genética (FST= 0.044 y de coeficiente de endogamia (FIS = 0.249. Conclusiones. El ganado criollo colombiano posee alto polimorfismo del gen BoLA-DRB3.2* representado en los altos valores de NPA y diversidad génetica.

  11. UVB emitting LiSrBO3 phosphor for phototherapy lamp

    Science.gov (United States)

    Kunghatkar, R. G.; Hemne, P. S.; Dhoble, S. J.

    2018-05-01

    LiSrBO3 doped Gadolinium have been synthesized by sol gel technique. The formation of host was confirmed by XRD techniques. The incorporation of Gd3+ was confirmed by photoluminescence (PL) characterization. The UVB emission is observed at 316 nm when UV excited by 274 nm. The second order emission are also observed in PL emission spectra at 612 nm and 627 nm. Energy band gap is found to be 5.81 eV by using Kubelka - Munk function. The UVB emission at 316 nm of Gd3+ doped materials are used as phototherapy lamp phosphor.

  12. Manje znani hrvatski kemičari. I. Božidar Rogina

    OpenAIRE

    Trinajstić, N.

    2007-01-01

    A brief account of Professor Božidar Rogina's life is given. He was born on December 21, 1901 in Ivanjska near Bjelovar and died of a heart attack on January 20, 1967 in Zagreb. He graduated high school in 1919 in Zagreb and the same year entered the Department of Chemical Engineering of Technological College in Zagreb, but the following year (1920) Rogina moved to Prague, where in 1923 he obtained his degree in chemical engineering at the Technological College. He obtained his Ph. D. in 1931...

  13. HIGH REPETITION RATE MICROCHIP ER3+,YB3+:YAL3(BO34 DIODE-PUMPED LASER

    Directory of Open Access Journals (Sweden)

    K. N. Gorbachenya

    2012-01-01

    Full Text Available Diode-pumped passively Q-switched microchip Er,Yb:YAl3(BO34 laser for range-finding has been demonstrated. By using a Co2+:MgAl2O4 as a saturable absorber TEM00–mode Q-switched average output power of 315 mW was demonstrated at 1522 nm with pulse duration of 5 ns and pulse energy of 5,25 μJ at a repetition rate of 60 kHz.

  14. A Game-Theoretical Approach for Spectrum Efficiency Improvement in Cloud-RAN

    Directory of Open Access Journals (Sweden)

    Zhuofu Zhou

    2016-01-01

    Full Text Available As tremendous mobile devices access to the Internet in the future, the cells which can provide high data rate and more capacity are expected to be deployed. Specifically, in the next generation of mobile communication 5G, cloud computing is supposed to be applied to radio access network. In cloud radio access network (Cloud-RAN, the traditional base station is divided into two parts, that is, remote radio heads (RRHs and base band units (BBUs. RRHs are geographically distributed and densely deployed, so as to achieve high data rate and low latency. However, the ultradense deployment inevitably deteriorates spectrum efficiency due to the severer intercell interference among RRHs. In this paper, the downlink spectrum efficiency can be improved through the cooperative transmission based on forming the coalitions of RRHs. We formulate the problem as a coalition formation game in partition form. In the process of coalition formation, each RRH can join or leave one coalition to maximize its own individual utility while taking into account the coalition utility at the same time. Moreover, the convergence and stability of the resulting coalition structure are studied. The numeric simulation result demonstrates that the proposed approach based on coalition formation game is superior to the noncooperative method in terms of the aggregate coalition utility.

  15. İran Halk Kütüphaneleri: Niceliksel Bir Değerlendirme

    Directory of Open Access Journals (Sweden)

    Jahangir Gholipour

    2013-06-01

    Full Text Available Halk kütüphaneleri dijital uçurumun azaltılmasında önemli roller üstlenen toplumsal kuruluşlardır. On­ların, bu rollerini gerçekleştirebilmeleri için niceliksel açıdan yeterli durumda olmaları gerekmektedir. Ayrıca, halk kütüphanelerine ilişkin niceliksel göstergeler niteliklerini ve nitelikli hizmet vermelerini doğrudan belirler. İran, 30 ilde yaşayan 71 milyon nüfusa sahip bir Ortadoğu ülkesidir. Bu çalışmada, İran’daki halk kütüphanelerine ilişkin niceliksel durum kütüphane sayısı, kullanıcı, derme ve personel unsurları açısından ortaya konulmaya çalışılmıştır. Elde edilen sonuçlara göre, İran’da ele alınan söz konusu unsurlar açısından genelde bir yetersizlik olduğu anlaşılmıştır. Çalışma sonunda bazı önerilerde bulunulmuştur.

  16. Reynolds Averaged Navier-Stokes (RANS) equation solutions of wind turbine wakes

    Energy Technology Data Exchange (ETDEWEB)

    Ludwig, Daniel Evandro; Horn, Diego Anderson; Petry, Adriane Prisco [Thermal and Energy Study Group, Mechanical Engeneering Department, Federal University of Rio Grande do Sul, Porto Alegre (Brazil)], E-mail: adrianep@mecanica.ufrgs.br

    2010-07-01

    This paper aims to evaluate the influence of three different turbulence models in the study of a wind turbine wake. Numerical Simulation is used as working tool to characterize the flow through the wind turbines, it is used the numeric simulation. The numerical analysis is based on the finite volume method and the Reynolds Averaged Navier-Stokes (RANS) equations. Three turbulence models are used to represent the total effects of turbulence in the flow: the two equations k-classical and the RNG k- models, based on the turbulent viscosity; and the Shear Stress Transport (SST) model, based on the transport of the Reynolds tensor. The results of the 'u' velocity profiles are compared to experimental data from Vermeer (2003) at distances equivalent to 2, 4, 6, 8, 10 and 16 diameters downstream from the turbine. Results shows that the SST model gives better results until 6 diameters, beyond this distance there is no significant differences between the compared models. (author)

  17. RANS Modeling of Stably Stratified Turbulent Boundary Layer Flows in OpenFOAM®

    Directory of Open Access Journals (Sweden)

    Wilson Jordan M.

    2015-01-01

    Full Text Available Quantifying mixing processes relating to the transport of heat, momentum, and scalar quantities of stably stratified turbulent geophysical flows remains a substantial task. In a stably stratified flow, such as the stable atmospheric boundary layer (SABL, buoyancy forces have a significant impact on the flow characteristics. This study investigates constant and stability-dependent turbulent Prandtl number (Prt formulations linking the turbulent viscosity (νt and diffusivity (κt for modeling applications of boundary layer flows. Numerical simulations of plane Couette flow and pressure-driven channel flow are performed using the Reynolds-averaged Navier-Stokes (RANS framework with the standard k-ε turbulence model. Results are compared with DNS data to evaluate model efficacy for predicting mean velocity and density fields. In channel flow simulations, a Prandtl number formulation for wall-bounded flows is introduced to alleviate overmixing of the mean density field. This research reveals that appropriate specification of Prt can improve predictions of stably stratified turbulent boundary layer flows.

  18. Validation of the simpleFoam (RANS solver for the atmospheric boundary layer in complex terrain

    Directory of Open Access Journals (Sweden)

    Peralta C.

    2014-01-01

    Full Text Available We validate the simpleFoam (RANS solver in OpenFOAM (version 2.1.1 for simulating neutral atmospheric boundary layer flows in complex terrain. Initial and boundary conditions are given using Richards and Hoxey proposal [1]. In order to obtain stable simulation of the ABL, modified wall functions are used to set the near-wall boundary conditions, following Blocken et al remedial measures [2]. A structured grid is generated with the new library terrainBlockMesher [3,4], based on OpenFOAM's blockMesh native mesher. The new tool is capable of adding orographic features and the forest canopy. Additionally, the mesh can be refined in regions with complex orography. We study both the classical benchmark case of Askervein hill [5] and the more recent Bolund island data set [6]. Our purpose is two-folded: to validate the performance of OpenFOAM steady state solvers, and the suitability of the new meshing tool to generate high quality structured meshes, which will be used in the future for performing more computationally intensive LES simulations in complex terrain.

  19. CFD modelling approaches against single wind turbine wake measurements using RANS

    International Nuclear Information System (INIS)

    Stergiannis, N; Lacor, C; Beeck, J V; Donnelly, R

    2016-01-01

    Numerical simulations of two wind turbine generators including the exact geometry of their blades and hub are compared against a simplified actuator disk model (ADM). The wake expansion of the upstream rotor is investigated and compared with measurements. Computational Fluid Dynamics (CFD) simulations have been performed using the open-source platform OpenFOAM [1]. The multiple reference frame (MRF) approach was used to model the inner rotating reference frames in a stationary computational mesh and outer reference frame for the full wind turbine rotor simulations. The standard k — ε and k — ω turbulence closure schemes have been used to solve the steady state, three dimensional Reynolds Averaged Navier- Stokes (RANS) equations. Results of near and far wake regions are compared with wind tunnel measurements along three horizontal lines downstream. The ADM under-predicted the velocity deficit at the wake for both turbulence models. Full wind turbine rotor simulations showed good agreement against the experimental data at the near wake, amplifying the differences between the simplified models. (paper)

  20. Simulating wind and marine hydrokinetic turbines with actuator lines in RANS and LES

    Science.gov (United States)

    Bachant, Peter; Wosnik, Martin

    2015-11-01

    As wind and marine hydrokinetic (MHK) turbine designs mature, focus is shifting towards improving turbine array layouts for maximizing overall power output, i.e., minimizing wake interference for axial-flow or horizontal-axis turbines, or taking advantage of constructive wake interaction for cross-flow or vertical-axis turbines. Towards this goal, an actuator line model (ALM) was developed to provide a computationally feasible method for simulating full turbine arrays inside Navier-Stokes models. The ALM predicts turbine loading with the blade element method combined with sub-models for dynamic stall and flow curvature. The open-source software is written as an extension library for the OpenFOAM CFD package, which allows the ALM body force to be applied to their standard RANS and LES solvers. Turbine forcing is also applied to volume of fluid (VOF) models, e.g., for predicting free surface effects on submerged MHK devices. An additional sub-model is considered for injecting turbulence model scalar quantities based on actuator line element loading. Results are presented for the simulation of performance and wake dynamics of axial- and cross-flow turbines and compared with moderate Reynolds number experiments and body-fitted mesh, blade-resolving CFD. Work supported by NSF-CBET grant 1150797.

  1. COPS5 (Jab1) protein increases β site processing of amyloid precursor protein and amyloid β peptide generation by stabilizing RanBP9 protein levels.

    Science.gov (United States)

    Wang, Hongjie; Dey, Debleena; Carrera, Ivan; Minond, Dmitriy; Bianchi, Elisabetta; Xu, Shaohua; Lakshmana, Madepalli K

    2013-09-13

    Increased processing of amyloid precursor protein (APP) and accumulation of neurotoxic amyloid β peptide (Aβ) in the brain is central to the pathogenesis of Alzheimer's disease (AD). Therefore, the identification of molecules that regulate Aβ generation is crucial for future therapeutic approaches for AD. We demonstrated previously that RanBP9 regulates Aβ generation in a number of cell lines and primary neuronal cultures by forming tripartite protein complexes with APP, low-density lipoprotein-related protein, and BACE1, consequently leading to increased amyloid plaque burden in the brain. RanBP9 is a scaffold protein that exists and functions in multiprotein complexes. To identify other proteins that may bind RanBP9 and regulate Aβ levels, we used a two-hybrid analysis against a human brain cDNA library and identified COPS5 as a novel RanBP9-interacting protein. This interaction was confirmed by coimmunoprecipitation experiments in both neuronal and non-neuronal cells and mouse brain. Colocalization of COPS5 and RanBP9 in the same subcellular compartments further supported the interaction of both proteins. Furthermore, like RanBP9, COPS5 robustly increased Aβ generation, followed by increased soluble APP-β (sAPP-β) and decreased soluble-APP-α (sAPP-α) levels. Most importantly, down-regulation of COPS5 by siRNAs reduced Aβ generation, implying that endogenous COPS5 regulates Aβ generation. Finally, COPS5 levels were increased significantly in AD brains and APΔE9 transgenic mice, and overexpression of COPS5 strongly increased RanBP9 protein levels by increasing its half-life. Taken together, these results suggest that COPS5 increases Aβ generation by increasing RanBP9 levels. Thus, COPS5 is a novel RanBP9-binding protein that increases APP processing and Aβ generation by stabilizing RanBP9 protein levels.

  2. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Science.gov (United States)

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  3. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Institute of Scientific and Technical Information of China (English)

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  4. Kale BoRACK1 is involved in the plant response to salt stress and Peronospora brassicae Gaumann.

    Science.gov (United States)

    Li, Da-Hong; Shen, Fu-Jia; Li, Hong-Yan; Li, Wei

    2017-06-01

    The receptor for activated C kinase 1 (RACK1) belongs to a protein subfamily containing a tryptophan-aspartic acid-domain (WD) repeat structure. Compelling evidence indicates that RACK1 can interact with many signal molecules and affect different signal transduction pathways. In this study, a kale (Brassica oleracea var. acephala f.tricolor) RACK1 gene (BoRACK1) was cloned by RT-PCR. The amino acid sequence of BoRACK1 had seven WD repeats in which there were typical GH (glycine-histidine) and WD dipeptides. Comparison with AtRACK1 from Arabidopsis revealed 87.1% identity at the amino acid level. Expression pattern analysis by RT-PCR showed that BoRACK1 was expressed in all analyzed tissues of kale and that its transcription in leaves was down-regulated by salt, abscisic acid, and H 2 O 2 at a high concentration. Overexpression of BoRACK1 in kale led to a reduction in symptoms caused by Peronospora brassicae Gaumann on kale leaves. The expression levels of the pathogenesis-related protein genes, PR-1 and PRB-1, increased 2.5-4-fold in transgenic kale, and reactive oxygen species production was more active than in the wild-type. They also exhibited increased tolerance to salt stress in seed germination. H 2 O 2 may also be involved in the regulation of BoRACK1 during seed germination under salt stress. Quantitative real-time PCR analyses showed that the transcript levels of BoRbohs genes were significantly higher in overexpression of BoRACK1 transgenic lines. Yeast two-hybrid assays showed that BoRACK1 could interact with WNK8, eIF6, RAR1, and SGT1. This study and previous work lead us to believe that BoRACK1 may form a complex with regulators of plant salt and disease resistance to coordinate kale reactions to pathogens. Copyright © 2017 Elsevier GmbH. All rights reserved.

  5. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    CERN Document Server

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  6. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Energy Technology Data Exchange (ETDEWEB)

    Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)

    2017-03-01

    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  7. Extraction and inhibition of enzymatic activity of botulinum neurotoxins/A1, /A2, and /A3 by a panel of monoclonal anti-BoNT/A antibodies.

    Directory of Open Access Journals (Sweden)

    Suzanne R Kalb

    Full Text Available Botulinum neurotoxins (BoNTs are extremely potent toxins that are capable of causing death or respiratory failure leading to long-term intensive care. Treatment includes serotype-specific antitoxins, which must be administered early in the course of the intoxication. Rapidly determining human exposure to BoNT is an important public health goal. In previous work, our laboratory focused on developing Endopep-MS, a mass spectrometry-based endopeptidase method for detecting and differentiating BoNT/A-G serotypes in buffer and BoNT/A, /B, /E, and /F in clinical samples. We have previously reported the effectiveness of antibody-capture to purify and concentrate BoNTs from complex matrices, such as clinical samples. Because some antibodies inhibit or neutralize the activity of BoNT, the choice of antibody with which to extract the toxin is critical. In this work, we evaluated a panel of 16 anti-BoNT/A monoclonal antibodies (mAbs for their ability to inhibit the in vitro activity of BoNT/A1, /A2, and /A3 complex as well as the recombinant LC of A1. We also evaluated the same antibody panel for the ability to extract BoNT/A1, /A2, and /A3. Among the mAbs, there were significant differences in extraction efficiency, ability to extract BoNT/A subtypes, and inhibitory effect on BoNT catalytic activity. The mAbs binding the C-terminal portion of the BoNT/A heavy chain had optimal properties for use in the Endopep-MS assay.

  8. Spectroscopic properties for identifying sapphire samples from Ban Bo Kaew, Phrae Province, Thailand

    Science.gov (United States)

    Mogmued, J.; Monarumit, N.; Won-in, K.; Satitkune, S.

    2017-09-01

    Gemstone commercial is a high revenue for Thailand especially ruby and sapphire. Moreover, Phrae is a potential gem field located in the northern part of Thailand. The studies of spectroscopic properties are mainly to identify gemstone using advanced techniques (e.g. UV-Vis-NIR spectrophotometry, FTIR spectrometry and Raman spectroscopy). Typically, UV-Vis-NIR spectrophotometry is a technique to study the cause of color in gemstones. FTIR spectrometry is a technique to study the functional groups in gem-materials. Raman pattern can be applied to identify the mineral inclusions in gemstones. In this study, the natural sapphires from Ban Bo Kaew were divided into two groups based on colors including blue and green. The samples were analyzed by UV-Vis-NIR spectrophotometer, FTIR spectrometer and Raman spectroscope for studying spectroscopic properties. According to UV-Vis-NIR spectra, the blue sapphires show higher Fe3+/Ti4+ and Fe2+/Fe3+ absorption peaks than those of green sapphires. Otherwise, green sapphires display higher Fe3+/Fe3+ absorption peaks than blue sapphires. The FTIR spectra of both blue and green sapphire samples show the absorption peaks of -OH,-CH and CO2. The mineral inclusions such as ferrocolumbite and rutile in sapphires from this area were observed by Raman spectroscope. The spectroscopic properties of sapphire samples from Ban Bo Kaew, Phrae Province, Thailand are applied to be the specific evidence for gemstone identification.

  9. Spontaneous and stimulated emission in Sm3+-doped YAl3(BO3)4 single crystal

    International Nuclear Information System (INIS)

    Ryba-Romanowski, Witold; Lisiecki, Radosław; Beregi, Elena; Martín, I.R.

    2015-01-01

    Single crystals of YAl 3 (BO 3 ) 4 doped with trivalent samarium were grown by the top-seeded high temperature solution method and their absorption and emission spectra were investigated. Optical pumping into prominent absorption band around 405 nm feeds the 4 G 5/2 metastable level giving rise to intense visible luminescence distributed in several spectral lines with the most intense line around 600 nm characterized by a branching ratio of 0.42 and peak emission cross section of 0.25×10 −20 cm 2 . Optical amplification at 600 nm with a gain coefficient of 2.9 cm −1 was achieved during a pump-and-probe experiment. - Highlights: • YAB:Sm crystal grown by the top-seeded high temperature solution method. • Spectroscopic qualities relevant for visible laser operation. • YAB:Sm single crystal used in a pump-and-probe experiment. • Optical amplification properties of samarium doped YAl 3 (BO 3 ) 4

  10. Systematics in the electron transport and magnetic properties of LnBO3 perovskites

    International Nuclear Information System (INIS)

    Ganguly, P.; Rao, C.N.R.

    1980-01-01

    Systematics in the electrical and magnetic properties of transition metal perovskites LnBO 3 (Ln = rare-earth ion, B = 3d transition metal) with the variation of Ln and B ions are reviewed. The electrical resistivity and activation energy of LnBO 3 compounds increase with the decreasing size of the Ln 3+ ion for a given B ion. The low-spin to high-spin transition temperature of Co 3+ ion in LnCoO 3 similarly increase with the decrease in size of Ln 3+ while the magnetic ordering temperatures in LnVO 3 , LnFeO 3 , LnCrO 3 and LnSrCo 2 O 6 decrease with decreasing size of the rare-earth ion. These results may be understood in terms of the increasing acidity of the rare earth ion with decreasing size and the competition between the Ln 3+ and the B 3+ ions for covalency with the oxygen ions. The effect of this competition on the metal oxygen covalency and crystal field parameter is discussed in relation to the results obtained and Goodenough's phase diagram. The possibility of d-f exchange interaction in Lasub(1-x)Lnsub(x)NiOsub(3) is also discussed in the light of ESR results. (auth.)

  11. Crystal growth, electronic structure and optical properties of Sr2Mg(BO3)2

    Science.gov (United States)

    Lv, Xianshun; Wei, Lei; Wang, Xuping; Xu, Jianhua; Yu, Huajian; Hu, Yanyan; Zhang, Huadi; Zhang, Cong; Wang, Jiyang; Li, Qinggang

    2018-02-01

    Single crystals of Sr2Mg(BO3)2 (SMBO) were grown by Kyropoulos method. X-ray powder diffraction (XRD) analysis, transmission spectrum, thermal properties, band structure, density of states and charge distribution as well as Raman spectra of SMBO were described. The as-grown SMBO crystals show wide transparency range with UV cut-off below 180 nm. A direct band gap of 4.66 eV was obtained from the calculated electronic structure results. The calculated band structure and density of states results indicated the top valence band is determined by O 2p states whereas the low conduction band mainly consists of Sr 5s states. Twelve Raman peaks were observed in the experimental spectrum, fewer than the number predicted by the site group analysis. Raman peaks of SMBO were assigned combining first-principle calculation and site group analysis results. The strongest peak at 917 cm-1 in the experimental spectrum is assigned to symmetric stretching mode A1‧(ν1) of free BO3 units. SMBO is a potential Raman crystal which can be used in deep UV laser frequency conversion.

  12. Evaluation of RANS and LES models for Natural Convection in High-Aspect-Ratio Parallel Plate Channels

    Science.gov (United States)

    Fradeneck, Austen; Kimber, Mark

    2017-11-01

    The present study evaluates the effectiveness of current RANS and LES models in simulating natural convection in high-aspect ratio parallel plate channels. The geometry under consideration is based on a simplification of the coolant and bypass channels in the very high-temperature gas reactor (VHTR). Two thermal conditions are considered, asymmetric and symmetric wall heating with an applied heat flux to match Rayleigh numbers experienced in the VHTR during a loss of flow accident (LOFA). RANS models are compared to analogous high-fidelity LES simulations. Preliminary results demonstrate the efficacy of the low-Reynolds number k- ɛ formulations and their enhancement to the standard form and Reynolds stress transport model in terms of calculating the turbulence production due to buoyancy and overall mean flow variables.

  13. Reduced RAN expression and disrupted transport between cytoplasm and nucleus; a key event in Alzheimer's disease pathophysiology.

    Directory of Open Access Journals (Sweden)

    Diego Mastroeni

    Full Text Available Transcription of DNA is essential for cell maintenance and survival; inappropriate localization of proteins that are involved in transcription would be catastrophic. In Alzheimer's disease brains, and in vitro studies, we have found qualitative and quantitative deficits in transport into the nucleus of DNA methyltransferase 1 (DNMT1 and RNA polymerase II (RNA pol II, accompanied by their abnormal sequestration in the cytoplasm. RAN (RAs-related Nuclear protein knockdown, by siRNA and oligomeric Aβ42 treatment in neurons, replicate human data which indicate that transport disruption in AD may be mechanistically linked to reduced expression of RAN, a pivotal molecule in nucleocytoplasmic transport. In vitro studies also indicate a significant role for oligomeric Aβ42 in the observed phenomena. We propose a model in which reduced transcription regulators in the nucleus and their increased presence in the cytoplasm may lead to many of the cellular manifestations of Alzheimer's disease.

  14. A frequency domain linearized Navier-Stokes method including acoustic damping by eddy viscosity using RANS

    Science.gov (United States)

    Holmberg, Andreas; Kierkegaard, Axel; Weng, Chenyang

    2015-06-01

    In this paper, a method for including damping of acoustic energy in regions of strong turbulence is derived for a linearized Navier-Stokes method in the frequency domain. The proposed method is validated and analyzed in 2D only, although the formulation is fully presented in 3D. The result is applied in a study of the linear interaction between the acoustic and the hydrodynamic field in a 2D T-junction, subject to grazing flow at Mach 0.1. Part of the acoustic energy at the upstream edge of the junction is shed as harmonically oscillating disturbances, which are conveyed across the shear layer over the junction, where they interact with the acoustic field. As the acoustic waves travel in regions of strong shear, there is a need to include the interaction between the background turbulence and the acoustic field. For this purpose, the oscillation of the background turbulence Reynold's stress, due to the acoustic field, is modeled using an eddy Newtonian model assumption. The time averaged flow is first solved for using RANS along with a k-ε turbulence model. The spatially varying turbulent eddy viscosity is then added to the spatially invariant kinematic viscosity in the acoustic set of equations. The response of the 2D T-junction to an incident acoustic field is analyzed via a plane wave scattering matrix model, and the result is compared to experimental data for a T-junction of rectangular ducts. A strong improvement in the agreement between calculation and experimental data is found when the modification proposed in this paper is implemented. Discrepancies remaining are likely due to inaccuracies in the selected turbulence model, which is known to produce large errors e.g. for flows with significant rotation, which the grazing flow across the T-junction certainly is. A natural next step is therefore to test the proposed methodology together with more sophisticated turbulence models.

  15. BoA 2 and 3 - Implementation of an innovative power plant concept and first operational experience

    Energy Technology Data Exchange (ETDEWEB)

    Elsen, Reinhold O. [RWE Power AG, Essen (Germany). Research and Development; Schoeddert, Guido [RWE Power AG, Grevenbroich (Germany). BoA Neurath; Hensel, Manfred [RWE Technology GmbH, Grevenbroich (Germany). Site Management

    2013-04-01

    Units F and G of RWE Powers Neurath power plant have been in commercial operation since the summer of 2012. After Niederaussem K, they are the second and third units equipped with BoA technology (BoA = lignite-fired power plant with optimised plant technology). The BoA approach comprises e.g. optimisation measures in connection with the steam turbine, elevated steam parameters, lean design of thick-walled parts in the steam generator, improvements to the auxiliary power consumption, and heat recovery from the flue gases. With a gross rating of 1,100 MW (1,050 MW net) each has a net design efficiency of more than 43% they are the biggest and most modern lignite-fired power plants worldwide.

  16. The cyst nematode SPRYSEC protein RBP-1 elicits Gpa2- and RanGAP2-dependent plant cell death.

    Directory of Open Access Journals (Sweden)

    Melanie Ann Sacco

    2009-08-01

    Full Text Available Plant NB-LRR proteins confer robust protection against microbes and metazoan parasites by recognizing pathogen-derived avirulence (Avr proteins that are delivered to the host cytoplasm. Microbial Avr proteins usually function as virulence factors in compatible interactions; however, little is known about the types of metazoan proteins recognized by NB-LRR proteins and their relationship with virulence. In this report, we demonstrate that the secreted protein RBP-1 from the potato cyst nematode Globodera pallida elicits defense responses, including cell death typical of a hypersensitive response (HR, through the NB-LRR protein Gpa2. Gp-Rbp-1 variants from G. pallida populations both virulent and avirulent to Gpa2 demonstrated a high degree of polymorphism, with positive selection detected at numerous sites. All Gp-RBP-1 protein variants from an avirulent population were recognized by Gpa2, whereas virulent populations possessed Gp-RBP-1 protein variants both recognized and non-recognized by Gpa2. Recognition of Gp-RBP-1 by Gpa2 correlated to a single amino acid polymorphism at position 187 in the Gp-RBP-1 SPRY domain. Gp-RBP-1 expressed from Potato virus X elicited Gpa2-mediated defenses that required Ran GTPase-activating protein 2 (RanGAP2, a protein known to interact with the Gpa2 N terminus. Tethering RanGAP2 and Gp-RBP-1 variants via fusion proteins resulted in an enhancement of Gpa2-mediated responses. However, activation of Gpa2 was still dependent on the recognition specificity conferred by amino acid 187 and the Gpa2 LRR domain. These results suggest a two-tiered process wherein RanGAP2 mediates an initial interaction with pathogen-delivered Gp-RBP-1 proteins but where the Gpa2 LRR determines which of these interactions will be productive.

  17. CFD RANS Simulations on a Generic Conventional Scale Model Submarine: Comparison between Fluent and OpenFOAM

    Science.gov (United States)

    2015-09-01

    UNCLASSIFIED UNCLASSIFIED CFD RANS Simulations on a Generic Conventional Scale Model Submarine: Comparison between Fluent and OpenFOAM ... OpenFOAM to replace some of the Fluent simulations. The fidelity of the Fluent code has been carefully validated, but the accuracy of parts of the... OpenFOAM code have not been so extensively tested. To test the accuracy of the OpenFOAM software, CFD simulations have been performed on the DSTO

  18. Comparison of nested PCR and qPCR for the detection and quantitation of BoHV6 DNA.

    Science.gov (United States)

    Kubiś, Piotr; Materniak, Magdalena; Kuźmak, Jacek

    2013-12-01

    Nested PCR and qPCR (quantitative PCR) tests based on glycoprotein B (gB) gene were designed for detecting Bovine herpesvirus 6 (BoHV6) in bovine whole blood samples and wild ruminant blood clots (deer and roe-deer). This virus, commonly known as BLHV (bovine lymphotropic herpesvirus) belongs to the Herpesviridae family, subfamily Gammaherpesvirinae and Macavirus genus. DNA isolated from 92 dairy cow blood samples and 69 wild ruminant clots were examined for the presence of BoHV6 using nested PCR and qPCR tests. Viral DNA was detected by using nested PCR in 59 out of 92 bovine blood samples (64.1%), and by qPCR in 68 out of 92 bovine blood samples (73.9%), but none out of 69 DNA samples isolated from wild ruminant blood clots, was positive in both assays. The specificity of nested PCR and qPCR was confirmed by using BoHV1, BoHV4, BoHV6, BFV, BIV, and BLV DNA. The sensitivity of nested PCR and qPCR was determined using a serially 10-fold diluted vector pCR2.1HgB (2 × 10(0)-2 × 10(6)copies/reaction). In this testing, qPCR was more sensitive than the nested PCR, detecting two copies of BoHV6 whilst the limit of detection for nested PCR was 20 copies. In all qPCR assays, the coefficients of determination (R(2)) ranged between 0.990 and 0.999, and the calculated amplification efficiencies (Eff%) within the range of 89.7-106.9. The intra- and inter-assay CV (coefficient of variation) values did not exceed 4%. Copyright © 2013 Elsevier B.V. All rights reserved.

  19. A Priori Analysis of a Compressible Flamelet Model using RANS Data for a Dual-Mode Scramjet Combustor

    Science.gov (United States)

    Quinlan, Jesse R.; Drozda, Tomasz G.; McDaniel, James C.; Lacaze, Guilhem; Oefelein, Joseph

    2015-01-01

    In an effort to make large eddy simulation of hydrocarbon-fueled scramjet combustors more computationally accessible using realistic chemical reaction mechanisms, a compressible flamelet/progress variable (FPV) model was proposed that extends current FPV model formulations to high-speed, compressible flows. Development of this model relied on observations garnered from an a priori analysis of the Reynolds-Averaged Navier-Stokes (RANS) data obtained for the Hypersonic International Flight Research and Experimentation (HI-FiRE) dual-mode scramjet combustor. The RANS data were obtained using a reduced chemical mechanism for the combustion of a JP-7 surrogate and were validated using avail- able experimental data. These RANS data were then post-processed to obtain, in an a priori fashion, the scalar fields corresponding to an FPV-based modeling approach. In the current work, in addition to the proposed compressible flamelet model, a standard incompressible FPV model was also considered. Several candidate progress variables were investigated for their ability to recover static temperature and major and minor product species. The effects of pressure and temperature on the tabulated progress variable source term were characterized, and model coupling terms embedded in the Reynolds- averaged Navier-Stokes equations were studied. Finally, results for the novel compressible flamelet/progress variable model were presented to demonstrate the improvement attained by modeling the effects of pressure and flamelet boundary conditions on the combustion.

  20. Critical role of RanBP2-mediated SUMOylation of Small Heterodimer Partner in maintaining bile acid homeostasis

    Science.gov (United States)

    Kim, Dong-Hyun; Kwon, Sanghoon; Byun, Sangwon; Xiao, Zhen; Park, Sean; Wu, Shwu-Yuan; Chiang, Cheng-Ming; Kemper, Byron; Kemper, Jongsook Kim

    2016-01-01

    Bile acids (BAs) are recently recognized signalling molecules that profoundly affect metabolism. Because of detergent-like toxicity, BA levels must be tightly regulated. An orphan nuclear receptor, Small Heterodimer Partner (SHP), plays a key role in this regulation, but how SHP senses the BA signal for feedback transcriptional responses is not clearly understood. We show an unexpected function of a nucleoporin, RanBP2, in maintaining BA homoeostasis through SUMOylation of SHP. Upon BA signalling, RanBP2 co-localizes with SHP at the nuclear envelope region and mediates SUMO2 modification at K68, which facilitates nuclear transport of SHP and its interaction with repressive histone modifiers to inhibit BA synthetic genes. Mice expressing a SUMO-defective K68R SHP mutant have increased liver BA levels, and upon BA- or drug-induced biliary insults, these mice exhibit exacerbated cholestatic pathologies. These results demonstrate a function of RanBP2-mediated SUMOylation of SHP in maintaining BA homoeostasis and protecting from the BA hepatotoxicity. PMID:27412403

  1. Accuracy of the actuator disc-RANS approach for predicting the performance and wake of tidal turbines.

    Science.gov (United States)

    Batten, W M J; Harrison, M E; Bahaj, A S

    2013-02-28

    The actuator disc-RANS model has widely been used in wind and tidal energy to predict the wake of a horizontal axis turbine. The model is appropriate where large-scale effects of the turbine on a flow are of interest, for example, when considering environmental impacts, or arrays of devices. The accuracy of the model for modelling the wake of tidal stream turbines has not been demonstrated, and flow predictions presented in the literature for similar modelled scenarios vary significantly. This paper compares the results of the actuator disc-RANS model, where the turbine forces have been derived using a blade-element approach, to experimental data measured in the wake of a scaled turbine. It also compares the results with those of a simpler uniform actuator disc model. The comparisons show that the model is accurate and can predict up to 94 per cent of the variation in the experimental velocity data measured on the centreline of the wake, therefore demonstrating that the actuator disc-RANS model is an accurate approach for modelling a turbine wake, and a conservative approach to predict performance and loads. It can therefore be applied to similar scenarios with confidence.

  2. İstanbul’da 1999 Yılında Sonuçlanmış Boşanma Davalarında Boşanma Nedenlerinin Değerlendirilmesi

    Directory of Open Access Journals (Sweden)

    Halim Dişsever

    2000-12-01

    Full Text Available Bu çalışmada İstanbul'da 1999 yılında sonuçlanmış boşanma davalarından rastlantısal örnekleme yöntemiyle seçilen 3060 boşanma olgusu incelenerek, boşanma nedenleri ve diğer değişkenler arasındaki ilişkilerin değerlendirilmesi amaçlanmıştır İncelenen ve davası sonuçlanmış toplam 3060 boşanma davasının %67.1’si kailin (2053, %32.9'u (1007 erkek taralından açılmıştır, boşanma nedenlerine göre dağılım incelendiğinde ilk sırayı şiddetli geçimsizlik, ikinci sırayı alkol kötüye kullanımı, üçüncü sırayı cana kast ve pek fena muamele. i sırayı ise terk boşanma nedeninin aldığı görülmektedir. Boşanan çiftlerin %41.6 sı (1272 çift çocuksuz olup. %40.4 ü (12.36 çift evliliklerinin ilk 5 yılı içinde boşanmışlardır. Çocukların çoğunun yaşları küçük olduğundan velayetlerin annelere verilme oranı daha yüksektir. Olguların %7.6’smıla (233 çift eşlerden birinin, %28.2’ sinde (864 çift her ikisinin İstanbul nüfusuna kayıtlı olduğu, %64.2’sinde (196.3 çift her ikisinin nüfus kaydının İstanbul dışında olduğu saptanmıştır. Boşanma sonrası eşler ve çocukları ruhsal ve ekonomik sorunlarla karşı karşıya kalmaktadır. Sosyal güvenceleri, eşlerin nafaka durumları, işsizlik ve çocukların eğitini durumu göz önüne alındığında sosyal destek mekanizmalarının daha ila güçlendirilmesi toplum ruh sağlığı açısından faydalı olacaktır. Anahtar Kelimeler: Boşanma, boşanma nedenleri.

  3. A Density Functional Theory Study of the Ionic and Electronic Transport Mechanisms in LiFeBO3 Battery Electrodes

    DEFF Research Database (Denmark)

    Loftager, Simon; García Lastra, Juan Maria; Vegge, Tejs

    2016-01-01

    electrochemical effects can be explained by an intrinsically low Li-ion and electron/hole-polaron mobility in Li0.5FeBO3 due to high activation barriers for both the ionic and electronic transport. These studies include the effects of the experimentally reported commensurate modulation. We have also investigated...... with the formation of intermediate phases is linked to the intrinsically poor properties of the Li0.5FeBO3 phase rather than to the presence of interfaces between different phases....

  4. Genetics and fine mapping of a purple leaf gene, BoPr, in ornamental kale (Brassica oleracea L. var. acephala).

    Science.gov (United States)

    Liu, Xiao-Ping; Gao, Bao-Zhen; Han, Feng-Qing; Fang, Zhi-Yuan; Yang, Li-Mei; Zhuang, Mu; Lv, Hong-Hao; Liu, Yu-Mei; Li, Zhan-Sheng; Cai, Cheng-Cheng; Yu, Hai-Long; Li, Zhi-Yuan; Zhang, Yang-Yong

    2017-03-14

    Due to its variegated and colorful leaves, ornamental kale (Brassica oleracea L. var. acephala) has become a popular ornamental plant. In this study, we report the fine mapping and analysis of a candidate purple leaf gene using a backcross population and an F 2 population derived from two parental lines: W1827 (with white leaves) and P1835 (with purple leaves). Genetic analysis indicated that the purple leaf trait is controlled by a single dominant gene, which we named BoPr. Using markers developed based on the reference genome '02-12', the BoPr gene was preliminarily mapped to a 280-kb interval of chromosome C09, with flanking markers M17 and BoID4714 at genetic distances of 4.3 cM and 1.5 cM, respectively. The recombination rate within this interval is almost 12 times higher than the usual level, which could be caused by assembly error for reference genome '02-12' at this interval. Primers were designed based on 'TO1000', another B. oleracea reference genome. Among the newly designed InDel markers, BRID485 and BRID490 were found to be the closest to BoPr, flanking the gene at genetic distances of 0.1 cM and 0.2 cM, respectively; the interval between the two markers is 44.8 kb (reference genome 'TO1000'). Seven annotated genes are located within the 44.8 kb genomic region, of which only Bo9g058630 shows high homology to AT5G42800 (dihydroflavonol reductase), which was identified as a candidate gene for BoPr. Blast analysis revealed that this 44.8 kb interval is located on an unanchored scaffold (Scaffold000035_P2) of '02-12', confirming the existence of assembly error at the interval between M17 and BoID4714 for reference genome '02-12'. This study identified a candidate gene for BoPr and lays a foundation for the cloning and functional analysis of this gene.

  5. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    International Nuclear Information System (INIS)

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.

    2013-01-01

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  6. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)

    2013-12-15

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  7. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Directory of Open Access Journals (Sweden)

    Curie Virág

    2014-10-01

    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  8. Investigation of the dynamic NMR frequency shift for Fe57 in FeBO3

    International Nuclear Information System (INIS)

    Bun'kov, Yu.M.; Punkkinen, M.; Yulinen, E.E.

    1978-01-01

    NMR of Fe 57 in FeBO 3 is investigated by pulsed magnetic resonance techniques in the 2 to 70 K temperature range. A dynamic NMR frequency shift is observed which is due to coupling between the NMR oscillations and the low-frequency AFMR mode, the magnitude of which only slightly exceeds the micro-inhomogeneous broadening of the NMR line caused by the spread of the value of hyperfine field at the nuclei. Under these conditions the nuclear spin system possesses a number of unusual properties. Thus, broadening of the magnetic resonance line is uniform, the magnitude of the homogeneous broadening depends on the angle of deviation of the nuclear magnetization from the equilibrium axis, and an echo signal is detected which is similar to the ''solid echo'' in substances with dipole broadening of the magnetic resonance line

  9. Uptake and accumulation of lead by plants from the Bo Ngam lead mine area in Thailand

    International Nuclear Information System (INIS)

    Rotkittikhun, P.; Kruatrachue, M.; Chaiyarat, R.; Ngernsansaruay, C.; Pokethitiyook, P.; Paijitprapaporn, A.; Baker, A.J.M.

    2006-01-01

    A field survey of terrestrial plants growing on Bo Ngam lead mine area, Thailand, was conducted to identify species accumulating exceptionally high concentrations of lead. Plant and soil samples were collected from five areas. Lead concentrations in surface soil ranged from 325 to 142 400 mg/kg. The highest lead concentration in soil was found at the ore dressing plant area and lowest at a natural pond area. In different areas, the concentrations of lead in plants were different when comparing various study sites. A total of 48 plant species belonging to 14 families were collected from five sampling sites. Twenty-six plant species had lead concentrations more than 1000 mg/kg in their shoots. Three species (Microstegium ciliatum, Polygala umbonata, Spermacoce mauritiana) showed extremely high lead concentrations in their shoots (12 200-28 370 mg/kg) and roots (14 580-128 830 mg/kg). - Uptake and accumulation of lead by plants

  10. Control and initial operation of the Fermilab BO low β insertion

    International Nuclear Information System (INIS)

    Finley, D.A.; Johnson, R.P.; Willeke, F.

    1985-06-01

    The operation of the Fermilab BO low β insertion involves the coordinated control of the 4 strings of quadrupoles of the insertion itself along with several magnetic correction elements (20 dipoles for the closed orbit, 2 quad circuits for betatron tunes, 1 skew quad circuit for coupling, and 2 sextupole circuits for chromaticity). When the beam is stored at high energy, these elements must correct the errors induced by the strong superconducting quadrupoles of the insertion as the optics are smoothly changed from the fixed target configuration to the low β state. The techniques and control programs for these manipulations and initial tests using a single coasting beam are described. 6 refs., 4 figs

  11. Fe-induced enhancement of antiferromagnetic spin correlations in Mn2-xFexBO4

    Science.gov (United States)

    Kazak, N. V.; Platunov, M. S.; Knyazev, Yu. V.; Moshkina, E. M.; Gavrilkin, S. Yu.; Bayukov, O. A.; Gorev, M. V.; Pogoreltsev, E. I.; Zeer, G. M.; Zharkov, S. M.; Ovchinnikov, S. G.

    2018-04-01

    Fe substitution effect on the magnetic behavior of Mn2-xFexBO4 (x = 0.3, 0.5, 0.7) warwickites has been investigated combining Mössbauer spectroscopy, dc magnetization, ac magnetic susceptibility, and heat capacity measurements. The Fe3+ ions distribution over two crystallographic nonequivalent sites is studied. The Fe introduction breaks a long-range antiferromagnetic order and leads to onset of spin-glass ground state. The antiferromagnetic short-range-order spin correlations persist up to temperatures well above TSG reflecting in increasing deviations from the Curie-Weiss law, the reduced effective magnetic moment and "missing" entropy. The results are interpreted in the terms of the progressive increase of the frustration effect and the formation of spin-correlated regions.

  12. Luminescence properties of Nd{sup 3+}-doped (Y,Gd)BO{sub 3} phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Yi, Soung Soo; Kim, Ji-Chul; Kim, Dong Woo [Department of Electronic Materials Engineering, Silla University, Busan 617-736 (Korea, Republic of); Balakrishnaiah, R. [Department of Electronic Materials Engineering, Silla University, Busan 617-736 (Korea, Republic of); Department of Physics, Pukyong National University, Busan 608-737 (Korea, Republic of); Kim, Sung Hoon [Department of Engineering in Energy and Applied Chemistry, Silla University, Busan 617-736 (Korea, Republic of); Jang, Kiwan, E-mail: kwjang@changwon.ac.k [Department of Physics, Changwon National University, Changwon 641-773 (Korea, Republic of); Lee, Ho Sueb [Department of Physics, Changwon National University, Changwon 641-773 (Korea, Republic of); Moon, Byung Kee; Jeong, Jung Hyun [Department of Physics, Pukyong National University, Busan 608-737 (Korea, Republic of)

    2010-09-01

    A system of 0.03 mol Nd{sup 3+}-doped (Y,Gd)BO{sub 3} phosphors were prepared by the conventional solid state reaction method for different concentrations of Gd{sup 3+} ions and were characterized by X-ray diffraction (XRD), field emission scanning electron microscopy (FESEM) and NIR emission measurements. The emitted radiation was dominated by 1057 nm peak in the NIR region as a result of {sup 4}F{sub 3/2} {yields} {sup 4}I{sub 11/2} transitions of Nd{sup 3+} ions. As the concentration of Gd{sup 3+} ions increases from 0.00 to 0.57 mol, the grain sizes and the intensity of NIR emission peaks were improved. The results are discussed in comparison with similar reported works.

  13. Cascade de photons dans les boîtes quantiques uniques

    Science.gov (United States)

    Robert, I.; Moreau, E.; Gérard, J. M.; Abram, I.

    2002-06-01

    Nous présentons l'observation expérimentale de l'émission squentielle de photons par une boîte quantique unique sous pompage optique continu ou pulsé. Cette cascade radiative produit des paires de photons corrélés qui sont émis suivant un ordre bien défini. En effet, la fonction de corrélation croisée entre les deux photons formant la paire présente une allure asymétrique, de type groupement ou dégroupement de photons, suivant l'ordre temporel de détection des deux photons. Prédit théoriquement en physique atomique, ce comportement asymétrique de la fonction de corrélation de second ordre est la signature de l'émission successive de photons.

  14. Tunable blue–violet Cr3+:LiCAF + BiBO compact laser

    International Nuclear Information System (INIS)

    Maestre, H; Torregrosa, A J; Capmany, J

    2015-01-01

    We present a compact continuous wave (CW) external-cavity tunable Cr 3+ :LiCaAlF 6 (Cr:LiCAF) laser which is intracavity frequency doubled using a BiB 3 O 6 (BiBO) nonlinear crystal to obtain tunable blue–violet radiation. The generated second harmonic (SH) can be tuned by means of either angular or temperature variation of the nonlinear crystal. We have obtained SH radiation between 390–415 nm and a maximum output power of 34 mW at 400 nm. Future improvements on the SH tuning range and output power are addressed in the text. Our results may be applied in the design of compact tunable composite external-cavity solid-state lasers. (paper)

  15. Preparation of red phosphor (Y, Gd)BO3:Eu by soft chemistry methods

    International Nuclear Information System (INIS)

    Cui Xiangzhong; Zhuang Weidong; Yu Zhijian; Xia Tian; Huang Xiaowei; Li Hongwei

    2008-01-01

    The three soft chemistry methods were employed to prepare the red phosphor (Y, Gd)BO 3 :Eu, such as coprecipitation-combustion method, salt assisted combustion method and emulsion method. The main factors affecting particle size, particle distribution and luminescent properties of the product were investigated in detail, and as a result, the preparation processes were optimized. The phosphors were characterized by X-ray diffraction (XRD), scanning electronic microscope (SEM), transmission electronic microscope (TEM) and vacuum ultraviolet (VUV) spectra. Results reveal that phosphors with different morphology, small particle size and high luminescence intensity could be obtained by soft chemistry methods. The difference between the luminescence properties of phosphors in this work and commercial rare earth borate phosphor is discussed. The phosphor with grain shape and high luminescence intensity could be prepared by coprecipitation-combustion method, nanophosphor could be prepared by salt assisted combustion method, and spherical phosphor with a narrow size distribution could be obtained by using emulsion method

  16. Scintillation characteristics of Tm3+ in Ca3(BO3)2 crystals

    International Nuclear Information System (INIS)

    Fujimoto, Yutaka; Yanagida, Takayuki; Yokota, Yuui; Kawaguchi, Noriaki; Fukuda, Kentaro; Totsuka, Daisuke; Watanabe, Kenichi; Yamazaki, Atsushi; Yoshikawa, Akira

    2011-01-01

    Basic optical properties and radiation responses of undoped, Tm 3+ 1.0% and 2.0% activated Ca 3 (BO 3 ) 2 (CBO) crystalline scintillator prepared by the micro-pulling down (μ-PD) method are reported. Tm 3+ : CBO crystals showed three weak absorption bands around 190, 260 and 350 nm, owing to the Tm 3+ 4f–4f transition. Strong blue luminescence peaks at 360 and 460 nm which are ascribed to the 1 D 2 – 3 H 6 and 1 D 2 – 3 F 4 transitions of Tm 3+ respectively were observed under 241 Am 5.5 MeV α-ray excitation. The scintillation light yield of 2.0% Tm 3+ -doped CBO crystal was evaluated to be about 250 ph/n from the 252 Cf excited pulse height spectrum.

  17. Stimulated luminescence property of Zn(BO{sub 2}){sub 2}:TbCl{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Cedillo, G.; Cruz Z, E. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Garcia H, M. [UNAM, Instituto de Investigaciones en Materiales, Posgrado en Ciencia e Ingenieria de Materiales, Apdo. Postal 70-360, 04510 Mexico D. F. (Mexico); Marcazzo, J. [Instituto de Fisica Arroyo Seco / UNICEN, Gral. Pinto 399, 7000 Tandil, Buenos Aires (Argentina); Hernandez A, J. M.; Murrieta S, H., E-mail: ecruz@nucleares.unam.mx [UNAM, Instituto de Fisica, Apdo. Postal 20-364, 01000 Mexico D. F. (Mexico)

    2015-10-15

    Zinc borate, Zn(BO{sub 2}){sub 2}, doped with TbCl{sub 3} at different concentration (0.5-8 mol %) was synthesized. The polycrystalline samples were characterized by Scanning Electron Microscopy (Sem/EDS) and X-ray Diffraction. The X-ray difractrograms of the pure samples sintered at 750 and 800 degrees C shown the evidence of the Zn(BO{sub 2}){sub 2} has the body centered cubic (bcc) structure and a ZnB{sub 4}O{sub 7} primitive orthorhombic phase of the crystal system. The thermoluminescent (Tl) intensity was dependent on the thermal treatment (250-500 degrees C) and also on the impurity concentration. The glow curves show four glow peaks at about 82, 164, 251, and 331 degrees C when the Tb{sup 3+} doped zinc borate samples were exposed to gamma or beta radiation. The structure of the glow curves was analyzed by CGCD deconvolution method. The kinetics parameters (activation energy, frequency factor and the kinetic order) were calculated assuming the general order kinetics model describing accurately the Tl process. The glow peaks were overlapped and then the whole glow curve was considered for dosimetric characteristics measurements. The linear Tl response as a function of gamma and beta doses was performed using a {sup 60}Co irradiator and a {sup 90}Sr, respectively. Zinc borate with 8 mol % of impurity concentration exhibited an intense radio luminescent (Rl) emission. The Rl spectra show their maximum bands at 370, 490, 545 and 700 nm. The linear dose-response was between 2.2 c Gy and 27.7 Gy when the samples were exposed to beta radiation. These results suggest that the Tb -doped zinc borate material is a good phosphor for use in radiation dosimetry because its high Tl sensitivity to the ionizing radiation and good dose-response. (Author)

  18. Identification of lactic acid bacteria from chili bo, a Malaysian food ingredient.

    Science.gov (United States)

    Leisner, J J; Pot, B; Christensen, H; Rusul, G; Olsen, J E; Wee, B W; Muhamad, K; Ghazali, H M

    1999-02-01

    Ninety-two strains of lactic acid bacteria (LAB) were isolated from a Malaysian food ingredient, chili bo, stored for up to 25 days at 28 degreesC with no benzoic acid (product A) or with 7,000 mg of benzoic acid kg-1 (product B). The strains were divided into eight groups by traditional phenotypic tests. A total of 43 strains were selected for comparison of their sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) whole-cell protein patterns with a SDS-PAGE database of LAB. Isolates from product A were identified as Lactobacillus plantarum, Lactobacillus fermentum, Lactobacillus farciminis, Pediococcus acidilactici, Enterococcus faecalis, and Weissella confusa. Five strains belonging to clusters which could not be allocated to existing species by SDS-PAGE were further identified by 16S rRNA sequence comparison. One strain was distantly related to the Lactobacillus casei/Pediococcus group. Two strains were related to Weissella at the genus or species level. Two other strains did not belong to any previously described 16S rRNA group of LAB and occupied an intermediate position between the L. casei/Pediococcus group and the Weissella group and species of Carnobacterium. The latter two strains belong to the cluster of LAB that predominated in product B. The incidence of new species and subspecies of LAB in chili bo indicate the high probability of isolation of new LAB from certain Southeast Asian foods. None of the isolates exhibited bacteriocin activity against L. plantarum ATCC 14917 and LMG 17682.

  19. Identification of Lactic Acid Bacteria from Chili Bo, a Malaysian Food Ingredient

    Science.gov (United States)

    Leisner, Jørgen J.; Pot, Bruno; Christensen, Henrik; Rusul, Gulam; Olsen, John E.; Wee, Bee Wah; Muhamad, Kharidah; Ghazali, Hasanah M.

    1999-01-01

    Ninety-two strains of lactic acid bacteria (LAB) were isolated from a Malaysian food ingredient, chili bo, stored for up to 25 days at 28°C with no benzoic acid (product A) or with 7,000 mg of benzoic acid kg−1 (product B). The strains were divided into eight groups by traditional phenotypic tests. A total of 43 strains were selected for comparison of their sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) whole-cell protein patterns with a SDS-PAGE database of LAB. Isolates from product A were identified as Lactobacillus plantarum, Lactobacillus fermentum, Lactobacillus farciminis, Pediococcus acidilactici, Enterococcus faecalis, and Weissella confusa. Five strains belonging to clusters which could not be allocated to existing species by SDS-PAGE were further identified by 16S rRNA sequence comparison. One strain was distantly related to the Lactobacillus casei/Pediococcus group. Two strains were related to Weissella at the genus or species level. Two other strains did not belong to any previously described 16S rRNA group of LAB and occupied an intermediate position between the L. casei/Pediococcus group and the Weissella group and species of Carnobacterium. The latter two strains belong to the cluster of LAB that predominated in product B. The incidence of new species and subspecies of LAB in chili bo indicate the high probability of isolation of new LAB from certain Southeast Asian foods. None of the isolates exhibited bacteriocin activity against L. plantarum ATCC 14917 and LMG 17682. PMID:9925588

  20. A novel UV-emitting phosphor: NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+}

    Energy Technology Data Exchange (ETDEWEB)

    Pekgözlü, İlhan, E-mail: pekgozluilhan@yahoo.com

    2016-01-15

    Pb{sup 2+} doped NaSr{sub 4}(BO{sub 3}){sub 3} materials were prepared by a solution combustion synthesis method. The phase analysis of all synthesized materials was carried out using the powder XRD. The synthesized materials were investigated using spectrofluorometer at room temperature. The excitation and emission bands of NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+} were observed at 291 and 368 nm, respectively. The dependence of the emission intensity on the Pb{sup 2+} concentration for the NaSr{sub 4}(BO{sub 3}){sub 3} was studied in detail. It was observed that the concentration quenching of Pb{sup 2+} in NaSr{sub 4}(BO{sub 3}){sub 3} is 0.01 mol. The Stokes shifts of NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+} phosphor were calculated to be 7190 cm{sup −1}. - Highlights: • A novel UV-emitting phosphor, NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+}, was prepared by combustion method. • The excitation and emission bands of NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+} were observed at 291 and 368 nm, respectively. • It was observed that the concentration quenching of Pb{sup 2+} in NaSr{sub 4}(BO{sub 3}){sub 3} is 0.01 mol.

  1. Impact of interstitial iron on the study of meta-stable B-O defects in Czochralski silicon: Further evidence of a single defect

    Science.gov (United States)

    Kim, Moonyong; Chen, Daniel; Abbott, Malcolm; Nampalli, Nitin; Wenham, Stuart; Stefani, Bruno; Hallam, Brett

    2018-04-01

    We explore the influence of interstitial iron (Fei) on lifetime spectroscopy of boron-oxygen (B-O) related degradation in p-type Czochralski silicon. Theoretical and experimental evidence presented in this study indicate that iron-boron pair (Fe-B) related reactions could have influenced several key experimental results used to derive theories on the fundamental properties of the B-O defect. Firstly, the presence of Fei can account for higher apparent capture cross-section ratios (k) of approximately 100 observed in previous studies during early stages of B-O related degradation. Secondly, the association of Fe-B pairs can explain the initial stage of a two-stage recovery of carrier lifetime with dark annealing after partial degradation. Thirdly, Fei can result in high apparent k values after the permanent deactivation of B-O defects. Subsequently, we show that a single k value can describe the recombination properties associated with B-O defects throughout degradation, that the recovery during dark annealing occurs with a single-stage, and both the fast- and slow-stage B-O related degradation can be permanently deactivated during illuminated annealing. Accounting for the recombination activity of Fei provides further evidence that the B-O defect is a single defect, rather than two separate defects normally attributed to fast-forming recombination centers and slow-forming recombination centers. Implications of this finding for the nature of the B-O defect are also discussed.

  2. Spectroscopic study of magnetic phase transitions and magnetic structures in rare earth ferroborates RFe3(BO3)4 (R = Y, Er, Tb, Gd)

    International Nuclear Information System (INIS)

    Popova, M.N.; Chukalina, E.P.; Stanislavchuk, T.N.; Bezmaternykh, L.N.

    2006-01-01

    One investigated into the absorption spectra of RFe 3 (BO 3 ) 4 , R=Y, Er, Tb, Gd rare earth borate single crystals containing erbium (1%) introduced to serve as a probe. On the basis of the temperature dependences of Er 3+ ion spectral line splittings one determined the values of the magnetic ordering temperatures of Er, Tb and Gd ferroborates and the temperatures of the spin reoriented first order phase transition in GdFe 3 (BO 3 ) 4 :Er 3+ (1%). On the basis of comparison of the splitting values of Er 3+ ion ground state in RFe 3 (BO 3 ) 4 (R=Y, Er, Tb) and in GdFe 3 (BO 3 )4 compounds the magnetic structure of which is known one makes a concussion about the orientation of iron magnetic moments in the magneto-ordered state: a lightly planar structure is observed for YFe 3 (BO 3 ) 4 and ErFe 3 (BO 3 ) 4 and a lightly axial one - for TbFe 3 (BO 3 ) 4 . One discusses the role of R 3+ ion single ion anisotropy when determining the magnetic structure type in RFe 3 (BO 3 ) 4 [ru

  3. I RAN Fast and I Remembered What I Read: The Relationship between Reading, Rapid Automatic Naming, and Auditory and Visual Short-Term Memory

    Directory of Open Access Journals (Sweden)

    Sheila G. Crewther

    2011-05-01

    Full Text Available Although rapid automatic naming (RAN speed and short-term auditory memory are widely recognised as good predictors of reading ability in most age groups, the predictive value of short-term memory for visually presented digits for reading and RAN in young typically developing learner readers (mean age 91.5 months has seldom been investigated. We found that visual digit span is a better predictor of reading ability than auditory digit span in learner readers. A significant correlation has also been found between RAN speed and visual, but not auditory digit span. These results suggests that RAN speed may be a good predictor of a child's future reading ability and eventual fluency because like visual digit span, it is a measure of rate of access to memory for the visual icons and their semantic name and meaning. The results also suggest that auditory memory is not an important factor in young children learning to read.

  4. In-Vivo Neutralization of Botulinum Neurotoxin Serotype E Using Rabbit Polyclonal Antibody Developed against BoNT/E Light Chain.

    Science.gov (United States)

    Rani, Sarita; Ponmariappan, S; Sharma, Arti; Kamboj, D V; Jain, A K

    2017-01-01

    Clostridium botulinum is an obligate anaerobic, Gram positive bacterium that secretes extremely toxic substances known as botulinum neurotoxins (BoNTs) that cause serious paralytic illness called botulism. Based upon the serological properties, these neurotoxin have been classified into seven serotypes designated from A to G. Due to extreme toxicity of BoNTs, these neurotoxins have been designated as category A biowarfare agents. There is no commercial neutralizing antibody available for the treatment of botulism. Hence there is an urgent need to develop therapeutic intervention for prevention and cure of botulism within short period. BoNT antiserum injection is still the effective treatment. In the present study, the recombinant light chain of BoNT/E was successfully purified in soluble form. The purified rBoNT/E LC was used for the generation of polyclonal antibody in rabbit. In order to find out the neutralizing capacity of generated antisera, rabbit antiserum was incubated with 20 LD50 of botulinum neurotoxin type E for 1 hour at 37°C and then injected intraperitoneally (IP) into mice. Further in another set of experiments antiserum was administered in different ways that included administration of - antiserum and BoNT/E toxin simultaneously without preincubation, one after another at the same and different time points for its therapeutic ability. To find out cross neutralization capacity, rBoNT/E LC antiserum was pre-incubated with 5 LD50 of BoNT/A, BoNT/B, BoNT/F and then injected (IP) into mice. In all the cases mice were observed continuously for 96 hours. The results clearly indicate that developed polyclonal rabbit antiserum showed serotype specific neutralization of BoNT/E toxin only but not of BoNT/A, BoNT/B and BoNT/F. The developed antibodies will be used for preventive and therapeutic intervention of type 'E' botulism. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  5. Linear and nonlinear optical susceptibilities for a novel borate oxide BaBiBO4: Theory and experiment

    Czech Academy of Sciences Publication Activity Database

    Reshak, Ali H; Auluck, S.; Kityk, I. V.

    2008-01-01

    Roč. 4, č. 181 (2008), s. 789-795 ISSN 0022-4596 Institutional research plan: CEZ:AV0Z60870520 Keywords : electronic structure * optical properties * SHG * DFT Subject RIV: BO - Biophysics Impact factor: 1.910, year: 2008

  6. Konflikt i wojna jako „bicz Boży” w literaturze bułgarskiego średniowiecza

    Directory of Open Access Journals (Sweden)

    Marzanna Kuczyńska

    2017-10-01

    Full Text Available Conflict and war as the “whip of God” in the literature of the Bulgarian Middle Ages The article focuses on the motif of war as a tool for the realization of God’s plans for people and the sign of His reward, and above all the penalty for human misdeeds, so called “whip of God”. The forms of the presence of the idea of God’s whip, his literary images and the functions it implements, are analyzed. The analysis was carried out on the material of the Bulgarian literature from 10th-15th century.   Konflikt i wojna jako „bicz Boży” w literaturze bułgarskiego średniowiecza Przedmiotem zainteresowania w artykule jest motyw wojny jako narzędzia realizacji Bożych planów wobec ludzi i znaku Jego nagrody, a przede wszystkim kary za ludzkie przewinienia, tzw. „bicz Boży”. Analizowane są formy obecności idei „bicza Bożego”, jego literackie wyobrażenia i funkcje, jakie realizuje. Analizę przeprowadzono na materiale bułgarskiego piśmiennictwa X–XV wieku.

  7. KCa4(BO33:Ln3+ (Ln = Dy, Eu, Tb phosphors for near UV excited white–light–emitting diodes

    Directory of Open Access Journals (Sweden)

    Allu Amarnath Reddy

    2013-02-01

    Full Text Available A series of doped KCa4(BO33:Ln3+ (Ln: Dy, Eu and Tb compositions were synthesized by solid–state reaction method and their photoluminescent properties were systematically investigated to ascertain their suitability for application in white light emitting diodes. The X–ray diffraction (XRD and nuclear magnetic resonance (MAS–NMR data indicates that Ln3+–ions are successfully occupied the non–centrosymmetric Ca2+ sites, in the orthorhombic crystalline phase of KCa4(BO33 having space group Ama2, without affecting the boron chemical environment. The present phosphor systems could be efficiently excitable at the broad UV wavelength region, from 250 to 350 nm, compatible to the most commonly available UV light–emitting diode (LED chips. Photoluminescence studies revealed optimal near white–light emission for KCa4(BO33 with 5 wt.% Dy3+ doping, while warm white–light (CIE; X = 0.353, Y = 0.369 is obtained at 1wt.% Dy3+ ion concentration. The principle of energy transfer between Eu3+ and Tb3+ also demonstrates the potential white–light from KCa4(BO33:Eu3+,Tb3+ phosphor. Whereas, single Tb3+ and Eu3+–doped systems showed bright green (Tb3+ and red (Eu3+ emissions, respectively. Having structural flexibility along with remarkable chemical/thermal stability and suitable quantum efficiency these phosphors can be promising candidates as white–light–emitter for near UV LEDs.

  8. Theory of the orthogonal dimer Heisenberg spin model for SrCu sub 2 (BO sub 3) sub 2

    CERN Document Server

    Miyahara, S

    2003-01-01

    The magnetic properties of SrCu sub 2 (BO sub 3) sub 2 are reviewed from a theoretical point of view. SrCu sub 2 (BO sub 3) sub 2 is a new two-dimensional spin gap system and its magnetic properties are well described by a spin-1/2 antiferromagnetic Heisenberg model of the orthogonal dimer lattice. The model has a dimer singlet ground state whose exactness was proven by Shastry and Sutherland for a topologically equivalent model more than 20 years ago. The exactness of the ground state is maintained even if interlayer couplings are introduced for SrCu sub 2 (BO sub 3) sub 2. In the two-dimensional model, quantum phase transitions take place between different ground states for which three phases are expected: a gapped dimer singlet state, a plaquette resonating valence bond state and a gapless magnetic ordered state. Analysis of the experimental data shows that the dimer singlet ground state is realized in SrCu sub 2 (BO sub 3) sub 2. The orthogonality of the dimer bonds, which is the underlying symmetry of th...

  9. BoKS 1.0. : Een voorstel voor een body of knowlegde & skills van de communicatieve competentie

    NARCIS (Netherlands)

    Els van der Pool; Monique van Wijk; Cecilia van Dongen

    2010-01-01

    Sinds 2008 bestaat er een landelijke Body of Knowledge & Skills voor vijf domeinen binnen het hoger onderwijs, te weten Business Administration, Commerce, Communications, Economics en Laws (Hbo-raad 2008). De term Body of Knowledge & Skills (BoKS) staat voor het geheel van kennis, vaardigheden en

  10. Intracavity doubling of CW Ti:sapphire laser to 392.5 nm using BiBO-crystal

    DEFF Research Database (Denmark)

    Mortensen, Jesper Liltorp; Thorhauge, Morten; Tidemand-Lichtenberg, Peter

    2005-01-01

    In this work we present results obtained for intra-cavity frequency-doubling of a 785 nm CW Ti:sapphire laser utilising BiBO as the non-linear crystal. Intracavity doubling offers several advantages compared to extra-cavity doubling, such as no need to couple to an external resonance cavity...

  11. Volvo ja Ikea endine tegevjuht Göran Carstedt : Tänapäevane (personali)juhtimine peab sisaldama eeskätt looduslähedast mõtteviisi / Göran Carstedt ; interv. Tiina Saar

    Index Scriptorium Estoniae

    Carstedt, Göran

    2008-01-01

    Juhtimiskonsultant ning Organisatsioonilise Õppimise Ühingu eestvedaja ja arendaja Göran Carsedt vastab küsimustele, mis puudutavad ettevõtte tegevust personali tööle pühendumise parendamiseks, ettevõtte jätkusuutlikku juhtimist ja tootlikkust, majanduslanguse mõju ettevõtete personalipoliitikale, talendijuhtimist, väikeste ettevõttete ellujäämist majanduslanguse ajal, IKEA kui hea tööandja mainet ning jätkusuutlikku personaliarendajat. Lisa: Jätkusuutlik juhtimine Rootsi moodi

  12. Saccharomyces cerevisiae GTPase complex: Gtr1p-Gtr2p regulates cell-proliferation through Saccharomyces cerevisiae Ran-binding protein, Yrb2p

    International Nuclear Information System (INIS)

    Wang Yonggang; Nakashima, Nobutaka; Sekiguchi, Takeshi; Nishimoto, Takeharu

    2005-01-01

    A Gtr1p GTPase, the GDP mutant of which suppresses both temperature-sensitive mutants of Saccharomyces cerevisiae RanGEF/Prp20p and RanGAP/Rna1p, was presently found to interact with Yrb2p, the S. cerevisiae homologue of mammalian Ran-binding protein 3. Gtr1p bound the Ran-binding domain of Yrb2p. In contrast, Gtr2p, a partner of Gtr1p, did not bind Yrb2p, although it bound Gtr1p. A triple mutant: yrb2Δ gtr1Δ gtr2Δ was lethal, while a double mutant: gtr1Δ gtr2Δ survived well, indicating that Yrb2p protected cells from the killing effect of gtr1Δ gtr2Δ. Recombinant Gtr1p and Gtr2p were purified as a complex from Escherichia coli. The resulting Gtr1p-Gtr2p complex was comprised of an equal amount of Gtr1p and Gtr2p, which inhibited the Rna1p/Yrb2 dependent RanGAP activity. Thus, the Gtr1p-Gtr2p cycle was suggested to regulate the Ran cycle through Yrb2p

  13. Formation of a Trimeric Xpo1-Ran[GTP]-Ded1 Exportin Complex Modulates ATPase and Helicase Activities of Ded1.

    Directory of Open Access Journals (Sweden)

    Glenn Hauk

    Full Text Available The DEAD-box RNA helicase Ded1, which is essential in yeast and known as DDX3 in humans, shuttles between the nucleus and cytoplasm and takes part in several basic processes including RNA processing and translation. A key interacting partner of Ded1 is the exportin Xpo1, which together with the GTP-bound state of the small GTPase Ran, facilitates unidirectional transport of Ded1 out of the nucleus. Here we demonstrate that Xpo1 and Ran[GTP] together reduce the RNA-stimulated ATPase and helicase activities of Ded1. Binding and inhibition of Ded1 by Xpo1 depend on the affinity of the Ded1 nuclear export sequence (NES for Xpo1 and the presence of Ran[GTP]. Association with Xpo1/Ran[GTP] reduces RNA-stimulated ATPase activity of Ded1 by increasing the apparent KM for the RNA substrate. Despite the increased KM, the Ded1:Xpo1:Ran[GTP] ternary complex retains the ability to bind single stranded RNA, suggesting that Xpo1/Ran[GTP] may modulate the substrate specificity of Ded1. These results demonstrate that, in addition to transport, exportins such as Xpo1 also have the capability to alter enzymatic activities of their cargo.

  14. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    Directory of Open Access Journals (Sweden)

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  15. Characterization of BoHV-5 field strains circulation and report of transient specific subtype of bovine herpesvirus 5 in Argentina

    Directory of Open Access Journals (Sweden)

    Thiry Julien

    2011-02-01

    Full Text Available Abstract Background Bovine herpesvirus 5 (BoHV-5 is a member of the subfamily Alphaherpesvirinae responsible for meningo-encephalitis in young cattle. The first case of bovine meningo-encephalitis associated with a herpesvirus infection was reported in Australia. The current geographical distribution of BoHV-5 infection is mainly restricted to South America, especially Brazil and Argentina. Outbreaks of BoHV-5 are regularly observed in Argentina suggesting the circulation of the virus in the bovine population. Results Seventeen field strains of BoHV-5 isolated from 1984 to now were confirmed by differential PCR and subjected to restriction endonuclease analysis (REA. Viral DNA was cleaved with BstEII which allows the differentiation among subtypes a, b and non a, non b. According to the REA with BstEII, only one field strain showed a pattern similar to the Argentinean A663 strain (prototype of BoHV-5b. All other isolates showed a clear pattern similar to the Australian N569 strain (prototype of BoHV-5a consistent with the subtypes observed in Brazil, the other South-American country where BoHV-5 is known to be prevalent. The genomic region of subtype b responsible for the distinct pattern was determined and amplified by PCR; specifically a point mutation was identified in glycoprotein B gene, on the BstEII restriction site, which generates the profile specific of BoHV-5b. Conclusions This is the first report of circulation of BoHV-5a in Argentina as the prevailing subtype. Therefore the circulation of BoHV-5b was restricted to a few years in Argentina, speculating that this subtype was not able to be maintained in the bovine population. The mutation in the gB gene is associated with the difference in the restriction patterns between subtypes "a" and "b".

  16. Frequency of antibodies against bovine herpesvirus type 1 (BoHV-1 in beef cattle not vaccinated

    Directory of Open Access Journals (Sweden)

    Ermilton Junio Pereira de Freitas

    2014-06-01

    Full Text Available Bovine herpesvirus type 1 (BoHV-1, is responsible for clinical manifestations such as infectious bovine rhinotracheitis, abortion, conjunctivitis, infectious pustular vulvovaginitis and balanoposthitis. This virus has been responsible for major losses in different productive and reproductive herds in the country. Thus, the objective of this study was to estimate the frequency of antibodies against BoHV-1 in beef heifers not vaccinated in Microregion of Imperatriz, Maranhao, and identify the age group most affected by the virus, as well as a study of factors associated with virus infection and to evaluate the indirect ELISA using the serum neutralization (SN as a reference standard. The study was conducted in 48 herds, cutting, distributed in 12 counties of Microregion of Imperatriz. The samples were collected from female cattle stratified into three age groups, ? 12 months, between 12 and 36 months and ? 36 months of age. The samples were subjected to two serological tests, ELISA and SN. In each herd, an epidemiological questionnaire was applied in order to obtain information on management and reproductive sanitary, for the study of risk factors. The frequency of antibodies against BoHV-1 in Microregion of Imperatriz was 63.23%, and the municipalities of Açailândia Buritirana showed the highest frequencies, both with 80.44%, the most affected age group, the Microregion, was animals aged ? 36 months (69.65%. Based on the results we can conclude that the frequency of antibodies against BoHV-1 is high, between the age groups most affected were the animals aged ? 36 months were considered risk factors for virus transmission, return to estrus (OR=1.874, recovery of animals from other states / region (OR=1.365 and the creation of goat / sheep associated with bovine (OR=1.348, the indirect ELISA technique showed moderate concordance when compared to SN technique, which is the gold standard technique for diagnosis of BoHV-1.

  17. Martinický palác v Praze za vlastnictví Jiřího Bořity z Martinic a jeho následovníka Jaroslava Bořity z Martinic. Architektonická podoba a výzdoba

    OpenAIRE

    Poláčková, Daniela

    2011-01-01

    Bachelor thesis "Martinic palace in Prague during the ownership of George Bořita of Martinic and his follower Jaroslav Bořita of Martinic. Its architectural form and decoration" is based on the Martinic palace in the Hradčany square during the ownerships of George Bořita of Martinic and Jaroslav Bořita of Martinic. At the beginning you can find the list of the owners, who owned the palace, during this there appeared important changes not only architectural, but also in decoration. The first c...

  18. The proliferation marker pKi-67 organizes the nucleolus during the cell cycle depending on Ran and cyclin B.

    Science.gov (United States)

    Schmidt, Mirko H H; Broll, Rainer; Bruch, Hans-Peter; Bögler, Oliver; Duchrow, Michael

    2003-01-01

    The proliferation marker pKi-67 ('Ki-67 antigen') is commonly used in clinical and research pathology to detect proliferating cells, as it is only expressed during cell-cycle progression. Despite the fact that this antigen has been known for nearly two decades, there is still no adequate understanding of its function. This study has therefore identified proteins that interact with pKi-67, using a yeast two-hybrid system. A mammalian two-hybrid system and immunoprecipitation studies were used to verify these interactions. Among other cell-cycle regulatory proteins, two binding partners associated with the small GTPase Ran were identified. In addition, DNA-structural and nucleolus-associated proteins binding to pKi-67 were found. Moreover, it was demonstrated that the N-terminal domain of pKi-67 is capable of self-binding to its own repeat region encoded by exon 13. Since RanBP, a protein involved in the transport of macromolecules over the nuclear lamina, was found to be a binding partner, a possible effect of pKi-67 on the localization of cell-cycle regulatory proteins was proposed. To test this hypothesis, a tetracycline-responsive gene expression system was used to induce the pKi-67 fragments previously used for the two-hybrid screens in HeLa cells. Subsequent immunostaining revealed the translocation of cyclin B1 from cytoplasm to nucleoli in response to this expression. It is suggested that pKi-67 is a Ran-associated protein with a role in the disintegration and reformation of the nucleolus and thereby in entry into and exit from the M-phase. Copyright 2002 John Wiley & Sons, Ltd.

  19. Extending the bounds of ‘steady’ RANS closures: Toward an instability-sensitive Reynolds stress model

    International Nuclear Information System (INIS)

    Jakirlić, S.; Maduta, R.

    2015-01-01

    Highlights: • A grid-spacing free, instability-sensitive Reynolds stress model is formulated. • The model is capable of capturing turbulence fluctuations. • Substantial improvement concerning proper turbulence activity enhancement is achieved. • The model is intensively validated in a series of 2D and 3D separating flows. • The model feasibility is also checked in some attached flows. - Abstract: The incapability of the conventional Unsteady RANS (Reynolds–Averaged Navier Stokes) models to adequately capture turbulence unsteadiness presents the prime motivation of the present work, which focuses on formulating an instability-sensitive, eddy-resolving turbulence model on the Second-Moment Closure level. The model scheme adopted, functioning as a ‘sub-scale’ model in the Unsteady RANS framework, represents a differential near-wall Reynolds stress model formulated in conjunction with the scale-supplying equation governing the homogeneous part of the inverse turbulent time scale ω h (ω h = ε h /k). The latter equation was straightforwardly obtained from the model equation describing the dynamics of the homogeneous part of the total viscous dissipation rate ε, defined as ε h = ε − 0.5ν∂ 2 k/(∂x j ∂x j ) (Jakirlic and Hanjalic, 2002), by applying the derivation rules to the expression for ω h . The model capability to account for vortex length and time scales variability was enabled through an additional term in the corresponding length-scale determining equation, providing a selective enhancement of its production, pertinent particularly to the highly unsteady separated shear layer region, modeled in terms of the von Karman length scale (comprising the second derivative of the velocity field) in line with the SAS (Scale-Adaptive Simulation) proposal (Menter and Egorov, 2010). The present model formulation, termed as SRANS model (Sensitized RANS), does not comprise any parameter depending explicitly on grid spacing. The predictive

  20. Once Bitten, Twice Shy

    DEFF Research Database (Denmark)

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  1. Once Bitten, Twice Shy

    DEFF Research Database (Denmark)

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  2. Synthesis, crystal structure, and properties of Bi{sub 3}TeBO{sub 9} or Bi{sub 3}(TeO{sub 6})(BO{sub 3}): a non-centrosymmetric borate-tellurate(VI) of bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Daub, Michael; Krummer, Michael; Hoffmann, Anke [Institut fuer Anorganische und Analytische Chemie, Albert-Ludwigs-Universitaet, Albertstrasse 21, 79104, Freiburg (Germany); Bayarjargal, Lkhamsuren [Institut fuer Geowissenschaften, Abt. Kristallographie, Goethe-Universitaet, Altenhoeferallee 1, 60438, Frankfurt am Main (Germany); Hillebrecht, Harald [Institut fuer Anorganische und Analytische Chemie, Albert-Ludwigs-Universitaet, Albertstrasse 21, 79104, Freiburg (Germany); Freiburger Materialforschungszentrum FMF, Albert-Ludwigs-Universitaet, Stefan-Meier-Strasse 25, 79104, Freiburg (Germany)

    2017-01-26

    Pale-yellow single crystals of the new borate tellurate(VI) Bi{sub 3}TeBO{sub 9} were obtained by reaction of stoichiometric amounts of Bi{sub 2}O{sub 3}, B{sub 2}O{sub 3}, and Te(OH){sub 6} at 780 C. The non-centrosymmetric crystal structure (P6{sub 3}, Z=2, a=8.7454(16), c=5.8911(11) Aa, 738 refl., 43 param, R1=0.037, wR2=0.093) contains isolated trigonal-planar BO{sub 3} units and nearly undistorted TeO{sub 6} octahedra. The Bi{sup 3+} cations are located in between in octahedral voids. The BiO{sub 6} octahedra are significantly distorted to a [3+3] pattern (2.25/2.50 Aa) due to the ns{sup 2} configuration. According to the structural features, the formula can be written as Bi{sub 3}(TeO{sub 6})(BO{sub 3}). Alternatively, the structure can also be described as hcp of oxygen with Te{sup VI} and Bi{sup III} in octahedral voids and B{sup III} in trigonal- planar voids. The vibrational spectra show the typical features of BO{sub 3} and TeO{sub 6} units with a significant {sup 10}B/{sup 11}B isotopic splitting of the IR-active B-O valence mode (1248 and 1282 cm{sup -1}). The UV/Vis spectrum shows an optical band edge with an onset around 480 nm (2.6 eV). MAS-NMR spectra of {sup 11}B show an anisotropic signal with a quadrupole coupling constant of C{sub Q}=2.55 MHz. and a very small deviation from rotational symmetry (η=0.2). The isotropic chemical shift is 20.1 ppm. The second harmonic generation (SHG) test was positive with an activity comparable to potassium dihydrogen phosphate (KDP). Bi{sub 3}TeBO{sub 9} decomposes in air at 825 C to Bi{sub 2}TeO{sub 5}. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. A graphene oxide based fluorescence resonance energy transfer (FRET) biosensor for ultrasensitive detection of botulinum neurotoxin A (BoNT/A) enzymatic activity.

    Science.gov (United States)

    Shi, Jingyu; Guo, Jiubiao; Bai, Gongxun; Chan, Chunyu; Liu, Xuan; Ye, Weiwei; Hao, Jianhua; Chen, Sheng; Yang, Mo

    2015-03-15

    Botulinum neurotoxins (BoNTs) are among the most potent toxic bacterial proteins for humans, which make them potential agents for bioterrorism. Therefore, an ultrasensitive detection of BoNTs and their active states is in great need as field-deployable systems for anti-terrorism applications. We report the construction of a novel graphene oxide (GO)-peptide based fluorescence resonance energy transfer (FRET) biosensor for ultrasensitive detection of the BoNT serotype A light chain (BoNT-LcA) protease activity. A green fluorescence protein (GFP) modified SNAP-25 peptide substrate (SNAP-25-GFP) was optimally designed and synthesized with the centralized recognition/cleavage sites. This FRET platform was constructed by covalent immobilization of peptide substrate on GO with BSA passivation which have advantages of low non-specific adsorption and high stability in protein abundant solution. BoNT-LcA can specifically cleave SNAP-25-GFP substrate covalently immobilized on GO to release the fragment with GFP. Based on fluorescence signal recovery measurement, the target BoNT-LcA was detected sensitively and selectively with the linear detection range from 1fg/mL to 1pg/mL. The limit of detection (LOD) for BoNT-LcA is around 1fg/mL. Copyright © 2014 Elsevier B.V. All rights reserved.

  4. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Directory of Open Access Journals (Sweden)

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  5. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  6. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  7. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Directory of Open Access Journals (Sweden)

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  8. LES and RANS modeling of pulverized coal combustion in swirl burner for air and oxy-combustion technologies

    International Nuclear Information System (INIS)

    Warzecha, Piotr; Boguslawski, Andrzej

    2014-01-01

    Combustion of pulverized coal in oxy-combustion technology is one of the effective ways to reduce the emission of greenhouse gases into the atmosphere. The process of transition from conventional combustion in air to the oxy-combustion technology, however, requires a thorough investigations of the phenomena occurring during the combustion process, that can be greatly supported by numerical modeling. The paper presents the results of numerical simulations of pulverized coal combustion process in swirl burner using RANS (Reynolds-averaged Navier–Stokes equations) and LES (large Eddy simulation) methods for turbulent flow. Numerical simulations have been performed for the oxyfuel test facility located at the Institute of Heat and Mass Transfer at RWTH Aachen University. Detailed analysis of the flow field inside the combustion chamber for cold flow and for the flow with combustion using different numerical methods for turbulent flows have been done. Comparison of the air and oxy-coal combustion process for pulverized coal shows significant differences in temperature, especially close to the burner exit. Additionally the influence of the combustion model on the results has been shown for oxy-combustion test case. - Highlights: • Oxy-coal combustion has been modeled for test facility operating at low oxygen ratio. • Coal combustion process has been modeled with simplified combustion models. • Comparison of oxy and air combustion process of pulverized coal has been done. • RANS (Reynolds-averaged Navier–Stokes equations) and LES (large Eddy simulation) results for pulverized coal combustion process have been compared

  9. Potential involvement of drought-induced Ran GTPase CLRan1 in root growth enhancement in a xerophyte wild watermelon.

    Science.gov (United States)

    Akashi, Kinya; Yoshimura, Kazuya; Kajikawa, Masataka; Hanada, Kouhei; Kosaka, Rina; Kato, Atsushi; Katoh, Akira; Nanasato, Yoshihiko; Tsujimoto, Hisashi; Yokota, Akiho

    2016-10-01

    Enhanced root growth is known as the survival strategy of plants under drought. Previous proteome analysis in drought-resistant wild watermelon has shown that Ran GTPase, an essential regulator of cell division and proliferation, was induced in the roots under drought. In this study, two cDNAs were isolated from wild watermelon, CLRan1 and CLRan2, which showed a high degree of structural similarity with those of other plant Ran GTPases. Quantitative RT-PCR and promoter-GUS assays suggested that CLRan1 was expressed mainly in the root apex and lateral root primordia, whereas CLRan2 was more broadly expressed in other part of the roots. Immunoblotting analysis confirmed that the abundance of CLRan proteins was elevated in the root apex region under drought stress. Transgenic Arabidopsis overexpressing CLRan1 showed enhanced primary root growth, and the growth was maintained under osmotic stress, indicating that CLRan1 functions as a positive factor for maintaining root growth under stress conditions.

  10. Controlled synthesis of different multilayer architectures of GdBO{sub 3}:Eu{sup 3+} phosphors and shape-dependent luminescence properties

    Energy Technology Data Exchange (ETDEWEB)

    Leng, Zhihua; Zhang, Nannan; Liu, Yali; Li, Linlin; Gan, Shucai, E-mail: gansc@jlu.edu.cn

    2015-03-01

    Graphical abstract: - Highlights: • Pancake-like/flower-like/leaf-like GdBO{sub 3} were obtained via a hydrothermal method. • Gd(OH){sub 3} nanorods and borates were used as the precursors for the first time. • A dissolution and recrystallization process was happened induced by the excess borax. • Three products have the similar stacked arrangements to reduce the surface energy. • The luminescence properties of GdBO{sub 3}:Eu{sup 3+} are related to shape and crystallinity. - Abstract: Monodisperse pancake-like/flower-like/leaf-like GdBO{sub 3} samples have been successfully synthesized via a designed hydrothermal conversion method using H{sub 3}BO{sub 3}, Na{sub 2}B{sub 4}O{sub 7}·10H{sub 2}O, or NaBO{sub 2}·4H{sub 2}O as boron sources, respectively. It was found that different boron sources have crucial influences on the formation and morphology of the products. The Gd(OH){sub 3} nanorods precursors were prepared through a simple hydrothermal process, which then served as sacrificial templates for the fabrication of GdBO{sub 3} micropancakes/microflowers/microleaves via a hydrothermal conversion process. FT-IR spectra confirm that vaterite-type GdBO{sub 3} can be synthesized by this method. The possible formation mechanisms for different microstructures were put forward on the basis of a series of time-dependent control experiments. The products have similar stacked arrangements driven by the minimization of the interfacial and surface energy of the hydrothermal system. An investigation on the photoluminescence (PL) properties of GdBO{sub 3}:Eu{sup 3+} samples with different morphologies indicates that the PL properties of as-obtained GdBO{sub 3}:Eu{sup 3+} phosphors are strongly dependent on their morphology and crystallinity. The flower-like structure exhibits the strongest red emission.

  11. New structural design standard for cooling towers. Pilot project BoA 2 and 3 in Neurath; Pilotprojekt der neuen Normengeneration im Kuehlturmbau. Die Naturzugkuehltuerme von BoA 2 and 3 in Neurath

    Energy Technology Data Exchange (ETDEWEB)

    Woermann, Ralf [Kraetzig und Partner Ingenieurgesellschaft fuer Bautechnik mbH, Bochum (Germany); Haupt, Ralf [ALPINE BAU DEUTSCHLAND AG NL Industrie- und Kraftwerksbau, Dortmund (Germany); Ohlmann, Uwe [RWE Power AG, Essen (Germany). Bautechnik

    2010-01-15

    Starting in 2006 RWE Power is erecting two lignite power plants with highly optimized efficiency (BoA) in Neurath near Cologne. These will be the second and third plant of this most advanced technique after the completion of BoA1 in Niederaussem in 2003. The most outstanding buildings of the new power-station are the natural draught cooling towers with a height of 173 m. Their design and execution will be described in this paper. For the first time in cooling tower design the completely revised new edition 2005 of the VGB-Guideline ''Structural Design of Cooling Towers'' was applied in connection with other related new design standards. (orig.)

  12. EPR study of the low-spin state of Ru{sup 3+}in the YAl{sub 3}(BO{sub 3}){sub 4} and EuAl{sub 3}(BO{sub 3}){sub 4} aluminum borates

    Energy Technology Data Exchange (ETDEWEB)

    Prokhorov, A.A., E-mail: andaprokhorov@gmail.com [Institute of Physics AS CR, Na Slovance 2, Praha 8 18221 (Czech Republic); Chernush, L.F. [A.A. Galkin Donetsk Physico-Technical Institute, 72, R. Luxembourg Str., Donetsk 83114 (Ukraine); Dyakonov, V.P.; Szymczak, H. [Institute of Physics, PAS, al. Lotników 32/46, Warsaw 02-668 (Poland); Prokhorov, A.D. [A.A. Galkin Donetsk Physico-Technical Institute, 72, R. Luxembourg Str., Donetsk 83114 (Ukraine)

    2016-12-15

    New data on the ground state of impurity Ru{sup 3+} ions in the crystals of YAl{sub 3}(BO{sub 3}){sub 4} and EuAl{sub 3}(BO{sub 3}){sub 4} aluminum borates were obtained. It was shown that Ru{sup 3+} ion replaces trivalent rare-earth ions without breaking the symmetry of the site. The crystal field acting on 4d{sup 5} ions forms an EPR spectrum, which is described by the spin Hamiltonian with S=1/2. The spin-Hamiltonian parameters determined are equal to g{sub II}=1.963, g{sub ⊥}=3.796, A{sub II}=43.03*10{sup −4} cm{sup −1}, A{sub ⊥}=84.86*10{sup −4} cm{sup −1} in the YAl{sub 3}(BO{sub 3}){sub 4} crystal (at T=15 K) and g{sub II}=2.016, g{sub ⊥}=3.796 in the EuAl{sub 3}(BO{sub 3}){sub 4} crystal (at T=15 K). It is found that the value of ∆g=g{sub II}-g{sub ⊥} is an indicator of distortions of nearest environment of Ru{sup 3+} ion. The angle between the C{sub 3} axis and the direction into nearest oxygen ion was determined. The EPR linewidth of Ru{sup 3+} ion increases with increasing temperature due to the dipole-dipole and exchange interactions with the excited states of the host lattice Ru{sup 3+} ion.

  13. Cyanobacteria, algae and microfungi present in biofilm from Božana Cave (Serbia

    Directory of Open Access Journals (Sweden)

    Slađana Popović

    2015-05-01

    Full Text Available Phototrophic microorganisms (cyanobacteria and algae and microfungi, were identified from biofilm on the walls of the entrance of BožanaCavein west Serbia. Temperature, relative humidity and light intensity were measured, and chlorophyll a content determined. Light intensity differed from the entrance inwards. However, Chl a content was not proportional to light intensity, instead it was positively correlated to biofilm weight. Biofilm samples from two sites were also observed using a scanning electron microscope. Coccoid forms of cyanobacteria were abundant at the sampling site with the lowest light intensity, while members of the order Nostocales were predominant at the sampling site with the highest light intensity measured. Cyanobacteria were the dominant group of phototrophs colonizing cave walls (29 taxa, with the order Chroococcales prevailing (21 taxa. The most frequently documented cyanobacteria were species from genera Gloeocapsa, Scytonema, Aphanocapsa and Chroococcus. Desmococcus olivaceus and Trentepohlia aurea were the only green algae documented on cave walls. Ascomycetes were common (e.g. Alternaria, Aspergillus, Cladosporium, Epicoccum, Penicillum and Trichoderma, while zygomycetes and oomycetes were less frequent. The different color of each biofilm sample was ascribed to the presence of various different species of cyanobacteria and algae.

  14. Electron paramagnetic resonance and optical properties of Cr3+ doped YAl3(BO3)4

    International Nuclear Information System (INIS)

    Wells, Jon-Paul R; Yamaga, Mitsuo; Han, Thomas P J; Honda, Makoto

    2003-01-01

    We report on the electron paramagnetic resonance (EPR) and optical absorption and fluorescence spectroscopy of YAl 3 (BO 3 ) 4 single crystals doped with 0.2 mol% of trivalent chromium. From EPR we determine that the Cr 3+ ions reside in sites of essentially octahedral symmetry with an orthorhombic distortion. The ground state 4 A 2 splitting is determined to be 2√D 2 + 3E 2 ∼ 1.05 ± 0.04 cm -1 , where D and E are fine-structure parameters, and we can attribute this splitting to the combined effect of a low-symmetry distortion and spin-orbit coupling. The g-values and fine-structure parameters D and E of the ground state 4 A 2 are measured to be g x ∼ g y ∼ g z = 1.978 ± 0.005, vertical bar D vertical bar = 0.52 ± 0.02 cm -1 and vertical bar E vertical bar 0.010 ± 0.005 cm -1 respectively. From 10 K optical absorption we have measured the position and crystal-field splittings of the 2 E, 2 T 1 , 4 T 2 , 2 T 2 and 4 T 1 states with the 4 T 2 and 4 T 1 levels appearing as vibronically broadened bands

  15. A community in trouble? The impact of gentrification on the Bo-Kaap, Cape Town

    Directory of Open Access Journals (Sweden)

    Nico Kotze

    2013-01-01

    Full Text Available The Bo-Kaap is an older inner-city, working-class neighbourhood in Cape Town, South Africa. By the 1930s, the area had degenerated into an overcrowded and run-down neighbourhood, consisting largely of dilapidated houses, but by 1941 about 150 housing units had been expropriated by the local authority for redevelopment in a comprehensive renewal scheme for the area. However, the process was halted with the formation of the so-called “Group for the Preservation of the Malay Quarter”, which fought against the demolition of the houses. At present, the area with its colourful housing units and 11 mosques is part of Cape Town’s cultural heritage and a very important tourist attraction. As in the case of De Waterkant, a gentrified neighbourhood adjacent to it, the area has seen a large number of housing units renovated and upgraded. Property prices have increased dramatically, although they are still relatively low, while the number of properties sold is also on the rise – so much so that the community leaders and especially the Muslim residents are in a constant battle to preserve the neighbourhood’s cultural identity.

  16. Electronic structure of lanthanum calcium oxoborate LaCa4O(BO3)3

    International Nuclear Information System (INIS)

    Nelson, A.J.; Buuren, T. van; Willey, Trevor M.; Bostedt, C.; Adams, J.J.; Schaffers, K.I.; Terminello, Lou; Callcott, T.A.

    2004-01-01

    Lanthanum calcium oxoborate (LaCOB) is a nonlinear optical (NLO) material that belongs to the calcium-rare-earth (R) oxoborate family, with general composition Ca 4 RO(BO 3 ) 3 (R 3+ =La, Sm, Gd, Lu, Y). X-ray photoemission, photoabsorption, and resonant fluorescence were applied to study the electronic structure of this material. High resolution photoemission measurements on the valence band (VB) electronic structure and La 3d and 4d, Ca 2p, B 1s, and O 1s core lines were used to evaluate the surface and near surface chemistry. Element specific density of unoccupied electronic states in LaCOB were probed by X-ray absorption spectroscopy (XAS) at the La 3d (M 4,5 -edge), B 1s, and O 1s (K-edges) absorption edges. Soft X-ray fluorescence was used to further examine valence band states associated with spectral differences noted in the absorption measurements. These results provide the first measurements of the electronic structure and surface chemistry of this rare-earth oxoborate

  17. Spin-glass behavior in single crystals of hetero-metallic magnetic warwickites MgFeBO{sub 4,} Mg{sub 0.5}Co{sub 0.5}FeBO{sub 4,} and CoFeBO{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Arauzo, A., E-mail: aarauzo@unizar.es [Servicio de Medidas Físicas, Universidad de Zaragoza, Pedro Cerbuna 12, 50009 Zaragoza (Spain); Kazak, N.V. [L.V. Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Ivanova, N.B. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Platunov, M.S. [L.V. Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Knyazev, Yu.V. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Bayukov, O.A.; Bezmaternykh, L.N. [L.V. Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Lyubutin, I.S.; Frolov, K.V. [Shubnikov Institute of Crystallography, RAS, 119333 Moscow (Russian Federation); Ovchinnikov, S.G. [L.V. Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Siberian State Aerospace University, 660014 Krasnoyarsk (Russian Federation); Bartolomé, J. [Instituto de Ciencia de Materiales de Aragón, CSIC-Universidad de Zaragoza and Departamento de Física de la Materia Condensada, 50009 Zaragoza (Spain)

    2015-10-15

    Magnetic properties of heterometallic warwickites MgFeBO{sub 4,} Mg{sub 0.5}Co{sub 0.5}FeBO{sub 4,} and CoFeBO{sub 4} are presented, highlighting the effect of Co substitution on the magnetic properties of these compounds. The analysis of magnetization and heat capacity data has shown that these compounds exhibit a spin-glass transition below T{sub SG}=10, 20 and 22 K, respectively. Using zero field ac susceptibility as entanglement witness we find that the low dimensional magnetic behavior above T{sub SG} show quantum entanglement behavior χ(Τ)∝T{sup −α(Τ)} up to T{sub E}≈130 K. The α parameters have been deduced as a function of temperature and Co content, indicating the existence of random singlet phase in this temperature region. Above T{sub E} the paramagnetism is interpreted in terms of non-entangled spins giving rise to Curie–Weiss paramagnetism. The different intra- and inter-ribbon exchange interaction pathways have been calculated within a simple indirect coupling model. It is determined that the triangular motifs in the warwickite structure, together with the competing interactions, induce frustration. The spin-glass character is explained in terms of the substitutional disorder of the Mg, Fe and Co atoms at the two available crystallographic sites, and the frustration induced by the competing interactions. The Co substitution induces uniaxial anisotropy, increases the absolute magnetization and increases the spin-glass freezing temperature. The entanglement behavior is supported in the intermediate phase irrespective of the introduction of anisotropy by the Co substitution. - Highlights: • Spin-glass transition of MgFeBO{sub 4,} Mg{sub 0.5}Co{sub 0.5}FeBO{sub 4,} and CoFeBO{sub 4}. • Anisotropy and transition temperature T{sub SG} increases with Co substitution. • Dynamical scaling theory near T{sub SG} is fulfilled. • Quantum entanglement is observed in between T{sub SG} and T{sub E}=130 K. • Low dimensional random singlet phase

  18. Diode-pumped orthogonally polarized dual-wavelength Nd3+:LaBO2MoO4 laser

    Science.gov (United States)

    Chen, Y. J.; Gong, X. H.; Lin, Y. F.; Huang, J. H.; Luo, Z. D.; Huang, Y. D.

    2013-08-01

    Polarized spectroscopic properties related to 1.07 μm laser operation of a 1.8 at.% Nd3+:LaBO2MoO4 crystal grown by the Czochralski method were investigated at room temperature. Using a 2.2-mm-thick, Z-cut Nd3+:LaBO2MoO4 crystal as gain medium, orthogonally polarized dual-wavelength laser at 1,068 and 1,074 nm was first realized in a plano-concave resonator end-pumped by a quasi-continuous-wave 795 nm diode laser. A total output peak power of 1.2 W with slope efficiency of 26 % around 1.07 μm was obtained. The influences of resonator length and pump power on output laser wavelength were also investigated.

  19. BoA大碟封套的彩虹效果,你也能做得到

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    近年的“韩风”十分强劲.哪里都能嗅到它的气息。现在的韩剧热潮与昔日的日剧相比.具的有过之而无不及.韩剧的剧情已经成为大家茶余饭后的话题了;不只是韩剧.韩国的流行音乐也是相当受“韩迷”们欢迎的。前段时间韩国小天后BoA推出了精选大碟《BoA BEST OF SOUL》。

  20. LiSr4(BO3)3:Ce3+ phosphor as a new material for ESR dosimetry

    International Nuclear Information System (INIS)

    Jiang, L.H.; Zhang, Y.L.; Gong, X.M.; Pang, R.; Zhang, S.; Li, C.Y.; Su, Q.

    2014-01-01

    LiSr 4 (BO 3 ) 3 :0.01Ce 3+ phosphor was investigated to assess its potential as a material for measurements of radiotherapeutic doses with electron spin resonance (ESR). The ESR spectrum of the phosphor irradiated with 60 Co features five ESR signals. An isochronal annealing experiment has shown that the strongest of these signals is associated with the same trap center as the 473 K peak on the TL glow curve of this material. The dose–response is linear in the studied range from 0.89 to 90.30 Gy. Fading of the signal was also investigated. - Highlights: • LiSr 4 (BO 3 ) 3 :Ce 3+ phosphor can be used as an ESR dosimeter for radiation therapy. • The ESR signal originates from the same traps as the TL. • Dose–response is linear, and the fading is slow

  1. Study on the effect of Huo Xue Bo Gu Pill on secretion of endogenous bFGF after fracture

    International Nuclear Information System (INIS)

    Li Qiang; Wang Xiping; Guo E; Ye Liyan; Liu Yingjie

    2006-01-01

    Objective: To study the effect of a Chinese traditional preparation Huo Xue Bo Gu Pill on the serum contents of basic fibroblast growth factor (bFGF) after forearm fractures. Method: Serum bFGF contents were measured (with ELISA) in 62 patients with forearm fractures on d1, d8, d14 and d20 after the accident. Thirty-two of the patients were treated with Huo Xue Bo Gu Pills and thirty patients were not. Results: The serum contents of bFGF on d8 and d14 were significantly higher in the patients treated with the pills than those in patients not treated with the pills (P<0.05). Conclusion: This pill could promote the secretion of endogenous bFGF with proliferation of capillaries at the fracture site. (authors)

  2. A comparison of theory and flight test of the BO 105/BMR in hover and forward flight

    Science.gov (United States)

    Mirick, Paul H.

    1988-01-01

    Four cases were selected for comparison with theoretical predictions using stability data obtained during the flight test of the Bearingless Main Rotor (BMR) on a Messerschmidt-Boelkow-Blohm BO 105 helicopter. The four cases selected form the flight test included two ground resonance cases and two air resonance cases. The BMR used four modified BO 105 blades attached to a bearingless hub. The hub consisted of dual fiberglass C-channel beams attached to the hub center at 0.0238R and attached to the blade root at 0.25R with blade pitch control provided by a torque tube. Analyses from Bell Helicopter Textron, Boeing Vertol, and Sikorsky Aircraft were compared with the data and the correlation ranged from very poor-to-poor to poor-to-fair.

  3. SUMO modification through rapamycin-mediated heterodimerization reveals a dual role for Ubc9 in targeting RanGAP1 to nuclear pore complexes

    International Nuclear Information System (INIS)

    Zhu Shanshan; Zhang Hong; Matunis, Michael J.

    2006-01-01

    SUMOs (small ubiquitin-related modifiers) are eukaryotic proteins that are covalently conjugated to other proteins and thereby regulate a wide range of important cellular processes. The molecular mechanisms by which SUMO modification influences the functions of most target proteins and cellular processes, however, remain poorly defined. A major obstacle to investigating the effects of SUMO modification is the availability of a system for selectively inducing the modification or demodification of an individual protein. To address this problem, we have developed a procedure using the rapamycin heterodimerizer system. This procedure involves co-expression of rapamycin-binding domain fusion proteins of SUMO and candidate SUMO substrates in living cells. Treating cells with rapamycin induces a tight association between SUMO and a single SUMO substrate, thereby allowing specific downstream effects to be analyzed. Using RanGAP1 as a model SUMO substrate, the heterodimerizer system was used to investigate the molecular mechanism by which SUMO modification targets RanGAP1 from the cytoplasm to nuclear pore complexes (NPCs). Our results revealed a dual role for Ubc9 in targeting RanGAP1 to NPCs: In addition to conjugating SUMO-1 to RanGAP1, Ubc9 is also required to form a stable ternary complex with SUMO-1 modified RanGAP1 and Nup358. As illustrated by our studies, the rapamycin heterodimerizer system represents a novel tool for studying the molecular effects of SUMO modification

  4. An investigation into the reduction of log-layer mismatch in wall-modeled LES with a hybrid RANS/LES approach

    Science.gov (United States)

    Balin, Riccardo; Spalart, Philippe R.; Jansen, Kenneth E.

    2017-11-01

    Hybrid RANS/LES modeling approaches used in the context of wall-modeled LES (WMLES) of channel flows and boundary layers often suffer from a mismatch in the RANS and LES log-layer intercepts of the mean velocity profile. In the vicinity of the interface between the RANS and LES regions, the mean velocity gradient is too steep causing a departure from the log-law, an over-prediction of the velocity in the outer layer and an under-prediction of the skin-friction. This steep gradient is attributed to inadequate modeled Reynolds stresses in the upper portion of the RANS layer and at the interface. Channel flow computations were carried out with the IDDES approach of Shur et al. in WMLES mode based on the Spalart-Allmaras RANS model. This talk investigates the robustness of this approach for unstructured grids and explores changes required for grids where insufficient elevation of the Reynolds stresses is observed. Awards of computer time were provided by Innovative and Novel Computational Impact on Theory and Experiment (INCITE) and Early Science programs. Resources of the Argonne Leadership Computing Facility, a DOE Office of Science User Facility, were used.

  5. UV-induced acoustooptics of matrices containing BaHf(BO{sub 3}){sub 2} microcrystallites embedded into olygoetheracrylate photopolymer

    Energy Technology Data Exchange (ETDEWEB)

    Majchrowski, A. [Institute of Applied Physics, Military University of Technology, Kaliskiego 2, 00-908 Warsaw (Poland); Kityk, I.V., E-mail: iwank74@gmail.com [Faculty of Electrical Engineering, Czestochowa University Technology, Armii Krajowej 17, Czestochowa (Poland); Jaroszewicz, L.R. [Institute of Applied Physics, Military University of Technology, Kaliskiego 2, 00-908 Warsaw (Poland); Fedorchuk, A.O. [Lviv National University of Veterinary Medicine and Biotechnologies, Department of Inorganic and Organic Chemistry, Lviv (Ukraine)

    2017-02-01

    UV-induced acoustooptics was explored for BaHf(BO{sub 3}){sub 2} microcrystallites with sizes varying within 5–30 μm range. The titled microcrystallites were embedded into the polymer matrices. The results were analyzed using both experimental optical as well as theoretical DFT approach. The measurements were done for principal acoustical frequencies: 0.5 MHz, 1 MHz, 2 MHz, and 3 MHz. The acoustical waves were excited by an electromechanical LiNbO{sub 3} piezoceramics transducers from acoustical generator. We explored dependence of the acoustooptical efficiency versus the photoinducing laser beam power, angle between the beams, acoustical power light polarization and temperature. We explored variation of the acoustooptical efficiency at 1150 nm probing cw He-Ne laser wavelength under influence of pulsed nitrogen laser at wavelength 371 nm working in the 7 ns regime with frequency repetition 6 Hz at power densities up to 900 MW/cm{sup 2}. Existence of some optimal conditions at about 1 MHz and UV photoinduced power equal to about 0.8 MW/cm{sup 2} was found. The spatial acousooptical gratings formation was observed. The DFT simulations of the charge density in main structural fragments under photoinducing UV beams is presented and principal role of the BO{sub 3} structural fragments is established. This is confirmed by crystallochemistry analysis. The phenomenological description is also presented. - Graphical abstract: Principal relation between the crystallochemistry and acoustically induced charge density space distribution changes. UV induced acoustooptical behaviours. - Highlights: • UV-induced increase of acoustooptics of BaHf(BO{sub 3}){sub 2} microcrystallites shown. • Principal role of the crystalline nano-interfaces is shown. • BO{sub 3} fragments play principal role.

  6. BoB, a best-of-breed automated text de-identification system for VHA clinical documents.

    Science.gov (United States)

    Ferrández, Oscar; South, Brett R; Shen, Shuying; Friedlin, F Jeffrey; Samore, Matthew H; Meystre, Stéphane M

    2013-01-01

    De-identification allows faster and more collaborative clinical research while protecting patient confidentiality. Clinical narrative de-identification is a tedious process that can be alleviated by automated natural language processing methods. The goal of this research is the development of an automated text de-identification system for Veterans Health Administration (VHA) clinical documents. We devised a novel stepwise hybrid approach designed to improve the current strategies used for text de-identification. The proposed system is based on a previous study on the best de-identification methods for VHA documents. This best-of-breed automated clinical text de-identification system (aka BoB) tackles the problem as two separate tasks: (1) maximize patient confidentiality by redacting as much protected health information (PHI) as possible; and (2) leave de-identified documents in a usable state preserving as much clinical information as possible. We evaluated BoB with a manually annotated corpus of a variety of VHA clinical notes, as well as with the 2006 i2b2 de-identification challenge corpus. We present evaluations at the instance- and token-level, with detailed results for BoB's main components. Moreover, an existing text de-identification system was also included in our evaluation. BoB's design efficiently takes advantage of the methods implemented in its pipeline, resulting in high sensitivity values (especially for sensitive PHI categories) and a limited number of false positives. Our system successfully addressed VHA clinical document de-identification, and its hybrid stepwise design demonstrates robustness and efficiency, prioritizing patient confidentiality while leaving most clinical information intact.

  7. A contribution to better understanding of structural characteristics and tectonic phases of the Boč region, Periadriatic Fault Zone

    Directory of Open Access Journals (Sweden)

    Lea Žibret

    2016-12-01

    Full Text Available The aim of this study was to determine properties of the tectonic contact between Permian/Mesozoic limestones and less competent Miocene clastites on the northeastern foothill of the Boč Mt. Because fault planes signifiantly mark the relief, this contact was studied by a detailed structural mapping, which showed that the Boč Mt. is limited by subvertical faults in its northeastern part. To ensure that mapped subvertical contact is compatible with regional geodynamics of the area, additionally paleostress analysis of fault-slip data was performed. Four individual paleostress tensor groups were documented in a wider Boč area and compared by published structural data from the border zone between Alps, Dinarides and Pannonian Basin. The oldest paleostress tensor group (Phase 1 is likely of Lower and Middle Miocene age and indicates SW-NE extension accommodated by W-E to WNW-ESE striking normal faults. Phase 2 can be correlated with Middle to Late Miocene NW-SE to WNWESE directed extension accommodated by NNE-SSW striking normal faults. Phase 3 is correlated with Late Miocene W-E directed contraction accommodated by N-S striking sinistral faults and NNE-SSW to NE-SW striking dextral faults. The youngest paleostress tensor group (Phase 4 fis well with Pliocene to Quaternary NNW-SSE to N-S directed contraction accommodated by NW-SE to W-E striking dextral faults and NE-SW striking reverse faults. Since the documented paleostress phases fis well with the geodynamic processes of the Alps-Dinarides-Carpathians territory the subvertical border in the northeastern part of Boč Mt. seems to be an acceptable structural solution. The study is important because the study area is located at interaction zone between two major Alpine fault systems: the Periadriatic and the Lavanttal faults.

  8. Novel ordered phases in the orthogonal dimer spin system SrCu2(BO3)2

    International Nuclear Information System (INIS)

    Takigawa, Masashi; Waki, Takeshi; Horvatic, Mladen; Berthier, Claude

    2010-01-01

    The magnetic properties of SrCu 2 (BO 3 ) 2 , a model spin system on the two-dimensional (2D) Shastry-Sutherland lattice, are reviewed with particular emphasis on the nuclear magnetic resonance (NMR) experiments. SrCu 2 (BO 3 ) 2 has a dimer singlet ground state at zero magnetic field and shows a sequence of magnetization plateaux at high magnetic fields. The plateaux are attributed to the localization of triplets into a superlattice due to mutual repulsion. Such a superstructure has been indeed observed at the 1/8 plateau by NMR experiments. Furthermore, the superstructure persists above the 1/8 plateau, where new phases have been identified by the torque and NMR measurements. SrCu 2 (BO 3 ) 2 also has the anisotropic Dzyaloshinski-Moriya interactions, which significantly change the ground state in magnetic fields. A recent development is the discovery of a new magnetic phase transition under high pressure. At 2.4 GPa, the 11 B NMR spectrum exhibits line splitting as a function of temperature in two steps. A gradual splitting below 30 K indicating loss of four-fold symmetry is followed by a further sudden splitting below 4 K marking a clear magnetic phase transition. The low-T phase has a doubled unit cell, yet with no spontaneous magnetic moment. A new type of valence-bond-solid (VBS) order is proposed. (author)

  9. Data Mining of Acupoint Characteristics from the Classical Medical Text: DongUiBoGam of Korean Medicine

    Directory of Open Access Journals (Sweden)

    Taehyung Lee

    2014-01-01

    Full Text Available Throughout the history of East Asian medicine, different kinds of acupuncture treatment experiences have been accumulated in classical medical texts. Reexamining knowledge from classical medical texts is expected to provide meaningful information that could be utilized in current medical practices. In this study, we used data mining methods to analyze the association between acupoints and patterns of disorder with the classical medical book DongUiBoGam of Korean medicine. Using the term frequency-inverse document frequency (tf-idf method, we quantified the significance of acupoints to its targeting patterns and, conversely, the significance of patterns to acupoints. Through these processes, we extracted characteristics of each acupoint based on its treating patterns. We also drew practical information for selecting acupoints on certain patterns according to their association. Data analysis on DongUiBoGam’s acupuncture treatment gave us an insight into the main idea of DongUiBoGam. We strongly believe that our approach can provide a novel understanding of unknown characteristics of acupoint and pattern identification from the classical medical text using data mining methods.

  10. Knowledge Attitude And Practice Of Street Food Vendors In Selected Schools Within Bo City Southern Sierra Leone

    Directory of Open Access Journals (Sweden)

    P.T. Lamin-Boima

    2017-12-01

    Full Text Available This paper attempts to investigate the lack of knowledge attitude and practices of street food vendors in Bo the Southern Province of Sierra Leone. A cross sectional study conducted among eighty-seven respondents vendors in forty-four in Bo City. Data was collected using a structured and semi structured questionnaire. The collected data is analysed using a simple descriptive statistics with the help Excel Microsoft ware. A statistical significance was found in relation to knowledge. Attitude towards food safety was negative self-reported practices by Street Food Vendors were statistically significant with low hygiene standards while predisposing factors showed relatively low personal hygiene poor environmental sanitation and low food safety practice. The realize consequences are utmost health risks of consuming street foods as food contamination has caused food borne diseases and outbreaks. It is recommended that standard training be provided for these vendors by the Bo City Council in collaboration with Njala University. It is essential that poor people in a developing country such as Sierra Leone be allowed to earn their livelihood by means of an easy-to-enter business such as street food vending when hygiene standards are sustained.

  11. Concentration quenching of Eu{sup 2+} doped Ca{sub 2}BO{sub 3}Cl

    Energy Technology Data Exchange (ETDEWEB)

    Seed Ahmed, H.A.A. [Department of Physics, University of the Free State, Bloemfontein, ZA 9300 (South Africa); Department of Physics, University of Khartoum, Khartoum (Sudan); Swart, H.C. [Department of Physics, University of the Free State, Bloemfontein, ZA 9300 (South Africa); Bergman, Peber [Department of Physics, Chemistry and Biology, Linköping University, Linköping (Sweden); Kroon, R.E., E-mail: KroonRE@Uufs.ac.za [Department of Physics, University of the Free State, Bloemfontein, ZA 9300 (South Africa)

    2016-03-15

    Highlights: • Ca{sub 2}BO{sub 3}Cl doped with Eu{sup 2+} prepared by solid state reaction. • Concentration quenching studied by intensity and lifetime measurements. • Accurate determination of the critical transfer distance. • Interaction mechanism verified to be dipole–dipole interactions. - Abstract: With the aim of determining the concentration quenching mechanism of Eu{sup 2+} doped Ca{sub 2}BO{sub 3}Cl, a series of phosphors with a varied Eu{sup 2+} concentration (Ca{sub 2−x}BO{sub 3}Cl:xEu{sup 2+}) was synthesized by the solid state reaction method. The phase structure was determined by X-ray diffraction. Photoluminescence (PL) measurements showed broad excitation and emission signatures of the allowed f–d transition of Eu{sup 2+} ions. The PL emission intensity was found to be increased by increasing the concentration of Eu{sup 2+} ions up to x = 0.03 and then decreased as a result of the concentration quenching effect. The lifetime of the emission from the Eu{sup 2+} ions was measured and the decrease in the lifetime with increasing Eu{sup 2+} concentration confirmed that non-radiative energy transfer occurred between Eu{sup 2+} ions. From the luminescence data, the value of the critical transfer distance was calculated as 1.5 nm and the corresponding concentration quenching mechanism was verified to be a dipole–dipole interaction.

  12. A Comparison of Hybrid Reynolds Averaged Navier Stokes/Large Eddy Simulation (RANS/LES) and Unsteady RANS Predictions of Separated Flow for a Variable Speed Power Turbine Blade Operating with Low Inlet Turbulence Levels

    Science.gov (United States)

    2017-10-01

    6 4 3 passage 4 passage 5 passage 3 Sta. 0 Sta. 2 −2.0 0.0 −55.5°m etal −1.0 y  pitch β 1= 34. 2 ° z ero i β1=−11.8°max i β1=−2.5° t-o β 1 =4 0.0...structured grids at 2 flow conditions, cruise and takeoff, of the VSPT blade. Computations were run in parallel on a Department of Defense...to predict the separation/reattachment suggested by experiment. The difference in results between the 2 grids for RANS computations suggests that

  13. A Mobility Management Using Follow-Me Cloud-Cloudlet in Fog-Computing-Based RANs for Smart Cities.

    Science.gov (United States)

    Chen, Yuh-Shyan; Tsai, Yi-Ting

    2018-02-06

    Mobility management for supporting the location tracking and location-based service (LBS) is an important issue of smart city by providing the means for the smooth transportation of people and goods. The mobility is useful to contribute the innovation in both public and private transportation infrastructures for smart cities. With the assistance of edge/fog computing, this paper presents a fully new mobility management using the proposed follow-me cloud-cloudlet (FMCL) approach in fog-computing-based radio access networks (Fog-RANs) for smart cities. The proposed follow-me cloud-cloudlet approach is an integration strategy of follow-me cloud (FMC) and follow-me edge (FME) (or called cloudlet). A user equipment (UE) receives the data, transmitted from original cloud, into the original edge cloud before the handover operation. After the handover operation, an UE searches for a new cloud, called as a migrated cloud, and a new edge cloud, called as a migrated edge cloud near to UE, where the remaining data is migrated from the original cloud to the migrated cloud and all the remaining data are received in the new edge cloud. Existing FMC results do not have the property of the VM migration between cloudlets for the purpose of reducing the transmission latency, and existing FME results do not keep the property of the service migration between data centers for reducing the transmission latency. Our proposed FMCL approach can simultaneously keep the VM migration between cloudlets and service migration between data centers to significantly reduce the transmission latency. The new proposed mobility management using FMCL approach aims to reduce the total transmission time if some data packets are pre-scheduled and pre-stored into the cache of cloudlet if UE is switching from the previous Fog-RAN to the serving Fog-RAN. To illustrate the performance achievement, the mathematical analysis and simulation results are examined in terms of the total transmission time, the

  14. A Mobility Management Using Follow-Me Cloud-Cloudlet in Fog-Computing-Based RANs for Smart Cities

    Directory of Open Access Journals (Sweden)

    Yuh-Shyan Chen

    2018-02-01

    Full Text Available Mobility management for supporting the location tracking and location-based service (LBS is an important issue of smart city by providing the means for the smooth transportation of people and goods. The mobility is useful to contribute the innovation in both public and private transportation infrastructures for smart cities. With the assistance of edge/fog computing, this paper presents a fully new mobility management using the proposed follow-me cloud-cloudlet (FMCL approach in fog-computing-based radio access networks (Fog-RANs for smart cities. The proposed follow-me cloud-cloudlet approach is an integration strategy of follow-me cloud (FMC and follow-me edge (FME (or called cloudlet. A user equipment (UE receives the data, transmitted from original cloud, into the original edge cloud before the handover operation. After the handover operation, an UE searches for a new cloud, called as a migrated cloud, and a new edge cloud, called as a migrated edge cloud near to UE, where the remaining data is migrated from the original cloud to the migrated cloud and all the remaining data are received in the new edge cloud. Existing FMC results do not have the property of the VM migration between cloudlets for the purpose of reducing the transmission latency, and existing FME results do not keep the property of the service migration between data centers for reducing the transmission latency. Our proposed FMCL approach can simultaneously keep the VM migration between cloudlets and service migration between data centers to significantly reduce the transmission latency. The new proposed mobility management using FMCL approach aims to reduce the total transmission time if some data packets are pre-scheduled and pre-stored into the cache of cloudlet if UE is switching from the previous Fog-RAN to the serving Fog-RAN. To illustrate the performance achievement, the mathematical analysis and simulation results are examined in terms of the total transmission time

  15. Kristološki naglasci govora o Božjem milosrđu u promišljanjima izabranih crkvenih otaca

    OpenAIRE

    Filić, Andrea

    2017-01-01

    Polazišno pitanje ovoga članka, nadahnuto tvrdnjama Waltera Kaspera, glasi: Ako milosrđe po definiciji u sebi nužno uključuje trpljenje može li se, dok držimo sigurnim da je netrpljivost jedna od bitnih vlastitosti božanske naravi, o njemu uopće govoriti, kako Kasper potiče, kao o temeljnom Božjem svojstvu i odrednici Božje biti? To se pitanje i odgovor na nj obrađuje pod kristološkim vidom i to na temelju promišljanja izabranih crkvenih otaca u čijim djelima pronalazimo govor o Božjem milosr...

  16. Experimental demonstration of bandwidth on demand (BoD) provisioning based on time scheduling in software-defined multi-domain optical networks

    Science.gov (United States)

    Zhao, Yongli; Li, Yajie; Wang, Xinbo; Chen, Bowen; Zhang, Jie

    2016-09-01

    A hierarchical software-defined networking (SDN) control architecture is designed for multi-domain optical networks with the Open Daylight (ODL) controller. The OpenFlow-based Control Virtual Network Interface (CVNI) protocol is deployed between the network orchestrator and the domain controllers. Then, a dynamic bandwidth on demand (BoD) provisioning solution is proposed based on time scheduling in software-defined multi-domain optical networks (SD-MDON). Shared Risk Link Groups (SRLG)-disjoint routing schemes are adopted to separate each tenant for reliability. The SD-MDON testbed is built based on the proposed hierarchical control architecture. Then the proposed time scheduling-based BoD (Ts-BoD) solution is experimentally demonstrated on the testbed. The performance of the Ts-BoD solution is evaluated with respect to blocking probability, resource utilization, and lightpath setup latency.

  17. Ab initio studies on the optical effects in the deep ultraviolet nonlinear optical crystals of the KBe2BO3F2 family

    International Nuclear Information System (INIS)

    Kang Lei; Luo Siyang; Huang Hongwei; Lin, Z S; Chen, C T; Zheng Tao

    2012-01-01

    Electronic structures of the deep ultraviolet nonlinear optical crystals of the KBe 2 BO 3 F 2 (KBBF) family, including KBBF, RbBe 2 BO 3 F 2 and CsBe 2 BO 3 F 2 , have been investigated based on a plane-wave pseudopotential method. Their linear and nonlinear optical coefficients are also calculated, and are in good agreement with the experimental results. A real-space atom-cutting method is adopted to analyze the respective contributions of the alkali metal cations and anionic groups to optical response. The results show that the contributions of anionic groups to the nonlinear optical anisotropic responses are dominant, but the influence of the A-site alkali metal cations becomes slightly more pronounced with the increase of their radius. Moreover, the birefringence difference among these crystals strongly depends on the volume effect, i.e., the spatial density of the (BO 3 ) 3- anionic groups. (paper)

  18. In vivo FRET imaging revealed a regulatory role of RanGTP in kinetochore-microtubule attachments via Aurora B kinase.

    Directory of Open Access Journals (Sweden)

    Yoke-Peng Lee

    Full Text Available Under the fluctuating circumstances provided by the innate dynamics of microtubules and opposing tensions resulted from microtubule-associated motors, it is vital to ensure stable kinetochore-microtubule attachments for accurate segregation. However, a comprehensive understanding of how this regulation is mechanistically achieved remains elusive. Using our newly designed live cell FRET time-lapse imaging, we found that post-metaphase RanGTP is crucial in the maintenance of stable kinetochore-microtubule attachments by regulating Aurora B kinase via the NES-bearing Mst1. More importantly, our study demonstrates that by ensuring stable alignment of metaphase chromosomes prior to segregation, RanGTP is indispensible in governing the genomic integrity and the fidelity of cell cycle progression. Our findings suggest an additional role of RanGTP beyond its known function in mitotic spindle assembly during the prometaphase-metaphase transition.

  19. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Science.gov (United States)

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  20. Host composition dependent tunable multicolor emission in the single-phase Ba2(Ln1-zTbz)(BO3)2Cl:Eu phosphors

    NARCIS (Netherlands)

    Xia, Z.; Zhuang, J.; Meijerink, A.; Jing, X.

    2013-01-01

    A new strategy based on the host composition design has been adopted to obtain efficient color-tunable emission from Ba2Ln0.97−zTbz(BO3)2Cl:0.03Eu (Ln = Y, Gd and Lu, z = 0–0.97) phosphors. This study reveals that the single-phase Ba2Ln1−zTbz(BO3)2Cl compounds can be applied to use allowed Eu2+

  1. The Cartoon quality in Internet. Clan TVE, Neox Kidz and Boing: entertainment platforms for young audiences

    Directory of Open Access Journals (Sweden)

    Inmaculada Sánchez-Labella Martín

    2016-05-01

    Full Text Available With the advancement of technology, Internet it has become the primary means for audiovisual consumption while presenting a critical situation around the debate the quality of the content. With the emergence of DTT (Digital Terrestrial Television in Spain television networks, public and private, they have created new thematics channels focused on content for children. At the same time, with the rise of new electronic devices such as tablets and smartphones, they have moved such content to the network by creating of platforms whose programs are aimed childhood. The non-linearity and immediacy in consumption make the Internet becomes an active mean giving autonomy and freedom to access a multitude of content regardless of time and the device. In this situation the child consumers is the audience that worries both parents and educational institutions. Restless, therefore, that children do not find programs adjusted to their age. The quality concept harbors no concrete definition because of the multitude of factors and perspectives that influence it. This paper, and based on different measurement criteria set by countries like Argentina, Chile, Spain, France, Italy, Japan, Sweden, the University of Pennsylvania (USA or the ACTF (Australian Children´s Television Foundation poses as main objective to analyze the online platforms Clan RTVE, Neox Kidz and Boing of television TVE, Antena 3 and Telecinco, respectively, because they are considered spaces with audiovisual material created for children. With the intention of demonstrating that they are presented as quality environments for children who access them it will conduct a qualitative methodology. Using the content analysis technique to each of the animated titles we can say that the cartoons, as outlined above, are quality entertainment programs.

  2. A rapid and low noise switch from RANS to WMLES on curvilinear grids with compressible flow solvers

    Science.gov (United States)

    Deck, Sébastien; Weiss, Pierre-Elie; Renard, Nicolas

    2018-06-01

    A turbulent inflow for a rapid and low noise switch from RANS to Wall-Modelled LES on curvilinear grids with compressible flow solvers is presented. It can be embedded within the computational domain in practical applications with WMLES grids around three-dimensional geometries in a flexible zonal hybrid RANS/LES modelling context. It relies on a physics-motivated combination of Zonal Detached Eddy Simulation (ZDES) as the WMLES technique together with a Dynamic Forcing method processing the fluctuations caused by a Zonal Immersed Boundary Condition describing roughness elements. The performance in generating a physically-sound turbulent flow field with the proper mean skin friction and turbulent profiles after a short relaxation length is equivalent to more common inflow methods thanks to the generation of large-scale streamwise vorticity by the roughness elements. Comparisons in a low Mach-number zero-pressure-gradient flat-plate turbulent boundary layer up to Reθ = 6 100 reveal that the pressure field is dominated by the spurious noise caused by the synthetic turbulence methods (Synthetic Eddy Method and White Noise injection), contrary to the new low-noise approach which may be used to obtain the low-frequency component of wall pressure and reproduce its intermittent nature. The robustness of the method is tested in the flow around a three-element airfoil with WMLES in the upper boundary layer near the trailing edge of the main element. In spite of the very short relaxation distance allowed, self-sustainable resolved turbulence is generated in the outer layer with significantly less spurious noise than with the approach involving White Noise. The ZDES grid count for this latter test case is more than two orders of magnitude lower than the Wall-Resolved LES requirement and a unique mesh is involved, which is much simpler than some multiple-mesh strategies devised for WMLES or turbulent inflow.

  3. Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

    International Nuclear Information System (INIS)

    Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki

    2016-01-01

    BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when not used in accordance with the use of the in-house Bos

  4. Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki [Dept. of Radiation Oncology, Samsung Seoul Hospital, Seoul (Korea, Republic of)

    2016-06-15

    BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

  5. Book Review: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War

    DEFF Research Database (Denmark)

    Taudal Poulsen, René

    2016-01-01

    Review of: Lenka Krátká: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War. Stuttgart: Ibidem Verlag, 2015. x + 271 pp., tables, notes, bibliography. ISBN: 978-3-8382-0666-0, £23.90 (pbk).......Review of: Lenka Krátká: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War. Stuttgart: Ibidem Verlag, 2015. x + 271 pp., tables, notes, bibliography. ISBN: 978-3-8382-0666-0, £23.90 (pbk)....

  6. Identification of fibroblast growth factor receptor 3 (FGFR3 as a protein receptor for botulinum neurotoxin serotype A (BoNT/A.

    Directory of Open Access Journals (Sweden)

    Birgitte P S Jacky

    Full Text Available Botulinum neurotoxin serotype A (BoNT/A causes transient muscle paralysis by entering motor nerve terminals (MNTs where it cleaves the SNARE protein Synaptosomal-associated protein 25 (SNAP25206 to yield SNAP25197. Cleavage of SNAP25 results in blockage of synaptic vesicle fusion and inhibition of the release of acetylcholine. The specific uptake of BoNT/A into pre-synaptic nerve terminals is a tightly controlled multistep process, involving a combination of high and low affinity receptors. Interestingly, the C-terminal binding domain region of BoNT/A, HC/A, is homologous to fibroblast growth factors (FGFs, making it a possible ligand for Fibroblast Growth Factor Receptors (FGFRs. Here we present data supporting the identification of Fibroblast Growth Factor Receptor 3 (FGFR3 as a high affinity receptor for BoNT/A in neuronal cells. HC/A binds with high affinity to the two extra-cellular loops of FGFR3 and acts similar to an agonist ligand for FGFR3, resulting in phosphorylation of the receptor. Native ligands for FGFR3; FGF1, FGF2, and FGF9 compete for binding to FGFR3 and block BoNT/A cellular uptake. These findings show that FGFR3 plays a pivotal role in the specific uptake of BoNT/A across the cell membrane being part of a larger receptor complex involving ganglioside- and protein-protein interactions.

  7. Luminescent properties of (Y,Gd)BO3:Bi3+,RE3+ (RE=Eu, Tb) phosphor under VUV/UV excitation

    International Nuclear Information System (INIS)

    Zeng Xiaoqing; Im, Seoung-Jae; Jang, Sang-Hun; Kim, Young-Mo; Park, Hyoung-Bin; Son, Seung-Hyun; Hatanaka, Hidekazu; Kim, Gi-Young; Kim, Seul-Gi

    2006-01-01

    Bi 3+ - and RE 3+ -co-doped (Y,Gd)BO 3 phosphors were prepared and their luminescent properties under vacuum ultraviolet (VUV)/UV excitation were investigated. Strong red emission for (Y,Gd)BO 3 :Bi 3+ ,Eu 3+ and strong green emission for (Y,Gd)BO 3 :Bi 3+ ,Tb 3+ are observed under VUV excitation from 147 to 200 nm with a much broader excitation region than that of single Eu 3+ -doped or Tb 3+ -doped (Y,Gd)BO 3 phosphor. Strong emissions are also observed under UV excitation around 265 nm where as nearly no luminescence is observed for single Eu 3+ -doped or Tb 3+ -doped (Y,Gd)BO 3 . The luminescence enhancement of Bi 3+ - and RE 3+ -co-doped (Y,Gd)BO 3 phosphors is due to energy transfer from Bi 3+ ion to Eu 3+ or Tb 3+ ion not only in the VUV region but also in the UV region. Besides, host sensitization competition between Bi 3+ and Eu 3+ or Tb 3+ is also observed. The investigated phosphors may be preferable for devices with a VUV light 147-200 nm as an excitation source such as PDP or mercury-free fluorescent lamp

  8. Luminescence, Energy Transfer and Tunable Color of Ce3+- and Tb3+-Activated Na3Gd(BO3)2 Phosphors

    Science.gov (United States)

    Zhang, Xinguo; Pan, Jialiang; Mo, Fuwang

    2017-07-01

    A series of blue Na3Gd(BO3)2:Ce3+ and blue-to-green color-tunable Na3Gd (BO3)2:Ce3+,Tb3+ phosphors were synthesized by the solid-state method. The luminescence, concentration quenching and energy transfer (ET) process of Na3Gd(BO3)2:Ce3+,Tb3+ were investigated. Both Ce3+ and Tb3+ occupy the Gd3+ site in the Na3Gd(BO3)2 host. Na3Gd(BO3)2:Ce3+ exhibits strong ultraviolet absorption and broadband blue emission. The Ce3+ sensitization effect on Tb3+ has been verified by the variation of PL/PLE spectra, the Ce3+ decay lifetimes and the energy transfer efficiency of Na3Gd(BO3)2:Ce3+,Tb3+ phosphors. The maximum Ce3+-Tb3+ ET efficiency has been calculated to be 95%. The emitting color of the obtained phosphors can be modulated from blue (0.179, 0.204) through bluish-green (0.271, 0.391) to green (0.349, 0.551) by properly changing the ratio of Ce3+/Tb3+.

  9. Identification and expression pattern analysis of BoMYB51 involved in indolic glucosinolate biosynthesis from broccoli (Brassica oleracea var. italica).

    Science.gov (United States)

    Yu, Qingyue; Hao, Guodong; Zhou, Jianxin; Wang, Jingying; Evivie, Ejiroghene Ruona; Li, Jing

    2018-06-22

    Glucosinolates are a class of amino acid-derived specialized metabolites characteristic of the Brassicales order. Trp derived indolic glucosinolates are essential for the effective plant defense responses to a wide range of pathogens and herbivores. In Arabidopsis, MYB51 is the key transcription factor positively regulates indolic glucosinolate production by activating certain biosynthetic genes. In this study, we report the isolation and identification of a MYB51 from broccoli designated as BoMYB51. Overexpression of BoMYB51 in Arabidopsis increased indolic glucosinolate production by upregulating biosynthetic genes and resulted in enhanced flagellin22 (Flg22) induced callose deposition. The spatial expression pattern and responsive expression of BoMYB51 to several hormones and stress treatments were investigated by expressing the β-glucuronidase (GUS) reporter gene driven by BoMYB51 promotor in Arabidopsis and quantitative real-time PCR analysis in broccoli. Our study provides information on molecular characteristics of BoMYB51 and possible physiological process BoMYB51 may involve. Copyright © 2018 Elsevier Inc. All rights reserved.

  10. High-pressure studies on electronic and mechanical properties of FeBO3 (B = Ti, Mn, Cr) ceramics - a first-principles study

    Science.gov (United States)

    Kishore, N.; Nagarajan, V.; Chandiramouli, R.

    2018-04-01

    Using the density functional theory (DFT) method, the electronic and mechanical properties of perovskites FeBO3 (B = Ti, Mn, Cr) nanostructures were studied in the pressure range of 0-100 GPa. The band structure studies show the change in the band structure upon substitution of different B cation in FeBO3 perovskite structure. The density of states spectrum gives the perception of change in the electronic properties of FeBO3 with the substitution of B cation. The bulk, shear and Young's moduli were calculated and an increase in the moduli is noticed. Moreover, the hardness increases under high pressure. The high-pressure studies of FeBO3 perovskite nanostructures are explored at atomistic level. The findings show that ductility and hardness of FeBO3 get increased upon an increase in the applied pressure. The substitution of Ti, Mn and Cr on FeBO3 shows a significant change in the electronic and mechanical properties.

  11. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    CERN Document Server

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  12. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Science.gov (United States)

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  13. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    CERN Document Server

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  14. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Science.gov (United States)

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  15. Facile controlled synthesis different morphologies of LuBO{sub 3}:Ln{sup 3+} (Ln = Eu, Tb) phosphors and tunable luminescent properties

    Energy Technology Data Exchange (ETDEWEB)

    Leng, Zhihua; Xiong, Hailong; Li, Linlin; Zhang, Nannan; Liu, Yali; Gan, Shucai, E-mail: gansc@jlu.edu.cn

    2015-10-15

    Sphere-like and cauliflower-like hexagonal-vaterite LuBO{sub 3} have been successfully synthesized for the first time via a chemical conversion route using Lu(OH)CO{sub 3} colloid spheres as sacrificial precursor and H{sub 3}BO{sub 3} as boron source without any additional surfactant. FTIR analysis provides an additional evidence of the formation of vaterite-type LuBO{sub 3} in this method. It was found that, an appropriate amount ethanol in the hydrothermal process has a great effect on the products' morphology and crystallinity. Time-dependent experiments indicate that the formation of LuBO{sub 3} crystals went through a two-stage growth process, which involves a fast nucleation of primary particles followed by a slow aggregation and crystallization of primary particles. An investigation on the photoluminescence (PL) properties of LuBO{sub 3}:Eu{sup 3+} phosphors with different morphologies indicates that their PL intensity are dependent on their crystallinity. The effect of Eu{sup 3+} and Tb{sup 3+} doping concentration on PL intensity were also investigated and the quenching concentration of LuBO{sub 3}:Eu{sup 3+} and LuBO{sub 3}:Tb{sup 3+} is 0.25 and 0.20, respectively. Moreover, for Eu{sup 3+}/Tb{sup 3+} doped LuBO{sub 3} phosphors, the color tones can be tuned from green, through green–yellow and yellow, and then to red by simply adjusting the relative doping concentrations of the Tb{sup 3+} and Eu{sup 3+} ions. - Highlights: • Sphere-like and cauliflower-like LuBO{sub 3} were obtained by a conversion route. • This method used Lu(OH)CO{sub 3} and H{sub 3}BO{sub 3} as the precursors for the first time. • Ethanol can control the products' morphology, crystallinity and PL intensity. • The emitting color tones vary with Tb{sup 3+}/Eu{sup 3+} doped concentration.

  16. Polydopamine-Functionalized CA-(PCL-ran-PLA) Nanoparticles for Target Delivery of Docetaxel and Chemo-photothermal Therapy of Breast Cancer

    Science.gov (United States)

    Kong, Na; Deng, Mei; Sun, Xiu-Na; Chen, Yi-Ding; Sui, Xin-Bing

    2018-01-01

    Current limitations of cancer therapy include the lack of effective strategy for target delivery of chemotherapeutic drugs, and the difficulty of achieving significant efficacy by single treatment. Herein, we reported a synergistic chemo-photothermal strategy based on aptamer (Apt)-polydopamine (pD) functionalized CA-(PCL-ran-PLA) nanoparticles (NPs) for effective delivery of docetaxel (DTX) and enhanced therapeutic effect. The developed DTX-loaded Apt-pD-CA-(PCL-ran-PLA) NPs achieved promising advantages, such as (i) improved drug loading content (LC) and encapsulation efficiency (EE) initiated by star-shaped copolymer CA-(PCL-ran-PLA); (ii) effective target delivery of drugs to tumor sites by incorporating AS1411 aptamers; (iii) significant therapeutic efficacy caused by synergistic chemo-photothermal treatment. In addition, the pD coating strategy with simple procedures could address the contradiction between targeting modification and maintaining formerly excellent bio-properties. Therefore, with excellent bio-properties and simple preparation procedures, the DTX-loaded Apt-pD-CA-(PCL-ran-PLA) NPs effectively increased the local drug concentration in tumor sites, minimized side effects, and significantly eliminated tumors, indicating the promising application of these NPs for cancer therapy. PMID:29527167

  17. A lentiviral sponge for miR-101 regulates RanBP9 expression and amyloid precursor protein metabolism in hippocampal neurons

    Directory of Open Access Journals (Sweden)

    Christian eBarbato

    2014-02-01

    Full Text Available Neurodegeneration associated with amyloid β (Aβ peptide accumulation, synaptic loss, and memory impairment are pathophysiological features of Alzheimer's disease (AD. Numerous microRNAs regulate amyloid precursor protein (APP expression and metabolism. We previously reported that miR-101 is a negative regulator of APP expression in cultured hippocampal neurons. In this study, a search for predicted APP metabolism-associated miR-101 targets led to the identification of a conserved miR-101 binding site within the 3’ untranslated region (UTR of the mRNA encoding Ran-binding protein 9 (RanBP9. RanBP9 increases APP processing by β-amyloid converting enzyme 1 (BACE1, secretion of soluble APPβ (sAPPβ, and generation of Aβ. MiR-101 significantly reduced reporter gene expression when co-transfected with a RanBP9 3'-UTR reporter construct, while site-directed mutagenesis of the predicted miR-101 target site eliminated the reporter response. To investigate the effect of stable inhibition of miR-101 both in vitro and in vivo, a microRNA sponge was developed to bind miR-101 and derepress its targets. Four tandem bulged miR-101 responsive elements (REs, located downstream of the enhanced green fluorescence protein (EGFP open reading frame and driven by the synapsin promoter, were placed in a lentiviral vector to create the pLSyn-miR-101 sponge. Delivery of the sponge to primary hippocampal neurons significantly increased both APP and RanBP9 expression, as well as sAPPβ levels in the conditioned medium. Importantly, silencing of endogenous RanBP9 reduced sAPPβ levels in miR-101 sponge-containing hippocampal cultures, indicating that miR-101 inhibition may increase amyloidogenic processing of APP by RanBP9. Lastly, the impact of miR-101 on its targets was demonstrated in vivo by intrahippocampal injection of the pLSyn-miR-101 sponge into C57BL6 mice. This study thus provides the basis for studying the consequences of long-term miR-101 inhibition on

  18. DEAD-box helicase DDX27 regulates 3′ end formation of ribosomal 47S RNA and stably associates with the PeBoW-complex

    Energy Technology Data Exchange (ETDEWEB)

    Kellner, Markus; Rohrmoser, Michaela [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany); Forné, Ignasi [Adolf Butenandt Institute, Ludwig Maximilians University of Munich, Center for Integrated Protein Science Munich (CIPSM), Schillerstr. 44, Munich 80336 (Germany); Voss, Kirsten; Burger, Kaspar; Mühl, Bastian; Gruber-Eber, Anita [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany); Kremmer, Elisabeth [Institute of Molecular Immunology, Helmholtz Center Munich, Marchioninistr. 25, Munich 81377 (Germany); Imhof, Axel [Adolf Butenandt Institute, Ludwig Maximilians University of Munich, Center for Integrated Protein Science Munich (CIPSM), Schillerstr. 44, Munich 80336 (Germany); Eick, Dirk, E-mail: eick@helmholtz-muenchen.de [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany)

    2015-05-15

    PeBoW, a trimeric complex consisting of pescadillo (Pes1), block of proliferation (Bop1), and the WD repeat protein 12 (WDR12), is essential for processing and maturation of mammalian 5.8S and 28S ribosomal RNAs. Applying a mass spectrometric analysis, we identified the DEAD-box helicase DDX27 as stably associated factor of the PeBoW-complex. DDX27 interacts with the PeBoW-complex via an evolutionary conserved F×F motif in the N-terminal domain and is recruited to the nucleolus via its basic C-terminal domain. This recruitment is RNA-dependent and occurs independently of the PeBoW-complex. Interestingly, knockdown of DDX27, but not of Pes1, induces the accumulation of an extended form of the primary 47S rRNA. We conclude that DDX27 can interact specifically with the Pes1 and Bop1 but fulfils critical function(s) for proper 3′ end formation of 47S rRNA independently of the PeBoW-complex. - Highlights: • DEAD-box helicase DDX27 is a new constituent of the PeBoW-complex. • The N-terminal F×F motif of DDX27 interacts with the PeBoW components Pes1 and Bop1. • Nucleolar anchoring of DDX27 via its basic C-terminal domain is RNA dependent. • Knockdown of DDX27 induces a specific defect in 3′ end formation of 47S rRNA.

  19. A near-UV-converted LiMgBO3:Dy3+ nanophosphor: Surface and spectral investigations

    International Nuclear Information System (INIS)

    Bedyal, A.K.; Kumar, Vinay; Prakash, Ram; Ntwaeaborwa, O.M.; Swart, H.C.

    2015-01-01

    Graphical abstract: - Highlights: • Combustion method was employed to synthesize LiMgBO 3 :Dy 3+ nanophosphors. • The phosphor can be efficiently excited by near-UV chips. • XPS was done to investigate the chemical constitution and chemical bonding state of elements in the LiMgBO 3 : Dy 3+ nanophosphor. • The calculated CIE coordinates (0.45, 0.46) were found to be in the white spectrum region. - Abstract: A near-ultra violet (UV) converted LiMgBO 3 :Dy 3+ nanophosphors have been synthesized by the combustion method. The structural, spectral and optical properties were examined by powder X-ray diffraction, fluorescent spectrophotometry and UV–vis spectroscopy. The excitation spectra of the phosphors contain sharp peaks at 294, 323, 348 and 385 nm due to the 4f–4f transition of the Dy 3+ ion. The phosphor is efficiently excited by near-UV chips. Upon near-UV excitation the phosphor emits intense blue and yellow with a weak red band centered at 484, 573 and 669 nm respectively, ascribed to the transition of Dy 3+ ion from 4 F 9/2 → 6 H 15/2 , 6 H 13/2 , 6 H 11/2 . The diffuse reflectance spectra of the phosphors were consistent with the excitation spectra and were used to calculate the band gap of the material, approximated to be 5.4 eV. The calculated CIE coordinates (0.45, 0.46) under 348 nm excitation were found to be in the white spectrum region. For surface investigation, X-ray photoelectron spectroscopy was used which confirms the presence of all the elements on the surface of the material

  20. Observation of soft phonon mode in TbFe3(BO3)4 by inelastic neutron scattering

    Science.gov (United States)

    Pavlovskiy, M. S.; Shaykhutdinov, K. A.; Wu, L. S.; Ehlers, G.; Temerov, V. L.; Gudim, I. A.; Shinkorenko, A. S.; Podlesnyak, A.

    2018-02-01

    The phonon dispersion in terbium iron borate TbFe3(BO3)4 has been measured by inelastic neutron scattering in a temperature range 180

  1. Interpretation Problem of Czubek's Σa Measurement Method. Reference Experiment on H3BO3 Solutions

    International Nuclear Information System (INIS)

    Krynicka, E.; Gabanska, B.; Woznicka, U.; Dabrowska, J.; Burda, J.

    2001-12-01

    Czubek's method of measurement of the thermal neutron absorption cross section may be influenced by the energy spectrum of the thermal neutron flux (deviated from the Maxwellian distribution) which exist in the two-region geometric system. A correction function has been experimentally obtained to eliminate this disturbance. A series of reference measurements has been done on the H 3 BO 3 solution and Plexiglas outer moderator. The obtained function allows to interpret correctly measurements of the thermal neutron absorption rate in the range from 10 000 to 45 000 s -1 for hydrogenous samples. (author)

  2. Decorated Shastry-Sutherland lattice in the spin-(1)/(2) magnet CdCu2(BO3)2

    Science.gov (United States)

    Janson, O.; Rousochatzakis, I.; Tsirlin, A. A.; Richter, J.; Skourski, Yu.; Rosner, H.

    2012-02-01

    We report the microscopic magnetic model for the spin-1/2 Heisenberg system CdCu2(BO3)2, one of the few quantum magnets showing the 1/2-magnetization plateau. Recent neutron diffraction experiments on this compound [M. Hase , Phys. Rev. BPLRBAQ0556-280510.1103/PhysRevB.80.104405 80, 104405 (2009)] evidenced long-range magnetic order, inconsistent with the previously suggested phenomenological magnetic model of isolated dimers and spin chains. Based on extensive density functional theory band structure calculations, exact diagonalizations, quantum Monte Carlo simulations, third-order perturbation theory as well as high-field magnetization measurements, we find that the magnetic properties of CdCu2(BO3)2 are accounted for by a frustrated quasi-2D magnetic model featuring four inequivalent exchange couplings: the leading antiferromagnetic coupling Jd within the structural Cu2O6 dimers, two interdimer couplings Jt1 and Jt2, forming magnetic tetramers, and a ferromagnetic coupling Jit between the tetramers. Based on comparison to the experimental data, we evaluate the ratios of the leading couplings Jd : Jt1 : Jt2 : Jit = 1 : 0.20 : 0.45 : -0.30, with Jd of about 178 K. The inequivalence of Jt1 and Jt2 largely lifts the frustration and triggers long-range antiferromagnetic ordering. The proposed model accounts correctly for the different magnetic moments localized on structurally inequivalent Cu atoms in the ground-state magnetic configuration. We extensively analyze the magnetic properties of this model, including a detailed description of the magnetically ordered ground state and its evolution in magnetic field with particular emphasis on the 1/2-magnetization plateau. Our results establish remarkable analogies to the Shastry-Sutherland model of SrCu2(BO3)2, and characterize the closely related CdCu2(BO3)2 as a material realization for the spin-1/2 decorated anisotropic Shastry-Sutherland lattice.

  3. First principles results on TbAl3(BO3)4: A promising magneto-optical material

    KAUST Repository

    Saeed, Y.

    2011-11-21

    The electronic and optical properties of TbAl3(BO3)4 are determined using density functional theory. The calculated total magnetic moment of 5.96 μB is close to the expected moment of Tb3+. The frequency dependent dielectric function, refractive index, extinction coefficient, absorption, optical reflectivity, and energy loss function are explained in terms of the transitions between the valence and conduction bands. We find very high Kerr angles for ultraviolet light and potential for extension, even into the visible range by band structure design.

  4. Modelling soil dust aerosol in the Bodélé depression during the BoDEx campaign

    OpenAIRE

    I. Tegen; B. Heinold; M. Todd; J. Helmert; R. Washington; O. Dubovik; O. Dubovik

    2006-01-01

    We present regional model simulations of the dust emission events during the Bodélé Dust Experiment (BoDEx) that was carried out in February and March 2005 in Chad. A box model version of the dust emission model is used to test different input parameters for the emission model, and to compare the dust emissions computed with observed wind speeds to those calculated with wind speeds from the regional model simulation. While field observations indicate that dust production occurs via self-abras...

  5. Modelling soil dust aerosol in the Bodélé depression during the BoDEx campaign

    OpenAIRE

    Tegen , I.; Heinold , B.; Todd , M.; Helmert , J.; Washington , R.; Dubovik , O.

    2006-01-01

    International audience; We present regional model simulations of the dust emission events during the Bodélé Dust Experiment (BoDEx) that was carried out in February and March 2005 in Chad. A box model version of the dust emission model is used to test different input parameters for the emission model, and to compare the dust emissions computed with observed wind speeds to those calculated with wind speeds from the regional model simulation. While field observations indicate that dust producti...

  6. Modelling soil dust aerosol in the Bodélé depression during the BoDEx campaign

    OpenAIRE

    R. Washington; J. Helmert; M. Todd; B. Heinold; I. Tegen; O. Dubovik

    2006-01-01

    We present regional model simulations of the dust emission events during the Bodélé Dust Experiment (BoDEx) that was carried out in February and March 2005 in Chad. A box model version of the dust emission model is used to test different input parameters for the emission model, and to compare the dust emissions computed with observed wind speeds to those calculated with wind speeds from the regional model simulation. While field observations indicate that dust production occurs via ...

  7. First principles results on TbAl3(BO3)4: A promising magneto-optical material

    KAUST Repository

    Saeed, Y.; Singh, Nirpendra; Schwingenschlö gl, Udo

    2011-01-01

    The electronic and optical properties of TbAl3(BO3)4 are determined using density functional theory. The calculated total magnetic moment of 5.96 μB is close to the expected moment of Tb3+. The frequency dependent dielectric function, refractive index, extinction coefficient, absorption, optical reflectivity, and energy loss function are explained in terms of the transitions between the valence and conduction bands. We find very high Kerr angles for ultraviolet light and potential for extension, even into the visible range by band structure design.

  8. Tunable Yellow-Red Photoluminescence and Persistent Afterglow in Phosphors Ca4LaO(BO3)3:Eu3+ and Ca4EuO(BO3)3.

    Science.gov (United States)

    Chen, Zhen; Pan, Yuexiao; Xi, Luqing; Pang, Ran; Huang, Shaoming; Liu, Guokui

    2016-11-07

    In most Eu 3+ activated phosphors, only red luminescence from the 5 D 0 is obtainable, and efficiency is limited by concentration quenching. Herein we report a new phosphor of Ca 4 LaO(BO 3 ) 3 :Eu 3+ (CLBO:Eu) with advanced photoluminescence properties. The yellow luminescence emitted from the 5 D 1,2 states is not thermally quenched at room temperature. The relative intensities of the yellow and red emission bands depend strongly on the Eu 3+ doping concentration. More importantly, concentration quenching of Eu 3+ photoluminescence is absent in this phosphor, and the stoichiometric compound of Ca 4 EuO(BO 3 ) 3 emits stronger luminescence than the Eu 3+ doped compounds of CLBO:Eu; it is three times stronger than that of a commercial red phosphor of Y 2 O 3 :Eu 3+ . Another beneficial phenomenon is that ligand-to-metal charge transfer (CT) transitions occur in the long UV region with the lowest charge transfer band (CTB) stretched down to about 3.67 eV (∼330 nm). The CT transitions significantly enhance Eu 3+ excitation, and thus result in stronger photoluminescence and promote trapping of excitons for persistent afterglow emission. Along with structure characterization, optical spectra and luminescence dynamics measured under various conditions as a function of Eu 3+ doping, temperature, and excitation wavelength are analyzed for a fundamental understanding of electronic interactions and for potential applications.

  9. Molecular Characterization of the First Bovine Herpesvirus 4 (BoHV-4 Strains Isolated from In Vitro Bovine Embryos production in Argentina.

    Directory of Open Access Journals (Sweden)

    Erika González Altamiranda

    Full Text Available Bovine herpesvirus 4 (BoHV-4 is increasingly considered as responsible for various problems of the reproductive tract. The virus infects mainly blood mononuclear cells and displays specific tropism for vascular endothelia, reproductive and fetal tissues. Epidemiological studies suggest its impact on reproductive performance, and its presence in various sites in the reproductive tract highlights its potential transmission in transfer-stage embryos. This work describes the biological and genetic characterization of BoHV-4 strains isolated from an in vitro bovine embryo production system. BoHV-4 strains were isolated in 2011 and 2013 from granulosa cells and bovine oocytes from ovary batches collected at a local abattoir, used as "starting material" for in vitro production of bovine embryos. Compatible BoHV-4-CPE was observed in the co-culture of granulosa cells and oocytes with MDBK cells. The identity of the isolates was confirmed by PCR assays targeting three ORFs of the viral genome. The phylogenetic analyses of the strains suggest that they were evolutionary unlinked. Therefore it is possible that BoHV-4 ovary infections occurred regularly along the evolution of the virus, at least in Argentina, which can have implications in the systems of in vitro embryo production. Thus, although BoHV-4 does not appear to be a frequent risk factor for in vitro embryo production, data are still limited. This study reveals the potential of BoHV-4 transmission via embryo transfer. Moreover, the high variability among the BoHV-4 strains isolated from aborted cows in Argentina highlights the importance of further research on the role of this virus as an agent with the potential to cause reproductive disease in cattle. The genetic characterization of the isolated strains provides data to better understand the pathogenesis of BoHV-4 infections. Furthermore, it will lead to fundamental insights into the molecular aspects of the virus and the means by which these

  10. Clinical protection of goats against CpHV-1 induced genital disease with a BoHV-4-based vector expressing CpHV-1 gD.

    Directory of Open Access Journals (Sweden)

    Gaetano Donofrio

    Full Text Available Caprine herpesvirus type 1 (CpHV-1 is an alphaherpesvirus causing genital disease leading to abortion in adult pregnant goats and a systemic disease with high morbility and mortality in kids. Further, Caprine herpesvirus 1 infection represents a valuable large animal model for human herpesvirus induced genital disease, exploitable for pathogenic studies, new vaccines and antiviral molecules testing. Here, the bovine herpesvirus 4 (BoHV-4 based vector derived from an apathogenic isolate of BoHV-4 and expressing the immunodominant CpHV-1 glycoprotein D (BoHV-4-A-gD(cpgD(106ΔTK was constructed and its ability to protect goats against CpHV-1 induced genital disease evaluated. The subcutaneous route of recombinant BoHV-4 administration was first tested in vivo/ex vivo by in vivo image analysis and in vitro by goat skin primary cultures preparation and transduction. Next, an exploratory immunization and safety study in goats was performed with two recombinant BoHV4, BoHV-4-A-gD(cpgD(106ΔTK or BoHV-4-CMV-IgK-gE2gD-TM. In both cases no clinical signs were evident but a good titer of serum neutralizing antibodies was produced in all inoculated animals. When a challenge experiment was performed in a new group of animals using a highly pathogenic dose of CpHV-1, all the vaccinated goats with BoHV-4-A-gD(cpgD(106ΔTK were protected toward CpHV-1 induced genital disease respect to the unvaccinated control which showed typical vaginal lesions with a high grade of clinical score as well as a long lasting viral shedding. In summary, the data acquired in the present study validate BoHV-4-based vector as a safe and effective viral vector for goat vaccination against CpHV-1 induced genital disease and pave the way for further applications.

  11. Synthesis and structural characterization of Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9}

    Energy Technology Data Exchange (ETDEWEB)

    Braeuchle, Sebastian; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie; Seibald, Markus [OSRAM GmbH, Schwabmuenchen (Germany). Corporate Innovation

    2017-07-01

    Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9} was prepared by high-temperature solid state synthesis at 900 C in a platinum crucible from lithium carbonate, potassium carbonate, boric acid, and europium(III) oxide. The title compound crystallizes in the orthorhombic space group Pca2{sub 1} (no. 29) (Z = 4). The structure was refined from single-crystal X-ray diffraction data: a = 21.126(2), b = 6.502(2), c = 17.619(2) Aa, V = 2420.1(2) Aa{sup 3}, R1 = 0.0183 and wR2 = 0.0412 for all data. The crystal structure of Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9} is isotypic to Li{sub 3}K{sub 3}Y{sub 7}(BO{sub 3}){sub 9} featuring isolated BO{sub 3} units and LiO{sub 6} octahedra forming [Li{sub 3}B{sub 4}O{sub 21}] units in the ac plane, which are linked by additional BO{sub 3} units. The K{sup +} and Eu{sup 3+} cations are arranged in the cavities of the structure.

  12. A Comparative Assessment of Spalart-Shur Rotation/Curvature Correction in RANS Simulations in a Centrifugal Pump Impeller

    Directory of Open Access Journals (Sweden)

    Ran Tao

    2014-01-01

    Full Text Available RANS simulation is widely used in the flow prediction of centrifugal pumps. Influenced by impeller rotation and streamline curvature, the eddy viscosity models with turbulence isotropy assumption are not accurate enough. In this study, Spalart-Shur rotation/curvature correction was applied on the SST k-ω turbulence model. The comparative assessment of the correction was proceeded in the simulations of a centrifugal pump impeller. CFD results were compared with existing PIV and LDV data under the design and low flow rate off-design conditions. Results show the improvements of the simulation especially in the situation that turbulence strongly produced due to undesirable flow structures. Under the design condition, more reasonable turbulence kinetic energy contour was captured after correction. Under the low flow rate off-design condition, the prediction of turbulence kinetic energy and velocity distributions became much more accurate when using the corrected model. So, the rotation/curvature correction was proved effective in this study. And, it is also proved acceptable and recommended to use in the engineering simulations of centrifugal pump impellers.

  13. Zonal RANS/LES coupling simulation of a transitional and separated flow around an airfoil near stall

    Energy Technology Data Exchange (ETDEWEB)

    Richez, F.; Mary, I.; Gleize, V. [ONERA, Department of Computational Fluid Dynamics and Aeroacoustics, 29 Avenue de la Division Leclerc, BP 72, Chatillon (France); Basdevant, C. [Universite Paris-Nord, Laboratoire d' Analyse, Geometrie et Applications, CNRS, Villetaneuse (France)

    2008-05-15

    The objective of the current study is to examine the course of events leading to stall just before its occurrence. The stall mechanisms are very sensitive to the transition that the boundary layer undergoes near the leading edge of the profile by a so-called laminar separation bubble (LSB). In order to provide helpful insights into this complex flow, a zonal Reynolds-averaged Navier-Stokes (RANS)/large-eddy simulation (LES) simulation of the flow around an airfoil near stall has been achieved and its results are presented and analyzed in this paper. LSB has already been numerically studied by direct numerical simulation (DNS) or LES, but for a flat plate with an adverse pressure gradient only. We intend, in this paper, to achieve a detailed analysis of the transition process by a LSB in more realistic conditions. The comparison with a linear instability analysis has shown that the numerical instability mechanism in the LSB provides the expected frequency of the perturbations. Furthermore, the right order of magnitude for the turbulence intensities at the reattachment point is found. (orig.)

  14. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动

    Institute of Scientific and Technical Information of China (English)

    李秋菊

    2017-01-01

    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  15. Effects of Zr4+ codoping on the Lu0.8Sc0.2BO3:Ce scintillation materials

    International Nuclear Information System (INIS)

    Wu, Yuntao; Ren, Guohao; Ding, Dongzhou; Shang, Shanshan; Sun, Dandan; Zhang, Guoqing; Wang, Jiayu; Pan, Shangke; Yang, Fan

    2013-01-01

    Both Zr-codoped Lu 0.8 Sc 0.2 BO 3 :Ce polycrystalline powders and single crystals were obtained by solid-state reaction and Czochralski method, respectively. The effects of Zr codoping on the optical absorption, Ce 3+ /Ce 4+ ratio, scintillation efficiency, decay time and point defect in Lu 0.8 Sc 0.2 BO 3 :Ce materials were examined systematically. Our results show that there is no positive contribution of Zr 4+ ion codoping to the scintillation efficiency. And the reasons for the deterioration of scintillation efficiency by codoping Zr 4+ were revealed. - Highlights: ► No positive contribution of the Zr 4+ ions on the scintillation efficiency was found. ► New optical absorption band was in the region from 200 to 225 nm. ► Continuously accelerated decay time indicated that Zr 4+ codoping induced new point defects. ► The induced hole trap located at 1.91 eV below the conduction band.

  16. Study on the fabrication and photoluminescence characteristics of LiBO2 glass scintillators with the lanthanides activators

    International Nuclear Information System (INIS)

    Sin, S. W.; Hwang, J. H.; Choi, S. H.; Sumarokov, S. Yu.

    2002-01-01

    LiBO 2 glass scintillators were fabricated, and lanthanides(except Pm) oxides or chlorides were used as an activator. For the fabrication of LiBO 2 glasses, optimum heating conditions were obtained, and the photoluminescence of the glasses was measured by the monochromator. For the best transparency of the glass samples, optimum heating temperature and time are 1000 .deg. C and 40 min, respectively. The result of photoluminescence analysis shows that Pr, Nd, Gd, Ho, Er, Tm, Yb, and Lu are not good as activator. Because emission spectrum of samples with them was equal to that of sample without activator. In the case of samples with Europium, the peak of emission spectrum of Eu(III) is 810 nm. And Samples with Ce(III) are 760 nm, and Tb(III) are about 535 nm. Samples with Ce(III) and Tb(III) have the best PL intensity with added sugar in Ar reduction atmosphere, and sample with Eu(III) has the best intensity without a reducing process

  17. BO2-functionalized B3N3C54 heterofullerene as a possible candidate for molecular spintronics and nonlinear optics

    Science.gov (United States)

    Srivastava, Ambrish Kumar; Pandey, Sarvesh Kumar; Misra, Neeraj

    2016-04-01

    BO2-substituted B3N3C54 heterofullerene was studied using density functional theory, and its electronic, magnetic and nonlinear optical properties are discussed. The substitution was considered at the B and N sites of the heterofullerene, in lower and higher spin states. We notice that BO2 substitution at the B sites of B3N3C54 heterofullerene leads to interesting properties, such as a smaller energy gap (0.66 eV) and a high spin magnetic moment (3 μ B). The density-of-states curves, molecular orbitals and spin density surfaces have been used to explain these facts. In addition, the first-order mean hyperpolarizability of B3N3C54 heterofullerene has been found to be significantly large (3.6 × 103 a.u.), which is due to smaller transition energy in the crucial excited state. This is reflected by the absorption spectra calculated using the time-dependent density functional theory method. These findings may be exploited to design novel materials for possible spintronic and electro-optical applications.

  18. Bovine herpes virus-1 (BoHV-1 detection in dairy cattle with reproductive problems in Sudan

    Directory of Open Access Journals (Sweden)

    Amira Mohamed Elhassan

    2015-06-01

    Full Text Available The present work aimed to observe the infection pattern of Bovine herpes virus-1 (BoHV-1 in dairy cattle with reproductive problems in Sudan. A total of 140 samples comprising of vaginal swab (n=97, placenta (n=15, whole blood (n=19, uterine fluid (n=1, and serum (n=8 were collected from 16 dairy herds showing particularly high rate of abortion and infertility in Khartoum State. The samples were used for virus isolation, and were tested by Enzyme-Linked Immunosorbent Assay (ELISA and polymerase chain reaction (PCR. No virus could be isolated from the samples inoculated for isolation in cell culture. Out of 80 specimens tested by ELISA, 7 (8.75% were found to be positive, and one sample was doubtful. Using PCR, 11 (10.7% out of 103 samples were found to be positive. When comparing between two methods for DNA extraction, the DNA extracted by commercial kit was found to be better in quality as compared to the DNA extracted using phenol/chloroform/isoamyl-alcohol method. The study confirmed the presence of BoHV-1 in cattle farms with reproductive problems in Sudan.

  19. Silylene-Nickel Promoted Cleavage of B-O Bonds: From Catechol Borane to the Hydroborylene Ligand.

    Science.gov (United States)

    Hadlington, Terrance J; Szilvási, Tibor; Driess, Matthias

    2017-06-19

    The first 16 valence electron [bis(NHC)](silylene)Ni 0 complex 1, [( TMS L)ClSi:→Ni(NHC) 2 ], bearing the acyclic amido-chlorosilylene ( TMS L)ClSi: ( TMS L=N(SiMe 3 )Dipp; Dipp=2,6-Pr i 2 C 6 H 4 ) and two NHC ligands (N-heterocyclic carbene=:C[(Pr i )NC(Me)] 2 ) was synthesized in high yield and structurally characterized. Compound 1 is capable of facile dihydrogen activation under ambient conditions to give the corresponding HSi-NiH complex 2. Most notably, 1 reacts with catechol borane to afford the unprecedented hydroborylene-coordinated (chloro)(silyl)nickel(II) complex 3, {[cat( TMS L)Si](Cl)Ni←:BH(NHC) 2 }, via the cleavage of two B-O bonds and simultaneous formation of two Si-O bonds. The mechanism for the formation of 3 was rationalized by means of DFT calculations, which highlight the powerful synergistic effects of the Si:→Ni moiety in the breaking of incredibly strong B-O bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. 4-spin plaquette singlet state in the Shastry-Sutherland compound SrCu2(BO3)2

    Science.gov (United States)

    Zayed, M. E.; Rüegg, Ch.; Larrea J., J.; Läuchli, A. M.; Panagopoulos, C.; Saxena, S. S.; Ellerby, M.; McMorrow, D. F.; Strässle, Th.; Klotz, S.; Hamel, G.; Sadykov, R. A.; Pomjakushin, V.; Boehm, M.; Jiménez-Ruiz, M.; Schneidewind, A.; Pomjakushina, E.; Stingaciu, M.; Conder, K.; Rønnow, H. M.

    2017-10-01

    The study of interacting spin systems is of fundamental importance for modern condensed-matter physics. On frustrated lattices, magnetic exchange interactions cannot be simultaneously satisfied, and often give rise to competing exotic ground states. The frustrated two-dimensional Shastry-Sutherland lattice realized by SrCu2(BO3)2 (refs ,) is an important test case for our understanding of quantum magnetism. It was constructed to have an exactly solvable 2-spin dimer singlet ground state within a certain range of exchange parameters and frustration. While the exact dimer state and the antiferromagnetic order at both ends of the phase diagram are well known, the ground state and spin correlations in the intermediate frustration range have been widely debated. We report here the first experimental identification of the conjectured plaquette singlet intermediate phase in SrCu2(BO3)2. It is observed by inelastic neutron scattering after pressure tuning to 21.5 kbar. This gapped singlet state leads to a transition to long-range antiferromagnetic order above 40 kbar, consistent with the existence of a deconfined quantum critical point.

  1. Effects of membrane curvature and pH on proton pumping activity of single cytochrome bo3 enzymes

    DEFF Research Database (Denmark)

    Li, Mengqiu; Khan, Sanobar; Rong, Honglin

    2017-01-01

    The molecular mechanism of proton pumping by heme-copper oxidases (HCO) has intrigued the scientific community since it was first proposed. We have recently reported a novel technology that enables the continuous characterisation of proton transport activity of a HCO and ubiquinol oxidase from...... Escherichia coli, cytochrome bo3, for hundreds of seconds on the single enzyme level (Li et al. J Am Chem Soc 137 (2015) 16055–16063). Here, we have extended these studies by additional experiments and analyses of the proton transfer rate as a function of proteoliposome size and pH at the N- and P......-side of single HCOs. Proton transport activity of cytochrome bo3 was found to decrease with increased curvature of the membrane. Furthermore, proton uptake at the N-side (proton entrance) was insensitive to pH between pH 6.4–8.4, while proton release at the P-side had an optimum pH of ~ 7.4, suggesting...

  2. Polarized spectra calculation and continuous wave laser operation of Yb-doped disordered Ca3La2(BO3)4 crystal

    Science.gov (United States)

    Wang, Yeqing; Chen, Aixi; You, Zhenyu; Tu, Chaoyang

    2015-12-01

    A notable disorder crystal Yb:Ca3La2(BO3)4 crystal with Yb3+ ion doping concentration of 10 at.% was grown by the Czochralski method. The polarized absorption, polarized emission, and polarized gain cross sections were systematically calculated. The laser operations were investigated with Yb:Ca3La2(BO3)4 crystals cut along the a, b, and c crystallographic axes. The highest output power of 3.88 W was obtained by using the b-cut Yb:Ca3La2(BO3)4 crystal, with a slope efficiency of 62%. Additionally, it was confirmed that the output laser spectra were largely dependent on the output coupler.

  3. Polarized spectra calculation and continuous wave laser operation of Yb-doped disordered Ca3La2(BO3)4 crystal

    International Nuclear Information System (INIS)

    Wang, Yeqing; Chen, Aixi; You, Zhenyu; Tu, Chaoyang

    2015-01-01

    A notable disorder crystal Yb:Ca 3 La 2 (BO 3 ) 4 crystal with Yb 3+ ion doping concentration of 10 at.% was grown by the Czochralski method. The polarized absorption, polarized emission, and polarized gain cross sections were systematically calculated. The laser operations were investigated with Yb:Ca 3 La 2 (BO 3 ) 4 crystals cut along the a, b, and c crystallographic axes. The highest output power of 3.88 W was obtained by using the b-cut Yb:Ca 3 La 2 (BO 3 ) 4 crystal, with a slope efficiency of 62%. Additionally, it was confirmed that the output laser spectra were largely dependent on the output coupler. (paper)

  4. PENGARUH GAYA KEPEMIMPINAN TRANSFORMASIONAL DAN KOMPENSASI TERHADAP KINERJA KARYAWAN DENGAN MOTIVASI SEBAGAI VARIABEL INTERVENING (STUDI PADA INDUSTRI ALAS KAKI PT. BO KYUNG PASURUAN

    Directory of Open Access Journals (Sweden)

    Wahyu Budi Priyanto

    2016-07-01

    Full Text Available Compensation is also self motivation factor for employees, where those things end in high-low level of work result or performance. This research purposes to test the effect of transformational leadership style, compensation, and motivation of employee’s performance, motivation as an effect mediator from transformational leadership style and compensation to employee’s performance in PT. Bo Kyung Pasuruan. This research is explanatory. In this research uses 96 samples from 2719 employees that work in PT. Bo Kyung Pasuruan. The result of Partial Least Square (PLS this research shows that transformational leadership style is positively effected but not significant to motivation and employee’s performance. Motivation affect transformational leadership style of employee’s performance, and motivation does not influence compensation of employee’s performance in PT. Bo Kyung Pasuruan.

  5. “Ni{sub 5}TiO{sub 7}” is Ni{sub 5}TiO{sub 4}(BO{sub 3}){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Nalbandyan, V.B.

    2017-05-15

    It is shown that the compound known as Ni{sub 5}TiO{sub 7} and considered as a promising catalyst and oxidation product of alloys does not exist and its XRD pattern actually corresponds to Ni{sub 5}TiO{sub 4}(BO{sub 3}){sub 2} - Graphical abstract: XRD pattern of “Ni{sub 5}TiO{sub 7}” (top) is identical to that for Ni{sub 5}TiO{sub 4}(BO{sub 3}){sub 2} (bottom) based on single-crystal structural data. - Highlights: • Popular catalyst known as Ni{sub 5}TiO{sub 7} is actually Ni{sub 5}TiO{sub 4}(BO{sub 3}){sub 2}. • B{sub 2}O{sub 3} came from the flux used for crystal growth. • Some authors reporting this phase did not use any boron compounds.

  6. A modern approach for epitope prediction: identification of foot-and-mouth disease virus peptides binding bovine leukocyte antigen (BoLA) class I molecules

    DEFF Research Database (Denmark)

    Pandya, Mital; Rasmussen, Michael; Hansen, Andreas

    2015-01-01

    Major histocompatibility complex (MHC) class I molecules regulate adaptive immune responses through the presentation of antigenic peptides to CD8+ T cells. Polymorphisms in the peptide binding region of class I molecules determine peptide binding affinity and stability during antigen presentation......, and different antigen peptide motifs are associated with specific genetic sequences of class I molecules. Understanding bovine leukocyte antigen (BoLA), peptide-MHC class I binding specificities may facilitate development of vaccines or reagents for quantifying the adaptive immune response to intracellular...... pathogens, such as foot-and-mouth disease virus (FMDV). Six synthetic BoLA class I (BoLA-I) molecules were produced, and the peptide binding motif was generated for five of the six molecules using a combined approach of positional scanning combinatorial peptide libraries (PSCPLs) and neural network...

  7. Icon of the Holy Mandylion and representation of multi-layered visual identity of Božidar Vuković

    Directory of Open Access Journals (Sweden)

    Borozan Igor

    2015-01-01

    Full Text Available It was in the monastery of Saint Francis in Venice in the year 1520 when Božidar Vuković purchased the icon of the Holy Mandylion. By that particular acquisition, this prominent publisher originating from Zeta has visualized his new position in the sixteenth century Venice. The multi-layered identity of Božidar Vuković was manifested by the subsequent inclusion of the noble coat of arms of the House of Vuković on the back of the icon. By the use of verbal and visual language the artificial initiation of Božidar Vuković within the distinguished members of Venetian society has been confirmed. [Projekat Ministarstva nauke Republike Srbije, br. 177001: Predstave identiteta u verbalno-vizuelnoj kulturi novog doba

  8. Multichannel Luminescence Properties of Mixed-Valent Eu2+/Eu3+ Coactivated SrAl3BO7 Nanocrystalline Phosphors for Near-UV LEDs.

    Science.gov (United States)

    Liu, Xiaoming; Xie, Weijie; Lü, Ying; Feng, Jingchun; Tang, Xinghua; Lin, Jun; Dai, Yuhua; Xie, Yu; Yan, Liushui

    2017-11-20

    Up to now, orchestrating the coexistence of Eu 2+ and Eu 3+ activators in a single host lattice has been an extremely difficult task, especially for the appearance of the characteristic emission of Eu 2+ and Eu 3+ in order to generate white light. Nevertheless, here we demonstrate a new Eu 2+ /Eu 3+ coactivated SrAl 3 BO 7 nanocrystalline phosphor with abundant and excellent multichannel luminescence properties. A series of Eu 2+ /Eu 3+ coactivated SrAl 3 BO 7 nanocrystalline phosphors were prepared through a Pechini-type sol-gel method followed by a reduction process. With excitation of UV/NUV light, the prepared SrAl 3 BO 7 :Eu 2+ ,Eu 3+ phosphors show not only the characteristic f-f transitions of Eu 3+ ion ( 5 D J → 7 F J,J' , J, J' = 0-3), but also the 5d → 4f transitions of Eu 2+ ion with comparable intensity from 400 to 700 nm in the whole visible spectral region. The luminescence color of the SrAl 3 BO 7 :Eu 2+ ,Eu 3+ phosphor can be tuned from blue, blue-green, white, and orange to orange-red by changing the excitation wavelength, the overall doping concentration of europium ions (Eu 2+ , Eu 3+ ), and the relative ratio of Eu 2+ to Eu 3+ ions to some extent. A single-phase white-light emission has been realized in SrAl 3 BO 7 :Eu 2+ ,Eu 3+ phosphor. The obtained SrAl 3 BO 7 :Eu 2+ ,Eu 3+ phosphor has potential application in the area of NUV white-light-emitting diodes.

  9. Czochralski growth and optical properties of Li 6Gd 1-xEu x(BO 3) 3 ( x=0-1) single crystals

    Science.gov (United States)

    Yavetskiy, R. P.; Dolzhenkova, E. F.; Dubovik, M. F.; Korshikova, T. I.; Tolmachev, A. V.

    2005-04-01

    It was shown that a continuous series of Li 6Gd 1-xEu x(BO 3) 3 solid solutions exist within the whole concentration range ( x=0-1). Li 6Gd 1-xEu x(BO 3) 3 ( x=0-0.03; 1) single crystals up to 25 mm in length and up to 20 mm in diameter have been grown by the Czochralski method. The structural perfection of the crystals has been estimated from etch patterns and XPA analysis results. The optical absorption and thermally stimulated luminescence of the grown crystals has been studied.

  10. MCNP calculation of the critical H_3BO_3 concentrations for the first fuel loading into the reactor core of NPP MO-3-4 units

    International Nuclear Information System (INIS)

    Vrban, B.; Lueley, J.; Farkas, G.; Hascik, J.; Hinca, R.; Petriska, M.; Slugen, V.

    2012-01-01

    The purpose of the analysis was the determination of critical H_3BO_3 concentrations for the first fuel loading into the reactor core of MO34 units using 2"n"d generation fuel during the first start-up of new unit using calculation code MCNP 1.60. H_3BO_3 concentrations were computed for the given temperature of the primary circuit and position of the 6"t"h safety control rod group. Because of the very first start-up of these units, detailed analyses of active-core parameters are required by National Regulatory Authority and needed for safe operation of nuclear facility. (authors)

  11. Magnetic properties of Co 2 2+ Co 1 - x 3+ Fe x 3+ BO5 ( x = 0.10) single crystals with a ludwigite structure

    Science.gov (United States)

    Knyazev, Yu. V.; Kazak, N. V.; Bayukov, O. A.; Platunov, M. S.; Velikanov, D. A.; Bezmaternykh, L. N.; Ivanova, N. B.; Ovchinnikov, S. G.

    2017-04-01

    The investigation of mixed Co-Fe ludwigite single crystals shows that their magnetic properties are close to the magnetic properties of Fe3BO5 despite the predominance of cobalt ions. The magnetic properties of Co3 - x Fe x BO5 single crystals with x = 0.10 are studied in detail. Magnetometric measurements demonstrate a strong magnetic anisotropy with easy magnetization axis b, and the orbital magnetic moment of cobalt is in a frozen state. The detected temperature dependence of the absorption of Mössbauer spectra allowed us to determine the magnetic ordering temperature, which agrees with the results of magnetization measurements ( T C = 84 K).

  12. Primerjava učinkovitosti različnih kombinacij herbicidov in njihov vpliv na plevelno združbo v vinogradu

    OpenAIRE

    Arnečič, Suzana

    2011-01-01

    V letih 2008 in 2009 smo na Univerzitetnem centru Meranovo Fakultete za kmetijstvo in biosistemske vede v vinogradu sorte 'Renski rizling' ugotavljali učinkovitost enajstih herbicidov oziroma njihovih kombinacij za zatiranje plevelne združbe pod trtami. Poskus je bil zastavljen po metodi naključnih blokov v treh ponovitvah. Ocenjevali smo učinkovitost herbicidov in pokrovnost tal s plevelno združbo. V letu 2008 je bila statistično značilna najmanjša pokrovnost tal s plevelno združbo pri obrav...

  13. Improved Prediction of Bovine Leucocyte Antigens (BoLA) Presented Ligands by Use of Mass-Spectrometry-Determined Ligand and in Vitro Binding Data

    DEFF Research Database (Denmark)

    Nielsen, Morten; Connelley, Tim; Ternette, Nicola

    2018-01-01

    Peptide binding to MHC class I molecules is the single most selective step in antigen presentation and the strongest single correlate to peptide cellular immunogenicity. The cost of experimentally characterizing the rules of peptide presentation for a given MHC-I molecule is extensive, and predic...... available at http://www.cbs.dtu.dk/services/NetMHCpan/NetBoLApan . The approach has here been applied to the BoLA-I system, but the pipeline is readily applicable to MHC systems in other species....

  14. Assessment of benzene-induced hematotoxicity using a human-like hematopoietic lineage in NOD/Shi-scid/IL-2Rγnull mice.

    Directory of Open Access Journals (Sweden)

    Masayuki Takahashi

    Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.

  15. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Science.gov (United States)

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei

    2014-05-01

    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.

  16. Estimativa por infravermelho da concentração da unidade estrutural b-O-4 em ligninas de angiospermas tropicais Infrared estimates of the concentration of the b-o-4 structural unit in lignins of tropical angiosperms

    Directory of Open Access Journals (Sweden)

    Heber dos Santos Abreu

    1997-12-01

    Full Text Available Five Björkman lignins, codified as AM, LL, GG, PP and AP, were isolated from wood species of Aspidosperma macrocarpum Mart., Lophanthera lactescens Ducke, Gallesia gorazema (Vell. Miq., Peltogyne paniculata Bth. and Aspidosperma polyneuron Muell. Arg., respectively. Analyses of the lignins were carried out by Fourier transformed infrared spectroscopy using an experimental technique, Diffusely Reflected Infrared Fourier Transformed (DRIFT, admitting in the original spectra a band at 1500 cm-1 as an internal reference. Application of a deconvolution technique made possible to estimate the percentage per mol of b-O-4 unit content around 65.5% to AM, 68.0% to LL, 71.0% to GG. 73.4% to PP and 75.0% to AP, toward AM

  17. Study of total oxidation of ethanol using the perovskite-type oxides LaBO{sub 3} (B= Mn, Ni, Fe); Estudo da oxidacao total do etanol usando oxidos tipo perovskita LaBO{sub 3} (B= Mn, Ni, Fe)

    Energy Technology Data Exchange (ETDEWEB)

    Soares, Ana Brigida [Centro Federal de Educacao Tecnologica do Espirito Santo, Vitoria, ES (Brazil). Centro de Ciencias e Tecnologias Quimicas]. E-mail: brigida@cefetes.br; Silva, Paulo Roberto Nagipe da [Universidade Estadual do Norte Fluminense (UENF), Campos dos Goytacases, RJ (Brazil). Centro de Ciencias e Tecnologia; Freitas, Jair C.C. [Universidade Federal do Espirito Santo, Vitoria, ES (Brazil). Centro de Ciencias Exatas. Dept. de Fisica; Almeida, Clara Muniz de [Pontificia Univ. Catolica do Rio de Janeiro, RJ (Brazil). Dept. de Fisica

    2007-09-15

    The present work investigated the effect of coprecipitation-oxidant synthesis on the specific surface area of perovskite-type oxides LaBO{sub 3} (BMn, Ni, Fe) for total oxidation of ethanol. The perovskite-type oxides were characterized by X-ray diffraction, nitrogen adsorption (BET method), thermogravimetric analysis (TGA-DTA), TPR and X-ray photoelectron spectroscopy (XPS). Through method involving the coprecipitation-oxidant was possible to obtain catalysts with different BET specific surface areas, of 33-51 m{sup 2}/g. The results of the catalytic test confirmed that all oxides investigated in this work have specific catalytic activity for total oxidation of ethanol, though the temperatures for total conversion change for each transition metal. (author)

  18. Proactive monitoring of a wind turbine array with lidar measurements, SCADA data and a data-driven RANS solver

    Science.gov (United States)

    Iungo, G.; Said, E. A.; Santhanagopalan, V.; Zhan, L.

    2016-12-01

    Power production of a wind farm and durability of wind turbines are strongly dependent on non-linear wake interactions occurring within a turbine array. Wake dynamics are highly affected by the specific site conditions, such as topography and local atmospheric conditions. Furthermore, contingencies through the life of a wind farm, such as turbine ageing and off-design operations, make prediction of wake interactions and power performance a great challenge in wind energy. In this work, operations of an onshore wind turbine array were monitored through lidar measurements, SCADA and met-tower data. The atmospheric wind field investing the wind farm was estimated by using synergistically the available data through five different methods, which are characterized by different confidence levels. By combining SCADA data and the lidar measurements, it was possible to estimate power losses connected with wake interactions. For this specific array, power losses were estimated to be 4% and 2% of the total power production for stable and convective atmospheric regimes, respectively. The entire dataset was then leveraged for the calibration of a data-driven RANS (DDRANS) solver for prediction of wind turbine wakes and power production. The DDRANS is based on a parabolic formulation of the Navier-Stokes equations with axisymmetry and boundary layer approximations, which allow achieving very low computational costs. Accuracy in prediction of wind turbine wakes and power production is achieved through an optimal tuning of the turbulence closure model. The latter is based on a mixing length model, which was developed based on previous wind turbine wake studies carried out through large eddy simulations and wind tunnel experiments. Several operative conditions of the wind farm under examination were reproduced through DDRANS for different stability regimes, wind directions and wind velocity. The results show that DDRANS is capable of achieving a good level of accuracy in prediction

  19. Toward the Validation of Depth-Averaged Three Dimensional, Rans Steady-State Simulations of Fluvial Flows at Natural Scale

    Science.gov (United States)

    Mateo Villanueva, P. A.; Hradisky, M.

    2010-12-01

    Simulations of fluvial flows are strongly influenced by geometric complexity and overall uncertainty on measured flow variables, including those assumed to be well known boundary conditions. Often, 2D steady-state models are used for computational simulations of flows at the scale of natural rivers. Such models have been successfully incorporated in iRIC (formerly MD_SWMS), one of the widely used quasi-3D CFD solvers to perform studies of environmental flows. iRIC aids in estimating such quantities as surface roughness and shear stress, which, in turn, can be used to estimate sediment transport. However, the computational results are inherently limited in accuracy because of restricting the computations to 2D, or quasi-3D, space, which can affect the values of these predictions. In the present work we perform computer-based simulations of fluvial flows using OpenFOAM, a free, open source fully 3D CFD software package, and compare our results to predictions obtained from iRIC. First, we study the suitability of OpenFOAM as the main CFD solver to analyze fluvial flows and validate our results for two well documented rectangular channel configurations: the first case consists of a large aspect-ratio channel (ratio of depth over width 0.017, ratio of depth over length 0.0019) with a rectangular obstacle mounted at the bottom wall; the second case involves a large aspect-ratio channel (ratio of depth over width 0.1, ratio of depth over length 0.0025) with cubic obstacles mounted at the lower wall (one obstacle) and upper wall (two obstacles). Secondly, we apply our model to simulation or river at natural scale and compare our results to the output obtained from iRIC to quantify the differences in velocity profiles and other flow parameters when comparable solution techniques are used. Steady-state, RANS k-epsilon models are employed for all simulations.

  20. Ran is a potential therapeutic target for cancer cells with molecular changes associated with activation of the PI3K/Akt/mTORC1 and Ras/MEK/ERK pathways

    Science.gov (United States)

    Yuen, Hiu-Fung; Chan, Ka-Kui; Grills, Claire; Murray, James T.; Platt-Higgins, Angela; Eldin, Osama Sharaf; O’Byrne, Ken; Janne, Pasi; Fennell, Dean A.; Johnston, Patrick G.; Rudland, Philip S.; El-Tanani, Mohamed

    2011-01-01

    Purpose Cancer cells have been shown to be more susceptible to Ran knockdown compared to normal cells. We now investigate whether Ran is a potential therapeutic target of cancers with frequently found mutations that lead to higher Ras/MEK/ERK and PI3K/Akt/mTORC1 activities. Experimental Design Apoptosis was measured by flow cytometry (PI and Annexin V staining) and MTT assay in cancer cells grown under different conditions after knockdown of Ran.. The correlations between Ran expression and patient survival were examined in breast and lung cancers. Results Cancer cells with their PI3K/Akt/mTORC1 and Ras/MEK/ERK pathways inhibited are less susceptible to Ran silencing-induced apoptosis. KRas mutated, c-Met amplified and Pten-deleted cancer cells are also more susceptible to Ran silencing-induced apoptosis than their wild-type counterparts and this effect is reduced by inhibitors of the PI3K/Akt/mTORC1 and MEK/ERK pathways. Overexpression of Ran in clinical specimens is significantly associated with poor patient outcome in both breast and lung cancers. This association is dramatically enhanced in cancers with increased c-Met or osteopontin expression, or with oncogenic mutations of KRas or PIK3CA, all of which are mutations that potentially correlate with activation of the PI3K/Akt/mTORC1 and/or Ras/MEK/ERK pathways. Silencing Ran also results in dysregulation of nucleocytoplasmic transport of transcription factors and downregulation of Mcl-1 expression, at the transcriptional level, which are reversed by inhibitors of the PI3K/Akt/mTORC1 and MEK/ERK pathways. Conclusion Ran is a potential therapeutic target for treatment of cancers with mutations/changes of expression in protooncogenes that lead to activation of the PI3K/Akt/mTORC1 and Ras/MEK/ERK pathways. PMID:22090358

  1. Application of the order-of-magnitude analysis to a fourth-order RANS closure for simulating a 2D boundary layer

    Science.gov (United States)

    Poroseva, Svetlana V.

    2013-11-01

    Simulations of turbulent boundary-layer flows are usually conducted using a set of the simplified Reynolds-Averaged Navier-Stokes (RANS) equations obtained by order-of-magnitude analysis (OMA) of the original RANS equations. The resultant equations for the mean-velocity components are closed using the Boussinesq approximation for the Reynolds stresses. In this study OMA is applied to the fourth-order RANS (FORANS) set of equations. The FORANS equations are chosen as they can be closed on the level of the 5th-order correlations without using unknown model coefficients, i.e. no turbulent diffusion modeling is required. New models for the 2nd-, 3rd- and 4th-order velocity-pressure gradient correlations are derived for the current FORANS equations. This set of FORANS equations and models are analyzed for the case of two-dimensional mean flow. The equations include familiar transport terms for the mean-velocity components along with algebraic expressions for velocity correlations of different orders specific to the FORANS approach. Flat plate DNS data (Spalart, 1988) are used to verify these expressions and the areas of the OMA applicability within the boundary layer. The material is based upon work supported by NASA under award NNX12AJ61A.

  2. Analysis of multiuser mixed RF/FSO relay networks for performance improvements in Cloud Computing-Based Radio Access Networks (CC-RANs)

    Science.gov (United States)

    Alimi, Isiaka A.; Monteiro, Paulo P.; Teixeira, António L.

    2017-11-01

    The key paths toward the fifth generation (5G) network requirements are towards centralized processing and small-cell densification systems that are implemented on the cloud computing-based radio access networks (CC-RANs). The increasing recognitions of the CC-RANs can be attributed to their valuable features regarding system performance optimization and cost-effectiveness. Nevertheless, realization of the stringent requirements of the fronthaul that connects the network elements is highly demanding. In this paper, considering the small-cell network architectures, we present multiuser mixed radio-frequency/free-space optical (RF/FSO) relay networks as feasible technologies for the alleviation of the stringent requirements in the CC-RANs. In this study, we use the end-to-end (e2e) outage probability, average symbol error probability (ASEP), and ergodic channel capacity as the performance metrics in our analysis. Simulation results show the suitability of deployment of mixed RF/FSO schemes in the real-life scenarios.

  3. Numerical investigation of the vortex-induced vibration of an elastically mounted circular cylinder at high Reynolds number (Re = 104 and low mass ratio using the RANS code.

    Directory of Open Access Journals (Sweden)

    Niaz Bahadur Khan

    Full Text Available This study numerically investigates the vortex-induced vibration (VIV of an elastically mounted rigid cylinder by using Reynolds-averaged Navier-Stokes (RANS equations with computational fluid dynamic (CFD tools. CFD analysis is performed for a fixed-cylinder case with Reynolds number (Re = 104 and for a cylinder that is free to oscillate in the transverse direction and possesses a low mass-damping ratio and Re = 104. Previously, similar studies have been performed with 3-dimensional and comparatively expensive turbulent models. In the current study, the capability and accuracy of the RANS model are validated, and the results of this model are compared with those of detached eddy simulation, direct numerical simulation, and large eddy simulation models. All three response branches and the maximum amplitude are well captured. The 2-dimensional case with the RANS shear-stress transport k-w model, which involves minimal computational cost, is reliable and appropriate for analyzing the characteristics of VIV.

  4. The E7 oncoprotein of high-risk human papillomavirus type 16 enters the nucleus via a nonclassical Ran-dependent pathway

    International Nuclear Information System (INIS)

    Angeline, Michael; Merle, Eric; Moroianu, Junona

    2003-01-01

    E7, the major transforming protein of high-risk human papillomavirus (HPV), type 16, binds and inactivates the retinoblastoma protein (pRb), and the Rb-related proteins p107 and p130. HPV16 E7 is a nuclear protein lacking a classical basic nuclear localization signal. In this study we investigated the nuclear import of HPV16 E7 oncoprotein in digitonin-permeabilized HeLa cells. HPV16 E7 nuclear import was independent of pRb, as an E7 ΔDLYC variant defective in pRb binding was imported into the nuclei of digitonin-permeabilized cells as efficiently as wild-type E7 in the presence of exogenous cytosol. Interestingly, we discovered that HPV16 E7 is imported into the nuclei via a novel pathway different from those mediated by Kap α2β1 heterodimers, Kap β1, or Kap β2. Nuclear accumulation of E7 required Ran and was not inhibited by the RanG19V-GTP variant, an inhibitor of Kap β mediated import pathways. Together the data suggest that HPV16 E7 translocates through the nuclear pores via a nonclassical Ran-dependent pathway, independent of the main cytosolic Kap β import receptors

  5. Cattle with the BoLA class II DRB3*0902 allele have significantly lower bovine leukemia proviral loads.

    Science.gov (United States)

    Hayashi, Takumi; Mekata, Hirohisa; Sekiguchi, Satoshi; Kirino, Yumi; Mitoma, Shuya; Honkawa, Kazuyuki; Horii, Yoichiro; Norimine, Junzo

    2017-09-12

    The bovine MHC (BoLA) class II DRB3 alleles are associated with polyclonal expansion of lymphocytes caused by bovine leukemia virus (BLV) infection in cattle. To examine whether the DRB3*0902 allele, one of the resistance-associated alleles, is associated with the proviral load, we measured BLV proviral load of BLV-infected cattle and clarified their DRB3 alleles. Fifty-seven animals with DRB3*0902 were identified out of 835 BLV-infected cattle and had significantly lower proviral load (Pclass II DRA/DRB3*0902 molecule plays an important immunological role in suppressing viral replication, resulting in resistance to the disease progression.

  6. Passively Q-switched microchip Er, Yb:YAl3(BO3)4 diode-pumped laser.

    Science.gov (United States)

    Kisel, V E; Gorbachenya, K N; Yasukevich, A S; Ivashko, A M; Kuleshov, N V; Maltsev, V V; Leonyuk, N I

    2012-07-01

    We report, for the first time to our knowledge, a diode-pumped cw and passively Q-switched microchip Er, Yb:YAl(3)(BO(3))(4) laser. A maximal output power of 800 mW at 1602 nm in the cw regime was obtained at an absorbed pump power of 7.7 W. By using Co(2+):MgAl(2)O(4) as a saturable absorber, a TEM(00)-mode Q-switched average output power of 315 mW was demonstrated at 1522 nm, with pulse duration of 5 ns and pulse energy of 5.25 μJ at a repetition rate of 60 kHz.

  7. Diode-pumped CW frequency-doubled Nd:CNGG-BiBO blue laser at 468 nm

    International Nuclear Information System (INIS)

    Lü, Y F; Xia, J; Lin, J Q; Gao, X; Dong, Y; Xu, L J; Sun, G C; Zhao, Z M; Tan, Y; Chen, J F; Liu, Z X; Li, C L; Cai, H X; Liu, Z T; Ma, Z Y; Ning, G B

    2011-01-01

    Efficient and compact blue laser output at 468 nm is generated by intracavity frequency doubling of a continuous-wave (CW) diode-pumped Nd:CNGG laser at 935 nm. With 17.8 W of diode pump power and the frequency-doubling crystal BiB 3 O 6 (BiBO), a maximum output power of 490 mW in the blue spectral range at 468 nm has been achieved, corresponding to an optical-to-optical conversion efficiency of 2.8%; the output power stability over 4 h is better than 2.6%. To the best of our knowledge, this is first work on intracavity frequency doubling of a diode pumped Nd:CNGG laser at 935 nm

  8. Manifestation of magnetoelastic interactions in Raman spectra of HoxNd1−xFe3(BO34 crystals

    Directory of Open Access Journals (Sweden)

    A. S. Krylov

    2018-04-01

    Full Text Available Raman spectra of Ho1−xNdxFe(BO34 (x=1, 0.75, 0.5, 0.25 have been studied in temperature range 10–400K. Two compositions (x=1, x=0.75 demonstrate structural phase transition with soft mode restoration. The addition of Nd atoms increases interatomic spacing and decreases the temperature of structural phase transition. The solid solutions (x=0.75, 0.5, 0.25 demonstrate the emergence of the peaks corresponding to magnetoelastic interaction below Néel temperature. The order parameter of the magnetic phase transition has been determined. The equal concentrations of holmium and neodymium atoms prevent magnon soft modes condensation caused by exchange interactions in Fe–O–Fe chains are observed. Calculations confirm the data obtained in the experiment.

  9. Rare-Earth Calcium Oxyborate Piezoelectric Crystals ReCa4O(BO33: Growth and Piezoelectric Characterizations

    Directory of Open Access Journals (Sweden)

    Fapeng Yu

    2014-07-01

    Full Text Available Rare-earth calcium oxyborate crystals, ReCa4O(BO33 (ReCOB, Re = Er, Y, Gd, Sm, Nd, Pr, and La , are potential piezoelectric materials for ultrahigh temperature sensor applications, due to their high electrical resistivity at elevated temperature, high piezoelectric sensitivity and temperature stability. In this paper, different techniques for ReCOB single-crystal growth are introduced, including the Bridgman and Czochralski pulling methods. Crystal orientations and the relationships between the crystallographic and physical axes of the monoclinic ReCOB crystals are discussed. The procedures for dielectric, elastic, electromechanical and piezoelectric property characterization, taking advantage of the impedance method, are presented. In addition, the maximum piezoelectric coefficients for different piezoelectric vibration modes are explored, and the optimized crystal cuts free of piezoelectric cross-talk are obtained by rotation calculations.

  10. Analysis of green luminescent Tb3+:Ca4GdO(BO3)3 powder phosphor

    International Nuclear Information System (INIS)

    Vengala Rao, B.; Rambabu, U.; Buddhudu, S.

    2007-01-01

    This paper reports on the emission analysis of a green luminescent Tb 3+ :Ca 4 GdO(BO 3 ) 3 powder phosphor based on the measurements of excitation, emission and lifetimes. Besides this, we have also observed an intense green emission from this powder phosphor under an UV source. The emission transitions of ( 5 D 4 →7 F 3,4,5,6 ) with λ exci =257 nm have been measured. Particularly, the green emission transition ( 5 D 4 →7 F 5 ) at 553 nm has been found to be more prominent and intense. Such green strong emission displaying powder phosphor will find applications in the development of coated screens in certain electronic systems. Apart from the emission analysis of this phosphor, XRD, SEM and FTIR studies have also been carried out in order to understand the structural details of it

  11. μ+SR Investigation of the Shastry-Sutherland Compound SrCu2(BO3)2

    Science.gov (United States)

    Sassa, Y.; Wang, S.; Sugiyama, J.; Amato, A.; Rønnow, H. M.; Rüegg, C.; Månsson, M.

    In this study we have investigated the low-dimensional correlated spin system SrCu2(BO3)2 using ambient-pressure muon spin rotation/relaxation (μ+SR). The zero-field data are similar to previously published data, but in addition, they give an even clearer sign of the two low-temperature transitions (T1 ≈ 3 and T2 ≈ 7 K), which is fully consistent with inelastic neutron scattering (INS) measurements. Longitudinal field (LF) data clearly show that the copper spins are highly dynamic and a saturation of the low-temperature relaxation rate indicate that these are indeed two-dimensional (2D) quantum spin fluctuations.

  12. Ab initio energetics of LaBO3(001) (B=Mn, Fe, Co, and Ni) for solid oxide fuel cell cathodes

    DEFF Research Database (Denmark)

    Lee, Yueh-Lin; Kleis, Jesper; Rossmeisl, Jan

    2009-01-01

    LaBO3 (B=Mn, Fe, Co, and Ni) perovskites form a family of materials of significant interest for cathodes of solid oxide fuel cells (SOFCs). In this paper ab initio methods are used to study both bulk and surface properties of relevance for SOFCs, including vacancy formation and oxygen binding...... reduction reaction on perovskite SOFC cathodes....

  13. Potential tunable white-emitting phosphor LiSr4(BO3)3:Ce3+, Eu2+ for ultraviolet light-emitting diodes

    International Nuclear Information System (INIS)

    Wang Qian; Deng Degang; Hua Youjie; Huang Lihui; Wang Huanping; Zhao Shilong; Jia Guohua; Li Chenxia; Xu Shiqing

    2012-01-01

    A novel Ce 3+ /Eu 2+ co-activated LiSr 4 (BO 3 ) 3 phosphor has been synthesized by traditional solid-state reaction. The samples could display varied color emission from blue towards white and ultimately to yellow under the excitation of ultraviolet (UV) light with the appropriate adjustment of the relative proportion of Ce 3+ /Eu 2+ . The resonance-type energy transfer mechanism from Ce 3+ to Eu 2+ in LiSr 4 (BO 3 ) 3 :Ce 3+ , Eu 2+ phosphors is dominant by electric dipole–dipole interaction, and the critical distance is calculated to be about 29.14 Å by the spectra overlap method. White light was observed from LiSr 4 (BO 3 ) 3 :mCe 3+ , nEu 2+ phosphors with chromaticity coordinates (0.34, 0.30) upon 350 nm excitation. The LiSr 4 (BO 3 ) 3 :Ce 3+ , Eu 2+ phosphor has potential applications as an UV radiation-converting phosphor for white light-emitting diodes. - Highlights: ► White light was observed from the novel phosphor with chromaticity coordinate (0.34, 0.30). ► Resonant energy transfer between Ce 3+ and Eu 2+ occurs in the novel phosphor. ► This novel phosphor has potential applications as a UV-driven light-emitting phosphor.

  14. Stěžejní východiska a koncepce současné anglické náboženské pedagogiky

    Directory of Open Access Journals (Sweden)

    Karim Sidibe

    2017-08-01

    Full Text Available Tento článek si klade za cíl analyzovat didaktické koncepce výuky náboženství pěti hlavních teoretiků současné anglické náboženské pedagogiky, Harolda Loukese, Niniana Smarta, Davida Haye, Cliva Errickera a Andrewa Wrighta. Loukes a Smart položili základy současné náboženské pedagogiky v Anglii v 60. letech 20. století. Loukes využil poznatky vývojové psychologie a Smart výuku sekularizoval. Hayovo pojetí z 80. let 20. století akcentuje niternou duchovní skutečnost žáků. V současné době Erricker aplikuje postmoderní filosofická východiska na výuku a akcentuje individualitu a nezávislost žáků, zatímco Wright vychází z filosofických východisek kritického realismu a akcentuje nutnost teologické a filosofické diskuze na hodinách náboženství.

  15. Concentration quenching of Eu2+ in a thermal-stable yellow phosphor Ca2BO3Cl:Eu2+ for LED application

    International Nuclear Information System (INIS)

    Zhang Xinguo; Zhang Jilin; Dong Zhiyue; Shi Jianxin; Gong Menglian

    2012-01-01

    A piece-shaped phosphor Ca 2 BO 3 Cl: Eu 2+ was synthesized by solid-state reaction method. This phosphor exhibited wide absorption in ultra-violet and visible range, and bright yellow emission band centering at 570 nm. The concentration quenching mechanism was verified to be a dipole–dipole interaction, and its critical transfer distance was about 17 Å by both calculated crystal structural method and experimental spectral method. This phosphor has a good thermal stability with a quenching temperature (T 1/2 ) of 200 °C. Yellow and white LEDs were fabricated with this phosphor and near UV chips, and the yellow LED has a high color purity of 97.0% and promising current tolerant property, while the white LED shows a luminous efficiency of 11.68 lm/W. - Highlights: ► Broadband excitable and strong yellow-emitting Ca 2 BO 3 Cl: Eu 2+ phosphor is obtained by solid state reaction. ► Concentration quenching mechanism of Ca 2 BO 3 Cl: Eu 2+ is dipole–dipole interaction. ► Quenching temperature (T 1/2 ) of Ca 2 BO 3 Cl: Eu 2+ is at 200 °C. ► As synthesized material can be used for LED phosphor application.

  16. Petrophysical characterization of the Dolomitic Member of the Boñar Formation (Upper Cretaceous; Duero Basin, Spain) as a potential CO2 reservoir

    Energy Technology Data Exchange (ETDEWEB)

    Suarez-Gonzalez, A.; Kovacs, C.; Herrero-Hernandez, A.; Gomez-Fernandez, F.

    2016-07-01

    Boñar Formation (Upper Cretaceous) is a mainly carbonate succession, which outcrops in the North of Duero Basin (Spain). According to the existing data, the Dolomitic Member of this formation appears to be the most suitable for geological storage of CO2. The main objective of this study is to find evidence to support, clarify and specify –at an initial level– the potential of the Dolomitic Member of the Boñar Formation as a geological reservoir. The study covers density, porosity and permeability tests on samples obtained from the outcrop of the succession near the village of Boñar (León). According to the analysis and interpretation of the mentioned petrophysical properties, the porosity of the Dolomitic Member is within the acceptable range for CO2 geological storage, but the permeability values are far too low. This minimizes the possibilities of the Dolomitic Member –and probably of the whole Boñar Formation– to become an appropriate CO2 reservoir. (Author)

  17. Synthesis and photoluminescence properties of Pb{sup 2+} doped inorganic borate phosphor NaSr{sub 4}(BO{sub 3}){sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Chauhan, A. O., E-mail: abhi2718@gmail.com; Koparkar, K. A.; Omanwar, S. K. [Department of Physics, SantGadge Baba Amravati University, Amravati MH, 444602 (India); Bajaj, N. S. [Department of Physics, Toshniwal Art, Commerce and Science College, Sengoan, Hingoli MH (India)

    2016-05-06

    A series of Inorganic borate phosphors NaSr{sub 4}(BO{sub 3}){sub 3} doped with Pb{sup 2+} was successfully synthesized by modified solid state diffusion method. The crystal structure and the phase purity of sample were characterized by powder X-ray diffraction (XRD). The photoluminescence properties of synthesized materials were investigated using spectrofluorometer at room temperature. The phosphor show strong broad band emission spectra in UVA region maximum at 370 nm under the excitation of 289 nm. The dependence of the emission intensity on the Pb{sup 2+} concentration for the NaSr{sub 4}(BO{sub 3}){sub 3} were studied in details. The concentration quenching of Pb{sup 2+} doped NaSr{sub 4}(BO{sub 3}){sub 3} was observed at 0.02 mol. The Stokes shifts of NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+} phosphor was calculated to be 7574 cm{sup −1}.

  18. X-ray photoelectron spectroscopy and full potential studies of the electronic density of state of ternary oxyborate Na3La9O3(BO3)(8)

    Czech Academy of Sciences Publication Activity Database

    Reshak, Ali H; Auluck, S.; Kityk, I. V.

    2009-01-01

    Roč. 472, č. 1-2 (2009), s. 30-34 ISSN 0925-8388 Institutional research plan: CEZ:AV0Z60870520 Keywords : Electronic structure * FPLAPW * DFT Subject RIV: BO - Biophysics Impact factor: 2.135, year: 2009

  19. 40 CFR 721.6660 - Polymer of alkanepolyol and poly-alkyl-poly-iso-cyan-ato-car-bo-mo-no-cycle, acetone oxime...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymer of alkanepolyol and poly-alkyl... Polymer of alkanepolyol and poly-alkyl-poly-iso-cyan-ato-car-bo-mo-no-cycle, acetone oxime-blocked... substance identified generically as a polymer of alkane-polyol and polyalkylpolyisocyanatocarbomonocy- cle...

  20. BoNT-A related changes of cortical activity in patients suffering from severe hand paralysis with arm spasticity following ischemic stroke.

    Science.gov (United States)

    Veverka, Tomáš; Hluštík, Petr; Tomášová, Zuzana; Hok, Pavel; Otruba, Pavel; Král, Michal; Tüdös, Zbyněk; Zapletalová, Jana; Herzig, Roman; Krobot, Alois; Kaňovský, Petr

    2012-08-15

    Investigations were performed to localize and analyze the botulinum toxin (BoNT-A) related changes of cerebral cortex activation in chronic stroke patients suffering from severe hand paralysis with arm spasticity. Effects on task- related cerebral activation were evaluated by functional magnetic resonance imaging (fMRI). 14 patients (5 males, 9 females, mean age 55.3 years) suffering from upper limb post-stroke spasticity were investigated. The change of arm spasticity was assessed by using the modified Ashworth scale (MAS). FMRI sessions were performed before (W0), four weeks (W4) and 11 weeks (W11) after BoNT-A application. Patients were scanned while performing imaginary movement with the impaired hand. Group fMRI analysis included patient age as a covariate. BoNT-A treatment was effective in alleviation of arm spasticity. Mean MAS was at Week 0: 2.5 (SD 0.53), at Week 4: 1.45 (SD 0.38), at Week 11: 2.32 (SD 0.44). Task-related fMRI prior to the treatment showed extensive activation of bilateral frontoparietal sensorimotor cortical areas, anterior cingulate gyrus, pallidum, thalamus and cerebellum. Effective BoNT-A treatment (W4) resulted in partial reduction of active network volume in most of the observed areas, whereas BoNT-free data (W11) revealed further volume reduction in the sensorimotor network. On direct comparison, significant activation decreases associated with BoNT-A treatment were located in areas outside the classical sensorimotor system, namely, ipsilesional lateral occipital cortex, supramarginal gyrus and precuneus cortex. On comparison of W4 and W11, no activation increases were found, instead, activation further decreased in ipsilesional insular cortex, contralesional superior frontal gyrus and bilateral frontal pole. Whole brain activation patterns during BoNT-A treatment of post-stroke arm spasticity and further follow up document predominantly gradual changes both within and outside the classical sensorimotor system. Copyright © 2012