WorldWideScience

Sample records for ran object ran

  1. RAN Translation in Huntington Disease.

    Science.gov (United States)

    Bañez-Coronel, Monica; Ayhan, Fatma; Tarabochia, Alex D; Zu, Tao; Perez, Barbara A; Tusi, Solaleh Khoramian; Pletnikova, Olga; Borchelt, David R; Ross, Christopher A; Margolis, Russell L; Yachnis, Anthony T; Troncoso, Juan C; Ranum, Laura P W

    2015-11-18

    Huntington disease (HD) is caused by a CAG ⋅ CTG expansion in the huntingtin (HTT) gene. While most research has focused on the HTT polyGln-expansion protein, we demonstrate that four additional, novel, homopolymeric expansion proteins (polyAla, polySer, polyLeu, and polyCys) accumulate in HD human brains. These sense and antisense repeat-associated non-ATG (RAN) translation proteins accumulate most abundantly in brain regions with neuronal loss, microglial activation and apoptosis, including caudate/putamen, white matter, and, in juvenile-onset cases, also the cerebellum. RAN protein accumulation and aggregation are length dependent, and individual RAN proteins are toxic to neural cells independent of RNA effects. These data suggest RAN proteins contribute to HD and that therapeutic strategies targeting both sense and antisense genes may be required for efficacy in HD patients. This is the first demonstration that RAN proteins are expressed across an expansion located in an open reading frame and suggests RAN translation may also contribute to other polyglutamine diseases. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. RAN GTPase and Osteopontin in Pancreatic Cancer.

    Science.gov (United States)

    Saxena, Shivam; Gandhi, Ankit; Lim, Pei-Wen; Relles, Daniel; Sarosiek, Konrad; Kang, Christopher; Chipitsyna, Galina; Sendecki, Jocelyn; Yeo, Charles J; Arafat, Hwyda A

    2013-04-01

    Pancreatic ductal adenocarcinoma (PDA) has the worst prognosis among cancers, mainly due to the high incidence of early metastases. RAN small GTPase (RAN) is a protein that plays physiological roles in the regulation of nuclear transport and microtubule spindle assembly. RAN was recently shown to mediate the invasive functions of the prometastatic protein osteopontin (OPN) in breast cancer cells. We and others have shown previously that high levels of OPN are present in PDA. In this study, we analyzed the expression and correlation of RAN with OPN in human pancreatic lesions, and explored their regulation in PDA cell lines. Real time PCR was used to analyze RAN and OPN mRNA levels in PDA, adjacent non-malignant, and benign pancreatic tissues. Expression levels were correlated with survival and different clinicopathological parameters using different statistical methods. Transient transfection studies using OPN and RAN plasmids, and knockdown experiments using siRNA were used to examine their mutual regulation. OPN and RAN levels highly correlated with each other (pobesity, T stage, BMI, or survival. However, we found a significant association between RAN levels and perineural invasion (HR=0.79, 95% CI 0.59, 1.07; p=0.0378.). OPN and RAN colocalized in PDA tissues and cell lines. Increasing RAN expression in PDA cells induced OPN transcription and RAN silencing reduced total OPN levels. OPN did not have any significant effect on RAN transcription. The high levels of RAN in PDA and its correlation with OPN and with perineural invasion suggest that RAN may contribute to PDA metastasis and progression through the induction of OPN. RAN's role in the regulation of OPN in PDA is unique and could provide potential novel therapeutic strategies to combat PDA aggressiveness.

  3. Tackling complex turbulent flows with transient RANS

    NARCIS (Netherlands)

    Kenjeres, S.; Hanjalic, K.

    2009-01-01

    This article reviews some recent applications of the transient-Reynoldsaveraged Navier–Stokes (T-RANS) approach in simulating complex turbulent flows dominated by externally imposed body forces, primarily by thermal buoyancy and the Lorentz force. The T-RANS aims at numerical resolving unsteady

  4. The Ran pathway in Drosophila melanogaster mitosis

    Directory of Open Access Journals (Sweden)

    James G Wakefield

    2015-11-01

    Full Text Available Over the last two decades, the small GTPase Ran has emerged as a central regulator of both mitosis and meiosis, particularly in the generation, maintenance and regulation of the microtubule (MT-based bipolar spindle. Ran-regulated pathways in mitosis bear many similarities to the well-characterized functions of Ran in nuclear transport and, as with transport, the majority of these mitotic effects are mediated through affecting the physical interaction between karyopherins and Spindle Assembly Factors (SAFs - a loose term describing proteins or protein complexes involved in spindle assembly through promoting nucleation, stabilization, and/or depolymerization of MTs, through anchoring MTs to specific structures such as centrosomes, chromatin or kinetochores, or through sliding MTs along each other to generate the force required to achieve bipolarity. As such, the Ran-mediated pathway represents a crucial functional module within the wider spindle assembly landscape. Research into mitosis using the model organism Drosophila melanogaster has contributed substantially to our understanding of centrosome and spindle function. However, in comparison to mammalian systems, very little is known about the contribution of Ran-mediated pathways in Drosophila mitosis. This article sets out to summarize our understanding of the roles of the Ran pathway components in Drosophila mitosis, focusing on the syncytial blastoderm embryo, arguing that, far from being superfluous, it can provide important insights into the conserved functions on Ran during spindle formation.

  5. Genomic organization, expression, and localization of murine Ran-binding protein 2 (RanBP2) gene.

    NARCIS (Netherlands)

    Fauser, S.; Aslanukov, A.; Roepman, R.; Ferreira, P.A.

    2001-01-01

    The Ran-binding protein 2 (RanBP2) is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. There are no orthologs of the RanBP2 gene in yeast and Drosophila genomes. In humans, this bona fide gene is partially duplicated in a RanBP2 gene cluster and lies in

  6. The contribution of lexical access speed to RAN and reading

    DEFF Research Database (Denmark)

    Poulsen, Mads

    Purpose: The study investigated why and when rapid automatised naming is a predictor of reading. Specifically, we tested the hypotheses that (1) RAN-objects predicts reading because it is a measure of lexical (e.g. phonological) access speed, but (2) that RAN only becomes a predictor of reading...... development once a certain level of phonological recoding proficiency has been reached. Method: Forty Danish students without reading difficulties were administered tests of reading speed and accuracy, phoneme awareness, RAN-objects, timed confrontation picture naming, and visio-motor reaction time....... The students were sampled from two age groups representing two levels of recoding proficiency: Beginning readers in Grade 2-3 and proficient decoders in grade 5-6. We conducted hierarchical regression analyses on reading speed and accuracy to determine whether the relationship between RAN and reading...

  7. Chromosomal association of Ran during meiotic and mitotic divisions.

    Science.gov (United States)

    Hinkle, Beth; Slepchenko, Boris; Rolls, Melissa M; Walther, Tobias C; Stein, Pascal A; Mehlmann, Lisa M; Ellenberg, Jan; Terasaki, Mark

    2002-12-01

    Recent studies in Xenopus egg extracts indicate that the small G protein Ran has a central role in spindle assembly and nuclear envelope reformation. We determined Ran localization and dynamics in cells during M phase. By immunofluorescence, Ran is accumulated on the chromosomes of meiosis-II-arrested Xenopus eggs. In living cells, fluorescently labeled Ran associated with the chromosomes in Xenopus and remained associated during anaphase when eggs were artificially activated. Fluorescent Ran associated with chromosomes in mouse eggs, during meiotic maturation and early embryonic divisions in starfish, and to a lesser degree during mitosis of a cultured mammalian cell line. Chromosomal Ran undergoes constant flux. From photobleach experiments in immature starfish oocytes, chromosomal Ran has a k(off) of approximately 0.06 second(-1), and binding analysis suggests that there is a single major site. The chromosomal interactions may serve to keep Ran-GTP in the vicinity of the chromosomes for spindle assembly and nuclear envelope reformation.

  8. Evaluation of energy and cost savings in mobile Cloud RAN

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Christiansen, Henrik Lehrmann; Berger, Michael Stübert

    2013-01-01

    The load in mobile networks is subject to variations during the day, due to user mobility and varying network average usage. Therefore, the traditional or Distributed Radio Access Network (D-RAN) architecture, where the BaseBand processing Units (BBUs) are assigned statically to a number of cells...... using OPNET Modeler. A real case scenario is built upon the mobile traffic forecast for year 2017, a number of recommendations on traffic models and a proposed C-RAN implementation. The results achieved show that the maximum statistical multiplexing gain for user plane traffic in C-RAN architecture is 4......, is sub optimal, comparing to a novel, cloud based architecture called Cloud Radio Access Network (C-RAN). In C-RAN a group of cells shares processing resources, and hence benefit from statistical multiplexing gain is expected. In this paper, the energy and cost savings in C-RAN are evaluated numerically...

  9. An Arabidopsis Ran-binding protein, AtRanBP1c, is a co-activator of Ran GTPase-activating protein and requires the C-terminus for its cytoplasmic localization

    Science.gov (United States)

    Kim, Soo-Hwan; Roux, Stanley J.

    2003-01-01

    Ran-binding proteins (RanBPs) are a group of proteins that bind to Ran (Ras-related nuclear small GTP-binding protein), and thus either control the GTP/GDP-bound states of Ran or help couple the Ran GTPase cycle to a cellular process. AtRanBP1c is a Ran-binding protein from Arabidopsis thaliana (L.) Heynh. that was recently shown to be critically involved in the regulation of auxin-induced mitotic progression [S.-H. Kim et al. (2001) Plant Cell 13:2619-2630]. Here we report that AtRanBP1c inhibits the EDTA-induced release of GTP from Ran and serves as a co-activator of Ran-GTPase-activating protein (RanGAP) in vitro. Transient expression of AtRanBP1c fused to a beta-glucuronidase (GUS) reporter reveals that the protein localizes primarily to the cytosol. Neither the N- nor C-terminus of AtRanBP1c, which flank the Ran-binding domain (RanBD), is necessary for the binding of PsRan1-GTP to the protein, but both are needed for the cytosolic localization of GUS-fused AtRanBP1c. These findings, together with a previous report that AtRanBP1c is critically involved in root growth and development, imply that the promotion of GTP hydrolysis by the Ran/RanGAP/AtRanBP1c complex in the cytoplasm, and the resulting concentration gradient of Ran-GDP to Ran-GTP across the nuclear membrane could be important in the regulation of auxin-induced mitotic progression in root tips of A. thaliana.

  10. The Anatomy of the RAN-Reading Relationship

    Science.gov (United States)

    Georgiou, George K.; Parrila, Rauno; Papadopoulos, Timothy C.

    2016-01-01

    The purpose of this study was to contrast three models of the RAN-reading relationship derived from the most prominent theoretical accounts of how RAN is related to reading: the phonological processing, the orthographic processing and the speed of processing accounts. Grade 4 Greek-speaking children (n = 208; 114 girls, 94 boys; mean…

  11. Applicability of RANS, DES and LES in propeller flow noise

    Directory of Open Access Journals (Sweden)

    LU Li

    2017-12-01

    Full Text Available [Objectives] In order to study the applicability of different turbulence models in propeller flow noise prediction, taking the DTMB 4119 propeller as the research object, the numerical simulation method is used to calculate the frequency domain noise under the non-uniform flow field.[Methods] First, the hydrodynamic coefficient and surface pressure distribution coefficient are obtained via the RANS method and the accuracy of the flow field simulation is verified by comparing it with the experimental data. Next,the pulsating pressures obtained by RANS, DES and LES are considered as the sound source respectively, and combined with the acoustic boundary element method to predict the radiation noise.[Results] The results show that spectral noise is the main contributor to total noise; when noise on 1 BPF is predicted, the results obtained by the three methods are very similar, so we can use RANS to predict noise quickly; when noise on the high order of BPF needs to be predicted, the calculation results of LES are better.[Conclusions] In noise prediction, the appropriate turbulence simulation method can be selected according to the demand.

  12. General and Specific Contributions of RAN to Reading and Arithmetic Fluency in First Graders: A Longitudinal Latent Variable Approach

    Directory of Open Access Journals (Sweden)

    Caroline Hornung

    2017-10-01

    Full Text Available In the present study, we opted for a longitudinal design and examined rapid automatized naming (RAN performance from two perspectives. In a first step, we examined the structure of RAN performance from a general cognitive perspective. We investigated whether rapid naming measures (e.g., digit RAN and color RAN reflect a mainly domain-general factor or domain-specific factors. In a second step, we examined how the best fitting RAN model was related to reading and arithmetic outcomes, assessed several months later. Finally in a third step we took a clinical perspective and investigated specific contributions of RAN measures to reading and arithmetic outcomes. While RAN has emerged as a promising predictor of reading, the relationship between RAN and arithmetic has been less examined in the past. Hundred and twenty-two first graders completed seven RAN tasks, each comprising visually familiar stimuli such as digits, vowels, consonants, dice, finger-numeral configurations, objects, and colors. Four months later the same children completed a range of reading and arithmetic tasks. From a general descriptive perspective, structural equation modeling supports a one-dimensional RAN factor in 6- to -7-year-old children. However, from a clinical perspective, our findings emphasize the specific contributions of RANs. Interestingly, alphanumeric RANs (i.e., vowel RAN were most promising when predicting reading skills and number-specific RANs (i.e., finger-numeral configuration RAN were most promising when predicting arithmetic fluency. The implications for clinical and educational practices will be discussed.

  13. The RanBP2/RanGAP1*SUMO1/Ubc9 SUMO E3 ligase is a disassembly machine for Crm1-dependent nuclear export complexes.

    Science.gov (United States)

    Ritterhoff, Tobias; Das, Hrishikesh; Hofhaus, Götz; Schröder, Rasmus R; Flotho, Annette; Melchior, Frauke

    2016-05-10

    Continuous cycles of nucleocytoplasmic transport require disassembly of transport receptor/Ran-GTP complexes in the cytoplasm. A basic disassembly mechanism in all eukaryotes depends on soluble RanGAP and RanBP1. In vertebrates, a significant fraction of RanGAP1 stably interacts with the nucleoporin RanBP2 at a binding site that is flanked by FG-repeats and Ran-binding domains, and overlaps with RanBP2's SUMO E3 ligase region. Here, we show that the RanBP2/RanGAP1*SUMO1/Ubc9 complex functions as an autonomous disassembly machine with a preference for the export receptor Crm1. We describe three in vitro reconstituted disassembly intermediates, which show binding of a Crm1 export complex via two FG-repeat patches, cargo-release by RanBP2's Ran-binding domains and retention of free Crm1 at RanBP2 after Ran-GTP hydrolysis. Intriguingly, all intermediates are compatible with SUMO E3 ligase activity, suggesting that the RanBP2/RanGAP1*SUMO1/Ubc9 complex may link Crm1- and SUMO-dependent functions.

  14. 5th Symposium on Hybrid RANS-LES Methods

    CERN Document Server

    Haase, Werner; Peng, Shia-Hui; Schwamborn, Dieter

    2015-01-01

    This book gathers the proceedings of the Fifth Symposium on Hybrid RANS-LES Methods, which was held on March 19-21 in College Station, Texas, USA. The different chapters, written by leading experts, reports on the most recent developments in flow physics modelling, and gives a special emphasis to industrially relevant applications of hybrid RANS-LES methods and other turbulence-resolving modelling approaches. The book addresses academic researchers, graduate students, industrial engineers, as well as industrial R&D managers and consultants dealing with turbulence modelling, simulation and measurement, and with multidisciplinary applications of computational fluid dynamics (CFD), such as flow control, aero-acoustics, aero-elasticity and CFD-based multidisciplinary optimization. It discusses in particular advanced hybrid RANS-LES methods. Further topics include wall-modelled Large Eddy Simulation (WMLES) methods, embedded LES, and a comparison of the LES methods with both hybrid RANS-LES and URANS methods. ...

  15. RanBPM, a scaffolding protein for gametogenesis.

    Science.gov (United States)

    Puverel, Sandrine; Tessarollo, Lino

    2013-01-01

    RanBPM is a multimodular scaffold protein that interacts with a great variety of molecules including nuclear, cytoplasmic, and membrane proteins. By building multiprotein complexes, RanBPM is thought to regulate various signaling pathways, especially in the immune and nervous system. However, the diversity of these interactions does not facilitate the identification of its precise mechanism of action, and therefore the physiological role of RanBPM still remains unclear. Recently, RanBPM has been shown to be critical for the fertility of both genders in mouse. Although mechanistically it is still unclear how RanBPM affects gametogenesis, the data collected so far suggest that it is a key player in this process. Here, we examine the RanBPM sterility phenotype in the context of other genetic mutations affecting mouse gametogenesis to investigate whether this scaffold protein affects the function of other known proteins whose deficiency results in similar sterility phenotypes. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Are Discrepancies in RANS Modeled Reynolds Stresses Random?

    CERN Document Server

    Xiao, Heng; Wang, Jian-xun; Paterson, Eric G

    2016-01-01

    In the turbulence modeling community, significant efforts have been made to quantify the uncertainties in the Reynolds-Averaged Navier--Stokes (RANS) models and to improve their predictive capabilities. Of crucial importance in these efforts is the understanding of the discrepancies in the RANS modeled Reynolds stresses. However, to what extent these discrepancies can be predicted or whether they are completely random remains a fundamental open question. In this work we used a machine learning algorithm based on random forest regression to predict the discrepancies. The success of the regression--prediction procedure indicates that, to a large extent, the discrepancies in the modeled Reynolds stresses can be explained by the mean flow feature, and thus they are universal quantities that can be extrapolated from one flow to another, at least among different flows sharing the same characteristics such as separation. This finding has profound implications to the future development of RANS models, opening up new ...

  17. Progress in Hybrid RANS-LES Modelling : Papers Contributed to the 4th Symposium on Hybrid RANS-LES Methods

    CERN Document Server

    Haase, Werner; Peng, Shia-Hui; Schwamborn, Dieter

    2013-01-01

    The present book contains contributions presented at the Fourth Symposium on Hybrid RANS-LES Methods, held in Beijing, China, 28-30 September 2011, being a continuation of symposia taking place in Stockholm (Sweden, 2005), in Corfu (Greece, 2007), and Gdansk (Poland, 2009). The contributions to the last two symposia were published as NNFM, Vol. 97 and Vol. 111. At the Beijing symposium, along with seven invited keynotes, another 46 papers (plus 5 posters) were presented addressing topics on Novel turbulence-resolving simulation and modelling, Improved hybrid RANS-LES methods, Comparative studies of difference modelling methods, Modelling-related numerical issues and Industrial applications.. The present book reflects recent activities and new progress made in the development and applications of hybrid RANS-LES methods in general.

  18. Cloud RAN for Mobile Networks - a Technology Overview

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Christiansen, Henrik Lehrmann; Yan, Ying

    2014-01-01

    Pool for statistical multiplexing gain, while shifting the burden to the high-speed wireline transmission of In-phase and Quadrature (IQ) data. C-RAN enables energy efficient network operation and possible cost savings on base- band resources. Furthermore, it improves network capacity by performing...

  19. Envisioning Spectrum Management in Virtualised C-RAN

    DEFF Research Database (Denmark)

    Al-Samman, Imad; Artuso, Matteo; Christiansen, Henrik Lehrmann

    2017-01-01

    Cloud Radio Access Network (C-RAN) has attracted a worldwide attention in both academia and industry. This network architecture re-forming has been considered as a potential solution to meet the increasing capacity demands for future mobile data traffic. In addition, Network Virtualisation is a p...

  20. Hybrid RANS-LES using high order numerical methods

    Science.gov (United States)

    Henry de Frahan, Marc; Yellapantula, Shashank; Vijayakumar, Ganesh; Knaus, Robert; Sprague, Michael

    2017-11-01

    Understanding the impact of wind turbine wake dynamics on downstream turbines is particularly important for the design of efficient wind farms. Due to their tractable computational cost, hybrid RANS/LES models are an attractive framework for simulating separation flows such as the wake dynamics behind a wind turbine. High-order numerical methods can be computationally efficient and provide increased accuracy in simulating complex flows. In the context of LES, high-order numerical methods have shown some success in predictions of turbulent flows. However, the specifics of hybrid RANS-LES models, including the transition region between both modeling frameworks, pose unique challenges for high-order numerical methods. In this work, we study the effect of increasing the order of accuracy of the numerical scheme in simulations of canonical turbulent flows using RANS, LES, and hybrid RANS-LES models. We describe the interactions between filtering, model transition, and order of accuracy and their effect on turbulence quantities such as kinetic energy spectra, boundary layer evolution, and dissipation rate. This work was funded by the U.S. Department of Energy, Exascale Computing Project, under Contract No. DE-AC36-08-GO28308 with the National Renewable Energy Laboratory.

  1. Eye-Movement Control in RAN and Reading

    Science.gov (United States)

    Kuperman, Victor; Van Dyke, Julie A.; Henry, Regina

    2016-01-01

    The present study examined the "visual scanning hypothesis", which suggests that fluent oculomotor control is an important component underlying the predictive relationship between Rapid Automatized Naming (RAN) tasks and reading ability. Our approach was to isolate components of saccadic planning, articulation, and lexical retrieval in 3…

  2. Characterization of RanBPM Molecular Determinants that Control Its Subcellular Localization

    Science.gov (United States)

    Salemi, Louisa M.; Loureiro, Sandra O.; Schild-Poulter, Caroline

    2015-01-01

    RanBPM/RanBP9 is a ubiquitous, nucleocytoplasmic protein that is part of an evolutionary conserved E3 ubiquitin ligase complex whose function and targets in mammals are still unknown. RanBPM itself has been implicated in various cellular processes that involve both nuclear and cytoplasmic functions. However, to date, little is known about how RanBPM subcellular localization is regulated. We have conducted a systematic analysis of RanBPM regions that control its subcellular localization using RanBPM shRNA cells to examine ectopic RanBPM mutant subcellular localization without interference from the endogenously expressed protein. We show that several domains and motifs regulate RanBPM nuclear and cytoplasmic localization. In particular, RanBPM comprises two motifs that can confer nuclear localization, one proline/glutamine-rich motif in the extreme N-terminus which has a dominant effect on RanBPM localization, and a second motif in the C-terminus which minimally contributes to RanBPM nuclear targeting. We also identified a nuclear export signal (NES) which mutation prevented RanBPM accumulation in the cytoplasm. Likewise, deletion of the central RanBPM conserved domains (SPRY and LisH/CTLH) resulted in the relocalization of RanBPM to the nucleus, suggesting that RanBPM cytoplasmic localization is also conferred by protein-protein interactions that promote its cytoplasmic retention. Indeed we found that in the cytoplasm, RanBPM partially colocalizes with microtubules and associates with α-tubulin. Finally, in the nucleus, a significant fraction of RanBPM is associated with chromatin. Altogether, these analyses reveal that RanBPM subcellular localization results from the combined effects of several elements that either confer direct transport through the nucleocytoplasmic transport machinery or regulate it indirectly, likely through interactions with other proteins and by intramolecular folding. PMID:25659156

  3. RANS Simulations using OpenFOAM Software

    Science.gov (United States)

    2016-01-01

    for “Open Source Field Operation and Manipulation ” and is a library of object oriented software written in the C++ programming language [1]. It...can be monitored visually from run time plots of the residuals by using the open source plotting program Gnuplot. A portion of the output from the...region are planned using a less intrusive support structure and flow visualization techniques. UNCLASSIFIED DST-Group-TR-3204 UNCLASSIFIED 27 -0.4

  4. Tuisland. Karin Brynard. Kaapstad: Penguin Ran- dom House Suid ...

    African Journals Online (AJOL)

    Karin Brynard. Kaapstad: Penguin Ran- dom House Suid-Afrika, 2016. 576 pp. ISBN 978-1-4152-0693-5,. ISBN 978-1-4152-0668-3,. ISBN 978-1-4125-0669-0. DOI: http://dx.doi.org/10.17159/tvl.v.54i1.29. Tuisland (2016) is oud-joernalis Karin. Brynard se derde spanningsroman. Haar debuut, Plaasmoord (2009), is met die.

  5. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Directory of Open Access Journals (Sweden)

    Azamat Aslanukov

    2006-10-01

    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  6. AVHRR GAC SST Reanalysis Version 1 (RAN1

    Directory of Open Access Journals (Sweden)

    Alexander Ignatov

    2016-04-01

    Full Text Available In response to its users’ needs, the National Oceanic and Atmospheric Administration (NOAA initiated reanalysis (RAN of the Advanced Very High Resolution Radiometer (AVHRR Global Area Coverage (GAC; 4 km sea surface temperature (SST data employing its Advanced Clear Sky Processor for Oceans (ACSPO retrieval system. Initially, AVHRR/3 data from five NOAA and two Metop satellites from 2002 to 2015 have been reprocessed. The derived SSTs have been matched up with two reference SSTs—the quality controlled in situ SSTs from the NOAA in situ Quality Monitor (iQuam and the Canadian Meteorological Centre (CMC L4 SST analysis—and analyzed in the NOAA SST Quality Monitor (SQUAM online system. The corresponding clear-sky ocean brightness temperatures (BT in AVHRR bands 3b, 4 and 5 (centered at 3.7, 11, and 12 µm, respectively have been compared with the Community Radiative Transfer Model simulations in another NOAA online system, Monitoring of Infrared Clear-sky Radiances over Ocean for SST (MICROS. For some AVHRRs, the time series of “AVHRR minus reference” SSTs and “observed minus model” BTs are unstable and inconsistent, with artifacts in the SSTs and BTs strongly correlated. In the official “Reanalysis version 1” (RAN1, data from only five platforms—two midmorning (NOAA-17 and Metop-A and three afternoon (NOAA-16, -18 and -19—were included during the most stable periods of their operations. The stability of the SST time series was further improved using variable regression SST coefficients, similarly to how it was done in the NOAA/NASA Pathfinder version 5.2 (PFV5.2 dataset. For data assimilation applications, especially those blending satellite and in situ SSTs, we recommend bias-correcting the RAN1 SSTs using the newly developed sensor-specific error statistics (SSES, which are reported in the product files. Relative performance of RAN1 and PFV5.2 SSTs is discussed. Work is underway to improve the calibration of AVHRR/3s and

  7. Overexpression of Ran gene from Lepidium latifolium L. (LlaRan) renders transgenic tobacco plants hypersensitive to cold stress.

    Science.gov (United States)

    Sinha, Vimlendu Bhushan; Grover, Atul; Singh, Sadhana; Pande, Veena; Ahmed, Zakwan

    2014-09-01

    Ran is a multifunctional small GTPase involved in important cellular activities like nucleocytoplasmic transport, mitotic spindle assembly, nuclear envelope formation, etc., but is also known to be differentially expressed in response to abiotic stress, particularly low temperature. We have over-expressed Lepidium latifolium (Fam. Brassicaceae) Ran gene in tobacco to study the response of the plants to cold stress (24 h; 4 °C). Transformation of the tobacco plants was verified using PCR targeting Ran gene and co-transformed selectable marker gene nptII. Segregation in Mendelian ratios was validated in five transgenic lines by germination of T1 and T2 seeds on moist filter papers containing 150 mg/l kanamycin. Higher levels of electrolyte leakage and lipid peroxidation pointed towards hypersensitivity of plants. Similarly, lesser proline accumulation compared to wild types also indicated susceptibility of plants to death under chilling conditions. Specific activity of antioxidant enzymes superoxide dismutase and glutathione reductase was also measured under stressed and control conditions. A variation was observed across the different lines, and four out of five lines showed lesser specific activity compared to wild type plants, thus indicating reduced capability of scavenging free radicals. In totality, a strong evidence on induced hypersensitivity to cold stress has been collected which may further be helpful in designing appropriate strategies for engineering crop plants for survival under cold stress conditions.

  8. GAP Activity, but Not Subcellular Targeting, Is Required for Arabidopsis RanGAP Cellular and Developmental Functions.

    Science.gov (United States)

    Boruc, Joanna; Griffis, Anna H N; Rodrigo-Peiris, Thushani; Zhou, Xiao; Tilford, Bailey; Van Damme, Daniël; Meier, Iris

    2015-07-01

    The Ran GTPase activating protein (RanGAP) is important to Ran signaling involved in nucleocytoplasmic transport, spindle organization, and postmitotic nuclear assembly. Unlike vertebrate and yeast RanGAP, plant RanGAP has an N-terminal WPP domain, required for nuclear envelope association and several mitotic locations of Arabidopsis thaliana RanGAP1. A double null mutant of the two Arabidopsis RanGAP homologs is gametophyte lethal. Here, we created a series of mutants with various reductions in RanGAP levels by combining a RanGAP1 null allele with different RanGAP2 alleles. As RanGAP level decreases, the severity of developmental phenotypes increases, but nuclear import is unaffected. To dissect whether the GAP activity and/or the subcellular localization of RanGAP are responsible for the observed phenotypes, this series of rangap mutants were transformed with RanGAP1 variants carrying point mutations abolishing the GAP activity and/or the WPP-dependent subcellular localization. The data show that plant development is differentially affected by RanGAP mutant allele combinations of increasing severity and requires the GAP activity of RanGAP, while the subcellular positioning of RanGAP is dispensable. In addition, our results indicate that nucleocytoplasmic trafficking can tolerate both partial depletion of RanGAP and delocalization of RanGAP from the nuclear envelope. © 2015 American Society of Plant Biologists. All rights reserved.

  9. Hybrid RANS/LES applied to complex terrain

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Sørensen, Niels N.

    2011-01-01

    Large Eddy Simulation (LES) of the wind in complex terrain is limited by computational cost. The number of computational grid points required to resolve the near-ground turbulent structures (eddies) are very high. The traditional solution to the problem has been to apply a wall function...... aspect ratio in the RANS layer and thereby resolve the mean near-wall velocity profile. The method is applicable to complex terrain and the benefits of traditional LES are kept intact. Using the hybrid method, simulations of the wind over a natural complex terrain near Wellington in New Zealand...

  10. Aggresome formation is regulated by RanBPM through an interaction with HDAC6

    Directory of Open Access Journals (Sweden)

    Louisa M. Salemi

    2014-05-01

    Full Text Available In conditions of proteasomal impairment, the build-up of damaged or misfolded proteins activates a cellular response leading to the recruitment of damaged proteins into perinuclear aggregates called aggresomes. Aggresome formation involves the retrograde transport of cargo proteins along the microtubule network and is dependent on the histone deacetylase HDAC6. Here we show that ionizing radiation (IR promotes Ran-Binding Protein M (RanBPM relocalization into discrete perinuclear foci where it co-localizes with aggresome components ubiquitin, dynein and HDAC6, suggesting that the RanBPM perinuclear clusters correspond to aggresomes. RanBPM was also recruited to aggresomes following treatment with the proteasome inhibitor MG132 and the DNA-damaging agent etoposide. Strikingly, aggresome formation by HDAC6 was markedly impaired in RanBPM shRNA cells, but was restored by re-expression of RanBPM. RanBPM was found to interact with HDAC6 and to inhibit its deacetylase activity. This interaction was abrogated by a RanBPM deletion of its LisH/CTLH domain, which also prevented aggresome formation, suggesting that RanBPM promotes aggresome formation through an association with HDAC6. Our results suggest that RanBPM regulates HDAC6 activity and is a central regulator of aggresome formation.

  11. A Taylor-Microscale Transport Model for RANS

    Science.gov (United States)

    Israel, Daniel; Hsu, Abigail; Rudolph, Joshua

    2017-11-01

    Since the first development of complete two-equation RANS models, there have been a variety of proposals for the choice of a second scaling quantity. Some of the most popular have been a time-scale ω (Kolmogorov, 1942; Wilcox, 1998), the dissipation rate ɛ (Harlow et al., 1968), the integral length-scale L, and the product kl (Mellor et al., 1982). All of these are formally equivalent in the production and dissipation terms, and differ only in which quantity is turbulently diffused. They also all rely on an equilibrium assumption that links the dissipation rate at the small scales to the scale of the large eddies. We propose using the Taylor microscale as the second scale. This has several nice properties, and also exhibits some interesting mathematical differences from conventional models. We show results for some simple shear flows using the new model.

  12. How Is RAN Related to Reading Fluency? A Comprehensive Examination of the Prominent Theoretical Accounts

    Science.gov (United States)

    Papadopoulos, Timothy C.; Spanoudis, George C.; Georgiou, George K.

    2016-01-01

    We examined the prominent theoretical explanations of the RAN-reading relationship in a relatively transparent language (Greek) in a sample of children (n = 286) followed from Grade 1 to Grade 2. Specifically, we tested the fit of eight different models, as defined by the type of reading performance predicted (oral vs. silent word reading fluency), the type of RAN tasks (non-alphanumeric vs. alphanumeric), and the RAN effects (direct vs. indirect). Working memory, attention, processing speed, and motor skills were used as “common cause” variables predicting both RAN and reading fluency and phonological awareness and orthographic processing were used as mediators of RAN's effects on reading fluency. The findings of both concurrent and longitudinal analyses indicated that RAN is a unique predictor of oral reading fluency, but not silent reading fluency. Using alphanumeric or non-alphanumeric RAN did not particularly affect the RAN-reading relationship. Both phonological awareness and orthographic processing partly mediated RAN's effects on reading fluency. Theoretical implications of these findings are discussed. PMID:27605918

  13. Encephalomyocarditis virus Leader protein hinge domain is responsible for interactions with Ran GTPase

    Energy Technology Data Exchange (ETDEWEB)

    Bacot-Davis, Valjean R., E-mail: bacotdavis@wisc.edu [Institute for Molecular Virology, University of Wisconsin-Madison, R.M. Bock Laboratories, 1525 Linden Dr. Madison, WI 53706 (United States); Palmenberg, Ann C., E-mail: acpalmen@wisc.edu [Institute for Molecular Virology, University of Wisconsin-Madison, R.M. Bock Laboratories, 1525 Linden Dr. Madison, WI 53706 (United States); Department of Biochemistry, University of Wisconsin-Madison, R.M. Bock Laboratories, 1525 Linden Dr. Madison, WI 53706 (United States)

    2013-08-15

    Encephalomyocarditis virus (EMCV), a Cardiovirus, initiates its polyprotein with a short 67 amino acid Leader (L) sequence. The protein acts as a unique pathogenicity factor, with anti-host activities which include the triggering of nuclear pore complex hyperphosphorylation and direct binding inhibition of the active cellular transport protein, Ran GTPase. Chemical modifications and protein mutagenesis now map the Ran binding domain to the L hinge-linker region, and in particular, to amino acids 35–40. Large deletions affecting this region were shown previously to diminish Ran binding. New point mutations, especially K35Q, D37A and W40A, preserve the intact L structure, abolish Ran binding and are deficient for nucleoporin (Nup) hyperphosphorylation. Ran itself morphs through multiple configurations, but reacts most effectively with L when in the GDP format, preferably with an empty nucleotide binding pocket. Therefore, L:Ran binding, mediated by the linker-hinge, is a required step in L-induced nuclear transport inhibition. - Highlights: • The hinge domain provides critical residues in Cardiovirus L:Ran complex formation. • Leader prefers to bind Ran in a nucleotide free, GDP-conformation. • L-induced Nup62 phosphorylation is reduced with Ran-deficient binding mutations.

  14. How Is RAN Related to Reading Fluency? A Comprehensive Examination of the Prominent Theoretical Accounts.

    Science.gov (United States)

    Papadopoulos, Timothy C; Spanoudis, George C; Georgiou, George K

    2016-01-01

    We examined the prominent theoretical explanations of the RAN-reading relationship in a relatively transparent language (Greek) in a sample of children (n = 286) followed from Grade 1 to Grade 2. Specifically, we tested the fit of eight different models, as defined by the type of reading performance predicted (oral vs. silent word reading fluency), the type of RAN tasks (non-alphanumeric vs. alphanumeric), and the RAN effects (direct vs. indirect). Working memory, attention, processing speed, and motor skills were used as "common cause" variables predicting both RAN and reading fluency and phonological awareness and orthographic processing were used as mediators of RAN's effects on reading fluency. The findings of both concurrent and longitudinal analyses indicated that RAN is a unique predictor of oral reading fluency, but not silent reading fluency. Using alphanumeric or non-alphanumeric RAN did not particularly affect the RAN-reading relationship. Both phonological awareness and orthographic processing partly mediated RAN's effects on reading fluency. Theoretical implications of these findings are discussed.

  15. RAN as a predictor of reading skills, and vice versa: results from a randomised reading intervention.

    Science.gov (United States)

    Wolff, Ulrika

    2014-07-01

    Although phonemic awareness is a well-known factor predicting early reading development, there is also evidence that Rapid Automatized Naming (RAN) is an independent factor that contributes to early reading. The aim of this study is to examine phonemic awareness and RAN as predictors of reading speed, reading comprehension and spelling for children with reading difficulties. It also investigates a possible reciprocal relationship between RAN and reading skills, and the possibility of enhancing RAN by intervention. These issues are addressed by examining longitudinal data from a randomised reading intervention study carried out in Sweden for 9-year-old children with reading difficulties (N = 112). The intervention comprised three main elements: training of phonics, reading comprehension strategies and reading speed. The analysis of the data was carried out using structural equation modelling. The results demonstrated that after controlling for autoregressive effects and non-verbal IQ, RAN predicts reading speed whereas phonemic awareness predicts reading comprehension and spelling. RAN was significantly enhanced by training and a reciprocal relationship between reading speed and RAN was found. These findings contribute to support the view that both phonemic awareness and RAN independently influence early phases of reading, and that both are possible to enhance by training.

  16. RAN as a Predictor of Reading Skills, and Vice Versa: Results from a Randomised Reading Intervention

    Science.gov (United States)

    Wolff, Ulrika

    2014-01-01

    Although phonemic awareness is a well-known factor predicting early reading development, there is also evidence that Rapid Automatized Naming (RAN) is an independent factor that contributes to early reading. The aim of this study is to examine phonemic awareness and RAN as predictors of reading speed, reading comprehension and spelling for…

  17. Mesh Resolution Effect on 3D RANS Turbomachinery Flow Simulations

    CERN Document Server

    Yershov, Sergiy

    2016-01-01

    The paper presents the study of the effect of a mesh refinement on numerical results of 3D RANS computations of turbomachinery flows. The CFD solver F, which based on the second-order accurate ENO scheme, is used in this study. The simplified multigrid algorithm and local time stepping permit decreasing computational time. The flow computations are performed for a number of turbine and compressor cascades and stages. In all flow cases, the successively refined meshes of H-type with an approximate orthogonalization near the solid walls were generated. The results obtained are compared in order to estimate their both mesh convergence and ability to resolve the transonic flow pattern. It is concluded that for thorough studying the fine phenomena of the 3D turbomachinery flows, it makes sense to use the computational meshes with the number of cells from several millions up to several hundred millions per a single turbomachinery blade channel, while for industrial computations, a mesh of about or less than one mil...

  18. A comparison between Smoothed-Particle Hydrodynamics and RANS Volume of Fluid method in modelling slamming

    Directory of Open Access Journals (Sweden)

    Marcus Sasson

    2016-04-01

    Full Text Available The oil and gas industry requires complex subsea infrastructure in order to develop offshore oil and gas fields. Upon installation, these components may encounter high slamming loads, stemming from impact with the water surface. This paper utilises two different numerical methods, the mesh-free Smoothed Particle Hydrodynamics (SPH approach and Reynolds Averaged Navier–Stokes (RANS Volume of Fluid (VOF method to quantify these loads on a free-falling object. The investigation is also interested in conducting a parameter study and determining the effect of varying simulation parameters on the prediction of slamming event kinematics and forces. The surface impact of a freefalling wedge was introduced as a case study and has been simulated using SPH and RANS, with the results being compared to an experimental investigation. It was found from the SPH simulations that particle resolution and the size of the SPH particle kernel are very important, whilst the diffusion term does not play an important role. The latter is due to the very transient nature of slamming events, which do not allow sufficient time for diffusion in the fluid domain. For the RANS simulations, motion of the wedge was achieved using the overset grid technique, whereby varying the discretising time step was found to have a pronounced impact on the accuracy of the captured slamming event. Through analysing the numerical data, one can observe that the RANS results correlate slightly better with the experimental data as opposed to that obtained from the SPH modelling. However, considering the robustness and quick set up of the SPH simulations, both of these two numerical approaches are considered to be promising tools for modelling more complicated slamming problems, including those potentially involving more intricate structures.

  19. How is RAN Related to Reading Fluency? A Comprehensive Examination of the Prominent Theoretical Accounts

    Directory of Open Access Journals (Sweden)

    TIMOTHY C PAPADOPOULOS

    2016-08-01

    Full Text Available We examined the prominent theoretical explanations of the RAN-reading relationship in a relatively transparent language (Greek in a sample of children (n= 286 followed from Grade 1 to Grade 2. Specifically, we tested the fit of eight different models, as defined by the type of reading performance predicted (oral vs. silent word reading fluency, the type of RAN tasks (non-alphanumeric vs. alphanumeric, and the RAN effects (direct vs. indirect. Working memory, attention, processing speed, and motor skills were used as common cause variables predicting both RAN and reading fluency and phonological awareness and orthographic processing were used as mediators of RAN’s effects on reading fluency. The findings of both concurrent and longitudinal analyses indicated that RAN is a unique predictor of oral reading fluency, but not silent reading fluency. Using alphanumeric or non-alphanumeric RAN did not particularly affect the RAN-reading relationship. Both phonological awareness and orthographic processing partly mediated RAN’s effects on reading fluency. Theoretical implications of these findings are discussed.

  20. Effect of Engine Installation on Jet Noise using a Hybrid LES/RANS Approach Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Installation effects arising from propulsion airframe interaction are known to produce substantial variations in the in-situ jet noise. A hybrid LES/RANS...

  1. Mesh Generation and Adaption for High Reynolds Number RANS Computations Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposal offers to provide NASA with an automatic mesh generator for the simulation of aerodynamic flows using Reynolds-Averages Navier-Stokes (RANS) models....

  2. A dynamic hybrid RANS/LES modeling methodology for turbulent/transitional flow field prediction

    Science.gov (United States)

    Alam, Mohammad Faridul

    A dynamic hybrid Reynolds-averaged Navier-Stokes (RANS)-Large Eddy Simulation (LES) modeling framework has been investigated and further developed to improve the Computational Fluid Dynamics (CFD) prediction of turbulent flow features along with laminar-to-turbulent transitional phenomena. In recent years, the use of hybrid RANS/LES (HRL) models has become more common in CFD simulations, since HRL models offer more accuracy than RANS in regions of flow separation at a reduced cost relative to LES in attached boundary layers. The first part of this research includes evaluation and validation of a dynamic HRL (DHRL) model that aims to address issues regarding the RANS-to-LES zonal transition and explicit grid dependence, both of which are inherent to most current HRL models. Simulations of two test cases---flow over a backward facing step and flow over a wing with leading-edge ice accretion---were performed to assess the potential of the DHRL model for predicting turbulent features involved in mainly unsteady separated flow. The DHRL simulation results are compared with experimental data, along with the computational results for other HRL and RANS models. In summary, these comparisons demonstrate that the DHRL framework does address many of the weaknesses inherent in most current HRL models. Although HRL models are widely used in turbulent flow simulations, they have limitations for transitional flow predictions. Most HRL models include a fully turbulent RANS component for attached boundary layer regions. The small number of HRL models that do include transition-sensitive RANS models have issues related to the RANS model itself and to the zonal transition between RANS and LES. In order to address those issues, a new transition-sensitive HRL modeling methodology has been developed that includes the DHRL methodology and a physics-based transition-sensitive RANS model. The feasibility of the transition-sensitive dynamic HRL (TDHRL) model has been investigated by

  3. Tuning a RANS k-e model for jet-in-crossflow simulations.

    Energy Technology Data Exchange (ETDEWEB)

    Lefantzi, Sophia; Ray, Jaideep; Arunajatesan, Srinivasan; DeChant, Lawrence Justin

    2013-09-01

    We develop a novel calibration approach to address the problem of predictive ke RANS simulations of jet-incrossflow. Our approach is based on the hypothesis that predictive ke parameters can be obtained by estimating them from a strongly vortical flow, specifically, flow over a square cylinder. In this study, we estimate three ke parameters, C%CE%BC, Ce2 and Ce1 by fitting 2D RANS simulations to experimental data. We use polynomial surrogates of 2D RANS for this purpose. We conduct an ensemble of 2D RANS runs using samples of (C%CE%BC;Ce2;Ce1) and regress Reynolds stresses to the samples using a simple polynomial. We then use this surrogate of the 2D RANS model to infer a joint distribution for the ke parameters by solving a Bayesian inverse problem, conditioned on the experimental data. The calibrated (C%CE%BC;Ce2;Ce1) distribution is used to seed an ensemble of 3D jet-in-crossflow simulations. We compare the ensemble's predictions of the flowfield, at two planes, to PIV measurements and estimate the predictive skill of the calibrated 3D RANS model. We also compare it against 3D RANS predictions using the nominal (uncalibrated) values of (C%CE%BC;Ce2;Ce1), and find that calibration delivers a significant improvement to the predictive skill of the 3D RANS model. We repeat the calibration using surrogate models based on kriging and find that the calibration, based on these more accurate models, is not much better that those obtained with simple polynomial surrogates. We discuss the reasons for this rather surprising outcome.

  4. An Enhanced OFDM Resource Allocation Algorithm in C-RAN Based 5G Public Safety Network

    Directory of Open Access Journals (Sweden)

    Lei Feng

    2016-01-01

    Full Text Available Public Safety Network (PSN is the network for critical communication when disaster occurs. As a key technology in 5G, Cloud-Radio Access Network (C-RAN can play an important role in PSN instead of LTE-based RAN. This paper firstly introduces C-RAN based PSN architecture and models the OFDM resource allocation problem in C-RAN based PSN as an integer quadratic programming, which allows the trade-off between expected bitrates and allocating fairness of PSN Service User (PSU. However, C-RAN based PSN needs to improve the efficiency of allocating algorithm because of a mass of PSU-RRH associations when disaster occurs. To deal with it, the resources allocating problem with integer variables is relaxed into one with continuous variables in the first step and an algorithm based on Generalized Bender’s Decomposition (GBD is proposed to solve it. Then we use Feasible Pump (FP method to get a feasible integer solution on the original OFDM resources allocation problem. The final experiments show the total throughput achieved by C-RAN based PSN is at most higher by 19.17% than the LTE-based one. And the average computational time of the proposed GBD and FP algorithm is at most lower than Barrier by 51.5% and GBD with no relaxation by 30.1%, respectively.

  5. Determinants of Small Ubiquitin-like Modifier 1 (SUMO1) Protein Specificity, E3 Ligase, and SUMO-RanGAP1 Binding Activities of Nucleoporin RanBP2

    Energy Technology Data Exchange (ETDEWEB)

    Gareau, Jaclyn R.; Reverter, David; Lima, Christopher D. (SKI)

    2012-02-16

    The RanBP2 nucleoporin contains an internal repeat domain (IR1-M-IR2) that catalyzes E3 ligase activity and forms a stable complex with SUMO-modified RanGAP1 and UBC9 at the nuclear pore complex. RanBP2 exhibits specificity for SUMO1 as RanGAP1-SUMO1/UBC9 forms a more stable complex with RanBP2 compared with RanGAP1-SUMO2 that results in greater protection of RanGAP-SUMO1 from proteases. The IR1-M-IR2 SUMO E3 ligase activity also shows a similar preference for SUMO1. We utilized deletions and domain swap constructs in protease protection assays and automodification assays to define RanBP2 domains responsible for RanGAP1-SUMO1 protection and SUMO1-specific E3 ligase activity. Our data suggest that elements in both IR1 and IR2 exhibit specificity for SUMO1. IR1 protects RanGAP1-SUMO1/UBC9 and functions as the primary E3 ligase of RanBP2, whereas IR2 retains the ability to interact with SUMO1 to promote SUMO1-specific E3 ligase activity. To determine the structural basis for SUMO1 specificity, a hybrid IR1 construct and IR1 were used to determine three new structures for complexes containing UBC9 with RanGAP1-SUMO1/2. These structures show more extensive contacts among SUMO, UBC9, and RanBP2 in complexes containing SUMO1 compared with SUMO2 and suggest that differences in SUMO specificity may be achieved through these subtle conformational differences.

  6. Quantifying Model Form Uncertainty in RANS Simulation of Wing-Body Junction Flow

    CERN Document Server

    Wu, Jin-Long; Xiao, Heng

    2016-01-01

    Wing-body junction flows occur when a boundary layer encounters an airfoil mounted on the surface. The corner flow near the trailing edge is challenging for the linear eddy viscosity Reynolds Averaged Navier-Stokes (RANS) models, due to the interaction of two perpendicular boundary layers which leads to highly anisotropic Reynolds stress at the near wall region. Recently, Xiao et al. proposed a physics-informed Bayesian framework to quantify and reduce the model-form uncertainties in RANS simulations by utilizing sparse observation data. In this work, we extend this framework to incorporate the use of wall function in RANS simulations, and apply the extended framework to the RANS simulation of wing-body junction flow. Standard RANS simulations are performed on a 3:2 elliptic nose and NACA0020 tail cylinder joined at their maximum thickness location. Current results show that both the posterior mean velocity and the Reynolds stress anisotropy show better agreement with the experimental data at the corner regio...

  7. Rapid automatized naming (RAN) in children with ADHD: An ex-Gaussian analysis.

    Science.gov (United States)

    Ryan, Matthew; Jacobson, Lisa A; Hague, Cole; Bellows, Alison; Denckla, Martha B; Mahone, E Mark

    2017-07-01

    Children with ADHD demonstrate increased frequent "lapses" in performance on tasks in which the stimulus presentation rate is externally controlled, leading to increased variability in response times. It is less clear whether these lapses are also evident during performance on self-paced tasks, e.g., rapid automatized naming (RAN), or whether RAN inter-item pause time variability uniquely predicts reading performance. A total of 80 children aged 9 to 14 years-45 children with attention-deficit/hyperactivity disorder (ADHD) and 35 typically developing (TD) children-completed RAN and reading fluency measures. RAN responses were digitally recorded for analyses. Inter-stimulus pause time distributions (excluding between-row pauses) were analyzed using traditional (mean, standard deviation [SD], coefficient of variation [CV]) and ex-Gaussian (mu, sigma, tau) methods. Children with ADHD were found to be significantly slower than TD children (p reading fluency. RAN response time distributions were also significantly more variable (SD, tau) in children with ADHD. Hierarchical regression revealed that the exponential component (tau) of the letter-naming response time distribution uniquely predicted reading fluency in children with ADHD (p reading, ADHD symptom severity and age. The findings suggest that children with ADHD (without word-level reading difficulties) manifest slowed performance on tasks of reading fluency; however, this "slowing" may be due in part to lapses from ongoing performance that can be assessed directly using ex-Gaussian methods that capture excessively long response times.

  8. Does ability to establish sound-symbol pairings mediate the RAN reading relationship?

    DEFF Research Database (Denmark)

    Poulsen, Mads; Juul, Holger; Elbro, Carsten

    for animals in a paired associate learning task. These animals were then used in a rapid naming task. Results Preliminary results show that reading correlated with the amount of training required for learning the animal names (r=-.19, p=.06). RAN speed with the same animals did not correlate with reading......Performance on tests to rapidly name letters and digits has been shown to correlate with reading. One possible reason is that these tests probe the ability to learn and automatise symbol-sound associations. However, most studies have not controlled for the amount of experience with the RAN......-items, so it is unclear whether it is the experience or the ability to take advantage of the experience that is responsible for the correlation between RAN and reading. Paired associate learning tasks have been shown to differentiate dyslexics from controls, and to correlate with reading in unselected...

  9. Development of a Hybrid RANS/LES Method for Compressible Mixing Layer Simulations

    Science.gov (United States)

    Georgiadis, Nicholas J.; Alexander, J. Iwan D.; Reshotko, Eli

    2001-01-01

    A hybrid method has been developed for simulations of compressible turbulent mixing layers. Such mixing layers dominate the flows in exhaust systems of modem day aircraft and also those of hypersonic vehicles currently under development. The hybrid method uses a Reynolds-averaged Navier-Stokes (RANS) procedure to calculate wall bounded regions entering a mixing section, and a Large Eddy Simulation (LES) procedure to calculate the mixing dominated regions. A numerical technique was developed to enable the use of the hybrid RANS/LES method on stretched, non-Cartesian grids. The hybrid RANS/LES method is applied to a benchmark compressible mixing layer experiment. Preliminary two-dimensional calculations are used to investigate the effects of axial grid density and boundary conditions. Actual LES calculations, performed in three spatial directions, indicated an initial vortex shedding followed by rapid transition to turbulence, which is in agreement with experimental observations.

  10. Model-Invariant Hybrid LES-RANS Computation of Separated Flow Past Periodic Hills

    Science.gov (United States)

    Woodruff, Stephen

    2014-01-01

    The requirement that physical quantities not vary with a hybrid LESRANS model's blending parameter imposes conditions on the computation that lead to better results across LES-RANS transitions. This promises to allow placement of those transitions so that LES is performed only where required by the physics, improving computational efficiency. The approach is applied to separated flow past periodic hills, where good predictions of separation-bubble size are seen due to the gradual, controlled, LES-RANS transition and the resulting enhanced near-wall eddy viscosity.

  11. RAN translation at C9orf72-associated repeat expansions is selectively enhanced by the integrated stress response.

    Science.gov (United States)

    Green, Katelyn M; Glineburg, M Rebecca; Kearse, Michael G; Flores, Brittany N; Linsalata, Alexander E; Fedak, Stephen J; Goldstrohm, Aaron C; Barmada, Sami J; Todd, Peter K

    2017-12-08

    Repeat-associated non-AUG (RAN) translation allows for unconventional initiation at disease-causing repeat expansions. As RAN translation contributes to pathogenesis in multiple neurodegenerative disorders, determining its mechanistic underpinnings may inform therapeutic development. Here we analyze RAN translation at G4C2 repeat expansions that cause C9orf72-associated amyotrophic lateral sclerosis and frontotemporal dementia (C9RAN) and at CGG repeats that cause fragile X-associated tremor/ataxia syndrome. We find that C9RAN translation initiates through a cap- and eIF4A-dependent mechanism that utilizes a CUG start codon. C9RAN and CGG RAN are both selectively enhanced by integrated stress response (ISR) activation. ISR-enhanced RAN translation requires an eIF2α phosphorylation-dependent alteration in start codon fidelity. In parallel, both CGG and G4C2 repeats trigger phosphorylated-eIF2α-dependent stress granule formation and global translational suppression. These findings support a model whereby repeat expansions elicit cellular stress conditions that favor RAN translation of toxic proteins, creating a potential feed-forward loop that contributes to neurodegeneration.

  12. Galaxy evolution. Isolated compact elliptical galaxies: stellar systems that ran away.

    Science.gov (United States)

    Chilingarian, Igor; Zolotukhin, Ivan

    2015-04-24

    Compact elliptical galaxies form a rare class of stellar system (~30 presently known) characterized by high stellar densities and small sizes and often harboring metal-rich stars. They were thought to form through tidal stripping of massive progenitors, until two isolated objects were discovered where massive galaxies performing the stripping could not be identified. By mining astronomical survey data, we have now found 195 compact elliptical galaxies in all types of environment. They all share similar dynamical and stellar population properties. Dynamical analysis for nonisolated galaxies demonstrates the feasibility of their ejection from host clusters and groups by three-body encounters, which is in agreement with numerical simulations. Hence, isolated compact elliptical and isolated quiescent dwarf galaxies are tidally stripped systems that ran away from their hosts. Copyright © 2015, American Association for the Advancement of Science.

  13. Modelling of sand transport under wave-generated sheet flows with a RANS diffusion model

    NARCIS (Netherlands)

    Hassan, Wael; Ribberink, Jan S.

    2010-01-01

    A 1DV-RANS diffusion model is used to study sand transport processes in oscillatory flat-bed/sheet flow conditions. The central aim is the verification of the model with laboratory data and to identify processes controlling the magnitude and direction (‘onshore’/‘offshore’) of the net time-averaged

  14. Computing the flow past Vortex Generators : Comparison between RANS Simulations and Experiments

    NARCIS (Netherlands)

    Manolesos, M.; Sorensen, NN; Troldborg, N.; Florentie, L.; Papadakis, G; Voutsinas, S.

    2016-01-01

    The flow around a wind turbine airfoil equipped with Vortex Generators (VGs) is examined. Predictions from three different Reynolds Averaged Navier Stokes (RANS) solvers with two different turbulence models and two different VG modelling approaches are compared between them and with experimental

  15. Computing the flow past Vortex Generators: Comparison between RANS Simulations and Experiments

    DEFF Research Database (Denmark)

    Manolesos, M.; Sørensen, Niels N.; Troldborg, Niels

    2016-01-01

    The flow around a wind turbine airfoil equipped with Vortex Generators (VGs) is examined. Predictions from three different Reynolds Averaged Navier Stokes (RANS) solvers with two different turbulence models and two different VG modelling approaches are compared between them and with experimental ...

  16. Inadequacy representation of flamelet-based RANS model for turbulent non-premixed flame

    Science.gov (United States)

    Lee, Myoungkyu; Oliver, Todd; Moser, Robert

    2017-11-01

    Stochastic representations for model inadequacy in RANS-based models of non-premixed jet flames are developed and explored. Flamelet-based RANS models are attractive for engineering applications relative to higher-fidelity methods because of their low computational costs. However, the various assumptions inherent in such models introduce errors that can significantly affect the accuracy of computed quantities of interest. In this work, we develop an approach to represent the model inadequacy of the flamelet-based RANS model. In particular, we pose a physics-based, stochastic PDE for the triple correlation of the mixture fraction. This additional uncertain state variable is then used to construct perturbations of the PDF for the instantaneous mixture fraction, which is used to obtain an uncertain perturbation of the flame temperature. A hydrogen-air non-premixed jet flame is used to demonstrate the representation of the inadequacy of the flamelet-based RANS model. This work was supported by DARPA-EQUiPS(Enabling Quantification of Uncertainty in Physical Systems) program.

  17. Optimal Assignment of Cells in C-RAN Deployments with Multiple BBU Pools

    DEFF Research Database (Denmark)

    Holm, Henrik; Checko, Aleksandra; Al-obaidi, Rami

    2015-01-01

    recommend to divide the area into multiple BBU Pools. In this paper we show how to optimally assign cells to different BBU Pools in such a scenario. By using Integer Linear Programming (ILP) method we derive engineering guidelines for minimizing the CAPital EXpenditure (CAPEX) of C-RAN deployment....

  18. Western Culture in Japanese Film: Kurosawa's "Throne of Blood" and "Ran."

    Science.gov (United States)

    Kane, Peter E.

    Akira Kurosawa, the most popular Asian film maker with audiences in the United States, has found in William Shakespeare's plays themes and plots that resonate within Japanese culture. While the translations of "Macbeth" into "Throne of Blood" and "King Lear" into "Ran" are quite direct and literal with only…

  19. Analysis of vegetation effect on waves using a vertical 2-D RANS model

    Science.gov (United States)

    A vertical two-dimensional (2-D) model has been applied in the simulation of wave propagation through vegetated water bodies. The model is based on an existing model SOLA-VOF which solves the Reynolds-Averaged Navier-Stokes (RANS) equations with the finite difference method on a staggered rectangula...

  20. Optimizing Cloud-RAN Deployments in Real-life Scenarios Using Microwave Radio

    DEFF Research Database (Denmark)

    Al-obaidi, Rami; Checko, Aleksandra; Holm, Henrik

    2015-01-01

    derive engineering guidelines for minimizing the CAPital EXpenditure (CAPEX) of C-RAN deployment. We show for which population density and span of BBU Pool coverage usage of Microwave Radio (MWR) links is viable. For larger scale deployment we recommend to divide the area into multiple BBU Pools....

  1. Ardo Ran Varres elustab härra Tartüffi / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2005-01-01

    2.-9. septembrini Pärnus, Haapsalus, Tallinnas, Viljandis ja Tartus toimuvast tummfilmi ühe olulisema lavastaja F. W. Murnau "Tartüff" filmikontserdist "Tartüff live", esitaja Varrese ansambel ARV Ensemble. Ardo Ran Varrese töödest

  2. ran Bonde - landsköpman och bondeseglare på 1500-talet / Bengt Eriksson

    Index Scriptorium Estoniae

    Eriksson, Bengt

    2012-01-01

    Üle Soome lahe kaubandusest 16. sajandil. Helsingi kihelkonnas tegutsenud kaupmehest Göran Bondest, kes käis aastas 5-6 korda kaubareisil Tallinnas. Tihedamad suhted sidusid Göran Bondet Tallinna kaupmehe Hemlich Fickega. "Läänemere valitsejast" Sören Norrbyst. Helsingi rajamisest Gustav I Vasa poolt vastukaaluks Tallinnale

  3. RANS Simulations of Aerodynamic Performance of NACA 0015 Flapped Airfoil

    Directory of Open Access Journals (Sweden)

    Sohaib Obeid

    2017-01-01

    Full Text Available An analysis of 2D subsonic flow over an NACA 0015 airfoil with a 30% trailing edge flap at a constant Reynolds number of 106 for various incidence angles and a range of flap deflections is presented. The steady-state governing equations of continuity and momentum conservation are solved combined with the realizable k-ε turbulence model using the ANSYS-Fluent code (Version 13.7, ANSYS, Inc., Canonsburg, PA, USA. The primary objective of the study is to provide a comprehensive understanding of flow characteristics around the NACA 0015 airfoil as a function of the angle of attack and flap deflection at Re = 106 using the realizable k-ε turbulence model. The results are validated through comparison of the predictions with the free field experimental measurements. Consistent with the experimental observations, the numerical results show that increased flap deflections increase the maximum lift coefficient, move the zero-lift angle of attack (AoA to a more negative value, decrease the stall AoA, while the slope of the lift curve remains unchanged and the curve just shifts upwards. In addition, the numerical simulations provide limits for lift increment Δ C l and Cl, max values to be 1.1 and 2.2, respectively, obtained at a flap deflection of 50°. This investigation demonstrates that the realizable k-ε turbulence model is capable of predicting flow features over an airfoil with and without flap deflections with reasonable accuracy.

  4. The Ran GTPase-activating protein (RanGAP1 is critically involved in smooth muscle cell differentiation, proliferation and migration following vascular injury: implications for neointima formation and restenosis.

    Directory of Open Access Journals (Sweden)

    Marc Vorpahl

    Full Text Available Differentiation and dedifferentiation, accompanied by proliferation play a pivotal role for the phenotypic development of vascular proliferative diseases (VPD, such as restenosis. Increasing evidence points to an essential role of regulated nucleoporin expression in the choice between differentiation and proliferation. However, whether components of the Ran GTPase cycle, which is of pivotal importance for both nucleocytoplasmic transport and for mitotic progression, are subject to similar regulation in VPD is currently unknown. Here, we show that differentiation of human coronary artery smooth muscle cell (CASMC to a contractile phenotype by stepwise serum depletion leads to significant reduction of RanGAP1 protein levels. The inverse event, dedifferentiation of cells, was assessed in the rat carotid artery balloon injury model, a well-accepted model for neointima formation and restenosis. As revealed by temporospatial analysis of RanGAP1 expression, neointima formation in rat carotid arteries was associated with a significant upregulation of RanGAP1 expression at 3 and 7 days after balloon injury. Of note, neointimal cells located at the luminal surface revealed persistent RanGAP1 expression, as opposed to cells in deeper layers of the neointima where RanGAP1 expression was less or not detectable at all. To gain first evidence for a direct influence of RanGAP1 levels on differentiation, we reduced RanGAP1 in human coronary artery smooth muscle cells by siRNA. Indeed, downregulation of the essential RanGAP1 protein by 50% induced a differentiated, spindle-like smooth muscle cell phenotype, accompanied by an upregulation of the differentiation marker desmin. Reduction of RanGAP1 levels also resulted in a reduction of mitogen induced cellular migration and proliferation as well as a significant upregulation of the cyclin-dependent kinase inhibitor p27KIP1, without evidence for cellular necrosis. These findings suggest that RanGAP1 plays a critical

  5. The Ran GTPase-activating protein (RanGAP1) is critically involved in smooth muscle cell differentiation, proliferation and migration following vascular injury: implications for neointima formation and restenosis.

    Science.gov (United States)

    Vorpahl, Marc; Schönhofer-Merl, Sabine; Michaelis, Cornelia; Flotho, Annette; Melchior, Frauke; Wessely, Rainer

    2014-01-01

    Differentiation and dedifferentiation, accompanied by proliferation play a pivotal role for the phenotypic development of vascular proliferative diseases (VPD), such as restenosis. Increasing evidence points to an essential role of regulated nucleoporin expression in the choice between differentiation and proliferation. However, whether components of the Ran GTPase cycle, which is of pivotal importance for both nucleocytoplasmic transport and for mitotic progression, are subject to similar regulation in VPD is currently unknown. Here, we show that differentiation of human coronary artery smooth muscle cell (CASMC) to a contractile phenotype by stepwise serum depletion leads to significant reduction of RanGAP1 protein levels. The inverse event, dedifferentiation of cells, was assessed in the rat carotid artery balloon injury model, a well-accepted model for neointima formation and restenosis. As revealed by temporospatial analysis of RanGAP1 expression, neointima formation in rat carotid arteries was associated with a significant upregulation of RanGAP1 expression at 3 and 7 days after balloon injury. Of note, neointimal cells located at the luminal surface revealed persistent RanGAP1 expression, as opposed to cells in deeper layers of the neointima where RanGAP1 expression was less or not detectable at all. To gain first evidence for a direct influence of RanGAP1 levels on differentiation, we reduced RanGAP1 in human coronary artery smooth muscle cells by siRNA. Indeed, downregulation of the essential RanGAP1 protein by 50% induced a differentiated, spindle-like smooth muscle cell phenotype, accompanied by an upregulation of the differentiation marker desmin. Reduction of RanGAP1 levels also resulted in a reduction of mitogen induced cellular migration and proliferation as well as a significant upregulation of the cyclin-dependent kinase inhibitor p27KIP1, without evidence for cellular necrosis. These findings suggest that RanGAP1 plays a critical role in smooth

  6. Evaluating C-RAN Fronthaul Functional Splits in Terms of Network Level Energy and Cost Savings

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Popovska Avramova, Andrijana; Berger, Michael Stübert

    2016-01-01

    split in the baseband processing chain has been proposed to overcome these challenges. This paper evaluates, by mathematical and simulation methods, different splits with respect to network level energy and cost efficiency having in the mind the expected quality of service.The proposed mathematical......The placement of the complete baseband processing in a centralized pool results in high data rate requirement and inflexibility of the fronthaul network, which challenges the energy and cost effectiveness of the cloud radio access network (C-RAN). Recently, redesign of the C-RAN through functional...... model quantifies the multiplexing gains and the trade-offs between centralization and decentralization concerning the cost of the pool, fronthaul network capacity and resource utilization. The event-based simulation captures the influence of the traffic load dynamics and traffic type variation...

  7. Assessment of 3D-RANS models for the simulation of topographically forced shallow flows

    Directory of Open Access Journals (Sweden)

    Safarzadeh Akbar

    2016-03-01

    Full Text Available In this work the performance of Reynolds Averaged Navier-Stokes (RANS simulations to predict the flow structure developed by the presence of a sidewall obstacle in a uniform open-channel shallow flow is discussed. The tested geometry was selected due to its important role in several fluvial applications, such as the control of riverbank erosion and the creation of improved ecological conditions in river restoration applications. The results are compared against experimental laboratory velocity fields obtained after Large Scale Particle Image Velocimetry (LSPIV measurements. It is shown that the length of reattachment of the separated shear layer generated by the obstacle is well predicted by a Reynolds Stress Model, while classical two-equation models show important limitations. All the performed RANS simulations are unable to properly predict the formation of a secondary gyre region, which develops immediately downstream the obstacle.

  8. Enhancing LTE with Cloud-RAN and Load-Controlled Parasitic Antenna Arrays

    DEFF Research Database (Denmark)

    Artuso, Matteo; Boviz, Dora; Checko, Aleksandra

    2016-01-01

    implementations of C-RANs tackle fundamental technical and economic challenges. In this article, we present an end-to-end solution for practically implementable C-RANs by providing innovative solutions to key issues such as the design of cost-effective hardware and power-effective signals for RRHs, efficient...... design and distribution of data and control traffic for coordinated communications, and conception of a flexible and elastic architecture supporting dynamic allocation of both the densely distributed RRHs and the centralized processing resources in the cloud to create virtual base stations. More...... specifically, we propose a novel antenna array architecture called load-controlled parasitic antenna array (LCPAA) where multiple antennas are fed by a single RF chain. Energy- and spectral-efficient modulation as well as signaling schemes that are easy to implement are also provided. Additionally, the design...

  9. On the use of (U)RANS and LES approaches for turbulent incompressible single phase flows in nuclear engineering applications

    Energy Technology Data Exchange (ETDEWEB)

    Benhamadouche, Sofiane, E-mail: sofiane.benhamadouche@edf.fr

    2017-02-15

    Highlights: • The paper deals with the use of (U)RANS and LES in nuclear engineering applications. • It gives some ideas and guidelines to run high quality computations. • Some perspectives are drawn concerning the development of (U)RANS and LES approaches in the future. - Abstract: The present paper gives some ideas and guidelines in order to run high quality (U)RANS or LES computations. The paper starts with (U)RANS approaches, advocating the use of Reynolds Stress Models for complex flows and recommending further work on modeling of turbulent heat fluxes, which remains today too basic in industry. The superiority of wall-resolved models vs. wall-modeled in RANS is recalled and the use of adaptive wall treatment is suggested. The concept of Unsteady RANS is finally questioned. Then, important issues around LES are raised. The mesh refinement criteria are recalled for wall-resolved LES and the use of wall models addressed. The production of DNS and wall-resolved LES calculations for flow understanding and RANS validation is encouraged.

  10. Computing the flow past Vortex Generators: Comparison between RANS Simulations and Experiments

    Science.gov (United States)

    Manolesos, M.; Sørensen, N. N.; Troldborg, N.; Florentie, L.; Papadakis, G.; Voutsinas, S.

    2016-09-01

    The flow around a wind turbine airfoil equipped with Vortex Generators (VGs) is examined. Predictions from three different Reynolds Averaged Navier Stokes (RANS) solvers with two different turbulence models and two different VG modelling approaches are compared between them and with experimental data. The best results are obtained with the more expensive fully resolved VG approach. The cost efficient BAY model can also provide acceptable results, if grid related numerical diffusion is minimized and only force coefficient polars are considered.

  11. Propeller Analysis Using RANS/BEM Coupling Accounting for Blade Blockage

    Science.gov (United States)

    2015-07-04

    2000 and 2010 Gothenburg and 2005 Tokyo workshops on numerical ship hydrodynamics (Larrson et al., 2002, Larsson et al. 2013, Hino 2005). The KCS is...Workshop on Numerical Ship Hydrodynamics, Chalmers University of Technology. Larsson , L., Stern, F. and Visonneau, M. (eds.), (2013). Numerical ...B2Y 3Z7 ABSTRACT A popular method for analyzing a propeller operating behind a ship is to couple a Reynolds-averaged Navier- Stokes (RANS) solution

  12. RANS/CAA based Prediction of Jet Mixing Noise in Cruise Flight

    OpenAIRE

    Appel, Christina; Rossignol, Karl-Stéphane; Klabes, Alexander; Neifeld, Andrej; Herr, Michaela; Ewert, Roland

    2014-01-01

    Besides turbulent boundary layer induced excitation noise, jet noise is the second most important aeroacoustic source for aircraft cabin noise. A goal within the DLR project ECCO (Enhanced Cabin Comfort Computations) was to improve current cabin noise pre- diction approaches. Within the framework of the project ECCO RANS (Reynolds Averaged Navier Stokes) and CAA (Computational Aero Acoustics) computations for jet noise at cruise conditions have been carried out. Especially at h...

  13. Application of Les, Pans and Rans to a Case of Intake Channel Steady Flow Test Bench

    Directory of Open Access Journals (Sweden)

    Vítek Oldřich

    2015-12-01

    Full Text Available The paper deals with evaluation of intake channel flow properties (discharge coefficient, tumble and swirl ratio using both 3-D CFD simulation and measurement. Sensitivity of different calculation parameters was tested. The most important ones are mesh parameters and applied turbulence models (considered models: LES, PANS and RANS. Concerning the mesh, the critical parameter is a mesh configuration near a wall - a thickness of mesh boundary layer and an amount of these layers have significant impact on mass flow rate while tumble/swirl ratio is unaffected by that. Based on that, these mesh parameters can be considered as tuning constants for fine-tuning the CFD model. Regarding the mesh cell size, 2 different values were tested (0.6 and 0.3 mm. It was found out that neither mesh is fine enough to perform proper LES. Hence, PANS performance is close to RANS. Concerning the turbulence models, PANS seems to be the best one as it combines advantages of both LES and RANS. Generally speaking, mass flow rate prediction is relatively good while swirl/tumble one is more problematic as only qualitative agreement can be achieved.

  14. Accurate load prediction by BEM with airfoil data from 3D RANS simulations

    Science.gov (United States)

    Schneider, Marc S.; Nitzsche, Jens; Hennings, Holger

    2016-09-01

    In this paper, two methods for the extraction of airfoil coefficients from 3D CFD simulations of a wind turbine rotor are investigated, and these coefficients are used to improve the load prediction of a BEM code. The coefficients are extracted from a number of steady RANS simulations, using either averaging of velocities in annular sections, or an inverse BEM approach for determination of the induction factors in the rotor plane. It is shown that these 3D rotor polars are able to capture the rotational augmentation at the inner part of the blade as well as the load reduction by 3D effects close to the blade tip. They are used as input to a simple BEM code and the results of this BEM with 3D rotor polars are compared to the predictions of BEM with 2D airfoil coefficients plus common empirical corrections for stall delay and tip loss. While BEM with 2D airfoil coefficients produces a very different radial distribution of loads than the RANS simulation, the BEM with 3D rotor polars manages to reproduce the loads from RANS very accurately for a variety of load cases, as long as the blade pitch angle is not too different from the cases from which the polars were extracted.

  15. Data-free and data-driven spectral perturbations for RANS UQ

    Science.gov (United States)

    Edeling, Wouter; Mishra, Aashwin; Iaccarino, Gianluca

    2017-11-01

    Despite recent developments in high-fidelity turbulent flow simulations, RANS modeling is still vastly used by industry, due to its inherent low cost. Since accuracy is a concern in RANS modeling, model-form UQ is an essential tool for assessing the impacts of this uncertainty on quantities of interest. Applying the spectral decomposition to the modeled Reynolds-Stress Tensor (RST) allows for the introduction of decoupled perturbations into the baseline intensity (kinetic energy), shape (eigenvalues), and orientation (eigenvectors). This constitutes a natural methodology to evaluate the model form uncertainty associated to different aspects of RST modeling. In a predictive setting, one frequently encounters an absence of any relevant reference data. To make data-free predictions with quantified uncertainty we employ physical bounds to a-priori define maximum spectral perturbations. When propagated, these perturbations yield intervals of engineering utility. High-fidelity data opens up the possibility of inferring a distribution of uncertainty, by means of various data-driven machine-learning techniques. We will demonstrate our framework on a number of flow problems where RANS models are prone to failure. This research was partially supported by the Defense Advanced Research Projects Agency under the Enabling Quantification of Uncertainty in Physical Systems (EQUiPS) project (technical monitor: Dr Fariba Fahroo), and the DOE PSAAP-II program.

  16. Nuclear size is sensitive to NTF2 protein levels in a manner dependent on Ran binding

    Science.gov (United States)

    Vuković, Lidija D.; Jevtić, Predrag; Zhang, Zhaojie; Stohr, Bradley A.; Levy, Daniel L.

    2016-01-01

    ABSTRACT Altered nuclear size is associated with many cancers, and determining whether cancer-associated changes in nuclear size contribute to carcinogenesis necessitates an understanding of mechanisms of nuclear size regulation. Although nuclear import rates generally positively correlate with nuclear size, NTF2 levels negatively affect nuclear size, despite the role of NTF2 (also known as NUTF2) in nuclear recycling of the import factor Ran. We show that binding of Ran to NTF2 is required for NTF2 to inhibit nuclear expansion and import of large cargo molecules in Xenopus laevis egg and embryo extracts, consistent with our observation that NTF2 reduces the diameter of the nuclear pore complex (NPC) in a Ran-binding-dependent manner. Furthermore, we demonstrate that ectopic NTF2 expression in Xenopus embryos and mammalian tissue culture cells alters nuclear size. Finally, we show that increases in nuclear size during melanoma progression correlate with reduced NTF2 expression, and increasing NTF2 levels in melanoma cells is sufficient to reduce nuclear size. These results show a conserved capacity for NTF2 to impact on nuclear size, and we propose that NTF2 might be a new cancer biomarker. PMID:26823604

  17. Nercc1, a mammalian NIMA-family kinase, binds the Ran GTPase and regulates mitotic progression.

    Science.gov (United States)

    Roig, Joan; Mikhailov, Alexei; Belham, Christopher; Avruch, Joseph

    2002-07-01

    The protein kinase NIMA is an indispensable pleiotropic regulator of mitotic progression in Aspergillus. Although several mammalian NIMA-like kinases (Neks) are known, none appears to have the broad importance for mitotic regulation attributed to NIMA. Nercc1 is a new NIMA-like kinase that regulates chromosome alignment and segregation in mitosis. Its NIMA-like catalytic domain is followed by a noncatalytic tail containing seven repeats homologous to those of the Ran GEF, RCC1, a Ser/Thr/Pro-rich segment, and a coiled-coil domain. Nercc1 binds to another NIMA-like kinase, Nek6, and also binds specifically to the Ran GTPase through both its catalytic and its RCC1-like domains, preferring RanGDP in vivo. Nercc1 exists as a homooligomer and can autoactivate in vitro by autophosphorylation. Nercc1 is a cytoplasmic protein that is activated during mitosis and is avidly phosphorylated by active p34(Cdc2). Microinjection of anti-Nercc1 antibodies in prophase results in spindle abnormalities and/or chromosomal misalignment. In Ptk2 cells the outcome is prometaphase arrest or aberrant chromosome segregation and aneuploidy, whereas in CFPAC-1 cells prolonged arrest in prometaphase is the usual response. Nercc1 and its partner Nek6 represent a new signaling pathway that regulates mitotic progression.

  18. Unsteady Three-Dimensional Simulation of a Shear Coaxial GO2/GH2 Rocket Injector with RANS and Hybrid-RAN-LES/DES Using Flamelet Models

    Science.gov (United States)

    Westra, Doug G.; West, Jeffrey S.; Richardson, Brian R.

    2015-01-01

    Historically, the analysis and design of liquid rocket engines (LREs) has relied on full-scale testing and one-dimensional empirical tools. The testing is extremely expensive and the one-dimensional tools are not designed to capture the highly complex, and multi-dimensional features that are inherent to LREs. Recent advances in computational fluid dynamics (CFD) tools have made it possible to predict liquid rocket engine performance, stability, to assess the effect of complex flow features, and to evaluate injector-driven thermal environments, to mitigate the cost of testing. Extensive efforts to verify and validate these CFD tools have been conducted, to provide confidence for using them during the design cycle. Previous validation efforts have documented comparisons of predicted heat flux thermal environments with test data for a single element gaseous oxygen (GO2) and gaseous hydrogen (GH2) injector. The most notable validation effort was a comprehensive validation effort conducted by Tucker et al. [1], in which a number of different groups modeled a GO2/GH2 single element configuration by Pal et al [2]. The tools used for this validation comparison employed a range of algorithms, from both steady and unsteady Reynolds Averaged Navier-Stokes (U/RANS) calculations, large-eddy simulations (LES), detached eddy simulations (DES), and various combinations. A more recent effort by Thakur et al. [3] focused on using a state-of-the-art CFD simulation tool, Loci/STREAM, on a two-dimensional grid. Loci/STREAM was chosen because it has a unique, very efficient flamelet parameterization of combustion reactions that are too computationally expensive to simulate with conventional finite-rate chemistry calculations. The current effort focuses on further advancement of validation efforts, again using the Loci/STREAM tool with the flamelet parameterization, but this time with a three-dimensional grid. Comparisons to the Pal et al. heat flux data will be made for both RANS and

  19. Nuclear-cytoplasmic trafficking of NTF2, the nuclear import receptor for the RanGTPase, is subjected to regulation

    National Research Council Canada - National Science Library

    Chafe, Shawn C; Pierce, Jacqueline B; Mangroo, Dev

    2012-01-01

    .... Treatment of mammalian cells with polysorbitan monolaurate was found to inhibit nuclear export of tRNA and proteins, which are processes dependent on RanGTP in the nucleus, but not nuclear import...

  20. Beyond Rab GTPases Legionella activates the small GTPase Ran to promote microtubule polymerization, pathogen vacuole motility, and infection.

    Science.gov (United States)

    Hilbi, Hubert; Rothmeier, Eva; Hoffmann, Christine; Harrison, Christopher F

    2014-01-01

    Legionella spp. are amoebae-resistant environmental bacteria that replicate in free-living protozoa in a distinct compartment, the Legionella-containing vacuole (LCV). Upon transmission of Legionella pneumophila to the lung, the pathogens employ an evolutionarily conserved mechanism to grow in LCVs within alveolar macrophages, thus triggering a severe pneumonia termed Legionnaires' disease. LCV formation is a complex and robust process, which requires the bacterial Icm/Dot type IV secretion system and involves the amazing number of 300 different translocated effector proteins. LCVs interact with the host cell's endosomal and secretory vesicle trafficking pathway. Accordingly, in a proteomics approach as many as 12 small Rab GTPases implicated in endosomal and secretory vesicle trafficking were identified and validated as LCV components. Moreover, the small GTPase Ran and its effector protein RanBP1 have been found to decorate the pathogen vacuole. Ran regulates nucleo-cytoplasmic transport, spindle assembly, and cytokinesis, as well as the organization of non-centrosomal microtubules. In L. pneumophila-infected amoebae or macrophages, Ran and RanBP1 localize to LCVs, and the small GTPase is activated by the Icm/Dot substrate LegG1. Ran activation by LegG1 leads to microtubule stabilization and promotes intracellular pathogen vacuole motility and bacterial growth, as well as chemotaxis and migration of Legionella-infected cells.

  1. The nucleoporin MEL-28 promotes RanGTP-dependent γ-tubulin recruitment and microtubule nucleation in mitotic spindle formation.

    Science.gov (United States)

    Yokoyama, Hideki; Koch, Birgit; Walczak, Rudolf; Ciray-Duygu, Fulya; González-Sánchez, Juan Carlos; Devos, Damien P; Mattaj, Iain W; Gruss, Oliver J

    2014-01-01

    The GTP-bound form of the Ran GTPase (RanGTP), produced around chromosomes, drives nuclear envelope and nuclear pore complex (NPC) re-assembly after mitosis. The nucleoporin MEL-28/ELYS binds chromatin in a RanGTP-regulated manner and acts to seed NPC assembly. Here we show that, upon mitotic NPC disassembly, MEL-28 dissociates from chromatin and re-localizes to spindle microtubules and kinetochores. MEL-28 directly binds microtubules in a RanGTP-regulated way via its C-terminal chromatin-binding domain. Using Xenopus egg extracts, we demonstrate that MEL-28 is essential for RanGTP-dependent microtubule nucleation and spindle assembly, independent of its function in NPC assembly. Specifically, MEL-28 interacts with the γ-tubulin ring complex and recruits it to microtubule nucleation sites. Our data identify MEL-28 as a RanGTP target that functions throughout the cell cycle. Its cell cycle-dependent binding to chromatin or microtubules discriminates MEL-28 functions in interphase and mitosis, and ensures that spindle assembly occurs only after NPC breakdown.

  2. Ivan Rančić: A forgotten painter of flowers and landscapes

    Directory of Open Access Journals (Sweden)

    Marković Kamenko M.

    2014-01-01

    Full Text Available Ivan Rančić was born in the Kraljevo village, in eastern Serbia to a family of farmers on 19th, February, 1906. Very little data about him has been preserved, therefore, this paper is an attempt to make a reconstruction of his life and work. He attended primary school in his birth place, lower secondary school he finished in Knjazevac and Military Academy in Belgrade. After completing the National Academy in 1934, he was sent to Zagreb where he got his first post. He lived there with his wife and his son until the capitulation of the country in 1941. A few months after the collapse of the country, he was arrested and sent to Ljubljana and three months later to a concentration camp in Austria. He spent about fifteen months in that camp in during which time he intensively studied painting. He fled from the camp to Switzerland and stayed there until his death in 1987. According to some letters he sent to his wife in Nis, some of his paintings he created during his time in the camp, ne took to Switzerland where he eventually sold them. He did the toughest jobs there in order to survive and painted extensively. After World War II he graduated from the School of Fine Arts in Lausanne. Later on he had two exhibitions at the New Gallery of Modern Art. Ivan Rančić came a long way from an unknown beginner to a respected prominent artist. He left behind about 350 works, many of which he sold during his life, mainly landscapes and still life in oil, watercolor and pastel. He was neither concerned about styles and trends nor did he believe in the old and the new. If he came to a certain specific manner of painting, it is because at one point it was imposed on him as the only proper way of expression. The analysis of Rančić's paintings leads to the conclusion that his creation had gone through four phases. The first one (started in the concentration camp in Austria during which he painted still lifes without full sketches, previous studies, and the use

  3. İRAN VE REJİM İSTİKRARI

    Directory of Open Access Journals (Sweden)

    Özgür ÜŞENMEZ

    2015-07-01

    Full Text Available ÖZ: Bu çalışma, İran rejiminin son yıllarda Orta Doğu'yu sarsan isyanlar ve istikrarsızlıklara-Batı'daki beklentilerin aksine- geçmişten, özellikle 1979'daki devrimden miras kalan sosyal yapı ve politikaların etkisiyle direnebildiğini iddia ediyor. Tunus ve Mısır'daki halk isyanları, temel aktör olan alt sınıflar ve onların neo-liberal ekonomik politikalara muhalefetiyle yayılırken, İran’da devrim sonrası gelişen sosyal devlet mekanizması hala halk ile rejimin tamamen birbirine yabancılaşmasını önlemekte. Ancak son yıllarda ortaya çıkan yeni gerilimler ve İran'ın uyguladığı ekonomi politikaları rejimin krizini derinleştirebilir. Bu nedenledir ki Orta Doğu'yu ve özelde İran'ı anlamak için hegemonik blokların tarihsel değişimini inceleyen ucu açık bir analiz elzemdir. ABSTRACT: This article argues that contrary to the expectations of the Western World, Iranian regime successfully resisted the revolutionary tides of the Arab Spring. Most important determinant of this process for Iran was the legacy of the 1979 revolution and it's associated structures that relatively protects the most vulnerable parts of the population against the wide spread neo-liberal economic policies in the Middle East. So with that feature Iran differs from the Tunisian and the Egyptian examples. In order to understand these features further this essay adapts a historical analysis of changes in hegemonic blocs in Iran since 1979.

  4. OTN Transport of Baseband Radio Serial Protocols in C-RAN Architecture for Mobile Network Applications

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Kardaras, Georgios; Lanzani, Christian Fabio Alessandro

    This white paper presents a proof of concept implementation of digital baseband radio data transport over Optical Transport Network (OTN) compliant to 3GPP Long Term Evolution – Advanced (LTE-A) standard enabling Cloud Radio Access Network (C-RAN) architecture. The transport between the baseband...... module and a remote radio module is compliant to Common Public Radio Interface (CPRI) and to the OBSAI reference point 3 - 01 (RP3-01) interface protocols, respectively. The purpose is to demonstrate that data integrity and clocking performance at the radio node still meets the strict standard...

  5. Investigation on hydrodynamic performance of a marine propeller in oblique flow by RANS computations

    Directory of Open Access Journals (Sweden)

    Jianxi Yao

    2015-01-01

    Full Text Available This paper presents a numerical study on investigating on hydrodynamic characteristics of a marine propeller in oblique flow. The study is achieved by RANS simulations on an open source platform - OpenFOAM. A sliding grid approach is applied to compute the rotating motion of the propeller. Total force and moment acting on blades, as well as average force distributions in one revolution on propeller disk, are obtained for 70 cases of com- binations of advance ratios and oblique angles. The computed results are compared with available experimental data and discussed.

  6. Hybrid RANS/LES method for wind flow over complex terrain

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Sørensen, Niels N.

    2010-01-01

    ), and this layer acts as wall model for the outer flow handled by LES. The well-known high Reynolds number two-equation k - turbulence model is used in the RANS layer and the model automatically switches to a two-equation k - subgrid scale stress model in the LES region. The approach can be used for flow over...... the turbulent kinetic energy, whereas the new method captures the high turbulence levels well but underestimates the mean velocity. The presented results are for a relative mild configuration of complex terrain, but the proposed method can also be used for highly complex terrain where the benefits of the new...

  7. Statistical Multiplexing of Computations in C-RAN with Tradeoffs in Latency and Energy

    DEFF Research Database (Denmark)

    Kalør, Anders Ellersgaard; Agurto Agurto, Mauricio Ignacio; Pratas, Nuno

    2017-01-01

    In the Cloud Radio Access Network (C-RAN) architecture, the baseband signals from multiple remote radio heads are processed in a centralized baseband unit (BBU) pool. This architecture allows network operators to adapt the BBU’s computational resources to the aggregate access load experienced...... frame duration, then this may result in additional access latency and limit the energy savings. In this paper we investigate the tradeoff by considering two extreme time-scales for the resource multiplexing: (i) long-term, where the computational resources are adapted over periods much larger than...

  8. Synchronization challenges in packet-based Cloud-RAN fronthaul for mobile networks

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Juul, Anders Christian; Christiansen, Henrik Lehrmann

    2015-01-01

    In this paper, we look at reusing existing packet-based network (e.g. Ethernet) to possibly decrease deployment costs of fronthaul Cloud Radio Access Network (C-RAN) network and cost of Baseband Unit (BBU) resources. The challenge of this solution is that it requires mobile traffic (until now...... transmitted over synchronous protocols) to traverse the asynchronous Ethernet without losing synchronization. We analyze synchronization requirements of mobile networks and present an overview of solutions that fulfill them in traditional mobile networks. Then we elaborate on challenges that packet...... bridge the gap between Ethernet and mobile network domains creating a comprehensive architectural analysis....

  9. Ran Involved in the Development and Reproduction Is a Potential Target for RNA-Interference-Based Pest Management in Nilaparvata lugens.

    Directory of Open Access Journals (Sweden)

    Kai-Long Li

    Full Text Available Ran (RanGTPase in insects participates in the 20-hydroxyecdysone signal transduction pathway in which downstream genes, FTZ-F1, Krüppel-homolog 1 (Kr-h1 and vitellogenin, are involved. A putative Ran gene (NlRan was cloned from Nilaparvata lugens, a destructive phloem-feeding pest of rice. NlRan has the typical Ran primary structure features that are conserved in insects. NlRan showed higher mRNA abundance immediately after molting and peaked in newly emerged female adults. Among the examined tissues ovary had the highest transcript level, followed by fat body, midgut and integument, and legs. Three days after dsNlRan injection the NlRan mRNA abundance in the third-, fourth-, and fifth-instar nymphs was decreased by 94.3%, 98.4% and 97.0%, respectively. NlFTZ-F1 expression levels in treated third- and fourth-instar nymphs were reduced by 89.3% and 23.8%, respectively. In contrast, NlKr-h1 mRNA levels were up-regulated by 67.5 and 1.5 folds, respectively. NlRan knockdown significantly decreased the body weights, delayed development, and killed >85% of the nymphs at day seven. Two apparent phenotypic defects were observed: (1 Extended body form, and failed to molt; (2 The cuticle at the notum was split open but cannot completely shed off. The newly emerged female adults from dsNlRan injected fifth-instar nymphs showed lower levels of NlRan and vitellogenin, lower weight gain and honeydew excretion comparing with the blank control, and no offspring. Those results suggest that NlRan encodes a functional protein that was involved in development and reproduction. The study established proof of concept that NlRan could serve as a target for dsRNA-based pesticides for N. lugens control.

  10. Canoe binds RanGTP to promote PinsTPR/Mud-mediated spindle orientation

    Science.gov (United States)

    Wee, Brett; Johnston, Christopher A.

    2011-01-01

    Regulated spindle orientation maintains epithelial tissue integrity and stem cell asymmetric cell division. In Drosophila melanogaster neural stem cells (neuroblasts), the scaffolding protein Canoe (Afadin/Af-6 in mammals) regulates spindle orientation, but its protein interaction partners and mechanism of action are unknown. In this paper, we use our recently developed induced cell polarity system to dissect the molecular mechanism of Canoe-mediated spindle orientation. We show that a previously uncharacterized portion of Canoe directly binds the Partner of Inscuteable (Pins) tetratricopeptide repeat (TPR) domain. The Canoe–PinsTPR interaction recruits Canoe to the cell cortex and is required for activation of the PinsTPR-Mud (nuclear mitotic apparatus in mammals) spindle orientation pathway. We show that the Canoe Ras-association (RA) domains directly bind RanGTP and that both the CanoeRA domains and RanGTP are required to recruit Mud to the cortex and activate the Pins/Mud/dynein spindle orientation pathway. PMID:22024168

  11. Comparisons of LES and RANS Computations with PIV Experiments on a Cylindrical Cavity Flow

    Directory of Open Access Journals (Sweden)

    Wen-Tao Su

    2013-01-01

    Full Text Available A comparison study on the numerical computations by large eddy simulation (LES and Reynolds-averaged Navier-Stokes (RANS methods with experiment on a cylindrical cavity flow was conducted in this paper. Numerical simulations and particle image velocimetry (PIV measurement were performed for two Reynolds numbers of the flow at a constant aspect ratio of H/R = 2.4 (R is the radius of the cylindrical cavity, and H is liquid level. The three components of velocity were extracted from 100 sequential PIV measured velocity frames with averaging, in order to illustrate the axial jet flow evolution and circulation distribution in the radial direction. The results show that LES can reproduce well the fine structure inside the swirling motions in both the meridional and the horizontal planes, as well as the distributions of velocity components and the circulation, in good agreement with experimental results, while the RANS method only provided a rough trend of inside vortex structure. Based on the analysis of velocity profiles at various locations, it indicates that LES is more suitable for predicting the complex flow characteristics inside complicated three-dimensional geometries.

  12. Validation of Heat Transfer and Film Cooling Capabilities of the 3-D RANS Code TURBO

    Science.gov (United States)

    Shyam, Vikram; Ameri, Ali; Chen, Jen-Ping

    2010-01-01

    The capabilities of the 3-D unsteady RANS code TURBO have been extended to include heat transfer and film cooling applications. The results of simulations performed with the modified code are compared to experiment and to theory, where applicable. Wilcox s k-turbulence model has been implemented to close the RANS equations. Two simulations are conducted: (1) flow over a flat plate and (2) flow over an adiabatic flat plate cooled by one hole inclined at 35 to the free stream. For (1) agreement with theory is found to be excellent for heat transfer, represented by local Nusselt number, and quite good for momentum, as represented by the local skin friction coefficient. This report compares the local skin friction coefficients and Nusselt numbers on a flat plate obtained using Wilcox's k-model with the theory of Blasius. The study looks at laminar and turbulent flows over an adiabatic flat plate and over an isothermal flat plate for two different wall temperatures. It is shown that TURBO is able to accurately predict heat transfer on a flat plate. For (2) TURBO shows good qualitative agreement with film cooling experiments performed on a flat plate with one cooling hole. Quantitatively, film effectiveness is under predicted downstream of the hole.

  13. Development of a Hybrid RANS/LES Method for Turbulent Mixing Layers

    Science.gov (United States)

    Georgiadis, Nicholas J.; Alexander, J. Iwan D.; Reshotko, Eli

    2001-01-01

    Significant research has been underway for several years in NASA Glenn Research Center's nozzle branch to develop advanced computational methods for simulating turbulent flows in exhaust nozzles. The primary efforts of this research have concentrated on improving our ability to calculate the turbulent mixing layers that dominate flows both in the exhaust systems of modern-day aircraft and in those of hypersonic vehicles under development. As part of these efforts, a hybrid numerical method was recently developed to simulate such turbulent mixing layers. The method developed here is intended for configurations in which a dominant structural feature provides an unsteady mechanism to drive the turbulent development in the mixing layer. Interest in Large Eddy Simulation (LES) methods have increased in recent years, but applying an LES method to calculate the wide range of turbulent scales from small eddies in the wall-bounded regions to large eddies in the mixing region is not yet possible with current computers. As a result, the hybrid method developed here uses a Reynolds-averaged Navier-Stokes (RANS) procedure to calculate wall-bounded regions entering a mixing section and uses a LES procedure to calculate the mixing-dominated regions. A numerical technique was developed to enable the use of the hybrid RANS-LES method on stretched, non-Cartesian grids. With this technique, closure for the RANS equations is obtained by using the Cebeci-Smith algebraic turbulence model in conjunction with the wall-function approach of Ota and Goldberg. The LES equations are closed using the Smagorinsky subgrid scale model. Although the function of the Cebeci-Smith model to replace all of the turbulent stresses is quite different from that of the Smagorinsky subgrid model, which only replaces the small subgrid turbulent stresses, both are eddy viscosity models and both are derived at least in part from mixing-length theory. The similar formulation of these two models enables the RANS

  14. Ran GTPase-activating protein 1 is a therapeutic target in diffuse large B-cell lymphoma.

    Directory of Open Access Journals (Sweden)

    Kung-Chao Chang

    Full Text Available Lymphoma-specific biomarkers contribute to therapeutic strategies and the study of tumorigenesis. Diffuse large B-cell lymphoma (DLBCL is the most common type of malignant lymphoma. However, only 50% of patients experience long-term survival after current treatment; therefore, developing novel therapeutic strategies is warranted. Comparative proteomic analysis of two DLBCL lines with a B-lymphoblastoid cell line (LCL showed differential expression of Ran GTPase-activating protein 1 (RanGAP1 between them, which was confirmed using immunoblotting. Immunostaining showed that the majority of DLBCLs (92%, 46/50 were RanGAP1(+, while reactive lymphoid hyperplasia (n = 12 was RanGAP1(+ predominantly in germinal centers. RanGAP1 was also highly expressed in other B-cell lymphomas (BCL, n = 180 with brisk mitotic activity (B-lymphoblastic lymphoma/leukemia: 93%, and Burkitt lymphoma: 95% or cell-cycle dysregulation (mantle cell lymphoma: 83%, and Hodgkin's lymphoma 91%. Interestingly, serum RanGAP1 level was higher in patients with high-grade BCL (1.71 ± 2.28 ng/mL, n = 62 than in low-grade BCL (0.75 ± 2.12 ng/mL, n = 52 and healthy controls (0.55 ± 1.58 ng/mL, n = 75 (high-grade BCL vs. low-grade BCL, p = 0.002; high-grade BCL vs. control, p < 0.001, Mann-Whitney U test. In vitro, RNA interference of RanGAP1 showed no effect on LCL but enhanced DLBCL cell death (41% vs. 60%; p = 0.035 and cell-cycle arrest (G0/G1: 39% vs. 49%, G2/M: 19.0% vs. 7.5%; p = 0.030 along with decreased expression of TPX2 and Aurora kinases, the central regulators of mitotic cell division. Furthermore, ON 01910.Na (Estybon, a multikinase inhibitor induced cell death, mitotic cell arrest, and hyperphosphorylation of RanGAP1 in DLBCL cell lines but no effects in normal B and T cells. Therefore, RanGAP1 is a promising marker and therapeutic target for aggressive B-cell lymphoma, especially DLBCL.

  15. Nuclear-cytoplasmic trafficking of NTF2, the nuclear import receptor for the RanGTPase, is subjected to regulation.

    Directory of Open Access Journals (Sweden)

    Shawn C Chafe

    Full Text Available NTF2 is a cytosolic protein responsible for nuclear import of Ran, a small Ras-like GTPase involved in a number of critical cellular processes, including cell cycle regulation, chromatin organization during mitosis, reformation of the nuclear envelope following mitosis, and controlling the directionality of nucleocytoplasmic transport. Herein, we provide evidence for the first time that translocation of the mammalian NTF2 from the nucleus to the cytoplasm to collect Ran in the GDP form is subjected to regulation. Treatment of mammalian cells with polysorbitan monolaurate was found to inhibit nuclear export of tRNA and proteins, which are processes dependent on RanGTP in the nucleus, but not nuclear import of proteins. Inhibition of the export processes by polysorbitan monolaurate is specific and reversible, and is caused by accumulation of Ran in the cytoplasm because of a block in translocation of NTF2 to the cytoplasm. Nuclear import of Ran and the nuclear export processes are restored in polysorbitan monolaurate treated cells overproducing NTF2. Moreover, increased phosphorylation of a phospho-tyrosine protein and several phospho-threonine proteins was observed in polysorbitan monolaurate treated cells. Collectively, these findings suggest that nucleocytoplasmic translocation of NTF2 is regulated in mammalian cells, and may involve a tyrosine and/or threonine kinase-dependent signal transduction mechanism(s.

  16. Comprehensive Approaches to Multiphase Flows in Geophysics - Application to nonisothermal, nonhomogenous, unsteady, large-scale, turbulent dusty clouds I. Hydrodynamic and Thermodynamic RANS and LES Models

    Energy Technology Data Exchange (ETDEWEB)

    S. Dartevelle

    2005-09-05

    The objective of this manuscript is to fully derive a geophysical multiphase model able to ''accommodate'' different multiphase turbulence approaches; viz., the Reynolds Averaged Navier-Stokes (RANS), the Large Eddy Simulation (LES), or hybrid RANSLES. This manuscript is the first part of a larger geophysical multiphase project--lead by LANL--that aims to develop comprehensive modeling tools for large-scale, atmospheric, transient-buoyancy dusty jets and plume (e.g., plinian clouds, nuclear ''mushrooms'', ''supercell'' forest fire plumes) and for boundary-dominated geophysical multiphase gravity currents (e.g., dusty surges, diluted pyroclastic flows, dusty gravity currents in street canyons). LES is a partially deterministic approach constructed on either a spatial- or a temporal-separation between the large and small scales of the flow, whereas RANS is an entirely probabilistic approach constructed on a statistical separation between an ensemble-averaged mean and higher-order statistical moments (the so-called ''fluctuating parts''). Within this specific multiphase context, both turbulence approaches are built up upon the same phasic binary-valued ''function of presence''. This function of presence formally describes the occurrence--or not--of any phase at a given position and time and, therefore, allows to derive the same basic multiphase Navier-Stokes model for either the RANS or the LES frameworks. The only differences between these turbulence frameworks are the closures for the various ''turbulence'' terms involving the unknown variables from the fluctuating (RANS) or from the subgrid (LES) parts. Even though the hydrodynamic and thermodynamic models for RANS and LES have the same set of Partial Differential Equations, the physical interpretations of these PDEs cannot be the same, i.e., RANS models an averaged field, while LES simulates a

  17. Physics-Informed Machine Learning for Predictive Turbulence Modeling: Using Data to Improve RANS Modeled Reynolds Stresses

    CERN Document Server

    Wang, Jian-Xun; Xiao, Heng

    2016-01-01

    Turbulence modeling is a critical component in numerical simulations of industrial flows based on Reynolds-averaged Navier-Stokes (RANS) equations. However, after decades of efforts in the turbulence modeling community, universally applicable RANS models with predictive capabilities are still lacking. Recently, data-driven methods have been proposed as a promising alternative to the traditional approaches of turbulence model development. In this work we propose a data-driven, physics-informed machine learning approach for predicting discrepancies in RANS modeled Reynolds stresses. The discrepancies are formulated as functions of the mean flow features. By using a modern machine learning technique based on random forests, the discrepancy functions are first trained with benchmark flow data and then used to predict Reynolds stresses discrepancies in new flows. The method is used to predict the Reynolds stresses in the flow over periodic hills by using two training flow scenarios of increasing difficulties: (1) ...

  18. GTPase Ran strongly accumulates at the kinetochores of somatic chromosomes in the spermatogonial mitoses of Acricotopus lucidus (Diptera, Chironomidae).

    Science.gov (United States)

    Staiber, Wolfgang

    2014-07-01

    Unequal chromosome segregation and spindle formation occurs in the last gonial mitosis in the germ line of the chironomid Acricotopus lucidus. During this differential mitosis, all germ line-limited chromosomes (=Ks) migrate undivided to only one pole of the cell, while the somatic chromosomes (=Ss) first remain in the metaphase plane, and with the arrival of the Ks at the pole, they then separate equally. The evolutionarily conserved GTPase Ran plays a crucial role in many cellular processes. This includes the regulation of microtubule nucleation and stabilisation at kinetochores and of spindle assembly during mitosis, which is promoted by a RanGTP concentration gradient that forms around the mitotic chromosomes (Kalab et al. in Science 295:2452-2456, 2002, Nature 440:697-701, 2006). In the present study, a strong accumulation of Ran was detected by immunofluorescence at the kinetochores of the Ss in normal gonial and differential gonial mitoses of males of A. lucidus. In contrast, no Ran accumulation was observed at the kinetochores of the Ss in the metaphases of brain ganglia mitoses or of aberrant spermatocytes or in metaphases I and II of spermatocyte meiotic divisions. Likewise, there was no accumulation at the kinetochores of Drosophila melanogaster mitotic chromosomes from larval brains. The specific accumulation of Ran at the kinetochores of the Ss in differential gonial mitoses of A. lucidus strongly suggests that Ran is involved in a mechanism acting in this exceptional mitosis, which retains the Ss at the metaphase plane and prevents a premature separation and unequal segregation of the Ss during monopolar migration of the Ks.

  19. Rinfoform Usage As Update Request Media Articles In iRAN

    Directory of Open Access Journals (Sweden)

    Untung Rahardja

    2016-10-01

    Full Text Available Ease of access to information made public should continue to improve his knowledge of information technology. As one of the Universities in the field of computers, Perguruan Tinggi Raharja has a lot of innovation to create pembelajalan unconventional media. For that create an information media that serve as a center of tutorial every innovation in Perguruan Tinggi Raharja. iRAN (iLeraning Prog Ask And News. In the implementation one that is still seen as less is a service request in Iran. Utilization of Cloud Computing RinfoApps as media RinfoForms one of them is deemed to cover deficiencies that affect the improvements in the services provided.This research was conducted using the method of data collection, including the method of observation, and literature study method. RinfoForm expected utilization associated with Cluod Computin can give effect to the service request is in Iran.

  20. RANS-based simulation of wave-induced sheet-flow transport of graded sediments

    DEFF Research Database (Denmark)

    Calistan, Ugur; Fuhrman, David R.

    2017-01-01

    A one-dimensional vertical (1DV) turbulence-closure flow model, coupled with sediment transport capabilities,is extended to incorporate graded sediment mixtures. The hydrodynamic model solves the horizontalcomponent of the incompressible Reynolds-averaged Navier–Stokes (RANS) equations coupled...... for each grain fraction, includingeffects associated with increased exposure of larger particles within a mixture. The suspended sedimenttransport model also makes use of modified reference concentration approach, wherein reference concentrationscomputed individually for each fraction are translated...... to a common level, conveniently enabling use of asingle computational grid for the simulation of suspended sediments. Parametric study shows that these twoeffects combine to help alleviate an otherwise systematic tendency towards over- (under-) predicted transportrates for fine (coarse) sand fractions...

  1. Rans-Based Numerical Simulation of Wave-Induced Sheet-Flow Transport of Graded Sediments

    DEFF Research Database (Denmark)

    Fuhrman, David R.; Caliskan, Ugur

    An existing one-dimensional vertical (1DV) turbulence-closure flow model, coupled with sediment transport capabilities, is extended to incorporate graded sediment mixtures. The hydrodynamic model solves the horizontal component of the incompressible Reynolds-averaged Navier–Stokes (RANS) equations...... coupled with k–ω turbulence closure. In addition to standard bed and suspended load descriptions, the sediment transport model incorporates so-called high-concentration effects (turbulence damping and hindered settling velocities). The sediment transport model treats the bed and suspended load...... individually for each grain fraction within a mixture, and includes effects associated with increased exposure of larger particles within a mixture. The model also makes use of a modified reference concentration approach, with reference concentrations computed individually for each fraction...

  2. RANS-based simulation of turbulent wave boundary layer and sheet-flow sediment transport processes

    DEFF Research Database (Denmark)

    Fuhrman, David R.; Schløer, Signe; Sterner, Johanna

    2013-01-01

    A numerical model coupling the horizontal component of the incompressible Reynolds-averaged Navier–Stokes (RANS) equationswith two-equation k−ω turbulence closure is presented and used to simulate a variety of turbulent wave boundary layer processes. The hydrodynamic model is additionally coupled...... of a number of local factors important within cross-shore wave boundary layer and sediment transport dynamics. The hydrodynamic model is validated for both hydraulically smooth and rough conditions, based on wave friction factor diagrams and boundary layer streaming profiles, with the results in excellent...... agreement with experimental and/or previous numerical work. The sediment transport model is likewise validated against oscillatory tunnel experiments involving both velocity-skewed and acceleration-skewed flows, as well as against measurements beneath real progressive waves.Model capabilities are exploited...

  3. Investigation on the wake evolution of contra-rotating propeller using RANS computation and SPIV measurement

    Directory of Open Access Journals (Sweden)

    Kwang-Jun Paik

    2015-05-01

    Full Text Available The wake characteristics of Contra-Rotating Propeller (CRP were investigated using numerical simulation and flow measurement. The numerical simulation was carried out with a commercial CFD code based on a Reynolds Averaged Navier-Stokes (RANS equations solver, and the flow measurement was performed with Stereoscopic Particle Image Velocimetry (SPIV system. The simulation results were validated through the comparison with the experiment results measured around the leading edge of rudder to investigate the effect of propeller operation under the conditions without propeller, with forward propeller alone, and with both forward and aft propellers. The evolution of CRP wake was analyzed through velocity and vorticity contours on three transverse planes and one longitudinal plane based on CFD results. The trajectories of propeller tip vortex core in the cases with and without aft propeller were also compared, and larger wake contraction with CRP was confirmed.

  4. RANS simulation of cavitation and hull pressure fluctuation for marine propeller operating behind-hull condition

    Directory of Open Access Journals (Sweden)

    Kwang-Jun Paik

    2013-12-01

    Full Text Available Simulations of cavitation flow and hull pressure fluctuation for a marine propeller operating behind a hull using the unsteady Reynolds-Averaged Navier-Stokes equations (RANS are presented. A full hull body submerged under the free surface is modeled in the computational domain to simulate directly the wake field of the ship at the propeller plane. Simulations are performed in design and ballast draught conditions to study the effect of cavitation number. And two propellers with slightly different geometry are simulated to validate the detectability of the numerical simulation. All simulations are performed using a commercial CFD software FLUENT. Cavitation patterns of the simulations show good agreement with the experimental results carried out in Samsung CAvitation Tunnel (SCAT. The simulation results for the hull pressure fluctuation induced by a propeller are also compared with the experimental results showing good agreement in the tendency and amplitude, especially, for the first blade frequency.

  5. A RANS modelling approach for predicting powering performance of ships in waves

    Directory of Open Access Journals (Sweden)

    Björn Windén

    2014-06-01

    Full Text Available In this paper, a modelling technique for simulating self-propelled ships in waves is presented. The flow is modelled using a RANS solver coupled with an actuator disk model for the propeller. The motion of the ship is taken into consideration in the definition of the actuator disk region as well as the advance ratio of the propeller. The RPM of the propeller is controlled using a PID-controller with constraints added on the maximum permissible RPM increase rate. Results are presented for a freely surging model in regular waves with different constraints put on the PID-controller. The described method shows promising results and allows for the studying of several factors relating to self-propulsion. However, more validation data is needed to judge the accuracy of the model.

  6. Optimizing small cell deployment by the use of C-RANs

    DEFF Research Database (Denmark)

    Checko, Aleksandra; Holm, Henrik Laumand; Christiansen, Henrik Lehrmann

    2014-01-01

    conditions. Furthermore, based on theoretical calculations and Network simulations we present considerations on deployment scenarios to optimize green field deployments in terms of Total Cost of Ownership (TCO). This involves optimizing the mix of cells with different traffic profiles and the BBU Pool......A Cloud Radio Access Network (C-RAN) is a novel mobile network architecture that has the potential to support extremely dense mobile network deployments enhancing the network capacity while offering cost savings on baseband resources. In this work we analyze cell traffic profiles and evaluate...... the conditions that impact the statistical multiplexing gain in the Baseband Unit (BBU) Pool. We conclude on the set of parameters that maximize the statistical multiplexing gain, leading to the highest potential cost savings. We then propose a packet based architecture that can adapt to changing traffic...

  7. Flow field analysis of a pentagonal-shaped bridge deck by unsteady RANS

    Directory of Open Access Journals (Sweden)

    Md. Naimul Haque

    2016-01-01

    Full Text Available Long-span cable-stayed bridges are susceptible to dynamic wind effects due to their inherent flexibility. The fluid flow around the bridge deck should be well understood for the efficient design of an aerodynamically stable long-span bridge system. In this work, the aerodynamic features of a pentagonal-shaped bridge deck are explored numerically. The analytical results are compared with past experimental work to assess the capability of two-dimensional unsteady RANS simulation for predicting the aerodynamic features of this type of deck. The influence of the bottom plate slope on aerodynamic response and flow features was investigated. By varying the Reynolds number (2 × 104 to 20 × 104 the aerodynamic behavior at high wind speeds is clarified.

  8. A RANS/DES Numerical Procedure for Axisymmetric Flows with and without Strong Rotation

    Energy Technology Data Exchange (ETDEWEB)

    Andrade, Andrew Jacob [Univ. of California, Davis, CA (United States)

    2007-01-01

    A RANS/DES numerical procedure with an extended Lax-Wendroff control-volume scheme and turbulence model is described for the accurate simulation of internal/external axisymmetric flow with and without strong rotation. This new procedure is an extension, from Cartesian to cylindrical coordinates, of (1) a second order accurate multi-grid, control-volume integration scheme, and (2) a k-ω turbulence model. This paper outlines both the axisymmetric corrections to the mentioned numerical schemes and the developments of techniques pertaining to numerical dissipation, multi-block connectivity, parallelization, etc. Furthermore, analytical and experimental case studies are presented to demonstrate accuracy and computational efficiency. Notes are also made toward numerical stability of highly rotational flows.

  9. A Synthesis of Hybrid RANS/LES CFD Results for F-16XL Aircraft Aerodynamics

    Science.gov (United States)

    Luckring, James M.; Park, Michael A.; Hitzel, Stephan M.; Jirasek, Adam; Lofthouse, Andrew J.; Morton, Scott A.; McDaniel, David R.; Rizzi, Arthur M.

    2015-01-01

    A synthesis is presented of recent numerical predictions for the F-16XL aircraft flow fields and aerodynamics. The computational results were all performed with hybrid RANS/LES formulations, with an emphasis on unsteady flows and subsequent aerodynamics, and results from five computational methods are included. The work was focused on one particular low-speed, high angle-of-attack flight test condition, and comparisons against flight-test data are included. This work represents the third coordinated effort using the F-16XL aircraft, and a unique flight-test data set, to advance our knowledge of slender airframe aerodynamics as well as our capability for predicting these aerodynamics with advanced CFD formulations. The prior efforts were identified as Cranked Arrow Wing Aerodynamics Project International, with the acronyms CAWAPI and CAWAPI-2. All information in this paper is in the public domain.

  10. Performance evaluation of RANS-based turbulence models in simulating a honeycomb heat sink

    Science.gov (United States)

    Subasi, Abdussamet; Ozsipahi, Mustafa; Sahin, Bayram; Gunes, Hasan

    2017-07-01

    As well-known, there is not a universal turbulence model that can be used to model all engineering problems. There are specific applications for each turbulence model that make it appropriate to use, and it is vital to select an appropriate model and wall function combination that matches the physics of the problem considered. Therefore, in this study, performance of six well-known Reynolds-Averaged Navier-Stokes ( RANS) based turbulence models which are the Standard k {{-}} ɛ, the Renormalized Group k- ɛ, the Realizable k- ɛ, the Reynolds Stress Model, the k- ω and the Shear Stress Transport k- ω and accompanying wall functions which are the standard, the non-equilibrium and the enhanced are evaluated via 3D simulation of a honeycomb heat sink. The CutCell method is used to generate grid for the part including heat sink called test section while a hexahedral mesh is employed to discretize to inlet and outlet sections. A grid convergence study is conducted for verification process while experimental data and well-known correlations are used to validate the numerical results. Prediction of pressure drop along the test section, mean base plate temperature of the heat sink and temperature at the test section outlet are regarded as a measure of the performance of employed models and wall functions. The results indicate that selection of turbulence models and wall functions has a great influence on the results and, therefore, need to be selected carefully. Hydraulic and thermal characteristics of the honeycomb heat sink can be determined in a reasonable accuracy using RANS- based turbulence models provided that a suitable turbulence model and wall function combination is selected.

  11. RANS based CFD methodology for a real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Jae-Ho, E-mail: jhjeong@kaeri.re.kr [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of); Song, Min-Seop [Department of Nuclear Engineering, Seoul National University, 559 Gwanak-ro, Gwanak-gu, Seoul (Korea, Republic of); Lee, Kwi-Lim [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of)

    2017-03-15

    Highlights: • This paper presents a suitable way for a practical RANS based CFD methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR. • A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI function in a general-purpose commercial CFD code, CFX. • The RANS based CFD methodology is implemented with high resolution scheme and SST turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC and JNC. Furthermore, the RANS based CFD methodology can be successfully extended to the real scale 217-pin wire-wrapped fuel bundles of KAERI PGSFR. • Three-dimensional thermal-hydraulic characteristics have been also investigated briefly. - Abstract: This paper presents a suitable way for a practical RANS (Reynolds Averaged Navier-Stokes simulation) based CFD (Computational Fluid Dynamics) methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI (Korea Atomic Energy Research Institute) PGSFR (Prototype Gen-IV Sodium-cooled Fast Reactor). The main purpose of the current study is to support license issue for the KAERI PGSFR core safety and to elucidate thermal-hydraulic characteristics in a 217-pin wire-wrapped fuel assembly of KAERI PGSFR. A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI (General Grid Interface) function in a general-purpose commercial CFD code, CFX. The innovative grid generation method with GGI function can achieve to simulate a real wire shape with minimizing cell skewness. The RANS based CFD methodology is implemented with high resolution scheme in convection term and SST (Shear Stress Transport) turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC (Power reactor and Nuclear fuel

  12. RANS / LES coupling applied to high Reynolds number turbulent flows of the nuclear industry; Application du couplage RANS / LES aux ecoulements turbulents a haut nombre de Reynolds de l'industrie nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Benarafa, Y

    2005-12-15

    The main issue to perform a computational study of high Reynolds numbered turbulent flows consists on predicting their unsteadiness without implying a tremendous computational cost. First, the main drawbacks of large-eddy simulation with standard wall model on a coarse mesh for a plane channel flow are highlighted. To correct these drawbacks two coupling RANS/LES methods have been proposed. The first one relies on a sophisticated wall model (TBLE) which consists on solving Thin Boundary Layer Equations with a RANS type turbulent closure in the near wall region. The second one consists on a RANS/LES methods have been proposed. The second one consists on a RANS/LES coupling method using a forcing term approach. These various approaches have been implemented in the TRIO-U code developed at CEA (French Atomic Center) at Grenoble, France. The studied flow configurations are the fully developed plane channel flow and a flow around a surface-mounted cubical obstacle. Both approaches provide encouraging results and allow a surface-mounted cubical obstacle. Both approaches provide encouraging results and allow unsteady simulations for a low computational cost. (author)

  13. 78 FR 34084 - Freeport-McMoRan Energy LLC; Application for Long-Term Authorization To Export Liquefied Natural...

    Science.gov (United States)

    2013-06-06

    ... Freeport-McMoRan Energy LLC; Application for Long-Term Authorization To Export Liquefied Natural Gas... natural gas (non-FTA countries) with which trade is not prohibited by U.S. law or policy. FME requests... Natural Gas Act (NGA), 15 U.S.C. 717b(c).\\3\\ In the current Application, FME requests both FTA and non...

  14. A comparison of RANS computations and wind tunnel tests for RMS pressures on a high-rise building model

    NARCIS (Netherlands)

    Kalkman, I.M.; Bronkhorst, A.J.; Bentum, C.A. van; Franke, J.

    2012-01-01

    Five root-mean-square (RMS) pressure models are used in combination with different turbulence models to determine whether it is possible to obtain a conservative estimate of RMS pressures on a high-rise building model from a RANS calculation. When a precursor domain is used for the generation of

  15. HIV Integration Targeting: A Pathway Involving Transportin-3 and the Nuclear Pore Protein RanBP2

    Science.gov (United States)

    Huegel, Alyssa; Roth, Shoshannah L.; Schaller, Torsten; James, Leo C.; Towers, Greg J.; Young, John A. T.; Chanda, Sumit K.; König, Renate; Malani, Nirav; Berry, Charles C.; Bushman, Frederic D.

    2011-01-01

    Genome-wide siRNA screens have identified host cell factors important for efficient HIV infection, among which are nuclear pore proteins such as RanBP2/Nup358 and the karyopherin Transportin-3/TNPO3. Analysis of the roles of these proteins in the HIV replication cycle suggested that correct trafficking through the pore may facilitate the subsequent integration step. Here we present data for coupling between these steps by demonstrating that depletion of Transportin-3 or RanBP2 altered the terminal step in early HIV replication, the selection of chromosomal sites for integration. We found that depletion of Transportin-3 and RanBP2 altered integration targeting for HIV. These knockdowns reduced HIV integration frequency in gene-dense regions and near gene-associated features, a pattern that differed from that reported for depletion of the HIV integrase binding cofactor Psip1/Ledgf/p75. MLV integration was not affected by the Transportin-3 knockdown. Using siRNA knockdowns and integration targeting analysis, we also implicated several additional nuclear proteins in proper target site selection. To map viral determinants of integration targeting, we analyzed a chimeric HIV derivative containing MLV gag, and found that the gag replacement phenocopied the Transportin-3 and RanBP2 knockdowns. Thus, our data support a model in which Gag-dependent engagement of the proper transport and nuclear pore machinery mediate trafficking of HIV complexes to sites of integration. PMID:21423673

  16. HIV integration targeting: a pathway involving Transportin-3 and the nuclear pore protein RanBP2.

    Directory of Open Access Journals (Sweden)

    Karen E Ocwieja

    2011-03-01

    Full Text Available Genome-wide siRNA screens have identified host cell factors important for efficient HIV infection, among which are nuclear pore proteins such as RanBP2/Nup358 and the karyopherin Transportin-3/TNPO3. Analysis of the roles of these proteins in the HIV replication cycle suggested that correct trafficking through the pore may facilitate the subsequent integration step. Here we present data for coupling between these steps by demonstrating that depletion of Transportin-3 or RanBP2 altered the terminal step in early HIV replication, the selection of chromosomal sites for integration. We found that depletion of Transportin-3 and RanBP2 altered integration targeting for HIV. These knockdowns reduced HIV integration frequency in gene-dense regions and near gene-associated features, a pattern that differed from that reported for depletion of the HIV integrase binding cofactor Psip1/Ledgf/p75. MLV integration was not affected by the Transportin-3 knockdown. Using siRNA knockdowns and integration targeting analysis, we also implicated several additional nuclear proteins in proper target site selection. To map viral determinants of integration targeting, we analyzed a chimeric HIV derivative containing MLV gag, and found that the gag replacement phenocopied the Transportin-3 and RanBP2 knockdowns. Thus, our data support a model in which Gag-dependent engagement of the proper transport and nuclear pore machinery mediate trafficking of HIV complexes to sites of integration.

  17. RANS-VOF modeling of hydrodynamics and sand transport under full-scale non-breaking and breaking waves

    NARCIS (Netherlands)

    Fernandez Mora, Maria de Los Angeles; Ribberink, Jan S.; van der Zanden, Joep; van der Werf, Jebbe J.; Jacobsen, N.G.; Lynett, P.; Lynett, Patrick

    2017-01-01

    A 2D RANS-VOF model is used to simulate the flow and sand transport for two different full-scale laboratory experiments: i) non-breaking waves over a horizontal sand bed (Schretlen et al., 2011) and ii) plunging breaking waves over a barred mobile bed profile (Van der Zanden et al., 2016). For the

  18. Repeat Associated Non-AUG Translation (RAN Translation Dependent on Sequence Downstream of the ATXN2 CAG Repeat.

    Directory of Open Access Journals (Sweden)

    Daniel R Scoles

    Full Text Available Spinocerebellar ataxia type 2 (SCA2 is a progressive autosomal dominant disorder caused by the expansion of a CAG tract in the ATXN2 gene. The SCA2 disease phenotype is characterized by cerebellar atrophy, gait ataxia, and slow saccades. ATXN2 mutation causes gains of toxic and normal functions of the ATXN2 gene product, ataxin-2, and abnormally slow Purkinje cell firing frequency. Previously we investigated features of ATXN2 controlling expression and noted expression differences for ATXN2 constructs with varying CAG lengths, suggestive of repeat associated non-AUG translation (RAN translation. To determine whether RAN translation occurs for ATXN2 we assembled various ATXN2 constructs with ATXN2 tagged by luciferase, HA or FLAG tags, driven by the CMV promoter or the ATXN2 promoter. Luciferase expression from ATXN2-luciferase constructs lacking the ATXN2 start codon was weak vs AUG translation, regardless of promoter type, and did not increase with longer CAG repeat lengths. RAN translation was detected on western blots by the anti-polyglutamine antibody 1C2 for constructs driven by the CMV promoter but not the ATXN2 promoter, and was weaker than AUG translation. Strong RAN translation was also observed when driving the ATXN2 sequence with the CMV promoter with ATXN2 sequence downstream of the CAG repeat truncated to 18 bp in the polyglutamine frame but not in the polyserine or polyalanine frames. Our data demonstrate that ATXN2 RAN translation is weak compared to AUG translation and is dependent on ATXN2 sequences flanking the CAG repeat.

  19. RANS Modeling of Stably Stratified Turbulent Boundary Layer Flows in OpenFOAM®

    Directory of Open Access Journals (Sweden)

    Wilson Jordan M.

    2015-01-01

    Full Text Available Quantifying mixing processes relating to the transport of heat, momentum, and scalar quantities of stably stratified turbulent geophysical flows remains a substantial task. In a stably stratified flow, such as the stable atmospheric boundary layer (SABL, buoyancy forces have a significant impact on the flow characteristics. This study investigates constant and stability-dependent turbulent Prandtl number (Prt formulations linking the turbulent viscosity (νt and diffusivity (κt for modeling applications of boundary layer flows. Numerical simulations of plane Couette flow and pressure-driven channel flow are performed using the Reynolds-averaged Navier-Stokes (RANS framework with the standard k-ε turbulence model. Results are compared with DNS data to evaluate model efficacy for predicting mean velocity and density fields. In channel flow simulations, a Prandtl number formulation for wall-bounded flows is introduced to alleviate overmixing of the mean density field. This research reveals that appropriate specification of Prt can improve predictions of stably stratified turbulent boundary layer flows.

  20. Validation of the simpleFoam (RANS solver for the atmospheric boundary layer in complex terrain

    Directory of Open Access Journals (Sweden)

    Peralta C.

    2014-01-01

    Full Text Available We validate the simpleFoam (RANS solver in OpenFOAM (version 2.1.1 for simulating neutral atmospheric boundary layer flows in complex terrain. Initial and boundary conditions are given using Richards and Hoxey proposal [1]. In order to obtain stable simulation of the ABL, modified wall functions are used to set the near-wall boundary conditions, following Blocken et al remedial measures [2]. A structured grid is generated with the new library terrainBlockMesher [3,4], based on OpenFOAM's blockMesh native mesher. The new tool is capable of adding orographic features and the forest canopy. Additionally, the mesh can be refined in regions with complex orography. We study both the classical benchmark case of Askervein hill [5] and the more recent Bolund island data set [6]. Our purpose is two-folded: to validate the performance of OpenFOAM steady state solvers, and the suitability of the new meshing tool to generate high quality structured meshes, which will be used in the future for performing more computationally intensive LES simulations in complex terrain.

  1. A Game-Theoretical Approach for Spectrum Efficiency Improvement in Cloud-RAN

    Directory of Open Access Journals (Sweden)

    Zhuofu Zhou

    2016-01-01

    Full Text Available As tremendous mobile devices access to the Internet in the future, the cells which can provide high data rate and more capacity are expected to be deployed. Specifically, in the next generation of mobile communication 5G, cloud computing is supposed to be applied to radio access network. In cloud radio access network (Cloud-RAN, the traditional base station is divided into two parts, that is, remote radio heads (RRHs and base band units (BBUs. RRHs are geographically distributed and densely deployed, so as to achieve high data rate and low latency. However, the ultradense deployment inevitably deteriorates spectrum efficiency due to the severer intercell interference among RRHs. In this paper, the downlink spectrum efficiency can be improved through the cooperative transmission based on forming the coalitions of RRHs. We formulate the problem as a coalition formation game in partition form. In the process of coalition formation, each RRH can join or leave one coalition to maximize its own individual utility while taking into account the coalition utility at the same time. Moreover, the convergence and stability of the resulting coalition structure are studied. The numeric simulation result demonstrates that the proposed approach based on coalition formation game is superior to the noncooperative method in terms of the aggregate coalition utility.

  2. RANS SIMULATION OF HYDROFOIL EFFECTS ON HYDRODYNAMIC COEFFICIENTS OF A PLANING CATAMARAN

    Directory of Open Access Journals (Sweden)

    Amin Najafi

    2016-03-01

    Full Text Available Determination of high-speed crafts’ hydrodynamic coefficients will help to analyze the dynamics of these kinds of vessels and the factors affecting their dynamic stabilities. Also, it can be useful and effective in controlling the vessel instabilities. The main purpose of this study is to determine the coefficients of longitudinal motions of a planing catamaran with and without a hydrofoil using RANS method to evaluate the foil effects on them. Determination of hydrodynamic coefficients by experimental approach is costly, and requires meticulous laboratory equipment; therefore, utilizing numerical methods and developing a virtual laboratory seems highly efficient. In the present study, the numerical results for hydrodynamic coefficients of a high-speed craft are verified against Troesch’s (1992 experimental results. In the following, after determination of hydrodynamic coefficients of a planing catamaran with and without foil, the foil effects on its hydrodynamic coefficients are evaluated. The results indicate that most of the coefficients are frequency independent especially at high frequencies.

  3. Aurora A phosphorylates MCAK to control ran-dependent spindle bipolarity.

    Science.gov (United States)

    Zhang, Xin; Ems-McClung, Stephanie C; Walczak, Claire E

    2008-07-01

    During mitosis, mitotic centromere-associated kinesin (MCAK) localizes to chromatin/kinetochores, a cytoplasmic pool, and spindle poles. Its localization and activity in the chromatin region are regulated by Aurora B kinase; however, how the cytoplasmic- and pole-localized MCAK are regulated is currently not clear. In this study, we used Xenopus egg extracts to form spindles in the absence of chromatin and centrosomes and found that MCAK localization and activity are tightly regulated by Aurora A. This regulation is important to focus microtubules at aster centers and to facilitate the transition from asters to bipolar spindles. In particular, we found that MCAK colocalized with NuMA and XMAP215 at the center of Ran asters where its activity is regulated by Aurora A-dependent phosphorylation of S196, which contributes to proper pole focusing. In addition, we found that MCAK localization at spindle poles was regulated through another Aurora A phosphorylation site (S719), which positively enhances bipolar spindle formation. This is the first study that clearly defines a role for MCAK at the spindle poles as well as identifies another key Aurora A substrate that contributes to spindle bipolarity.

  4. Simulating wind and marine hydrokinetic turbines with actuator lines in RANS and LES

    Science.gov (United States)

    Bachant, Peter; Wosnik, Martin

    2015-11-01

    As wind and marine hydrokinetic (MHK) turbine designs mature, focus is shifting towards improving turbine array layouts for maximizing overall power output, i.e., minimizing wake interference for axial-flow or horizontal-axis turbines, or taking advantage of constructive wake interaction for cross-flow or vertical-axis turbines. Towards this goal, an actuator line model (ALM) was developed to provide a computationally feasible method for simulating full turbine arrays inside Navier-Stokes models. The ALM predicts turbine loading with the blade element method combined with sub-models for dynamic stall and flow curvature. The open-source software is written as an extension library for the OpenFOAM CFD package, which allows the ALM body force to be applied to their standard RANS and LES solvers. Turbine forcing is also applied to volume of fluid (VOF) models, e.g., for predicting free surface effects on submerged MHK devices. An additional sub-model is considered for injecting turbulence model scalar quantities based on actuator line element loading. Results are presented for the simulation of performance and wake dynamics of axial- and cross-flow turbines and compared with moderate Reynolds number experiments and body-fitted mesh, blade-resolving CFD. Work supported by NSF-CBET grant 1150797.

  5. Simulation of an Isolated Tiltrotor in Hover with an Unstructured Overset-Grid RANS Solver

    Science.gov (United States)

    Lee-Rausch, Elizabeth M.; Biedron, Robert T.

    2009-01-01

    An unstructured overset-grid Reynolds Averaged Navier-Stokes (RANS) solver, FUN3D, is used to simulate an isolated tiltrotor in hover. An overview of the computational method is presented as well as the details of the overset-grid systems. Steady-state computations within a noninertial reference frame define the performance trends of the rotor across a range of the experimental collective settings. Results are presented to show the effects of off-body grid refinement and blade grid refinement. The computed performance and blade loading trends show good agreement with experimental results and previously published structured overset-grid computations. Off-body flow features indicate a significant improvement in the resolution of the first perpendicular blade vortex interaction with background grid refinement across the collective range. Considering experimental data uncertainty and effects of transition, the prediction of figure of merit on the baseline and refined grid is reasonable at the higher collective range- within 3 percent of the measured values. At the lower collective settings, the computed figure of merit is approximately 6 percent lower than the experimental data. A comparison of steady and unsteady results show that with temporal refinement, the dynamic results closely match the steady-state noninertial results which gives confidence in the accuracy of the dynamic overset-grid approach.

  6. Ras-Related Nuclear Protein Ran3B Gene Is Involved in Hormone Responses in the Embryogenic Callus of Dimocarpus longan Lour.

    Directory of Open Access Journals (Sweden)

    Qilin Tian

    2016-06-01

    Full Text Available Ras-related guanosine triphosphate (GTP-binding nuclear protein (Ran GTPases function as molecular switches and regulate diverse cellular events in eukaryotes. Our previous work suggested that DlRan3B is active during longan (Dimocarpus longan Lour. somatic embryogenesis (SE processes. Herein, subcellular localization of DlRan3B was found to be localized in the nucleus and expression profiling of DlRan3B was performed during longan SE and after exposure to plant hormones (indoleacetic acid (IAA, gibberellin A3 (GA3, salicylic acid (SA, methyl jasmonte (MeJA, and abscisic acid (ABA. We cloned and sequenced 1569 bp of 5′-flanking sequence of DlRan3B (GenBank: JQ279697. Bioinformatic analysis indicated that the promoter contained plant hormone-related regulatory elements. Deletion analysis and responses to hormones identified stimulative and repressive regulatory elements in the DlRan3B promoter. The key elements included those responding to auxin, gibberellin, SA, MeJA, and ABA. DlRan3B was located in the nucleus and accumulated in the late stage of longan SE. The expression of DlRan3B was significantly induced by IAA, GA3, and ABA, but suppressed by SA and MeJA. Promoter transcription was induced by IAA and GA3, but suppressed by SA. Thus, DlRan3B might participate in auxin, gibberellin, and ABA responses during longan late SE, and DlRan3B is involved in phytohormone responsiveness.

  7. Antisense expression of an Arabidopsis ran binding protein renders transgenic roots hypersensitive to auxin and alters auxin-induced root growth and development by arresting mitotic progress

    Science.gov (United States)

    Kim, S. H.; Arnold, D.; Lloyd, A.; Roux, S. J.

    2001-01-01

    We cloned a cDNA encoding an Arabidopsis Ran binding protein, AtRanBP1c, and generated transgenic Arabidopsis expressing the antisense strand of the AtRanBP1c gene to understand the in vivo functions of the Ran/RanBP signal pathway. The transgenic plants showed enhanced primary root growth but suppressed growth of lateral roots. Auxin significantly increased lateral root initiation and inhibited primary root growth in the transformants at 10 pM, several orders of magnitude lower than required to induce these responses in wild-type roots. This induction was followed by a blockage of mitosis in both newly emerged lateral roots and in the primary root, ultimately resulting in the selective death of cells in the tips of both lateral and primary roots. Given the established role of Ran binding proteins in the transport of proteins into the nucleus, these findings are consistent with a model in which AtRanBP1c plays a key role in the nuclear delivery of proteins that suppress auxin action and that regulate mitotic progress in root tips.

  8. The cyst nematode SPRYSEC protein RBP-1 elicits Gpa2- and RanGAP2-dependent plant cell death.

    Directory of Open Access Journals (Sweden)

    Melanie Ann Sacco

    2009-08-01

    Full Text Available Plant NB-LRR proteins confer robust protection against microbes and metazoan parasites by recognizing pathogen-derived avirulence (Avr proteins that are delivered to the host cytoplasm. Microbial Avr proteins usually function as virulence factors in compatible interactions; however, little is known about the types of metazoan proteins recognized by NB-LRR proteins and their relationship with virulence. In this report, we demonstrate that the secreted protein RBP-1 from the potato cyst nematode Globodera pallida elicits defense responses, including cell death typical of a hypersensitive response (HR, through the NB-LRR protein Gpa2. Gp-Rbp-1 variants from G. pallida populations both virulent and avirulent to Gpa2 demonstrated a high degree of polymorphism, with positive selection detected at numerous sites. All Gp-RBP-1 protein variants from an avirulent population were recognized by Gpa2, whereas virulent populations possessed Gp-RBP-1 protein variants both recognized and non-recognized by Gpa2. Recognition of Gp-RBP-1 by Gpa2 correlated to a single amino acid polymorphism at position 187 in the Gp-RBP-1 SPRY domain. Gp-RBP-1 expressed from Potato virus X elicited Gpa2-mediated defenses that required Ran GTPase-activating protein 2 (RanGAP2, a protein known to interact with the Gpa2 N terminus. Tethering RanGAP2 and Gp-RBP-1 variants via fusion proteins resulted in an enhancement of Gpa2-mediated responses. However, activation of Gpa2 was still dependent on the recognition specificity conferred by amino acid 187 and the Gpa2 LRR domain. These results suggest a two-tiered process wherein RanGAP2 mediates an initial interaction with pathogen-delivered Gp-RBP-1 proteins but where the Gpa2 LRR determines which of these interactions will be productive.

  9. A Priori Analysis of a Compressible Flamelet Model using RANS Data for a Dual-Mode Scramjet Combustor

    Science.gov (United States)

    Quinlan, Jesse R.; Drozda, Tomasz G.; McDaniel, James C.; Lacaze, Guilhem; Oefelein, Joseph

    2015-01-01

    In an effort to make large eddy simulation of hydrocarbon-fueled scramjet combustors more computationally accessible using realistic chemical reaction mechanisms, a compressible flamelet/progress variable (FPV) model was proposed that extends current FPV model formulations to high-speed, compressible flows. Development of this model relied on observations garnered from an a priori analysis of the Reynolds-Averaged Navier-Stokes (RANS) data obtained for the Hypersonic International Flight Research and Experimentation (HI-FiRE) dual-mode scramjet combustor. The RANS data were obtained using a reduced chemical mechanism for the combustion of a JP-7 surrogate and were validated using avail- able experimental data. These RANS data were then post-processed to obtain, in an a priori fashion, the scalar fields corresponding to an FPV-based modeling approach. In the current work, in addition to the proposed compressible flamelet model, a standard incompressible FPV model was also considered. Several candidate progress variables were investigated for their ability to recover static temperature and major and minor product species. The effects of pressure and temperature on the tabulated progress variable source term were characterized, and model coupling terms embedded in the Reynolds- averaged Navier-Stokes equations were studied. Finally, results for the novel compressible flamelet/progress variable model were presented to demonstrate the improvement attained by modeling the effects of pressure and flamelet boundary conditions on the combustion.

  10. Critical role of RanBP2-mediated SUMOylation of Small Heterodimer Partner in maintaining bile acid homeostasis

    Science.gov (United States)

    Kim, Dong-Hyun; Kwon, Sanghoon; Byun, Sangwon; Xiao, Zhen; Park, Sean; Wu, Shwu-Yuan; Chiang, Cheng-Ming; Kemper, Byron; Kemper, Jongsook Kim

    2016-01-01

    Bile acids (BAs) are recently recognized signalling molecules that profoundly affect metabolism. Because of detergent-like toxicity, BA levels must be tightly regulated. An orphan nuclear receptor, Small Heterodimer Partner (SHP), plays a key role in this regulation, but how SHP senses the BA signal for feedback transcriptional responses is not clearly understood. We show an unexpected function of a nucleoporin, RanBP2, in maintaining BA homoeostasis through SUMOylation of SHP. Upon BA signalling, RanBP2 co-localizes with SHP at the nuclear envelope region and mediates SUMO2 modification at K68, which facilitates nuclear transport of SHP and its interaction with repressive histone modifiers to inhibit BA synthetic genes. Mice expressing a SUMO-defective K68R SHP mutant have increased liver BA levels, and upon BA- or drug-induced biliary insults, these mice exhibit exacerbated cholestatic pathologies. These results demonstrate a function of RanBP2-mediated SUMOylation of SHP in maintaining BA homoeostasis and protecting from the BA hepatotoxicity. PMID:27412403

  11. MicroRNA-1301-Mediated RanGAP1 Downregulation Induces BCR-ABL Nuclear Entrapment to Enhance Imatinib Efficacy in Chronic Myeloid Leukemia Cells.

    Science.gov (United States)

    Lin, Tsung-Yao; Chen, Ku-Chung; Liu, Hsing-Jin Eugene; Liu, Ann-Jeng; Wang, Kun-Li; Shih, Chwen-Ming

    2016-01-01

    Chronic myeloid leukemia (CML) is a myeloproliferative disease. Imatinib (IM), the first line treatment for CML, is excessively expensive and induces various side effects in CML patients. Therefore, it is essential to investigate a new strategy for improving CML therapy. Our immunoblot data revealed that RanGTPase activating protein 1 (RanGAP1) protein levels increased by approximately 30-fold in K562 cells compared with those in normal cells. RanGAP1 is one of the important components of RanGTPase system, which regulates the export of nuclear protein. However, whether RanGAP1 level variation influences BCR-ABL nuclear export is still unknown. In this report, using shRNA to downregulate RanGAP1 expression level augmented K562 cell apoptosis by approximately 40% after treatment with 250 nM IM. Immunofluorescence assay also indicated that three-fold of nuclear BCR-ABL was detected. These data suggest that BCR-ABL nuclear entrapment induced by RanGAP1 downregulation can be used to improve IM efficacy. Moreover, our qRT-PCR data indicated a trend of inverse correlation between the RanGAP1 and microRNA (miR)-1301 levels in CML patients. MiR-1301, targeting the RanGAP1 3' untranslated region, decreased by approximately 100-fold in K562 cells compared with that in normal cells. RanGAP1 downregulation by miR-1301 transfection impairs BCR-ABL nuclear export to increase approximately 60% of cell death after treatment of 250 nM IM. This result was almost the same as treatment with 1000 nM IM alone. Furthermore, immunofluorescence assay demonstrated that Tyr-99 of nuclear P73 was phosphorylated accompanied with nuclear entrapment of BCR-ABL after transfection with RanGAP1 shRNA or miR-1301 in IM-treated K562 cells. Altogether, we demonstrated that RanGAP1 downregulation can mediate BCR-ABL nuclear entrapment to activate P73-dependent apoptosis pathway which is a novel strategy for improving current IM treatment for CML.

  12. Nuclear-Cytoplasmic Trafficking of NTF2, the Nuclear Import Receptor for the RanGTPase, Is Subjected to Regulation: e42501

    National Research Council Canada - National Science Library

    Shawn C Chafe; Jacqueline B Pierce; Dev Mangroo

    2012-01-01

    .... Treatment of mammalian cells with polysorbitan monolaurate was found to inhibit nuclear export of tRNA and proteins, which are processes dependent on RanGTP in the nucleus, but not nuclear import...

  13. RanBP9 overexpression down-regulates phospho-cofilin, causes early synaptic deficits and impaired learning, and accelerates accumulation of amyloid plaques in the mouse brain.

    Science.gov (United States)

    Palavicini, Juan Pablo; Wang, Hongjie; Minond, Dmitriy; Bianchi, Elisabetta; Xu, Shaohua; Lakshmana, Madepalli K

    2014-01-01

    Loss of synaptic proteins and functional synapses in the brains of patients with Alzheimer's disease (AD) as well as transgenic mouse models expressing amyloid-β protein precursor is now well established. However, the earliest age at which such loss of synapses occurs, and whether known markers of AD progression accelerate functional deficits is completely unknown. We previously showed that RanBP9 overexpression leads to enhanced amyloid plaque burden in a mouse model of AD. In this study, we found significant reductions in the levels of synaptophysin and spinophilin, compared with wild-type controls, in both the cortex and the hippocampus of 5- and 6-month old but not 3- or 4-month old APΔE9/RanBP9 triple transgenic mice, and not in APΔE9 double transgenic mice, nor in RanBP9 single transgenic mice. Interestingly, amyloid plaque burden was also increased in the APΔE9/RanBP9 mice at 5-6 months. Consistent with these results, we found significant deficits in learning and memory in the APΔE9/RanBP9 mice at 5 and 6 month. These data suggest that increased amyloid plaques and accelerated learning and memory deficits and loss of synaptic proteins induced by RanBP9 are correlated. Most importantly, APΔE9/RanBP9 mice also showed significantly reduced levels of the phosphorylated form of cofilin in the hippocampus. Taken together these data suggest that RanBP9 overexpression down-regulates cofilin, causes early synaptic deficits and impaired learning, and accelerates accumulation of amyloid plaques in the mouse brain.

  14. Volvo ja Ikea endine tegevjuht Göran Carstedt : Tänapäevane (personali)juhtimine peab sisaldama eeskätt looduslähedast mõtteviisi / Göran Carstedt ; interv. Tiina Saar

    Index Scriptorium Estoniae

    Carstedt, Göran

    2008-01-01

    Juhtimiskonsultant ning Organisatsioonilise Õppimise Ühingu eestvedaja ja arendaja Göran Carsedt vastab küsimustele, mis puudutavad ettevõtte tegevust personali tööle pühendumise parendamiseks, ettevõtte jätkusuutlikku juhtimist ja tootlikkust, majanduslanguse mõju ettevõtete personalipoliitikale, talendijuhtimist, väikeste ettevõttete ellujäämist majanduslanguse ajal, IKEA kui hea tööandja mainet ning jätkusuutlikku personaliarendajat. Lisa: Jätkusuutlik juhtimine Rootsi moodi

  15. Selective Impairment of a Subset of Ran-GTP-binding Domains of Ran-binding Protein 2 (Ranbp2) Suffices to Recapitulate the Degeneration of the Retinal Pigment Epithelium (RPE) Triggered by Ranbp2 Ablation*

    Science.gov (United States)

    Patil, Hemangi; Saha, Arjun; Senda, Eugene; Cho, Kyoung-in; Haque, MdEmdadul; Yu, Minzhong; Qiu, Sunny; Yoon, Dosuk; Hao, Ying; Peachey, Neal S.; Ferreira, Paulo A.

    2014-01-01

    Retinal pigment epithelium (RPE) degeneration underpins diseases triggered by disparate genetic lesions, noxious insults, or both. The pleiotropic Ranbp2 controls the expression of intrinsic and extrinsic pathological stressors impinging on cellular viability. However, the physiological targets and mechanisms controlled by Ranbp2 in tissue homeostasis, such as RPE, are ill defined. We show that mice, RPE-cre::Ranbp2−/−, with selective Ranbp2 ablation in RPE develop pigmentary changes, syncytia, hypoplasia, age-dependent centrifugal and non-apoptotic degeneration of the RPE, and secondary leakage of choriocapillaris. These manifestations are accompanied by the development of F-actin clouds, metalloproteinase-11 activation, deregulation of expression or subcellular localization of critical RPE proteins, atrophic cell extrusions into the subretinal space, and compensatory proliferation of peripheral RPE. To gain mechanistic insights into what Ranbp2 activities are vital to the RPE, we performed genetic complementation analyses of transgenic lines of bacterial artificial chromosomes of Ranbp2 harboring loss of function of selective Ranbp2 domains expressed in a Ranbp2−/− background. Among the transgenic lines produced, only TgRBD2/3*-HA::RPE-cre::Ranbp2−/−-expressing mutations, which selectively impair binding of RBD2/3 (Ran-binding domains 2 and 3) of Ranbp2 to Ran-GTP, recapitulate RPE degeneration, as observed with RPE-cre::Ranbp2−/−. By contrast, TgRBD2/3*-HA expression rescues the degeneration of cone photoreceptors lacking Ranbp2. The RPE of RPE-cre::Ranbp2−/− and TgRBD2/3*-HA::RPE-cre::Ranbp2−/− share proteostatic deregulation of Ran GTPase, serotransferrin, and γ-tubulin and suppression of light-evoked electrophysiological responses. These studies unravel selective roles of Ranbp2 and its RBD2 and RBD3 in RPE survival and functions. We posit that the control of Ran GTPase by Ranbp2 emerges as a novel therapeutic target in diseases

  16. Selective impairment of a subset of Ran-GTP-binding domains of ran-binding protein 2 (Ranbp2) suffices to recapitulate the degeneration of the retinal pigment epithelium (RPE) triggered by Ranbp2 ablation.

    Science.gov (United States)

    Patil, Hemangi; Saha, Arjun; Senda, Eugene; Cho, Kyoung-in; Haque, MdEmdadul; Yu, Minzhong; Qiu, Sunny; Yoon, Dosuk; Hao, Ying; Peachey, Neal S; Ferreira, Paulo A

    2014-10-24

    Retinal pigment epithelium (RPE) degeneration underpins diseases triggered by disparate genetic lesions, noxious insults, or both. The pleiotropic Ranbp2 controls the expression of intrinsic and extrinsic pathological stressors impinging on cellular viability. However, the physiological targets and mechanisms controlled by Ranbp2 in tissue homeostasis, such as RPE, are ill defined. We show that mice, RPE-cre::Ranbp2(-/-), with selective Ranbp2 ablation in RPE develop pigmentary changes, syncytia, hypoplasia, age-dependent centrifugal and non-apoptotic degeneration of the RPE, and secondary leakage of choriocapillaris. These manifestations are accompanied by the development of F-actin clouds, metalloproteinase-11 activation, deregulation of expression or subcellular localization of critical RPE proteins, atrophic cell extrusions into the subretinal space, and compensatory proliferation of peripheral RPE. To gain mechanistic insights into what Ranbp2 activities are vital to the RPE, we performed genetic complementation analyses of transgenic lines of bacterial artificial chromosomes of Ranbp2 harboring loss of function of selective Ranbp2 domains expressed in a Ranbp2(-/-) background. Among the transgenic lines produced, only Tg(RBD2/3*-HA)::RPE-cre::Ranbp2(-/-)-expressing mutations, which selectively impair binding of RBD2/3 (Ran-binding domains 2 and 3) of Ranbp2 to Ran-GTP, recapitulate RPE degeneration, as observed with RPE-cre::Ranbp2(-/-). By contrast, Tg(RBD2/3*-HA) expression rescues the degeneration of cone photoreceptors lacking Ranbp2. The RPE of RPE-cre::Ranbp2(-/-) and Tg(RBD2/3*-HA)::RPE-cre::Ranbp2(-/-) share proteostatic deregulation of Ran GTPase, serotransferrin, and γ-tubulin and suppression of light-evoked electrophysiological responses. These studies unravel selective roles of Ranbp2 and its RBD2 and RBD3 in RPE survival and functions. We posit that the control of Ran GTPase by Ranbp2 emerges as a novel therapeutic target in diseases promoting

  17. Reduction of exportin 6 activity leads to actin accumulation via failure of RanGTP restoration and NTF2 sequestration in the nuclei of senescent cells

    Energy Technology Data Exchange (ETDEWEB)

    Park, Su Hyun; Park, Tae Jun; Lim, In Kyoung, E-mail: iklim@ajou.ac.kr

    2011-04-15

    We have previously reported that G-actin accumulation in nuclei is a universal phenomenon of cellular senescence. By employing primary culture of human diploid fibroblast (HDF) and stress-induced premature senescence (SIPS), we explored whether the failure of actin export to cytoplasm is responsible for actin accumulation in nuclei of senescent cells. Expression of exportin 6 (Exp6) and small G-protein, Ran, was significantly reduced in the replicative senescence, but not yet in SIPS, whereas nuclear import of actin by cofilin was already increased in SIPS. After treatment of young HDF cells with H{sub 2}O{sub 2}, rapid reduction of nuclear RanGTP was observed along with cytoplasmic increase of RanGDP. Furthermore, significantly reduced interaction of Exp6 with RanGTP was found by GST-Exp6 pull-down analysis. Failure of RanGTP restoration was accompanied with inhibition of ATP synthesis and NTF2 sequestration in the nuclei along with accordant change of senescence morphology. Indeed, knockdown of Exp6 expression significantly increased actin molecule in the nuclei of young HDF cells. Therefore, actin accumulation in nuclei of senescent cells is most likely due to the failure of RanGTP restoration with ATP deficiency and NTF2 accumulation in nuclei, which result in the decrease of actin export via Exp6 inactivation, in addition to actin import by cofilin activation.

  18. Formation of a Trimeric Xpo1-Ran[GTP]-Ded1 Exportin Complex Modulates ATPase and Helicase Activities of Ded1.

    Directory of Open Access Journals (Sweden)

    Glenn Hauk

    Full Text Available The DEAD-box RNA helicase Ded1, which is essential in yeast and known as DDX3 in humans, shuttles between the nucleus and cytoplasm and takes part in several basic processes including RNA processing and translation. A key interacting partner of Ded1 is the exportin Xpo1, which together with the GTP-bound state of the small GTPase Ran, facilitates unidirectional transport of Ded1 out of the nucleus. Here we demonstrate that Xpo1 and Ran[GTP] together reduce the RNA-stimulated ATPase and helicase activities of Ded1. Binding and inhibition of Ded1 by Xpo1 depend on the affinity of the Ded1 nuclear export sequence (NES for Xpo1 and the presence of Ran[GTP]. Association with Xpo1/Ran[GTP] reduces RNA-stimulated ATPase activity of Ded1 by increasing the apparent KM for the RNA substrate. Despite the increased KM, the Ded1:Xpo1:Ran[GTP] ternary complex retains the ability to bind single stranded RNA, suggesting that Xpo1/Ran[GTP] may modulate the substrate specificity of Ded1. These results demonstrate that, in addition to transport, exportins such as Xpo1 also have the capability to alter enzymatic activities of their cargo.

  19. Comparison of RANS and IDDES solutions for turbulent flow and heat transfer past a backward-facing step

    Science.gov (United States)

    Smirnov, E. M.; Smirnovsky, A. A.; Schur, N. A.; Zaitsev, D. K.; Smirnov, P. E.

    2017-10-01

    Numerical simulations were carried out under conditions of the benchmark-quality experiments of Vogel&Eaton (1985), where nominally 2D fluid dynamics and heat transfer past a backward-facing step in a channel with expansion ratio of 1.25 was investigated at the Reynolds number of 28,000 (based on the step height and the upstream centreline velocity). Comparative computations were performed using an in-house finite-volume code SINF/Flag-S and the ANSYS Fluent, running the codes with same grids. Two approaches were used for turbulence modelling. First, the Menter SST turbulence model was used to perform refined 2D and 3D RANS steady-state computations. The 3D analysis was undertaken to evaluate influence of boundary layers developing on the sidewalls of the experimental channel. The data obtained has resulted in the conclusion that the side wall effects disturbing spanwise uniformity of wall friction and heated wall temperature in the test configuration were of the same order or less than the skin friction coefficient and the Stanton number measurement errors. Then, 3D time-dependent computations were carried out using the vortex-resolving IDDES method being a hybridization of RANS and LES. The IDDES results obtained with the two codes are in a satisfactory agreement, especially for the finer grid of 17.3 million cells. Comparing with the experimental data, the IDDES approach produces the best agreement for the wall friction, whereas the RANS solutions show superiority in predictions of the local Stanton number distribution.

  20. The proliferation marker pKi-67 organizes the nucleolus during the cell cycle depending on Ran and cyclin B.

    Science.gov (United States)

    Schmidt, Mirko H H; Broll, Rainer; Bruch, Hans-Peter; Bögler, Oliver; Duchrow, Michael

    2003-01-01

    The proliferation marker pKi-67 ('Ki-67 antigen') is commonly used in clinical and research pathology to detect proliferating cells, as it is only expressed during cell-cycle progression. Despite the fact that this antigen has been known for nearly two decades, there is still no adequate understanding of its function. This study has therefore identified proteins that interact with pKi-67, using a yeast two-hybrid system. A mammalian two-hybrid system and immunoprecipitation studies were used to verify these interactions. Among other cell-cycle regulatory proteins, two binding partners associated with the small GTPase Ran were identified. In addition, DNA-structural and nucleolus-associated proteins binding to pKi-67 were found. Moreover, it was demonstrated that the N-terminal domain of pKi-67 is capable of self-binding to its own repeat region encoded by exon 13. Since RanBP, a protein involved in the transport of macromolecules over the nuclear lamina, was found to be a binding partner, a possible effect of pKi-67 on the localization of cell-cycle regulatory proteins was proposed. To test this hypothesis, a tetracycline-responsive gene expression system was used to induce the pKi-67 fragments previously used for the two-hybrid screens in HeLa cells. Subsequent immunostaining revealed the translocation of cyclin B1 from cytoplasm to nucleoli in response to this expression. It is suggested that pKi-67 is a Ran-associated protein with a role in the disintegration and reformation of the nucleolus and thereby in entry into and exit from the M-phase. Copyright 2002 John Wiley & Sons, Ltd.

  1. Surface Mechanical and Rheological Behaviors of Biocompatible Poly((D,L-lactic acid-ran-glycolic acid)-block-ethylene glycol) (PLGA-PEG) and Poly((D,L-lactic acid-ran-glycolic acid-ran-ε-caprolactone)-block-ethylene glycol) (PLGACL-PEG) Block Copolymers at the Air-Water Interface

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Chang; Lee, Hoyoung; Khetan, Jawahar; Won, You-Yeon [Purdue

    2016-02-01

    Air–water interfacial monolayers of poly((d,l-lactic acid-ran-glycolic acid)-block-ethylene glycol) (PLGA–PEG) exhibit an exponential increase in surface pressure under high monolayer compression. In order to understand the molecular origin of this behavior, a combined experimental and theoretical investigation (including surface pressure–area isotherm, X-ray reflectivity (XR) and interfacial rheological measurements, and a self-consistent field (SCF) theoretical analysis) was performed on air–water monolayers formed by a PLGA–PEG diblock copolymer and also by a nonglassy analogue of this diblock copolymer, poly((d,l-lactic acid-ran-glycolic acid-ran-caprolactone)-block-ethylene glycol) (PLGACL–PEG). The combined results of this study show that the two mechanisms, i.e., the glass transition of the collapsed PLGA film and the lateral repulsion of the PEG brush chains that occur simultaneously under lateral compression of the monolayer, are both responsible for the observed PLGA–PEG isotherm behavior. Upon cessation of compression, the high surface pressure of the PLGA–PEG monolayer typically relaxes over time with a stretched exponential decay, suggesting that in this diblock copolymer situation, the hydrophobic domain formed by the PLGA blocks undergoes glass transition in the high lateral compression state, analogously to the PLGA homopolymer monolayer. In the high PEG grafting density regime, the contribution of the PEG brush chains to the high monolayer surface pressure is significantly lower than what is predicted by the SCF model because of the many-body attraction among PEG segments (referred to in the literature as the “n-cluster” effects). The end-grafted PEG chains were found to be protein resistant even under the influence of the “n-cluster” effects.

  2. Surface Mechanical and Rheological Behaviors of Biocompatible Poly((D,L-lactic acid-ran-glycolic acid)-block-ethylene glycol) (PLGA-PEG) and Poly((D,L-lactic acid-ran-glycolic acid-ran-ε-caprolactone)-block-ethylene glycol) (PLGACL-PEG) Block Copolymers at the Air-Water Interface.

    Science.gov (United States)

    Kim, Hyun Chang; Lee, Hoyoung; Khetan, Jawahar; Won, You-Yeon

    2015-12-29

    Air-water interfacial monolayers of poly((D,L-lactic acid-ran-glycolic acid)-block-ethylene glycol) (PLGA-PEG) exhibit an exponential increase in surface pressure under high monolayer compression. In order to understand the molecular origin of this behavior, a combined experimental and theoretical investigation (including surface pressure-area isotherm, X-ray reflectivity (XR) and interfacial rheological measurements, and a self-consistent field (SCF) theoretical analysis) was performed on air-water monolayers formed by a PLGA-PEG diblock copolymer and also by a nonglassy analogue of this diblock copolymer, poly((D,L-lactic acid-ran-glycolic acid-ran-caprolactone)-block-ethylene glycol) (PLGACL-PEG). The combined results of this study show that the two mechanisms, i.e., the glass transition of the collapsed PLGA film and the lateral repulsion of the PEG brush chains that occur simultaneously under lateral compression of the monolayer, are both responsible for the observed PLGA-PEG isotherm behavior. Upon cessation of compression, the high surface pressure of the PLGA-PEG monolayer typically relaxes over time with a stretched exponential decay, suggesting that in this diblock copolymer situation, the hydrophobic domain formed by the PLGA blocks undergoes glass transition in the high lateral compression state, analogously to the PLGA homopolymer monolayer. In the high PEG grafting density regime, the contribution of the PEG brush chains to the high monolayer surface pressure is significantly lower than what is predicted by the SCF model because of the many-body attraction among PEG segments (referred to in the literature as the "n-cluster" effects). The end-grafted PEG chains were found to be protein resistant even under the influence of the "n-cluster" effects.

  3. Exploiting Statistical Methodologies and Controlled Vocabularies for Prioritized Functional Analysis of Genomic Experiments: the StRAnGER Web Application.

    Science.gov (United States)

    Chatziioannou, Aristotelis A; Moulos, Panagiotis

    2011-01-01

    StRAnGER is a web application for the automated statistical analysis of annotated gene profiling experiments, exploiting controlled biological vocabularies, like the Gene Ontology or the KEGG pathways terms. Starting from annotated lists of differentially expressed genes and gene enrichment scores, regarding the terms of each vocabulary, StRAnGER repartitions and reorders the initial distribution of terms to define a new distribution of elements. Each element pools terms holding the same enrichment score. The new distribution thus derived, is reordered in a decreasing order to the right, according to the observation score of the elements, while elements with the same score, are sorted again in a decreasing order of their enrichment scores. By applying bootstrapping techniques, a corrected measure of the statistical significance of these elements is derived, which enables the selection of terms mapped to these elements, unambiguously associated with respective significant gene sets. The selected terms are immunized against the bias infiltrating statistical enrichment analyses, producing technically very high statistical scores, due to the finite nature of the data population. Besides their high statistical score, another selection criterion for the terms is the number of their members, something that incurs a biological prioritization in line with a Systems Biology context. The output derived, represents a detailed ranked list of significant terms, which constitute a starting point for further functional analysis.

  4. Exploiting statistical methodologies and controlled vocabularies for prioritized functional analysis of genomic experiments: The StRAnGER web application

    Directory of Open Access Journals (Sweden)

    Aristotle A Chatziioannou

    2011-01-01

    Full Text Available StRAnGER is a web application for the automated statistical analysis of annotated gene profiling experiments, exploiting controlled biological vocabularies, like the Gene Ontology or the KEGG pathways terms. Starting from annotated lists of differentially expressed genes and gene enrichment scores, regarding the terms of each vocabulary, StRAnGER repartitions and reorders the initial distribution of terms to define a new distribution of elements. Each element pools terms holding the same enrichment score. The new distribution thus derived, is reordered in a decreasing order to the right, according to the observation score of the elements, while elements with the same score, are sorted again in a decreasing order of their enrichment scores. By applying bootstrapping techniques, a corrected measure of the statistical significance of these elements is derived, which enables the selection of terms mapped to these elements, unambiguously associated with respective significant gene sets. The selected terms are immunized against the bias infiltrating statistical enrichment analyses, producing technically very high statistical scores, due to the finite nature of the data population. Besides their high statistical score, another selection criterion for the terms is the number of their members, something that incurs a biological prioritization in line with a Systems Biology context. The output derived, represents a detailed ranked list of significant terms, which constitute a starting point for further functional analysis.

  5. c9RAN translation: a potential therapeutic target for the treatment of amyotrophic lateral sclerosis and frontotemporal dementia.

    Science.gov (United States)

    Gendron, Tania F; Cosio, Danielle M; Petrucelli, Leonard

    2013-09-01

    A hexanucleotide (GGGGCC) repeat expansion within a non-coding region of the C9ORF72 gene is the most common mutation associated with both frontotemporal dementia (FTD) and amyotrophic lateral sclerosis (ALS). Elucidating how these expanded repeats (GGGGCCexp) cause 'c9FTD/ALS' has since become an important goal of the FTD/ALS field. GGGGCCexp transcripts aggregate into discrete nuclear structures, termed RNA foci. This phenomenon, observed in various repeat expansion disorders, is associated with RNA-binding protein sequestration. Of note, recent findings show that GGGGCCexp transcripts also succumb to an alternative fate: repeat-associated non-ATG translation (RAN translation). This unconventional mode of translation, which occurs in the absence of an initiating codon, results in the production of polyGA, polyGP and polyGR peptides. Antibodies generated against these peptides detect high molecular weight, insoluble material in brain homogenates, as well as neuronal inclusions throughout the central nervous system of c9FTD/ALS cases. Given that both foci formation and RAN translation in c9FTD/ALS require the synthesis of GGGGCCexp RNA, therapeutic strategies that target these transcripts and result in their neutralization or degradation could effectively block these two potential pathogenic mechanisms and provide a much needed treatment for c9FTD/ALS.

  6. The Defective Nuclear Lamina in Hutchinson-Gilford Progeria Syndrome Disrupts the Nucleocytoplasmic Ran Gradient and Inhibits Nuclear Localization of Ubc9▿

    Science.gov (United States)

    Kelley, Joshua B.; Datta, Sutirtha; Snow, Chelsi J.; Chatterjee, Mandovi; Ni, Li; Spencer, Adam; Yang, Chun-Song; Cubeñas-Potts, Caelin; Matunis, Michael J.; Paschal, Bryce M.

    2011-01-01

    The mutant form of lamin A responsible for the premature aging disease Hutchinson-Gilford progeria syndrome (termed progerin) acts as a dominant negative protein that changes the structure of the nuclear lamina. How the perturbation of the nuclear lamina in progeria is transduced into cellular changes is undefined. Using patient fibroblasts and a variety of cell-based assays, we determined that progerin expression in Hutchinson-Gilford progeria syndrome inhibits the nucleocytoplasmic transport of several factors with key roles in nuclear function. We found that progerin reduces the nuclear/cytoplasmic concentration of the Ran GTPase and inhibits the nuclear localization of Ubc9, the sole E2 for SUMOylation, and of TPR, the nucleoporin that forms the basket on the nuclear side of the nuclear pore complex. Forcing the nuclear localization of Ubc9 in progerin-expressing cells rescues the Ran gradient and TPR import, indicating that these pathways are linked. Reducing nuclear SUMOylation decreases the nuclear mobility of the Ran nucleotide exchange factor RCC1 in vivo, and the addition of SUMO E1 and E2 promotes the dissociation of RCC1 and Ran from chromatin in vitro. Our data suggest that the cellular effects of progerin are transduced, at least in part, through reduced function of the Ran GTPase and SUMOylation pathways. PMID:21670151

  7. RANS simulations of wind turbine wakes: optimal tuning of turbulence closure and aerodynamic loads from LiDAR and SCADA data

    Science.gov (United States)

    Letizia, Stefano; Puccioni, Matteo; Zhan, Lu; Viola, Francesco; Camarri, Simone; Iungo, Giacomo Valerio

    2017-11-01

    Numerical simulations of wakes produced by utility-scale wind turbines still present challenges related to the variability of the atmospheric conditions and, in the most of the cases, the lack of information about the geometry and aerodynamic performance of the wind turbine blades. In order to overcome the mentioned difficulties, we propose a RANS solver for which turbine aerodynamic forcing and turbulence closure are calibrated through LiDAR and SCADA data acquired for an onshore wind farm. The wind farm under examination is located in North Texas over a relatively flat terrain. The experimental data are leveraged to maximize accuracy of the RANS predictions in terms of wake velocity field and power capture for different atmospheric stability conditions and settings of the wind turbines. The optimization of the RANS parameters is performed through an adjoint-RANS formulation and a gradient-based procedure. The optimally-tuned aerodynamic forcing and turbulence closure are then analyzed in order to investigate effects of the atmospheric stability on the evolution of wind turbine wakes and power performance. The proposed RANS solver has low computational costs comparable to those of wake engineering models, which make it a compelling tool for wind farm control and optimization. Acknowledgments: NSF I/UCRC WindSTAR IIP 1362033 and TACC.

  8. A Mobility Management Using Follow-Me Cloud-Cloudlet in Fog-Computing-Based RANs for Smart Cities.

    Science.gov (United States)

    Chen, Yuh-Shyan; Tsai, Yi-Ting

    2018-02-06

    Mobility management for supporting the location tracking and location-based service (LBS) is an important issue of smart city by providing the means for the smooth transportation of people and goods. The mobility is useful to contribute the innovation in both public and private transportation infrastructures for smart cities. With the assistance of edge/fog computing, this paper presents a fully new mobility management using the proposed follow-me cloud-cloudlet (FMCL) approach in fog-computing-based radio access networks (Fog-RANs) for smart cities. The proposed follow-me cloud-cloudlet approach is an integration strategy of follow-me cloud (FMC) and follow-me edge (FME) (or called cloudlet). A user equipment (UE) receives the data, transmitted from original cloud, into the original edge cloud before the handover operation. After the handover operation, an UE searches for a new cloud, called as a migrated cloud, and a new edge cloud, called as a migrated edge cloud near to UE, where the remaining data is migrated from the original cloud to the migrated cloud and all the remaining data are received in the new edge cloud. Existing FMC results do not have the property of the VM migration between cloudlets for the purpose of reducing the transmission latency, and existing FME results do not keep the property of the service migration between data centers for reducing the transmission latency. Our proposed FMCL approach can simultaneously keep the VM migration between cloudlets and service migration between data centers to significantly reduce the transmission latency. The new proposed mobility management using FMCL approach aims to reduce the total transmission time if some data packets are pre-scheduled and pre-stored into the cache of cloudlet if UE is switching from the previous Fog-RAN to the serving Fog-RAN. To illustrate the performance achievement, the mathematical analysis and simulation results are examined in terms of the total transmission time, the

  9. A Mobility Management Using Follow-Me Cloud-Cloudlet in Fog-Computing-Based RANs for Smart Cities

    Directory of Open Access Journals (Sweden)

    Yuh-Shyan Chen

    2018-02-01

    Full Text Available Mobility management for supporting the location tracking and location-based service (LBS is an important issue of smart city by providing the means for the smooth transportation of people and goods. The mobility is useful to contribute the innovation in both public and private transportation infrastructures for smart cities. With the assistance of edge/fog computing, this paper presents a fully new mobility management using the proposed follow-me cloud-cloudlet (FMCL approach in fog-computing-based radio access networks (Fog-RANs for smart cities. The proposed follow-me cloud-cloudlet approach is an integration strategy of follow-me cloud (FMC and follow-me edge (FME (or called cloudlet. A user equipment (UE receives the data, transmitted from original cloud, into the original edge cloud before the handover operation. After the handover operation, an UE searches for a new cloud, called as a migrated cloud, and a new edge cloud, called as a migrated edge cloud near to UE, where the remaining data is migrated from the original cloud to the migrated cloud and all the remaining data are received in the new edge cloud. Existing FMC results do not have the property of the VM migration between cloudlets for the purpose of reducing the transmission latency, and existing FME results do not keep the property of the service migration between data centers for reducing the transmission latency. Our proposed FMCL approach can simultaneously keep the VM migration between cloudlets and service migration between data centers to significantly reduce the transmission latency. The new proposed mobility management using FMCL approach aims to reduce the total transmission time if some data packets are pre-scheduled and pre-stored into the cache of cloudlet if UE is switching from the previous Fog-RAN to the serving Fog-RAN. To illustrate the performance achievement, the mathematical analysis and simulation results are examined in terms of the total transmission time

  10. In vivo FRET imaging revealed a regulatory role of RanGTP in kinetochore-microtubule attachments via Aurora B kinase.

    Directory of Open Access Journals (Sweden)

    Yoke-Peng Lee

    Full Text Available Under the fluctuating circumstances provided by the innate dynamics of microtubules and opposing tensions resulted from microtubule-associated motors, it is vital to ensure stable kinetochore-microtubule attachments for accurate segregation. However, a comprehensive understanding of how this regulation is mechanistically achieved remains elusive. Using our newly designed live cell FRET time-lapse imaging, we found that post-metaphase RanGTP is crucial in the maintenance of stable kinetochore-microtubule attachments by regulating Aurora B kinase via the NES-bearing Mst1. More importantly, our study demonstrates that by ensuring stable alignment of metaphase chromosomes prior to segregation, RanGTP is indispensible in governing the genomic integrity and the fidelity of cell cycle progression. Our findings suggest an additional role of RanGTP beyond its known function in mitotic spindle assembly during the prometaphase-metaphase transition.

  11. Steady RANS methodology for calculating pressure drop in an in-line molten salt compact crossflow heat exchanger

    Energy Technology Data Exchange (ETDEWEB)

    Carasik, Lane B.; Shaver, Dillon R.; Hassan, Yassin A.; Haefner, Jonah B.

    2017-11-01

    The development of molten salt cooled reactors (MSR) and fluoride-salt cooled high temperature reactors (FHR) requires the use of advanced design tools for the primary heat exchanger design. Due to geometric and flow characteristics, compact (pitch to diameter ratios equal to or less than 1.25) heat exchangers with a crossflow flow arrangement can become desirable for these reactors. Unfortunately, the available experimental data is limited for compact tube bundles or banks in crossflow. Computational Fluid Dynamics can be used to alleviate the lack of experimental data in these tube banks. Previous computational efforts have been primarily focused on large S/D ratios (larger than 1.4) using unsteady Reynolds averaged Navier-Stokes and Large Eddy Simulation frameworks. These approaches are useful, but have large computational requirements that make comprehensive design studies impractical. A CFD study was conducted with steady RANS in an effort to provide a starting point for future design work. The study was performed for an in-line tube bank geometry with FLiBe (LiF-BeF2), a frequently selected molten salt, as the working fluid. Based on the estimated pressure drops, the pressure and velocity distributions in the domain, an appropriate meshing strategy was determined and presented. Periodic boundaries in the spanwise direction transverse flow were determined to be an appropriate boundary condition for reduced computational domains. The domain size was investigated and a minimum of 2-flow channels for a domain is recommended to ensure the behavior is accounted for. Lastly, the standard low Re κ-ε (Lien) turbulence model was determined to be the most appropriate for steady RANS of this case at the time of writing.

  12. Book Review: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War

    DEFF Research Database (Denmark)

    Taudal Poulsen, René

    2016-01-01

    Review of: Lenka Krátká: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War. Stuttgart: Ibidem Verlag, 2015. x + 271 pp., tables, notes, bibliography. ISBN: 978-3-8382-0666-0, £23.90 (pbk).......Review of: Lenka Krátká: A History of the Czechoslovak Ocean Shipping Company, 1948–1989: How a Small, Landlocked Country Ran Maritime Business During the Cold War. Stuttgart: Ibidem Verlag, 2015. x + 271 pp., tables, notes, bibliography. ISBN: 978-3-8382-0666-0, £23.90 (pbk)....

  13. RanBP9 overexpression accelerates loss of pre and postsynaptic proteins in the APΔE9 transgenic mouse brain.

    Science.gov (United States)

    Wang, Hongjie; Wang, Ruizhi; Xu, Shaohua; Lakshmana, Madepalli K

    2014-01-01

    There is now compelling evidence that the neurodegenerative process in Alzheimer's disease (AD) begins in synapses. Loss of synaptic proteins and functional synapses in the amyloid precursor protein (APP) transgenic mouse models of AD is well established. However, what is the earliest age at which such loss of synapses occurs, and whether known markers of AD progression accelerate functional deficits is completely unknown. We previously showed that RanBP9 overexpression leads to robustly increased amyloid β peptide (Aβ) generation leading to enhanced amyloid plaque burden in a mouse model of AD. In this study we compared synaptic protein levels among four genotypes of mice, i.e., RanBP9 single transgenic (Ran), APΔE9 double transgenic (Dbl), APΔE9/RanBP9 triple transgenic (Tpl) and wild-type (WT) controls. We found significant reductions in the levels of synaptic proteins in both cortex and hippocampus of 5- and 6-months-old but not 3- or 4-months-old mice. Specifically, at 5-months of age, rab3A was reduced in the triple transgenic mice only in the cortex by 25% (pproteins in the mouse brain.

  14. Study of laminar separation bubble on low Reynolds number operating airfoils: RANS modelling by means of an high-accuracy solver and experimental verification

    Science.gov (United States)

    Crivellini, A.; D'Alessandro, V.; Di Benedetto, D.; Montelpare, S.; Ricci, R.

    2014-04-01

    This work is devoted to the Computational Fluid-Dynamics (CFD) simulation of laminar separation bubble (LSB) on low Reynolds number operating airfoils. This phenomenon is of large interest in several fields, such as wind energy, and it is characterised by slow recirculating flow at an almost constant pressure. Presently Reynolds Averaged Navier-Stokes (RANS) methods, due to their limited computational requests, are the more efficient and feasible CFD simulation tool for complex engineering applications involving LSBs. However adopting RANS methods for LSB prediction is very challenging since widely used models assume a fully turbulent regime. For this reason several transitional models for RANS equations based on further Partial Differential Equations (PDE) have been recently introduced in literature. Nevertheless in some cases they show questionable results. In this work RANS equations and the standard Spalart-Allmaras (SA) turbulence model are used to deal with LSB problems obtaining promising results. This innovative result is related to: (i) a particular behaviour of the SA equation; (ii) a particular implementation of SA equation; (iii) the use of a high-order discontinuous Galerkin (DG) solver. The effectiveness of the proposed approach is tested on different airfoils at several angles of attack and Reynolds numbers. Numerical results were verified with both experimental measurements performed at the open circuit subsonic wind tunnel of Università Politecnica delle Marche (UNIVPM) and literature data.

  15. Ozsvath, Zsuzsanna: "When the Danube Ran Red"; Mandel, Eva Marika: "Le Livre de Mana"; Roth, Marika: "All the Pretty Shoes; A Memoir of Survival and the Feminine Spirit".

    Directory of Open Access Journals (Sweden)

    Evi Blaikie

    2011-01-01

    Full Text Available Ozsvath, Zsuzsanna. When the Danube Ran Red. Syracuse University Press, 2010,171 pp., Illus.Mandel, Eva Marika. Le Livre de Mana. Paris, Glyphe 2009, 231 pp., Illus.Roth, Marika. All the Pretty Shoes; A Memoir of Survival and the Feminine SpiritWyatt McKenzy 2010, 254 pp., Illus.Reviewed by Evi Blaikie, Freelance Writer.

  16. A lentiviral sponge for miR-101 regulates RanBP9 expression and amyloid precursor protein metabolism in hippocampal neurons

    Directory of Open Access Journals (Sweden)

    Christian eBarbato

    2014-02-01

    Full Text Available Neurodegeneration associated with amyloid β (Aβ peptide accumulation, synaptic loss, and memory impairment are pathophysiological features of Alzheimer's disease (AD. Numerous microRNAs regulate amyloid precursor protein (APP expression and metabolism. We previously reported that miR-101 is a negative regulator of APP expression in cultured hippocampal neurons. In this study, a search for predicted APP metabolism-associated miR-101 targets led to the identification of a conserved miR-101 binding site within the 3’ untranslated region (UTR of the mRNA encoding Ran-binding protein 9 (RanBP9. RanBP9 increases APP processing by β-amyloid converting enzyme 1 (BACE1, secretion of soluble APPβ (sAPPβ, and generation of Aβ. MiR-101 significantly reduced reporter gene expression when co-transfected with a RanBP9 3'-UTR reporter construct, while site-directed mutagenesis of the predicted miR-101 target site eliminated the reporter response. To investigate the effect of stable inhibition of miR-101 both in vitro and in vivo, a microRNA sponge was developed to bind miR-101 and derepress its targets. Four tandem bulged miR-101 responsive elements (REs, located downstream of the enhanced green fluorescence protein (EGFP open reading frame and driven by the synapsin promoter, were placed in a lentiviral vector to create the pLSyn-miR-101 sponge. Delivery of the sponge to primary hippocampal neurons significantly increased both APP and RanBP9 expression, as well as sAPPβ levels in the conditioned medium. Importantly, silencing of endogenous RanBP9 reduced sAPPβ levels in miR-101 sponge-containing hippocampal cultures, indicating that miR-101 inhibition may increase amyloidogenic processing of APP by RanBP9. Lastly, the impact of miR-101 on its targets was demonstrated in vivo by intrahippocampal injection of the pLSyn-miR-101 sponge into C57BL6 mice. This study thus provides the basis for studying the consequences of long-term miR-101 inhibition on

  17. Investigation of Synthetic Jets Efficiency to Control Cavity Flotation with Subsonic External Flow by High-Resolution RANS / ILES Method

    Directory of Open Access Journals (Sweden)

    D. A. Lyubimov

    2015-01-01

    Full Text Available Cavities often found in airplanes: a niche for the landing gear, various weapons, etc. Reducing fluctuations of pressure and temperature in the cavity is a relevant practical problem. The article presents simulation results of external subsonic flow around the cavity (M = 0.85, T = 300K. . Calculations were performed using the high-resolution RANS/ILES (Reynolds Averaged Navier-Stokes - RANS, Implicit Large Eddy Simulation - ILES method. To control flow the authors propose to use synthetic jets. Synthetic jets are produced by periodic ejection and suction of fluid from a slot induced by the movement of a diaphragm (generator of synthetic jets inside a cavity. They are compact and efficient and do not require a special working body and the ways for its supply. Instead of calculating the flow in the synthetic jet generator was used the modified boundary condition on the wall where the output slots was positioned. Under consideration there were two variants of slots for synthetic jets output: in front of the cavity and inside the cavity on the front wall. The frequency and amplitude values of the synthetic jet specified a mode of each jet. For a jet inside the cavity two modes have been reviewed, namely: 100 Hz and 50m/s, 200Hz and 50m/s. For jet in front of the cavity three modes have been reviewed, specifically: 20Hz and 20m/s, 100Hz and 50m/s, 200Hz and 50m/s. Analysis of calculation results showed that for all modes under examination, the synthetic jets reduced fluctuation of static pressure and temperature on the bottom and back walls of the cavity. The mode with parameters 200Hz, 50 m/s and synthetic jet located in front of the cavity was the most efficient. Furthermore, we compared the results of calculations for two-and three-dimensional cavities, which have the same length and depth. Research has shown that the simplified quasi-two-dimensional calculations cannot be used to evaluate the pressure and temperature fluctuations. This is due to

  18. The communities of harvestmen (Opilionida of floodplain forest in the Ranšpurk National Nature Reserve and their fluctuations

    Directory of Open Access Journals (Sweden)

    Hana Šejnohová

    2005-01-01

    Full Text Available During the years 1993–2001 the monitoring of the soil surface fauna was carried out in a floodplain fo- rest in the Ranšpurk National Nature Reserve (south Moravia. The harvestmen assemblages fluctuation is described in detail in this paper. The method of pitfall traps was used. A total of 3174 individuals of seven harvestmen species were collected. The species composition was very similar to other research results from the southern Moravian floodplain forest. Only the dominance values differ from the values in the other localities. All of the registered species prefer moisture and shadow places. The highest abundance was observed in Astrobunus laevipes (Canestrini, 1872, Nemastoma lugubre (Müller, 1776, Oligolophus tridens (C. L. Koch, 1936 and Rilaena triangularis (Herbst, 1799. The dynamics of harvestmen occurrence during the year had a different development than in other groups of invertebrates. Harvestmen mostly occurred in pitfall traps in autumn and winter months. The highest abundance of harvestmen in traps was observed in December and January. In July 1997, disastrous flood affected all groups of invertebrates. The flood had a minimal impact on the abundance of harvestmen in pitfall traps.

  19. Proactive monitoring of an onshore wind farm through lidar measurements, SCADA data and a data-driven RANS solver

    Science.gov (United States)

    Iungo, Giacomo Valerio; Camarri, Simone; Ciri, Umberto; El-Asha, Said; Leonardi, Stefano; Rotea, Mario A.; Santhanagopalan, Vignesh; Viola, Francesco; Zhan, Lu

    2016-11-01

    Site conditions, such as topography and local climate, as well as wind farm layout strongly affect performance of a wind power plant. Therefore, predictions of wake interactions and their effects on power production still remain a great challenge in wind energy. For this study, an onshore wind turbine array was monitored through lidar measurements, SCADA and met-tower data. Power losses due to wake interactions were estimated to be approximately 4% and 2% of the total power production under stable and convective conditions, respectively. This dataset was then leveraged for the calibration of a data driven RANS (DDRANS) solver, which is a compelling tool for prediction of wind turbine wakes and power production. DDRANS is characterized by a computational cost as low as that for engineering wake models, and adequate accuracy achieved through data-driven tuning of the turbulence closure model. DDRANS is based on a parabolic formulation, axisymmetry and boundary layer approximations, which allow achieving low computational costs. The turbulence closure model consists in a mixing length model, which is optimally calibrated with the experimental dataset. Assessment of DDRANS is then performed through lidar and SCADA data for different atmospheric conditions. This material is based upon work supported by the National Science Foundation under the I/UCRC WindSTAR, NSF Award IIP 1362033.

  20. Enhancing LTE with Cloud-RAN and Load-Controlled Parasitic Antenna Arrays

    DEFF Research Database (Denmark)

    Artuso, Matteo; Boviz, Dora; Checko, Aleksandra

    2016-01-01

    Cloud radio access network systems, consisting of remote radio heads densely distributed in a coverage area and connected by optical fibers to a cloud infrastructure with large computational capabilities, have the potential to meet the ambitious objectives of next generation mobile networks. Actu...

  1. Development of an AD/RANS model for predicting wind turbine wakes

    DEFF Research Database (Denmark)

    Tian, Linlin; Zhu, Wei Jun; Shen, Wen Zhong

    2013-01-01

    methods together. The simulations are performed by using the in-house flow solver EllipSys3D coupled with the actuator disc (AD) methodology. The main objective of the proposed model is to control the turbulence decay caused by the intrinsic property of the two-equation turbu-lence model and further...... increasing the pre-dicted turbulence intensity through correct-ing the destruction terms. To validate the proposed method, comparisons are carried out between measurements and other nu-merical simulations for the Nibe B wind tur-bine. Results show that the newly developed model can provide satisfactory...... predictions for the wind speed deficit and the turbulence intensity....

  2. The productivity and its barriers in public hospitals: case study of ran.

    Science.gov (United States)

    Nabilou, Bahram; Yusefzadeh, Hassan; Rezapour, Aziz; Ebadi Fard Azar, Farbod; Salem Safi, Parviz; Sarabi Asiabar, Ali; Ahmadzadeh, Nahal

    2016-01-01

    Due to the increasing health care costs, the issue of productivity in hospitals must be taken into great consideration in order to provide, preserve and promote public health services. Thus, increasing the level of productivity must become the main aim of any hospital. Objective of this study is to determine the total factor productivity and its components over the period under the study. In this cross sectional study, total factor productivity changes of hospitals affiliated to Tehran University of Medical Sciences were measured according to Malmquist index over the period 2009-2014. To estimate total productivity changes using Data Envelopment Analysis method, inputoriented and variable return to scale assumptions were applied and Deap2.1 software was used. The mean value of total productivity changes was 1.013. It means that during the study period the productivity experienced a 1.3% decrease. Technological efficiency changes have the greatest influence on productivity decrease than the other factors. Scale efficiency, managerial efficiency and technical efficiency changes were ranked. Lack of knowledge of hospital personnel on proper application of technology in patient treatment is the main factor leading to productivity decrease resulting from technological changes in the studied hospitals. Therefore, holding courses for personnel in order to teach them the proper use of technology in diagnosis and patient care can be helpful.

  3. Writing Beyond the Wall: Translation, Cross-cultural Exchange, and Chen Ran's 'A Private Life'

    Directory of Open Access Journals (Sweden)

    Kay Schaffer

    2006-09-01

    Full Text Available The past decade has witnessed an unprecedented rise in the global flow of knowledge, nowhere more apparent in the exchange of ideas between China and modern western democracies. Our interest concerns one aspect of this global flow— the translation of Chinese women’s autobiographical writing into English. Taking Chen Ran’s A Private Life (English edition, 2004 as a point of departure, the paper explores issues of translingual practice and cross-cultural exchange. It considers what escapes or is lost in translation as well as the additive potential of the host text. It is sometimes the case that the translation can deliberately make certain ambiguities visible—whether from pragmatic, market-driven motivations or from more complex political, historical and cultural considerations. These negotiations of meaning that occur in the translation process can reverberate on the critical reception of texts in both the ‘guest’ and ‘host’ languages (Liu 1995, with open-ended, incomplete and indeterminate effects. The paper examines the effects of the omission of a brief parenthetical section of three paragraphs from one chapter of the Chinese edition of A Private Life. Yet, even that small emendation changes the original text as a cultural object and alters potential modes of its reception. In this case, the translation results in a loss of ambiguity, irony, philosophic and rhetorical sophistication while also offering additive potentials that enhance the generation of new meanings in the translingual exchange, here with reference Tiananmen and contemporary feminism in China. The translation process provides new channels for readers, writers and theorists to dialogue and communicate across gaps of difference, despite inhibiting factors like the imposition of local restraints, the universalising pressures of western modernity, and asymmetrical relations of power between guest and host language contexts.

  4. Simulation du givrage sur ailes en fleche par methodes RANS/Eulerienne quasi stationnaires

    Science.gov (United States)

    Bourgault-Cote, Simon

    Numerical simulations are becoming increasingly used by engineers in the design and certification processes, especially in aeronautics where flight tests are so expensive. The numerical tools used by the industry are continuously improved in order to simulate and analyse almost every physical behaviors of airplanes. This technology development was not done in all domains though, which is the case of inflight ice accretion softwares. These comprise many modules solving different physical phenomena in order to obtain ice accretion shapes on the airplanes in various atmospheric conditions. These modules are an airflow solver, a droplet flow solver, a thermodynamic solver and a geometry evolution algorithm. If any of these presents a lack of precision, the final results can be wrong and the whole process is jeopardized. Even then, the softwares used by the industry are based on low fidelity technology in each modules. In fact, these softwares were developed in the early 90's and were not improved with the new techniques developed since year 2000. These techniques are simply too complex to implement, which is risky for a company. Nevertheless, as the certification authorities are increasing the icing constraints on the industry, a massive change is required in these icing simulation tools. This is why Bombardier Aeronautic showed interest in the development of a new state-of-the-art icing simulation software. A collaborative project was then started with Polytechnique Montreal, under the supervision of prof. Eric Laurendeau, in order to implement and validate the best techniques in icing while in academia, where risks are low. The project consists of two main objectives. First, a two-dimensional inflight ice accretion software needs to be developed with robustness, efficiency and automation as its main characteristics. Then, some three-dimensional icing should be simulated with a proper numerical model added to the two-dimensional software, without requiring the same

  5. Origin of the nucleus and Ran-dependent transport to safeguard ribosome biogenesis in a chimeric cell

    Directory of Open Access Journals (Sweden)

    Jékely Gáspár

    2008-07-01

    Full Text Available Abstract Background The origin of the nucleus is a central problem about the origin of eukaryotes. The common ancestry of nuclear pore complexes (NPC and vesicle coating complexes indicates that the nucleus evolved via the modification of a pre-existing endomembrane system. Such an autogenous scenario is cell biologically feasible, but it is not clear what were the selective or neutral mechanisms that had led to the origin of the nuclear compartment. Results A key selective force during the autogenous origin of the nucleus could have been the need to segregate ribosome factories from the cytoplasm where ribosomal proteins (RPs of the protomitochondrium were synthesized. After its uptake by an anuclear cell the protomitochondrium transferred several of its RP genes to the host genome. Alphaproteobacterial RPs and archaebacterial-type host ribosomes were consequently synthesized in the same cytoplasm. This could have led to the formation of chimeric ribosomes. I propose that the nucleus evolved when the host cell compartmentalised its ribosome factories and the tightly linked genome to reduce ribosome chimerism. This was achieved in successive stages by first evolving karyopherin and RanGTP dependent chaperoning of RPs, followed by the evolution of a membrane network to serve as a diffusion barrier, and finally a hydrogel sieve to ensure selective permeability at nuclear pores. Computer simulations show that a gradual segregation of cytoplasm and nucleoplasm via these steps can progressively reduce ribosome chimerism. Conclusion Ribosome chimerism can provide a direct link between the selective forces for and the mechanisms of evolving nuclear transport and compartmentalisation. The detailed molecular scenario presented here provides a solution to the gradual evolution of nuclear compartmentalization from an anuclear stage. Reviewers This article was reviewed by Eugene V Koonin, Martijn Huynen, Anthony M. Poole and Patrick Forterre.

  6. Proactive monitoring of a wind turbine array with lidar measurements, SCADA data and a data-driven RANS solver

    Science.gov (United States)

    Iungo, G.; Said, E. A.; Santhanagopalan, V.; Zhan, L.

    2016-12-01

    Power production of a wind farm and durability of wind turbines are strongly dependent on non-linear wake interactions occurring within a turbine array. Wake dynamics are highly affected by the specific site conditions, such as topography and local atmospheric conditions. Furthermore, contingencies through the life of a wind farm, such as turbine ageing and off-design operations, make prediction of wake interactions and power performance a great challenge in wind energy. In this work, operations of an onshore wind turbine array were monitored through lidar measurements, SCADA and met-tower data. The atmospheric wind field investing the wind farm was estimated by using synergistically the available data through five different methods, which are characterized by different confidence levels. By combining SCADA data and the lidar measurements, it was possible to estimate power losses connected with wake interactions. For this specific array, power losses were estimated to be 4% and 2% of the total power production for stable and convective atmospheric regimes, respectively. The entire dataset was then leveraged for the calibration of a data-driven RANS (DDRANS) solver for prediction of wind turbine wakes and power production. The DDRANS is based on a parabolic formulation of the Navier-Stokes equations with axisymmetry and boundary layer approximations, which allow achieving very low computational costs. Accuracy in prediction of wind turbine wakes and power production is achieved through an optimal tuning of the turbulence closure model. The latter is based on a mixing length model, which was developed based on previous wind turbine wake studies carried out through large eddy simulations and wind tunnel experiments. Several operative conditions of the wind farm under examination were reproduced through DDRANS for different stability regimes, wind directions and wind velocity. The results show that DDRANS is capable of achieving a good level of accuracy in prediction

  7. Analysis of multiuser mixed RF/FSO relay networks for performance improvements in Cloud Computing-Based Radio Access Networks (CC-RANs)

    Science.gov (United States)

    Alimi, Isiaka A.; Monteiro, Paulo P.; Teixeira, António L.

    2017-11-01

    The key paths toward the fifth generation (5G) network requirements are towards centralized processing and small-cell densification systems that are implemented on the cloud computing-based radio access networks (CC-RANs). The increasing recognitions of the CC-RANs can be attributed to their valuable features regarding system performance optimization and cost-effectiveness. Nevertheless, realization of the stringent requirements of the fronthaul that connects the network elements is highly demanding. In this paper, considering the small-cell network architectures, we present multiuser mixed radio-frequency/free-space optical (RF/FSO) relay networks as feasible technologies for the alleviation of the stringent requirements in the CC-RANs. In this study, we use the end-to-end (e2e) outage probability, average symbol error probability (ASEP), and ergodic channel capacity as the performance metrics in our analysis. Simulation results show the suitability of deployment of mixed RF/FSO schemes in the real-life scenarios.

  8. Numerical investigation of the vortex-induced vibration of an elastically mounted circular cylinder at high Reynolds number (Re = 104 and low mass ratio using the RANS code.

    Directory of Open Access Journals (Sweden)

    Niaz Bahadur Khan

    Full Text Available This study numerically investigates the vortex-induced vibration (VIV of an elastically mounted rigid cylinder by using Reynolds-averaged Navier-Stokes (RANS equations with computational fluid dynamic (CFD tools. CFD analysis is performed for a fixed-cylinder case with Reynolds number (Re = 104 and for a cylinder that is free to oscillate in the transverse direction and possesses a low mass-damping ratio and Re = 104. Previously, similar studies have been performed with 3-dimensional and comparatively expensive turbulent models. In the current study, the capability and accuracy of the RANS model are validated, and the results of this model are compared with those of detached eddy simulation, direct numerical simulation, and large eddy simulation models. All three response branches and the maximum amplitude are well captured. The 2-dimensional case with the RANS shear-stress transport k-w model, which involves minimal computational cost, is reliable and appropriate for analyzing the characteristics of VIV.

  9. Impairments in age-dependent ubiquitin proteostasis and structural integrity of selective neurons by uncoupling Ran GTPase from the Ran-binding domain 3 of Ranbp2 and identification of novel mitochondrial isoforms of ubiquitin-conjugating enzyme E2I (ubc9) and Ranbp2.

    Science.gov (United States)

    Patil, Hemangi; Yoon, Dosuk; Bhowmick, Reshma; Cai, Yunfei; Cho, Kyoung-In; Ferreira, Paulo A

    2017-09-06

    The Ran-binding protein 2 (Ranbp2/Nup358) is a cytoplasmic and peripheral nucleoporin comprised of 4 Ran-GTP-binding domains (RBDs) that are interspersed among diverse structural domains with multifunctional activities. Our prior studies found that the RBD2 and RBD3 of Ranbp2 control mitochondrial motility independently of Ran-GTP-binding in cultured cells, whereas loss of Ran-GTP-binding to RBD2 and RBD3 are essential to support cone photoreceptor development and the survival of mature retinal pigment epithelium (RPE) in mice. Here, we uncover that loss of Ran-GTP-binding to RBD3 alone promotes the robust age-dependent increase of ubiquitylated substrates and S1 subunit (Pmsd1) of the 19S cap of the proteasome in the retina and RPE and that such loss in RBD3 also compromises the structural integrity of the outer segment compartment of cone photoreceptors only and without affecting the viability of these neurons. We also found that the E2-ligase and partner of Ranbp2, ubc9, is localized prominently in the mitochondrial-rich ellipsoid compartment of photoreceptors, where Ranbp2 is also known to localize with and modulate the activity of mitochondrial proteins. However, the natures of Ranbp2 and ubc9 isoforms to the mitochondria are heretofore elusive. Subcellular fractionation, co-immunolocalization and immunoaffinity purification of Ranbp2 complexes show that novel isoforms of Ranbp2 and ubc9 with molecular masses distinct from the large Ranbp2 and unmodified ubc9 isoforms localize specifically to the mitochondrial fraction or associate with mitochondrial components, whereas unmodified and SUMOylated Ran GTPase are excluded from the mitochondrial fraction. Further, liposome-mediated intracellular delivery of an antibody against a domain shared by the mitochondrial and nuclear pore isoforms of Ranbp2 causes the profound fragmentation of mitochondria and their delocalization from Ranbp2 and without affecting Ranbp2 localization at the nuclear pores. Collectively, the

  10. The interaction of RNA helicase DDX3 with HIV-1 Rev-CRM1-RanGTP complex during the HIV replication cycle.

    Science.gov (United States)

    Mahboobi, Seyed Hanif; Javanpour, Alex A; Mofrad, Mohammad R K

    2015-01-01

    Molecular traffic between the nucleus and the cytoplasm is regulated by the nuclear pore complex (NPC), which acts as a highly selective channel perforating the nuclear envelope in eukaryotic cells. The human immunodeficiency virus (HIV) exploits the nucleocytoplasmic pathway to export its RNA transcripts across the NPC to the cytoplasm. Despite extensive study on the HIV life cycle and the many drugs developed to target this cycle, no current drugs have been successful in targeting the critical process of viral nuclear export, even though HIV's reliance on a single host protein, CRM1, to export its unspliced and partially spliced RNA transcripts makes it a tempting target. Due to recent findings implicating a DEAD-box helicase, DDX3, in HIV replication and a member of the export complex, it has become an appealing target for anti-HIV drug inhibition. In the present research, we have applied a hybrid computational protocol to analyze protein-protein interactions in the HIV mRNA export cycle. This method is based on molecular docking followed by molecular dynamics simulation and accompanied by approximate free energy calculation (MM/GBSA), computational alanine scanning, clustering, and evolutionary analysis. We highlight here some of the most likely binding modes and interfacial residues between DDX3 and CRM1 both in the absence and presence of RanGTP. This work shows that although DDX3 can bind to free CRM1, addition of RanGTP leads to more concentrated distribution of binding modes and stronger binding between CRM1 and RanGTP.

  11. Prediction of dosage-based parameters from the puff dispersion of airborne materials in urban environments using the CFD-RANS methodology

    Science.gov (United States)

    Efthimiou, G. C.; Andronopoulos, S.; Bartzis, J. G.

    2018-02-01

    One of the key issues of recent research on the dispersion inside complex urban environments is the ability to predict dosage-based parameters from the puff release of an airborne material from a point source in the atmospheric boundary layer inside the built-up area. The present work addresses the question of whether the computational fluid dynamics (CFD)-Reynolds-averaged Navier-Stokes (RANS) methodology can be used to predict ensemble-average dosage-based parameters that are related with the puff dispersion. RANS simulations with the ADREA-HF code were, therefore, performed, where a single puff was released in each case. The present method is validated against the data sets from two wind-tunnel experiments. In each experiment, more than 200 puffs were released from which ensemble-averaged dosage-based parameters were calculated and compared to the model's predictions. The performance of the model was evaluated using scatter plots and three validation metrics: fractional bias, normalized mean square error, and factor of two. The model presented a better performance for the temporal parameters (i.e., ensemble-average times of puff arrival, peak, leaving, duration, ascent, and descent) than for the ensemble-average dosage and peak concentration. The majority of the obtained values of validation metrics were inside established acceptance limits. Based on the obtained model performance indices, the CFD-RANS methodology as implemented in the code ADREA-HF is able to predict the ensemble-average temporal quantities related to transient emissions of airborne material in urban areas within the range of the model performance acceptance criteria established in the literature. The CFD-RANS methodology as implemented in the code ADREA-HF is also able to predict the ensemble-average dosage, but the dosage results should be treated with some caution; as in one case, the observed ensemble-average dosage was under-estimated slightly more than the acceptance criteria. Ensemble

  12. Prediction of dosage-based parameters from the puff dispersion of airborne materials in urban environments using the CFD-RANS methodology

    Science.gov (United States)

    Efthimiou, G. C.; Andronopoulos, S.; Bartzis, J. G.

    2017-02-01

    One of the key issues of recent research on the dispersion inside complex urban environments is the ability to predict dosage-based parameters from the puff release of an airborne material from a point source in the atmospheric boundary layer inside the built-up area. The present work addresses the question of whether the computational fluid dynamics (CFD)-Reynolds-averaged Navier-Stokes (RANS) methodology can be used to predict ensemble-average dosage-based parameters that are related with the puff dispersion. RANS simulations with the ADREA-HF code were, therefore, performed, where a single puff was released in each case. The present method is validated against the data sets from two wind-tunnel experiments. In each experiment, more than 200 puffs were released from which ensemble-averaged dosage-based parameters were calculated and compared to the model's predictions. The performance of the model was evaluated using scatter plots and three validation metrics: fractional bias, normalized mean square error, and factor of two. The model presented a better performance for the temporal parameters (i.e., ensemble-average times of puff arrival, peak, leaving, duration, ascent, and descent) than for the ensemble-average dosage and peak concentration. The majority of the obtained values of validation metrics were inside established acceptance limits. Based on the obtained model performance indices, the CFD-RANS methodology as implemented in the code ADREA-HF is able to predict the ensemble-average temporal quantities related to transient emissions of airborne material in urban areas within the range of the model performance acceptance criteria established in the literature. The CFD-RANS methodology as implemented in the code ADREA-HF is also able to predict the ensemble-average dosage, but the dosage results should be treated with some caution; as in one case, the observed ensemble-average dosage was under-estimated slightly more than the acceptance criteria. Ensemble

  13. A stable chemical SUMO1-Ubc9 conjugate specifically binds as a thioester mimic to the RanBP2-E3 ligase complex.

    Science.gov (United States)

    Sommer, Stefanie; Ritterhoff, Tobias; Melchior, Frauke; Mootz, Henning D

    2015-05-26

    Ubiquitin and ubiquitin-like (Ubl) modifiers such as SUMO are conjugated to substrate proteins by E1, E2, and E3 enzymes. In the presence of an E3 ligase, the E2∼Ubl thioester intermediate becomes highly activated and is prone to chemical decomposition, thus making biochemical and structural studies difficult. Here we explored a stable chemical conjugate of the E2 enzyme from the SUMO pathway, Ubc9, with its modifier SUMO1 as a structural analogue of the Ubc9∼SUMO1 thioester intermediate, by introducing a triazole linkage by biorthogonal click chemistry. The chemical conjugate proved stable against proteolytic cleavage, in contrast to a Ubc9-SUMO1 isopeptide analogue obtained by auto-SUMOylation. Triazole-linked Ubc9-SUMO1 bound specifically to the preassembled E3 ligase complex RanBP2/RanGAP1*SUMO1/Ubc9, thus suggesting that it is a suitable thioester mimic. We anticipate interesting prospects for its use as a research tool to study protein complexes involving E2 and E3 enzymes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. From DNS to RANS: A Multi-model workflow to understand the Influence of Hurricanes on Generating Turbidity Currents in the Gulf of Mexico

    Science.gov (United States)

    Syvitski, J. P.; Arango, H.; Harris, C. K.; Meiburg, E. H.; Jenkins, C. J.; Auad, G.; Hutton, E.; Kniskern, T. A.; Radhakrishnan, S.

    2016-12-01

    A loosely coupled numerical workflow is developed to address land-sea pathways for sediment routing from terrestrial and coastal sources, across the continental shelf and ultimately down the continental slope canyon system of the northern Gulf of Mexico (GOM). Model simulations represent a range of environmental conditions that might lead to the generation of turbidity-currents. The workflow comprises: 1) A simulator for the water and sediment discharged from rivers into the GOM with WMBsedv2 with calibration using USGS and USACE gauged river data; 2) Domain grids and bathymetry (ETOPO2) for the ocean models and realistic seabed sediment texture grids (dbSEABED) for the sediment transport models; 3) A spectral wave action simulator (10 km resolution) (WaveWatch III) driven by GFDL - GFS winds; 4) A simulator for ocean dynamics (ROMS) forced with ECMWF ERA winds; 5) A simulator for seafloor resuspension and transport (CSTMS); 6) Simulators (HurriSlip) of seafloor failure and flow ignition locations for boundary input to a turbidity current model; and 7) A RANS turbidity current model (TURBINS) to route sediment flows down GOM canyons, providing estimates of bottom shear stresses. TURBINS was developed first as a DNS model and then converted to an LES model wherein a dynamic turbulence closure scheme was employed. Like most DNS to LES model comparisons (these being done by the UCSB team), turbulence scaling allowed for higher Re applications but were found still not capable of simulating field scale (GOM continental canyons) environments. The LES model was next converted to a non-hydrostatic RANS model capable of field scale applications but only with a daisy-chain approach to multiple model runs along the simulated canyon floor. These model adaptations allowed the workflow to be tested for the year 1-Oct-2007 to 30-Sep-2008 that included two domain Hurricanes (Ike and Gustav). The RANS-TURBINS employed further boundary simplifications on both sediment erosion and

  15. Desenvolvimento de um novo método RANS-based para a aeroacústica computacional de jatos de alta velocidade.

    OpenAIRE

    Carlos Roberto Ilário da Silva

    2011-01-01

    Uma nova ferramenta de aeroacústica computacional baseada em simulações RANS (Reynolds Averaged Navier-Stokes) foi desenvolvida para a predição do ruído gerado pelo escoamento tri-dimensional de jatos complexos. O método é denominado de LRT o qual surgiu da combinação da analogia acústica de Lighthill com o método de acústica geométrica Ray-Tracing. A grande vantagem da utilização do método LRT para predições de ruído é que este determina não apenas as fontes sonoras presentes...

  16. Wave breaking in the surf zone and deep-water in a non-hydrostatic RANS model. Part 2: Turbulence and mean circulation

    Science.gov (United States)

    Derakhti, Morteza; Kirby, James T.; Shi, Fengyan; Ma, Gangfeng

    2016-11-01

    Field-scale modeling of wave-breaking-induced turbulence and mean circulation is still challenging. Although Boussinesq-type models have been successfully used to study field-scale wave transformation and wave-breaking-driven circulation, they cannot provide turbulence or the vertical structure of the velocity field. In addition, the applicability of such models is limited to shallow water. In Part 1 (Derakhti et al., 2016b) of this study, we showed that the non-hydrostatic σ-coordinate RANS model NHWAVE, as described by Derakhti et al. (2016a), accurately predicts organized wave motions and total wave-breaking-induced energy dissipation from deep-water up to the swash zone using a few vertical σ-layers. In this paper, our goal is to examine what level of detail of wave-breaking-induced turbulence and mean circulation, both in depth- and steepness-limited breaking waves, can be reproduced by NHWAVE. Further, effects of modeled turbulent eddy viscosity on the predicted time-averaged velocity distribution is discussed. We establish that NHWAVE is capable of predicting the structure of the mean velocity and vorticity fields including large-scale breaking-induced coherent vortices in deep-water breaking events; where the absence of turbulence-induced eddy viscosity results in the overprediction of the velocity and vorticity field in the breaking region. We show that NHWAVE reduces the required CPU time up to two orders of magnitude in comparison with a comparable VOF-based simulation.

  17. Dependence of solvent quality on the composition of copolymers: experiment and theory for solutions of P(MMA-ran-t-BMA) in toluene and in chloroform.

    Science.gov (United States)

    Bercea, Maria; Wolf, Bernhard A

    2015-01-21

    The interaction of toluene with P(MMA-ran-t-BMA) and with the corresponding homopolymers was determined via vapor pressure measurements at 30, 50 and 70 °C. A unified thermodynamic approach served for the modeling of the results. It is capable of describing the behavior of the different solutions by means of two adjustable parameters, one representing the effective number of solvent segments and the other accounting for the interactions between the components. The solvent quality of toluene passes a maximum, a minimum and another maximum upon an increase of the t-BMA content of the copolymer at all temperatures. A similar behavior is discernable from vapor pressure data of chloroform published for the same copolymers. The heats of mixing for toluene depend strongly on temperature; at 50 °C they are all endothermal with the exception of PMMA, for which the value obtained from vapor pressures at 30 °C agrees very well with published caloric data.

  18. RANS computations for identification of 1-D cavitation model parameters: application to full load cavitation vortex rope

    Science.gov (United States)

    Alligné, S.; Decaix, J.; Müller, A.; Nicolet, C.; Avellan, F.; Münch, C.

    2017-04-01

    Due to the massive penetration of alternative renewable energies, hydropower is a key energy conversion technology for stabilizing the electrical power network by using hydraulic machines at off design operating conditions. At full load, the axisymmetric cavitation vortex rope developing in Francis turbines acts as an internal source of energy, leading to an instability commonly referred to as self-excited surge. 1-D models are developed to predict this phenomenon and to define the range of safe operating points for a hydropower plant. These models require a calibration of several parameters. The present work aims at identifying these parameters by using CFD results as objective functions for an optimization process. A 2-D Venturi and 3-D Francis turbine are considered.

  19. Wave breaking in the surf zone and deep-water in a non-hydrostatic RANS model. Part 1: Organized wave motions

    Science.gov (United States)

    Derakhti, Morteza; Kirby, James T.; Shi, Fengyan; Ma, Gangfeng

    2016-11-01

    We examine wave-breaking predictions ranging from shallow- to deep-water conditions using a non-hydrostatic σ-coordinate RANS model NHWAVE as described in Derakhti et al. (2016a), comparing results both with corresponding experiments and with the results of a volume-of-fluid (VOF)/Navier-Stokes solver (Ma et al., 2011; Derakhti and Kirby, 2014a,b). Our study includes regular and irregular depth-limited breaking waves on planar and barred beaches as well as steepness-limited unsteady breaking focused wave packets in intermediate and deep water. In Part 1 of this paper, it is shown that the model resolves organized wave motions in terms of free-surface evolution, spectral evolution, organized wave velocity evolution and wave statistics, using a few vertical σ-levels. In addition, the relative contribution of modeled physical dissipation and numerical dissipation to the integral breaking-induced wave energy loss is discussed. In steepness-limited unsteady breaking focused wave packets, the turbulence model has not been triggered, and all the dissipation is imposed indirectly by the numerical scheme. Although the total wave-breaking-induced energy dissipation is underestimated in the unsteady wave packets, the model is capable of predicting the dispersive and nonlinear properties of different wave packet components before and after the break point, as well as the overall wave height decay and the evolution of organized wave velocity field and power spectrum density over the breaking region. In Part 2 (Derakhti et al., 2016b), model reproduction of wave-breaking-induced turbulence and mean circulation is examined in detail. The same equations and numerical methods are used for the various depth regimes, and no ad-hoc treatment, such as imposing hydrostatic conditions, is involved in triggering breaking. Vertical grid resolution in all simulated cases is at least an order of magnitude coarser than that of typical VOF-based simulations.

  20. Tendency towards the Self-Citation among Journals in Iran and Turkey / İran ve Türkiye Dergilerinde Kendine Atıf Yapma Eğilimleri

    Directory of Open Access Journals (Sweden)

    Mohammad Hossein Biglu

    2007-10-01

    Full Text Available AbstractThis paper investigates the trends of Impact Factors and self-citation rates of journals indexed in the JCR by two neighbouring countries Iran and Turkey for a period of five years (2000- 2005. All data extracted from the Journal Citation Reports – Science Edition (2000-2005. The study showed that the portion of Turkish journals entering data to the JCR data bank is two times higher than the portion of Iranian journals. From a total number of 6,088 journals in the JCR in 2005, 3 (0.05% were published in Iran and the same number of journals published in Turkey. The 6,088 journals in the JCR produced 847,114 articles, 159 (0.02% appeared in the Iranian journals and 352 (0.04% in the Turkish journals. Of the 22,353,992 citations in 2005, 214 (0.001% came from Iranian journals and 911 (0.004% came from Turkish journals.The self-citation tendency by Iranian journals has increased dramatically throughout the period of study, it reached from 8% self-citation rate in 2000 to 18% in 2005, an increase of 2.25 times, whereas the self-citation rate by Turkish journals showed a negative trend, its self-citation rate fell from 22% in 2002 to 15% in 2005. The Impact Factors of Turkish journals showed faster growth than the Iranian journals, the mean value of Impact Factor for Turkish journals in 2000 was 0.49 under than the mean value of Impact Factor for Iranian journals, but in 2005 the mean value of Impact Factor for Turkish journals stayed 0.14 higher than the mean value of Impact Factor for Iranian journalsÖzBu makale, iki komşu ülke, İran ve Türkiye tarafından 5 yıl (2000-2005 içinde üretilen yayınlardan JCR’de dizinlenen dergilerdeki kendine atıfları ve etki faktöründeki eğilimleri incelemektedir. Bütün veriler JCR-Science Edition (2000-2005’den alınmıştır. Çalışma, Türk dergilerinin İran dergilerinden iki kat fazla miktarda JCR’ye girdiğini göstermektedir. 2005 yılında JCR’de yer alan toplam 6

  1. Humidity-dependent compression-induced glass transition of the air–water interfacial Langmuir films of poly(D,L-lactic acid-ran-glycolic acid) (PLGA)

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Chang; Lee, Hoyoung; Jung, Hyunjung; Choi, Yun Hwa; Meron, Mati; Lin, Binhua; Bang, Joona; Won, You-Yeon (KUS); (UC); (Purdue)

    2015-08-26

    Constant rate compression isotherms of the air–water interfacial Langmuir films of poly(D,L-lactic acid-ran-glycolic acid) (PLGA)show a distinct feature of an exponential increase in surface pressure in the high surface polymer concentration regime. We have previously demonstrated that this abrupt increase in surface pressure is linked to the glass transition of the polymer film, but the detailed mechanism of this process is not understood. In order to obtain a molecular-level understanding of this behavior, we performed extensive characterizations of the surface mechanical, structural and rheological properties of Langmuir PLGA films at the air–water interface, using combined experimental techniques including the Langmuir film balance, X-ray reflectivity and double-wall-ring interfacial rheometry methods.

  2. Influence of a roughness length error on vertical wind speed extrapolation for 2D ideal hills using an OpenFOAM® RANS simulation

    Directory of Open Access Journals (Sweden)

    Einav-Levy Hanan

    2014-01-01

    Full Text Available In modelling wind flow over a flat and complex terrain, the choice of roughness-length-distribution is critical for accurate wind speed predications. This choice is often made based on the Davenport scale [1]. A satellite or aerial image of the location is used [2–4] and subjective or objective measures are used for translating the image into roughness length - z0 - based on the Davenport scale. The choice of a Davenport table value is generally regarded as within an error of plus or minus one table value, leading to a ±6% error in wind speed predictions for a flat terrain in neutral conditions [5]. In the paper this error is studied for a non-flat terrain, using a series of CFD simulations for 2D hills of various combinations of aspect ratio and steepness. Results show that the wind speed prediction error as a result of a “wrong” parameterization decreases with hill steepness until separation occurs. As a result of separation the error increases slightly, and then decreases again with a further increase in hill steepness.

  3. Numerical CFD Comparison of Lillgrund Employing RANS

    DEFF Research Database (Denmark)

    Simisiroglou, N.; Breton, S.-P.; Crasto, G.

    2014-01-01

    The following article will validate the results obtained using the actuator disc method in the state of the art numerical Computational Fluid Dynamic (CFD) tool WindSim using on-site measurements from the offshore wind farm Lillgrund. WindSim solves the mass, momentum and energy conservation...

  4. On the stagnation point anomaly of RANS

    OpenAIRE

    野村, 駿; 島, 信行; Takashi, NOMURA; Nobuyuki, SHIMA; 静大院; 静大工; Shizuoka Univ.

    2010-01-01

    In impinging flows, most Reynolds-averaged turbulence models severely overpredict the wall-normal turbulence intensity on the stagnation streamline (The stagnation point anomaly). In the present study, plane impinging flows are predicted using a second-moment closure which employs a stress redistribution model proposed by Shima and Kobayashi (2007) with an additional redistribution term. The closure dissolves the stagnation point anomaly in spite of a simple "standard" ε transport equation ad...

  5. Steps Towards Automated Robust RANS Meshing

    OpenAIRE

    Tomac, Maximilian; Eller, David

    2013-01-01

    The creation of high-quality discretizations for use in viscous flow simulations remains a challenging task. Even with modern software tools and substantial human effort, the application of state-of-the-art mesh generation algorithms in the presence of geometric features such as concave corners may still result in inadequate local mesh configurations, which can severely affect the resolution of important flow features. To address such issues, mesh generation tools for hybrid unstructured grid...

  6. Vingt ans de recherches à Saint-Véran, Hautes Alpes: état des connaissances de l’activité de production de cuivre à l’âge du Bronze ancien

    Directory of Open Access Journals (Sweden)

    Bourgarit, David

    2010-12-01

    Full Text Available Not available

    Durante la Edad del Bronce en Europa occidental, el aumento drástico de la producción de cobre apenas está documentado en las actividades mineras y metalúrgicas de transformación. En este contexto, el yacimiento minero y metalúrgico de Saint-Véran, Hautes-Alpes constituye un testimonio privilegiado de la producción en masa a fines del III milenio, ya que las obras mineras dan cuenta de una explotación a gran escala, con una producción de casi 7 t de cobre al año. Numerosos sitios de metalurgia extractiva puede haber estado asociados con ella. Desde hace 20 años, diversos equipos, como en el que participan los autores, han emprendido o emprenden investigaciones para intentar documentar el sitio y su actividad. El objetivo de este artículo es presentar el estado actual de la cuestión sobre el yacimiento. Los resultados principales son la puesta en evidencia de la actividad de producción en masa y su cuantificación. Además se ha descrito por primera vez la organización de la producción, poniendo en evidencia la sucesión de fases entre la actividad minera y metalúrgica, así como las técnicas metalúrgicas innovadoras puestas en práctica. El yacimiento revela un estallido muy marcado de la actividad metalúrgica en el espacio que no deja de plantear interrogantes. Igualmente, la cuestión del destino de la producción sigue abierta por completo. Por otro lado, los motores para una implantación semejante en un territorio de alta montaña han comenzado a identificarse. Así se invocan determinismos naturales ya se trate de la mineralización particular de un yacimiento como de la evolución del clima. [fr] A l’âge du Bronze ancien en Europe occidentale, l’augmentation drastique de la production de cuivre est très peu documentée au niveau des activités minières et métallurgiques de transformation. Dans ce contexte, le gisement minier et métallurgique de Saint-Véran, Hautes- Alpes constitue un

  7. Encapsulated development, spawning and early veliger of the ranellid snail Fusitriton magellanicus (Roding, 1798 in the cold waters of the Magellan Strait, Chile Desarrollo intracapsular, oviposturas y velígeras tempranas del caracol ranélido Fusitriton magellanicus (Roding, 1798 en aguas frías del estrecho de Magallanes, Chile

    Directory of Open Access Journals (Sweden)

    Juan I Cañete

    2012-11-01

    Full Text Available Field and laboratory study of egg masses, encapsulated development stages and early-hatched veliger larvae of the sub-Antarctic observations Fusitriton magellanicus (Roding, 1798 are described from samples collected in the Magellan Strait (Santa Ana Point: 53°38'15"S, 70°54'38"W, Chile, between 2005 and 2006. We aimed to determined if: i if these gastropod shows a reproductive pattern development similar to low-latitude ranellids, and with respect to other sub-Antarctic locations within the Gondwanian distributional range (Australia, New Zealand, South America; ii if F. magellanicus exhibit similar patterns as other Chilean ranellids; and iii if F. magellanicus exhibit developmental attributes that define as long-distance broadcasters from cold water. F. magellanicus laid around 125 capsules/egg mass. Each contained an average of 2,789 ± 481 embryos, grouped in one circular arrangement. Mean eggs size was 180 μπι. Encapsulated period lasted between 55 and 67 days at 10°C, and hatched larvae of 245 to 349 μm in shell length. Spawning occur during spring (October to November; 8°C associated to an increment of freshwater discharge of San Juan River. A comparison of eggs/embryos/larvae abundance between temperate and tropical Ranellidae allow us to predict that Fusitriton magellanicus shows developmental attributes that indicate higher fecundity in relation to Chilean ranellids and that define it as a long-distance broadcaster.Antecedentes de terreno y laboratorio fueron utilizados para describir las oviposturas, los estadios del desarrollo intracapsular y las larvas velígeras recién eclosionadas del gasterópodo subantártico Fusitriton magellanicus (Roding, 1798, recolectado en el estrecho de Magallanes, sector Punta Santa Ana (53°38'15"S, 70°54'38"W, Chile, entre el 2005 y 2006 para determinar: i si este gasterópodo ranélido muestra un patrón reproductivo similar a aquellos ranélidos de bajas latitudes como en aquellas especies

  8. Raná tvorba Františka Koblihy

    OpenAIRE

    Hekrdlová, Alice

    2010-01-01

    This work deals with early production of František Kobliha in the first quarter of 20th century, and it is mostly devoted to his works made during the period from 1909 to 1916. The center of this work is detailed analysis of Kobliha's woodcut series, searching for their art sources and parallels and formulating the basic characteristics of author's early works with regard to its form and content. Followingly the question of "a literature spirit in art", in other words, the relation between th...

  9. A framework for resources allocation in virtualised C-RAN

    DEFF Research Database (Denmark)

    Al-Samman, Imad; Artuso, Matteo; Christiansen, Henrik Lehrmann

    2016-01-01

    The vast growth in mobile data traffic with its increasing capacity demands necessitates investigating future solutions to cope with these challenges. Network Virtualisation is considered one potential solution to simplify the current wireless networks. Recently efforts have been made to show....... Simulation results show improvements in the throughput of the mobile video traffic and reduction in end-to-end delay for delay sensitive applications. In addition, an assessment of fairness guarantee is considered across all users. Note that this paper considers the impact of the proposed schemes...

  10. Quantifying inflow uncertainties in RANS simulations of urban pollutant dispersion

    Science.gov (United States)

    García-Sánchez, C.; Van Tendeloo, G.; Gorlé, C.

    2017-07-01

    Numerical simulations of flow and pollutant dispersion in urban environments have the potential to support design and policy decisions that could reduce the population's exposure to air pollution. Reynolds-averaged Navier-Stokes simulations are a common modeling technique for urban flow and dispersion, but several sources of uncertainty in the simulations can affect the accuracy of the results. The present study proposes a method to quantify the uncertainty related to variability in the inflow boundary conditions. The method is applied to predict flow and pollutant dispersion in downtown Oklahoma City and the results are compared to field measurements available from the Joint Urban 2003 measurement campaign. Three uncertain parameters that define the inflow profiles for velocity, turbulence kinetic energy and turbulence dissipation are defined: the velocity magnitude and direction, and the terrain roughness length. The uncertain parameter space is defined based on the available measurement data, and a non-intrusive propagation approach that employs 729 simulations is used to quantify the uncertainty in the simulation output. A variance based sensitivity analysis is performed to identify the most influential uncertain parameters, and it is shown that the predicted tracer concentrations are influenced by all three uncertain variables. Subsequently, we specify different probability distributions for the uncertain inflow variables based on the available measurement data and calculate the corresponding means and 95% confidence intervals for comparison with the field measurements at 35 locations in downtown Oklahoma City.

  11. RANS-VOF modelling of the Wavestar point absorber

    DEFF Research Database (Denmark)

    Ransley, E. J.; Greaves, D. M.; Raby, A.

    2017-01-01

    Highlights •A fully nonlinear, coupled model of the Wavestar WEC has been created using open-source CFD software, OpenFOAM®. •The response of the Wavestar WEC is simulated in regular waves with different steepness. •Predictions of body motion, surface elevation, fluid velocity, pressure and load ...

  12. RAn Enlarged Conception of the Subject Matter of Logic

    Directory of Open Access Journals (Sweden)

    John T. Kearns

    2004-01-01

    Full Text Available Una concepción ampliada del objeto de estudio de la lógica: El ensayo es una introducción a la lógica ilocucionaria, es decir a la lógica de los actos de habla. El autor propone una aproximación distinta a este campo de investigación con respecto al que han propuesto John Searle y Daniel Vanderveken. Ellos conciben la lógica ilocucionaria como un suplemento o un apéndice a la lógica estándar, la lógica de los enunciados, y se concentran en el estudio de leyes y principios muy generales que caracterizan todo tipo de actos ilocucionarios. Kearns, en cambio, concibe la lógica ilocucionaria como una disciplina muy comprensiva, con muchos subsistemas, que cobija a la lógica estándar como parte suya. El escrito describe brevemente el uso de los operadores ilocucionarios (de aseveración, de negación, de suposición de verdad o falsedad, explica la manera como se expande la concepción semántica en términos de condiciones de verdad para incluir los compromisos racionales del hablante y presenta un sistema de deducción para esta lógica. Como un ejemplo de lo que esta lógica puede hacer se ofrece una solución a la paradoja de Moore contenida en la aseveración “Está lloviendo, pero no lo creo”

  13. Valged raamatud korrastavad Eesti ajalugu / Carl Göran Andrae

    Index Scriptorium Estoniae

    Andrae, Carl Göran

    2008-01-01

    rets. rmt.: Estonia 1940-1945. Reports of the Estonian International Commision for the Investigation of Crimes Against Humanity. Tallinn : Inimsusevastaste Kuritegude Uurimise Eesti Sihtasutus, 2006. XXX+1337 sidor med 10 kartor. Valge raamat. Eesti rahva kaotustest okupatsioonide läbi 1940-1991. Tallinn, 2006. 192 lk.

  14. A framework for resources allocation in virtualised C-RAN

    DEFF Research Database (Denmark)

    Al-Samman, Imad; Artuso, Matteo; Christiansen, Henrik Lehrmann

    2016-01-01

    . Simulation results show improvements in the throughput of the mobile video traffic and reduction in end-to-end delay for delay sensitive applications. In addition, an assessment of fairness guarantee is considered across all users. Note that this paper considers the impact of the proposed schemes...... on the transmission/data plane....

  15. Simulating tidal turbines with mesh optimisation and RANS turbulence models

    NARCIS (Netherlands)

    Abolghasemi, A.; Piggott, M.D.; Spinneken, J.; Vire, A.; Cotter, C.J.

    2015-01-01

    A versatile numerical model for the simulation of flow past horizontal axis tidal turbines has been developed. Currently most large-scale marine models employed to study marine energy use the shallow water equations and therefore can fail to account for important turbulent physics. The model

  16. RANS Modeling of Benchmark Shockwave / Boundary Layer Interaction Experiments

    Science.gov (United States)

    Georgiadis, Nick; Vyas, Manan; Yoder, Dennis

    2010-01-01

    This presentation summarizes the computations of a set of shock wave / turbulent boundary layer interaction (SWTBLI) test cases using the Wind-US code, as part of the 2010 American Institute of Aeronautics and Astronautics (AIAA) shock / boundary layer interaction workshop. The experiments involve supersonic flows in wind tunnels with a shock generator that directs an oblique shock wave toward the boundary layer along one of the walls of the wind tunnel. The Wind-US calculations utilized structured grid computations performed in Reynolds-averaged Navier-Stokes mode. Three turbulence models were investigated: the Spalart-Allmaras one-equation model, the Menter Shear Stress Transport wavenumber-angular frequency two-equation model, and an explicit algebraic stress wavenumber-angular frequency formulation. Effects of grid resolution and upwinding scheme were also considered. The results from the CFD calculations are compared to particle image velocimetry (PIV) data from the experiments. As expected, turbulence model effects dominated the accuracy of the solutions with upwinding scheme selection indicating minimal effects.!

  17. Nízkoteplotní plazma v hojení ran

    Czech Academy of Sciences Publication Activity Database

    Kubinová, Šárka; Závišková, Kristýna; Lunov, Oleg; Churpita, Olexandr; Zablotskyy, Vitaliy A.; Dejneka, Alexandr

    2016-01-01

    Roč. 2016, č. 1 (2016), s. 20-21 ISSN 1214-231X R&D Projects: GA TA ČR(CZ) TA04010449 Institutional support: RVO:68378041 Keywords : low-temperature plasma * wound healing * chronic wounds * dermatology * diabetic foot Subject RIV: BO - Biophysics

  18. Simulating effects of a wind-turbine array using LES and RANS: Simulating turbines using LES and RANS

    Energy Technology Data Exchange (ETDEWEB)

    Vanderwende, Brian J. [Department of Atmospheric and Oceanic Sciences, University of Colorado, Boulder Colorado USA; Now at National Center for Atmospheric Research, Boulder Colorado USA; Kosović, Branko [National Center for Atmospheric Research, Boulder Colorado USA; Lundquist, Julie K. [Department of Atmospheric and Oceanic Sciences, University of Colorado, Boulder Colorado USA; National Renewable Energy Laboratory, Golden Colorado USA; Mirocha, Jeffrey D. [Lawrence Livermore National Laboratory, Livermore California USA

    2016-08-27

    Growth in wind power production has motivated investigation of wind-farm impacts on in situ flow fields and downstream interactions with agriculture and other wind farms. These impacts can be simulated with both large-eddy simulations (LES) and mesoscale wind-farm parameterizations (WFP). The Weather Research and Forecasting (WRF) model offers both approaches. We used the validated generalized actuator disk (GAD) parameterization in WRF-LES to assess WFP performance. A 12-turbine array was simulated using the GAD model and the WFP in WRF. We examined the performance of each scheme in both convective and stable conditions. The GAD model and WFP produced qualitatively similar wind speed deficits and turbulent kinetic energy (TKE) production across the array in both stability regimes, though the magnitudes of velocity deficits and TKE production levels were underestimated and overestimated, respectively. While wake growth slowed in the latter half of the WFP array as expected, wakes did not approach steady state by the end of the array as simulated by the GAD model. A sensitivity test involving the deactivation of explicit TKE production by the WFP resulted in turbulence levels within the array well that were below those produced by the GAD in both stable and unstable conditions. Finally, the WFP overestimated downwind power production deficits in stable conditions because of the lack of wake stabilization in the latter half of the array.

  19. William Wordsworth's 'Double Awareness' of Memory in Virginia Woolf's Mrs Dalloway = William Wordsworth'un 'Hatıranın Çift Yönlü Algılaması' Kavramının Virgina Woolf'un Mrs Dalloway Adlı Romanındaki Kullanımı

    Directory of Open Access Journals (Sweden)

    Ali GÜNEŞ

    2003-06-01

    Full Text Available This article deals with Romanticism in modernist British writer Virginia Woolf's novel, Mrs Dalloway. Although her works are experimental and new, they are part of a wider and developing perspective in the historical process of literary tradition, so that they cannot be viewed as completely breaking away from literary tradition, but rather as a reworking and redevelopment in its evolution. In her reworking of the traditional novel, this paper may suggest that Woolf made it "new" by returning to the Romantics, particularly to Wordsworth. By this claim, this paper does not mean that Woolf copied Wordsworth exactly, but was profoundly and pervasively influenced by his aesthetic views, especially in relation to her understanding of life as "consciousness". By returning to the Romantics, Woolf develops her sense of "reality" as both fragmented and whole, and of the "self" as fragmented but desiring and imagining unity. Hence she not only strove to construct a poetical or lyrical novel to express that contradictory view but also used her fiction to explore the mystery of the subjective consciousness as the dominant modernist view. In order to express her perception of modernist identity, Woolf used memory as a device in Mrs Dalloway and thus developed a new way of narration as well as a new view of human identity. By means of this new method, she left the objective narration of the traditional novel, and thus meaning or the view of identity in Woolf's late fiction is not static but undecided, unfinished and mysterious.

  20. CFD-RANS analysis of the rotational effects on the boundary layer of wind turbine blades

    DEFF Research Database (Denmark)

    Carcangiu, Carlo Enrico; Sørensen, Jens Nørkær; Cambuli, Francesco

    2007-01-01

    of the output are proposed for the analyzed flow situations. The main features of the boundary layer flow are described, for both the rotating blade and the corresponding 2-D profiles. Computed pressure distributions and aerodynamic coefficients evidence less lift losses after separation in the 3-D rotating...

  1. ran Greider, Ingen kommer undan Olof Palme (Stockholm: Ordfront, 2011

    Directory of Open Access Journals (Sweden)

    Monica Quirico

    2012-03-01

    Full Text Available In 2011 within the Swedish labour movement many activists dissatisfied with the Social Democratic Party (SAP – who in 2010 suffered from the second electoral defeat in succession and fell into a never-ending crisis – turned to the legacy of Olof Palme (whose XXV death anniversary was celebrated on February, 28 as a flag of the true Social Democratic tradition, to which it is urgent to come back before the centre-right government achieves a full “paradigm shift”, deregulating further the labour market and privatizing the Welfare State.

  2. Page 1 ul-Ham-". 174 RAN SROMONEY AND GIFT SROMONY (b) a ...

    Indian Academy of Sciences (India)

    ſ We define the rank of an EMLL to be the smallest integer k such that. L is generated by an EMG of order k. It can be seen that a set is regular iff it. is generated by an EMG of order I and that the family of regular sets is properly contained in the family of EML. THEOREMI 2: If L is an EML of rank k and R a regular set then I. r.

  3. Hybrid RANS/LES method for high Reynolds numbers, applied to atmospheric flow over complex terrain

    DEFF Research Database (Denmark)

    Bechmann, Andreas; Sørensen, Niels N.; Johansen, Jeppe

    2007-01-01

      The use of Large-Eddy Simulation (LES) to predict wall-bounded flows has presently been limited to low Reynolds number flows. Since the number of computational grid points required to resolve the near-wall turbulent structures increase rapidly with Reynolds number, LES has been unattainable for...

  4. Non-Indigenous Marine Species (NIMS) in Biofouling on RAN Vessels: Threat Analysis

    Science.gov (United States)

    2015-09-01

    social impacts (Burgiel & Muir, 2010; Bax & Carlton, 2011), and attempted eradication and/or management of potentially harmful NIMS following...Garcia, C. B. and Salzwedel, H. (1995) Boletin de Investigaciones Marinas y Costeras 24, 1- 25. Golder Associates. Darwin Harbour Marine Pest

  5. Numerical Study Comparing RANS and LES Approaches on a Circulation Control Airfoil

    Science.gov (United States)

    Rumsey, Christopher L.; Nishino, Takafumi

    2011-01-01

    A numerical study over a nominally two-dimensional circulation control airfoil is performed using a large-eddy simulation code and two Reynolds-averaged Navier-Stokes codes. Different Coanda jet blowing conditions are investigated. In addition to investigating the influence of grid density, a comparison is made between incompressible and compressible flow solvers. The incompressible equations are found to yield negligible differences from the compressible equations up to at least a jet exit Mach number of 0.64. The effects of different turbulence models are also studied. Models that do not account for streamline curvature effects tend to predict jet separation from the Coanda surface too late, and can produce non-physical solutions at high blowing rates. Three different turbulence models that account for streamline curvature are compared with each other and with large eddy simulation solutions. All three models are found to predict the Coanda jet separation location reasonably well, but one of the models predicts specific flow field details near the Coanda surface prior to separation much better than the other two. All Reynolds-averaged Navier-Stokes computations produce higher circulation than large eddy simulation computations, with different stagnation point location and greater flow acceleration around the nose onto the upper surface. The precise reasons for the higher circulation are not clear, although it is not solely a function of predicting the jet separation location correctly.

  6. The Role of RAN and Reading Rate in Predicting Reading Self-Concept

    Science.gov (United States)

    Kasperski, Ronen; Shany, Michal; Katzir, Tami

    2016-01-01

    Social identity theory states that a person's self-concept is created from comparison with others (Walsh & Gordon, 2008). In the case of reading, oral reading is a salient feature young children have to compare themselves on to their classroom peer group. The current study was set to explore the ability of oral reading tasks such as rapid…

  7. PENJERNIHAN NIRA TEBU MENGGUNAKAN MEMBRAN UL TRAFIL TRASI DENGAN SISTEM ALI RAN SILANG

    Directory of Open Access Journals (Sweden)

    Suprihatin

    2007-08-01

    Full Text Available Membrane ultrafiltration is one alternative technology to produce a high quality cane sugar with reasonable cost, because its ability to produce a brighter color and lower impurities as well as sulphur free of product. This technology can reduce process steps, chemical and energy demand, so that the production cost is potentially reduced significantly. This research work was aimed to study the performance of various membrane filtrations in the application for clarifying sugar cane juice, covering the achievable flux, membrane rejection againstimpurities, and quality of the filtered juice. The experiments were conducted according to the principle of cross flow using three different transmembrane pressures of 0.7, 1.4, and 2.1 bar and cross flow rate of 0.42 m/s. Various membranes were studied in this experiments both commercial ultrafiltration membrane and ultrafiltration membrane prepared in our laboratory. Sugar cane juice before and after clarification were characterized by measuring the parameters of brix, sucrose concentration, solution color, clarity, and pH. Thepolisulfone membrane, which was prepared in our laboratory, produced fluxes in the range of 25-30 L/m2.h at the transmembrane pressures of 0.7-2.1 bar. The membranes increased clarity of the juice from app. 10 to 60% of transmition and reduced color up to 80-90%, comparable with the results of the commercial ultrafiltration membrane

  8. Fronthaul dimensioning in C-RAN with web traffic for coordinated multipoint joint transmission

    DEFF Research Database (Denmark)

    Artuso, Matteo; Christiansen, Henrik Lehrmann

    2015-01-01

    multi-point. Nevertheless, this puts stringent requirements on the network interconnecting the processing pool and the sites, especially in terms of maximum latency. In this paper, we provide results for dimensioning the fronthaul network that are obtained through modelling and discrete-event simulation...

  9. Efficient resolution of (±)-rans-2, 3-diphenylpiperazine using (1)-(+ ...

    Indian Academy of Sciences (India)

    ... the corresponding racemic mixture using (1)-(+)-10-camphorsulfonic acid. The partially resolved enriched sample of (,)-(-)-2,3-diphenylpiperazine with 73% ee was purified to obtain samples of 97% ee using different achiral acids via the preparation of either homochiral or heterochiral hydrogen bonded aggregates.

  10. A RANS simulation toward the effect of turbulence and cavitation on spray propagation and combustion characteristics

    Science.gov (United States)

    Taghavifar, Hadi; Khalilarya, Shahram; Jafarmadar, Samad; Taghavifar, Hamid

    2016-08-01

    A multidimensional computational fluid dynamic code was developed and integrated with probability density function combustion model to give the detailed account of multiphase fluid flow. The vapor phase within injector domain is treated with Reynolds-averaged Navier-Stokes technique. A new parameter is proposed which is an index of plane-cut spray propagation and takes into account two parameters of spray penetration length and cone angle at the same time. It was found that spray propagation factor (SPI) tends to increase at lower r/ d ratios, although the spray penetration tends to decrease. The results of SPI obtained by empirical correlation of Hay and Jones were compared with the simulation computation as a function of respective r/ d ratio. Based on the results of this study, the spray distribution on plane area has proportional correlation with heat release amount, NO x emission mass fraction, and soot concentration reduction. Higher cavitation is attributed to the sharp edge of nozzle entrance, yielding better liquid jet disintegration and smaller spray droplet that reduces soot mass fraction of late combustion process. In order to have better insight of cavitation phenomenon, turbulence magnitude in nozzle and combustion chamber was acquired and depicted along with spray velocity.

  11. Calcul des coefficients aerodynamiques d'un avion complet par la methode rans

    Science.gov (United States)

    Lux, Quentin

    The evaluation of stability derivatives within the entire flight domain through the use of Computational Fluids Dynamics is one of the next challenges of numerical external aerodynamics. To remain competitive, aircraft manufacturers are increasingly turning to CFD to provide aerodynamic data in an effort to increase the quality of their products while reducing the development turnaround time and costs. However, the numerical analysis need to evolve to insure a higher fidelity and meets the need of the aircraft manufacturers and decrease wind-tunnel experiments. The present study aims to estimate the potential of a high-fidelity 3D CFD analysis in the determination of the aerodynamic behavior of an airplane in incidence and yaw. The complete methodology to obtain the static stability coefficients will be developed and the results compared with the experimental data. All the phases of the methodology will be presented including: the treatment of the geometry, the meshing process and the flow solving by a commercial CFD software. Important points to obtain a high-fidelity will also be developed as well as the verification and validation phase. The results will be presented as raw as well as with an error metric in order to estimate the accuracy of the current method. First, it will be applied on a validation case from the literature: the Drag Prediction Workshop II with the study of the DLR-F6. The test cases including a study at fixed CL as well as an incidence sweeping will be recreated. Then, the methodology will be applied to a Bombardier Research Aircraft. The various associations of components on the fuselage including the wing, the nacelle and the tail will be studied in incidence and yaw sweepings. The study concludes on the potential of such study with regard to its development costs in the cases presented here.

  12. RANS Based Methodology for Predicting the Influence of Leading Edge Erosion on Airfoil Performance

    Energy Technology Data Exchange (ETDEWEB)

    Langel, Christopher M. [Univ. of California, Davis, CA (United States). Dept. of Mechanical and Aerospace Engineering; Chow, Raymond C. [Univ. of California, Davis, CA (United States). Dept. of Mechanical and Aerospace Engineering; van Dam, C. P. [Univ. of California, Davis, CA (United States). Dept. of Mechanical and Aerospace Engineering; Maniaci, David Charles [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Wind Energy Technologies Dept.

    2017-10-01

    The impact of surface roughness on flows over aerodynamically designed surfaces is of interested in a number of different fields. It has long been known the surface roughness will likely accelerate the laminar- turbulent transition process by creating additional disturbances in the boundary layer. However, there are very few tools available to predict the effects surface roughness will have on boundary layer flow. There are numerous implications of the premature appearance of a turbulent boundary layer. Increases in local skin friction, boundary layer thickness, and turbulent mixing can impact global flow properties compounding the effects of surface roughness. With this motivation, an investigation into the effects of surface roughness on boundary layer transition has been conducted. The effort involved both an extensive experimental campaign, and the development of a high fidelity roughness model implemented in a R ANS solver. Vast a mounts of experimental data was generated at the Texas A&M Oran W. Nicks Low Speed Wind Tunnel for the calibration and validation of the roughness model described in this work, as well as future efforts. The present work focuses on the development of the computational model including a description of the calibration process. The primary methodology presented introduces a scalar field variable and associated transport equation that interacts with a correlation based transition model. The additional equation allows for non-local effects of surface roughness to be accounted for downstream of rough wall sections while maintaining a "local" formulation. The scalar field is determined through a boundary condition function that has been calibrated to flat plate cases with sand grain roughness. The model was initially tested on a NACA 0012 airfoil with roughness strips applied to the leading edge. Further calibration of the roughness model was performed using results from the companion experimental study on a NACA 633 -418 airfoil. The refined model demonstrates favorable agreement predicting changes to the transition location, as well as drag, for a number of different leading edge roughness configurations on the NACA 633-418 airfoil. Additional tests were conducted on a thicker S814 airfoil, with similar roughness configurations to the NACA 633-418. Simulations run with the roughness model compare favorably with the results obtained in the experimental study for both airfoils.

  13. Performance of the Tin-Free Antifouling Coating International Ecoloflex in DSTO/RAN Trials

    Science.gov (United States)

    2008-10-01

    than 2 months, were heavily fouled by tubeworms, macroalgae , barnacles, bryozoans and ascidians. Fouling and physico-chemical data for the raft site...months, all five coatings tested had fouled (Figure 9); all were fouled by green macroalgae near the water surface, and all but one were also fouled

  14. High Performance Hybrid RANS-LES Simulation Framework for Turbulent Combusting Flows Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The innovation proposed here is a computational framework for high performance, high fidelity computational fluid dynamics (CFD) to enable accurate, fast and robust...

  15. The social licence for research: why care.data ran into trouble.

    Science.gov (United States)

    Carter, Pam; Laurie, Graeme T; Dixon-Woods, Mary

    2015-05-01

    In this article we draw on the concept of a social licence to explain public concern at the introduction of care.data, a recent English initiative designed to extract data from primary care medical records for commissioning and other purposes, including research. The concept of a social licence describes how the expectations of society regarding some activities may go beyond compliance with the requirements of formal regulation; those who do not fulfil the conditions for the social licence (even if formally compliant) may experience ongoing challenge and contestation. Previous work suggests that people's cooperation with specific research studies depends on their perceptions that their participation is voluntary and is governed by values of reciprocity, non-exploitation and service of the public good. When these conditions are not seen to obtain, threats to the social licence for research may emerge. We propose that care.data failed to adequately secure a social licence because of: (i) defects in the warrants of trust provided for care.data, (ii) the implied rupture in the traditional role, expectations and duties of general practitioners, and (iii) uncertainty about the status of care.data as a public good. The concept of a social licence may be useful in explaining the specifics of care.data, and also in reinforcing the more general lesson for policy-makers that legal authority does not necessarily command social legitimacy. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  16. Aurora A Phosphorylates MCAK to Control Ran-dependent Spindle Bipolarity

    OpenAIRE

    Zhang, Xin; Ems-McClung, Stephanie C.; Walczak, Claire E.

    2008-01-01

    During mitosis, mitotic centromere-associated kinesin (MCAK) localizes to chromatin/kinetochores, a cytoplasmic pool, and spindle poles. Its localization and activity in the chromatin region are regulated by Aurora B kinase; however, how the cytoplasmic- and pole-localized MCAK are regulated is currently not clear. In this study, we used Xenopus egg extracts to form spindles in the absence of chromatin and centrosomes and found that MCAK localization and activity are tightly regulated by Auro...

  17. A400M Wake Flow Studies Based on RANS CFD Methods on Hybrid Meshes

    National Research Council Canada - National Science Library

    Doetter, F; Aumann, P; Acisu, I; Brodersen, O; Ronzheimer, A

    2006-01-01

    .... CFD methods used by Airbus and DLR allow valuable predictions of these conditions, taking into account the influence of flow deflectors, sponsons, open cargo hold doors/ramps, as well as propulsion slip-streams...

  18. 3D RANS simulations of shallow water effects on rudder hydrodynamic characteristics

    NARCIS (Netherlands)

    Liu, J.; Hekkenberg, R.G.

    2016-01-01

    An accurate estimation of the rudder forces and moments is essential for manoeuvrability prediction. Previous research has shown that ships have different manoeuvring performance in deep and shallow water. Before considering the rudder’s contribution to shallow water manoeuvring, it is meaningful to

  19. Computation of vortex-shedding flows past a square cylinder employing LES and RANS

    Energy Technology Data Exchange (ETDEWEB)

    Lakehal, D.; Thiele, F. [Technische Univ. Berlin (Germany). Hermann Foettinger Inst. fuer Stroemungsmechanik; Duchamp de Lageneste, L.; Buffat, M. [LMFA, Ecole Centrale de Lyon, Ecully (France)

    1998-12-31

    The paper addresses the predictive capabilities of different computational modelling practices which employ various eddy-viscosity models for turbulence, that are based on a linear, a quadratic and two cubic representations of the Reynolds stress tensor in terms of strain and vorticity rates respectively, in the context of a comparative study between Reynolds-Averaged Navier-Stokes Equations and Large Eddy Simulation of vortex-shedding flows. The test case considered here refers to the familiar vortex-shedding flow past a square cylinder at R{sub e}=22.000 studied experimentally by Lyn et al. All the models were found to reproduce fairly well the shedding dynamics with the exception of eddy-viscosity models employed with a high rate of oncoming turbulence. The total kinetic energy was fairly well predicted by all models, whereas the turbulent part was significantly underestimated. Comparison of this latter quantity has emphasized the effective role of turbulence anisotropy in rendering the effects of shedding mechanisms. The integral parameters were determined with much better agreement with measurements than the averaged quantities. The essential finding is that the explicit algebraic stress models predict much better the global parameters with increasing the order of anisotropy. The confusing results of Large Eddy Simulation, i.e. satisfactory agreements of the time-averaged velocity and energy profiles to the expense of a less accurate prediction of the global coefficients, did not support the superiority of the concept. Still, the practice has revealed a particular sentivity to the near-wall treatment. (orig.)

  20. RANS solver for microscale pollution dispersion problems in areas with vegetation: Development and validation

    CERN Document Server

    Šíp, Viktor

    2016-01-01

    We present a description and validation of a finite volume solver aimed at solving the problems of microscale urban flows where vegetation is present. The solver is based on the five equation system of Reynolds-averaged Navier-Stokes equations for atmospheric boundary layer flows, which are complemented by the k-epsilon turbulence model. The vegetation is modelled as a porous zone, and the effects of the vegetation are included in the momentum and turbulence equations. A detailed dry deposition model is incorporated in the pollutant transport equation, allowing the investigation of the filtering properties of urban vegetation. The solver is validated on four test cases to assess the components of the model: the flow and pollutant dispersion around the 2D hill, the temporal evolution of the rising thermal bubble, the flow through and around the forest canopy, and a hedgerow filtering the particle-laden flow. Generally good agreement with the measured values or previously computed numerical solution is observed...

  1. A Cognitive Metaphorical Analysis of Selected Verses in the Glorius Qu’ran

    Directory of Open Access Journals (Sweden)

    Ahmad Abdel Tawwab Sharaf Eldin

    2015-03-01

    Full Text Available Metaphor has been generally contemplated and broke down inside the schema of verbal and written discourse, scholarly works and artistic studies. It has been identified with metaphorical language and has been viewed as quite recently a sort of aesthetic frivolity (Murray & Moon, 2006. In addition, conventional instructing of metaphors presents language as an abnormal or different method for using it (Goatly, 1997. Likewise, as Goatly has put it, scholars have needed figures of speech strictly limited to writing, talk and craftsmanship. Moreover, metaphor is viewed as something that fits in with abstract structures which is more concerned with novel or intriguing uses of words. Lakoff & Johnson (1980 presented an alternate idea and perspective of metaphor which is known as reasonable metaphorical dissection. The theory underlying this new approach is that the reasonable metaphors enter our understanding of our general surroundings and they shape our demeanor. Appropriately, as pointed out by Lakoff & Johnson (1980, metaphor is available in ordinary discourse, in every language, and is to a certain degree, has gotten to be culturally specific. Besides both contend that metaphors affect our way of viewing the meanings and are discovered widely in a significant number of our languages, contemplations and activities.

  2. The concept of text in cultural semiotics / Göran Sonesson

    Index Scriptorium Estoniae

    Sonesson, Göran, 1951-

    1998-01-01

    "Tekstist" Tartu koolkonna kirjutistes ning Roland Posnerþi rekonstrueeritud teoorias. Tekstuaalsuse sellisest hierarhiast, mis nõuab interpretatsiooni ning mis on seejärel omakorda allutatud interpretatsioonile

  3. Thermal Stress in RAN (Royal Australian Navy) Sea King Helicopter Operations

    Science.gov (United States)

    1988-02-01

    3.2Tg + 0.1rdb, and WBGT = 0.7Twbp + 0.3Tg, where a. Twbn is the naturally convected wet bulb temperature; b. Twbp is the psychrometric wet bulb...session started. Water was available ad lib during the chamber exposure. The volume of water consumed by each subject, urine volume and food intake were...N=6). (27) Calculation of sweat production (kg/hour), based on the pre-exposure and post-exposure body mass adju.Aed for the fluids and food consumed

  4. Turbulence Model Effects on RANS Simulations of the HIFiRE Flight 2 Ground Test Configurations

    Science.gov (United States)

    Georgiadis, Nicholas J.; Mankbadi, Mina R.; Vyas, Manan A.

    2014-01-01

    The Wind-US Reynolds-averaged Navier-Stokes solver was applied to the Hypersonic International Flight Research Experimentation (HIFiRE) Flight 2 scramjet ground test configuration. Two test points corresponding to flight Mach numbers of 5.9 and 8.9 were examined. The emphasis was examining turbulence model effects on the prediction of flow path pressures. Three variants of the Menter k-omega turbulence model family were investigated. These include the baseline (BSL) and shear stress transport (SST) as well as a modified SST model where the shear stress limiter was altered. Variations in the turbulent Schmidt number were also considered. Choice of turbulence model had a substantial effect on prediction of the flow path pressures. The BSL model produced the highest pressures and the SST model produced the lowest pressures. As expected, the settings for the turbulent Schmidt number also had significant effects on predicted pressures. Small values for the turbulent Schmidt number enabled more rapid mass transfer, faster combustion, and in turn higher flowpath pressures. Optimal settings for turbulence model and turbulent Schmidt number were found to be rather case dependent, as has been concluded in other scramjet investigations.

  5. Raná intervence u dětí s autismem

    OpenAIRE

    Schovánková, Johana

    2013-01-01

    The first purpose of my bachelor thesis is to describe and analyse the methods of early intervention for children with autism spectrum disorders (ASD). This theme is not in the Czech often processed, altought it is a very important field that can greatly help a child in his development and parents in understanding the needs of the child. we will adress the main areas of early intervention, which are functional communication training, game and self-care skills as well as manners. The empirical...

  6. A Study of Supersonic Compression-Corner Interactions using Hybrid LES/RANS Models

    Science.gov (United States)

    2014-01-20

    jjj t jj j xx kF xx S x u t ∂ ∂ ∂ ∂ −+         ∂ ∂ + ∂ ∂ +−= ∂ ∂ + ∂ ∂ ω ω ρσωµσµβρωγρ ρωρω ωω 112 21 22 (2.1.2) where S is...10.1.6) jjj uppuup −=′′′ (10.1.7) iii uuu ~−=′′ (10.1.8) i i i i i i x up x up x up

  7. Raně středověké mince z hradu Přerov

    Czech Academy of Sciences Publication Activity Database

    Procházka, Rudolf; Kučerovská, T.; Chumchal, M.; Kohoutek, J.

    2005-01-01

    Roč. 90, č. 20 (2005), s. 3-16 ISSN 0862-1195 R&D Projects: GA ČR GA404/05/2671; GA ČR GA404/03/0722 Institutional research plan: CEZ:AV0Z80010507 Keywords : Moravia * castle Přerov * early Middle Age * coins Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. LES/RANS Modeling of Aero-Optical Effects in a Supersonic Cavity Flow

    Science.gov (United States)

    2016-06-13

    uncertainty since the calculated modes are sensitive to the choice of maximum rank. Presently, the maximum rank of the DMD operator was set to 50, which...STE 240 Campus BX 7514 Raleigh NC 27695-7003 9. SPONSORING / MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR/MONITOR’S ACRONYM(S) Air Force...difference. Two-dimensional proper orthogonal decomposition modes of the optical wavefront are computed; these compare favorably with wind tunnel data

  9. Mesh Generation and Adaption for High Reynolds Number RANS Computations Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The innovation of our Phase II STTR program is to develop and provide to NASA automatic mesh generation software for the simulation of fluid flows using...

  10. Lessons Learned from RANS Simulations of Shock-Wave/Boundary-Layer Interactions

    National Research Council Canada - National Science Library

    Thivet, Frederic

    2006-01-01

    .... Such a correction, originally proposed to ensure realizability in subsonic flows, is extended to deal with compressible flows and applied to three-dimensional supersonic SWBLI developing on three...

  11. Second-Moment RANS Model Verification and Validation Using the Turbulence Modeling Resource Website (Invited)

    Science.gov (United States)

    Eisfeld, Bernhard; Rumsey, Chris; Togiti, Vamshi

    2015-01-01

    The implementation of the SSG/LRR-omega differential Reynolds stress model into the NASA flow solvers CFL3D and FUN3D and the DLR flow solver TAU is verified by studying the grid convergence of the solution of three different test cases from the Turbulence Modeling Resource Website. The model's predictive capabilities are assessed based on four basic and four extended validation cases also provided on this website, involving attached and separated boundary layer flows, effects of streamline curvature and secondary flow. Simulation results are compared against experimental data and predictions by the eddy-viscosity models of Spalart-Allmaras (SA) and Menter's Shear Stress Transport (SST).

  12. Validation of 3D RANS-SA Calculations on Strand/Cartesian Meshes

    Science.gov (United States)

    2014-01-07

    solution accuracy. A grid convergence study of the computed drag coefficient for the flow over a NACA0012 airfoil in two dimensions is conducted to...over a NACA0012 airfoil using a sequence of bent- and multi-strand meshes. 20 of 22 American Institute of Aeronautics and Astronautics 22 VII

  13. Linking Immunity to Atherosclerosis: Implications for Vascular Pharmacology - A tribute to Göran K. Hansson

    Science.gov (United States)

    Geng, Yong-Jian; Jonasson, Lena

    2011-01-01

    For the past decade, we have deepened our understanding of the pathogenesis of atherosclerosis, a chronic arterial disease that causes cardiac and cerebral infarction and peripheral vascular disorders. Because of this extended understanding, more effective strategies for prevention and treatment of this disease are emerging. One of the fundamental mechanisms that lead to progress or regression in atherosclerosis, thus influencing its life-threatening complications, occurs through functional changes in vascular immunity and inflammation. This review briefly summarized the discoveries in basic and translational sciences in this area and recent advances in clinical medicine against atherosclerotic vascular diseases. PMID:22120836

  14. Differential Relationships between RAN Performance, Behaviour Ratings, and Executive Function Measures: Searching for a Double Dissociation

    Science.gov (United States)

    Stringer, Ronald W.; Toplak, Maggie E.; Stanovich, Keith E.

    2004-01-01

    In this study, we investigated the relationships between rapid naming of letters, digits and colours, and reading ability and executive function. We gave fifty-six grade three and four children rapid automatised naming tasks using letters and digits as stimuli, executive function measures including the Stroop task, a working memory task and the…

  15. Modeling of Fuel Film Cooling Using Steady State RANS and Unsteady DES Approaches

    Science.gov (United States)

    2016-07-27

    NAME(S) AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NO. Air Force Research Laboratory (AFMC) AFRL/RQRC 10 E. Saturn Edwards AFB, CA 93524-7680...b. ABSTRACT Unclassified c. THIS PAGE Unclassified SAR 30 19b. TELEPHONE NO (include area code ) N/A Standard Form 298 (Rev. 8-98

  16. A Comparison of Hybrid Reynolds Averaged Navier Stokes/Large Eddy Simulation (RANS/LES) and Unsteady RANS Predictions of Separated Flow for a Variable Speed Power Turbine Blade Operating with Low Inlet Turbulence Levels

    Science.gov (United States)

    2017-10-01

    turbine blade with large incidence and Reynolds number variations. AIAA-2014-3933. Proceedings of the 50th AIAA/ ASME /SAE/ASEE Joint Propulsion...pressure field and loss. ASME J Turbomach. 2000;123(2):296–304. Approved for public release; distribution is unlimited. 26 9. Menter FR, Langtry...dimensional Navier- stokes analysis and redesign of an imbedded bellmouth nozzle in a turbine cascade inlet section. ASME Journal of Turbomachinery

  17. Evaluating hydraulic and disinfection efficiencies of a full-scale ozone contactor using a RANS-based modeling framework.

    Science.gov (United States)

    Zhang, Jie; Tejada-Martínez, Andrés E; Zhang, Qiong; Lei, Hongxia

    2014-04-01

    The capability of predicting hydraulic and disinfection efficiencies of ozone disinfection contactors is essential for evaluating existing contactors and improving future designs. Previous attempts based on ideal and non-ideal models for the hydraulics and simplified mechanisms for chemical reaction modeling have resulted in low accuracy and are restricted to contactors with simple geometries. This manuscript develops a modeling framework for the ozonation process by combining computational fluid dynamics (CFD) with a kinetics-based reaction modeling for the first time. This computational framework has been applied to the full-scale ozone contactor operated by the City of Tampa Water Department. Flow fields, residence time distribution, ozone concentration distribution, and concentration-contact time (CT) distribution within the contactor have been predicted via the computational framework. The predictions of ozone and bromate concentrations at sample points agree well with physical experimental data measured in the contactor. The predicted CT values at the contactor outlet demonstrate that the disinfection performance of the ozone contactor operated by the City of Tampa Water Department is sufficient to meet regulation requirements. The impact of seasonal flow rate change on disinfection performance is found to be significant and deserves attention during the management and operation of a water treatment plant. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Unsteady rans simulation of the off-design operation of a high expansion ratio ORC radial turbine

    OpenAIRE

    Rinaldi, E; Pecnik, R.; Colonna di Paliano, P.

    2015-01-01

    The design of Organic Rankine cycle (ORC) turbines is a challenging task due to the complex thermodynamic behavior of the working fluid, the typical high expansion ratio which leads to a highly supersonic flow, the flow unsteadiness, and the continuous shift of operation between on- and off-design conditions. Computational fluid dynamic (CFD) simulations provide useful insights on the turbine flow which help the design, analysis and optimization process. Steady state CFD computations are nowa...

  19. RANS study of unsteady flow around a profile blade : application to stall of horizontal axis wind turbine

    Energy Technology Data Exchange (ETDEWEB)

    Belkheir, N. [Khemis Miliana Univ., Ain Defla (Algeria); Dizene, R. [Univ. des Sciences et de la Technologie Houari Boumediene, Algiers (Algeria). Laboratoire de Mecanique Avancee; Khelladi, S.; Massouh, F.; Dobrev, I. [Arts et Metiers Paris Tech., Paris (France)

    2010-07-01

    The shape of an airfoil is designed to achieve the best aerodynamic performance. An aerofoil section undergoes dynamic stall when subjected to any form of unsteady angle of pitch. The study of a horizontal-axis wind turbine (HAWT) under wind operating conditions is complex because it is subject to instantaneous speed and wind direction variation. When turbine blades are driven into a dynamic stall, the lift coefficient drops suddenly resulting in a degradation in aerodynamic performance. This study presented steady and unsteady wind load predictions over an oscillating S809 airfoil tested in a subsonic wind tunnel. A model of sinusoidal pitch oscillations was used. The values for the angles of attack in steady state ranged from -20 to +40 degrees. The model considered 3 frequencies and 2 amplitudes. The two-dimensional numerical model simulated the instantaneous change of wind direction with respect to the turbine blade. Results were compared with data measurements of S809 aerofoil. Reasonable deviations were obtained between the predicted and experimental results for pitch oscillations. The URANS approach was used to predict the stall while the software FLUENT was used for the numerical solution. It was concluded that the behaviour of the unsteady flow in the wind farm must be considered in order to obtain an accurate estimate of the wind turbine aerodynamic load. 12 refs., 5 figs.

  20. The application of RANS CFD for design of SNCR technology for a pulverized coal-fired boiler

    Directory of Open Access Journals (Sweden)

    Ruszak Monika

    2017-06-01

    Full Text Available The article describes the technology of NOx emission abatement by SNCR method. The scope of research included CDF simulations as well as design and construction of the pilot plant and tests of NOx reduction by urea in the plant located in industrial pulverized-coal fired boiler. The key step of research was to determine the appropriate temperature window for the SNCR process. The proposed solution of the location of injection lances in the combustion chamber enabled to achieve over a 30% reduction of NOx. It is possible to achieve higher effectiveness of the proposed SNCR technology and meet the required emission standards via providing prior reduction of NOx to the level of 350 mg/um3 using the primary methods.

  1. Assessment of RANS at low Prandtl number and simulation of sodium boiling flows with a CMFD code

    Energy Technology Data Exchange (ETDEWEB)

    Mimouni, S., E-mail: stephane.mimouni@edf.fr; Guingo, M.; Lavieville, J.

    2017-02-15

    Highlights: • Modelling of boiling sodium flows in a multiphase flow solver. • Rod heated with a constant heat flux in a pipe liquid metal flow. • Sodium boiling flow around a rod heated with a constant heat. • Computations in progress in an assembly constituted of 19 pins equipped with a wrapped wire. - Abstract: In France, Sodium-cooled Fast Reactors (SFR) have recently received a renewed interest. In 2006, the decision was taken by the French Government to initiate research in order to build a first Generation IV prototype (called ASTRID) by 2020. The improvement in the safety of SFR is one of the key points in their conception. Accidental sequences may lead to a significant increase of reactivity. This is for instance the case when the sodium coolant is boiling within the fissile zone. As a consequence, incipient boiling superheat of sodium is an important parameter, as it can influence boiling process which may appear during some postulated accidents as the unexpected loss of flow (ULOF). The problem is that despite the reduction in core power, when boiling conditions are reached, the flow decreases progressively and vapour expands into the heating zone. A crucial investigating way is to optimize the design of the fissile assemblies of the core in order to lead to stable boiling during a ULOF accident, without voiding of the fissile zone. Moreover, in order to evaluate nuclear plant design and safety, a CFD tool has been developed at EDF in the framework of the nuclear industry. Advanced models dedicated to boiling flows have been implemented and validated against experimental data for ten years now including a wall law for boiling flows, wall transfer for nucleate boiling, turbulence and polydispersion model. This paper aims at evaluating the generalization of these models to SFR. At least two main issues are encountered. Firstly, at low Prandtl numbers such as those of liquid metal, classical approaches derived for unity or close to unity fail to accurately predict the heat transfer. In order to evaluate the wall law implemented in the CFD tool, computations have been compared with KALLA experimental results obtained in the case of a rod heated with a constant heat flux which is concentrically embedded in a pipe liquid metal flow (single-phase flow). Secondly, the incipient boiling superheat of sodium is quite different from that of conventional fluids. As a consequence, the nucleate boiling model has been improved and validated against the Charlety’s experiment where a rod heated with a constant heat flux is concentrically embedded in a pipe sodium flow. For different values of the heat flux, the pressure is measured at different locations as function of the mass flow rate. A reasonable agreement has been reached which is very encouraging for further applications. Finally, preliminary computations have been carried out in an assembly constituted of 19 pins equipped with a wrapped wire where partial experimental results are available. Computations have shown a pressure drop at the end of the heated length due to the sudden increase of the hydraulic diameter. Thus, the pressure can drop below the vapour pressure leading to liquid vaporization. This first result supports the assumption of boiling in the upper subassembly zone which could possibly lead to a sodium boiling stabilization.

  2. Vortex dynamics and elliptical structure wake interaction in the proximity of wall using 2-D RANS simulation

    Directory of Open Access Journals (Sweden)

    Arunkumar H. S.

    2018-01-01

    Full Text Available The 2-D numerical study is performed to analyses the flow characteristic behind the elliptical structure placed near the wall for three different gap ratios as 0.25, 0.5, and 1.0. Computational domain and model is initially validated with the unbounded flow over a cylinder without considering wall effect for Reynolds number of 3900. For flow over the cylinder with near wall, computational domain is modelled as Blasius profile is the input to the area of interest. At different gap ratios the effect of boundary layer on vortex shedding is studied with Reynolds number of 1440. By applying different turbulent model for analysis, study the variation in the results and suggest the suitable model for the present type of study. It has been observed that the wall effect is predominant in case of the gap ratio of 0.25 as compared to other gap ratios.

  3. CFD RANS Simulations on a Generic Conventional Scale Model Submarine: Comparison between Fluent and OpenFOAM

    Science.gov (United States)

    2015-09-01

    1 – Hydrodynamics”, Defence Science and Technology Organisation Technical Report DSTO-TR-1622, 2004. UNCLASSIFIED DST-Group-TN-1449 UNCLASSIFIED...17 7. Joubert, P.N., “Some Aspects of Submarine Design Part 2– Shape of a Submarine 2026”, Defence Science and Technology Organisation Technical

  4. U-rans model for the prediction of the acoustic sound power generated in a whistling corrugated pipe

    NARCIS (Netherlands)

    Golliard, J.; González Díez, N.; Belfroid, S.P.C.; Nakiboǧlu, G.; Hirschberg, A.

    2013-01-01

    Corrugated pipes, as used in flexible risers for gas production or in domestic appliances, can whistle when a flow is imposed through the pipe. Nakiboglu et al [1, 2] have developed a method to compute the acoustic source term for axi-symmetric cavities. The method is based on the resolution of

  5. The GTPase activating Rap/RanGAP domain-like 1 gene is associated with chicken reproductive traits.

    Directory of Open Access Journals (Sweden)

    Xu Shen

    Full Text Available BACKGROUND: Abundant evidence indicates that chicken reproduction is strictly regulated by the hypothalamic-pituitary-gonad (HPG axis, and the genes included in the HPG axis have been studied extensively. However, the question remains as to whether any other genes outside of the HPG system are involved in regulating chicken reproduction. The present study was aimed to identify, on a genome-wide level, novel genes associated with chicken reproductive traits. METHODOLOGY/PRINCIPAL FINDING: Suppressive subtractive hybridization (SSH, genome-wide association study (GWAS, and gene-centric GWAS were used to identify novel genes underlying chicken reproduction. Single marker-trait association analysis with a large population and allelic frequency spectrum analysis were used to confirm the effects of candidate genes. Using two full-sib Ningdu Sanhuang (NDH chickens, GARNL1 was identified as a candidate gene involved in chicken broodiness by SSH analysis. Its expression levels in the hypothalamus and pituitary were significantly higher in brooding chickens than in non-brooding chickens. GWAS analysis with a NDH two tail sample showed that 2802 SNPs were significantly associated with egg number at 300 d of age (EN300. Among the 2802 SNPs, 2 SNPs composed a block overlapping the GARNL1 gene. The gene-centric GWAS analysis with another two tail sample of NDH showed that GARNL1 was strongly associated with EN300 and age at first egg (AFE. Single marker-trait association analysis in 1301 female NDH chickens confirmed that variation in this gene was related to EN300 and AFE. The allelic frequency spectrum of the SNP rs15700989 among 5 different populations supported the above associations. Western blotting, RT-PCR, and qPCR were used to analyze alternative splicing of the GARNL1 gene. RT-PCR detected 5 transcripts and revealed that the transcript, which has a 141 bp insertion, was expressed in a tissue-specific manner. CONCLUSIONS/SIGNIFICANCE: Our findings demonstrate that the GARNL1 gene contributes to chicken reproductive traits.

  6. K. Bannikov. Antropologiia ekstremal’nykh grupp. Dominanthye otnoshenie sredi voennosluzhashchikh srochnoi sluzhby Rossiiskoi Armii, RAN, Moskva, 2002. 399 p.

    Directory of Open Access Journals (Sweden)

    Françoise Daucé

    2004-07-01

    Full Text Available Bannikov’s book is a prominent work in the social-scientific landscape of post-Soviet Russia. Devoted to the study of informal hierarchies in the army, this work is quite unusual in terms of Russian human sciences where military studies have usually been monopolised by military sociologists. Bannikov offers a lot of new sociological material on the army analysed in a convincing anthropological way. Initially, not specialized on military matters but a specialist on traditional rituals in Easte...

  7. Computations of Separated High-Enthalpy Hypersonic Flows: Development of RANS and Variable-Resolution PANS Approaches Project

    Data.gov (United States)

    National Aeronautics and Space Administration — We propose the development of a high fidelity computational approach for unsteady calculations of strongly separated non-equilibrium high-enthalpy hypersonic flows....

  8. Zobrazení psychických poruch v raném díle Chucka Palahniuka

    OpenAIRE

    Konečná, Tereza

    2017-01-01

    This thesis is concerned with the ways mental disorders caused by trauma are represented in the novels Fight Club, Invisible Monsters and Survivor by Chuck Palahniuk. The theoretical part focuses on introduction of the mental disorders and trauma, while the practical part analyses the individual ways the disorders are presented in the novels.

  9. Unsteady rans simulation of the off-design operation of a high expansion ratio ORC radial turbine

    NARCIS (Netherlands)

    Rinaldi, E.; Pecnik, R.; Colonna di Paliano, P.

    2015-01-01

    The design of Organic Rankine cycle (ORC) turbines is a challenging task due to the complex thermodynamic behavior of the working fluid, the typical high expansion ratio which leads to a highly supersonic flow, the flow unsteadiness, and the continuous shift of operation between on- and off-design

  10. Objectivity

    CERN Document Server

    Daston, Lorraine

    2010-01-01

    Objectivity has a history, and it is full of surprises. In Objectivity, Lorraine Daston and Peter Galison chart the emergence of objectivity in the mid-nineteenth-century sciences--and show how the concept differs from its alternatives, truth-to-nature and trained judgment. This is a story of lofty epistemic ideals fused with workaday practices in the making of scientific images. From the eighteenth through the early twenty-first centuries, the images that reveal the deepest commitments of the empirical sciences--from anatomy to crystallography--are those featured in scientific atlases, the compendia that teach practitioners what is worth looking at and how to look at it. Galison and Daston use atlas images to uncover a hidden history of scientific objectivity and its rivals. Whether an atlas maker idealizes an image to capture the essentials in the name of truth-to-nature or refuses to erase even the most incidental detail in the name of objectivity or highlights patterns in the name of trained judgment is a...

  11. How prevalent is object-based attention?

    Directory of Open Access Journals (Sweden)

    Karin S Pilz

    Full Text Available Previous research suggests that visual attention can be allocated to locations in space (space-based attention and to objects (object-based attention. The cueing effects associated with space-based attention tend to be large and are found consistently across experiments. Object-based attention effects, however, are small and found less consistently across experiments. In three experiments we address the possibility that variability in object-based attention effects across studies reflects low incidence of such effects at the level of individual subjects. Experiment 1 measured space-based and object-based cueing effects for horizontal and vertical rectangles in 60 subjects comparing commonly used target detection and discrimination tasks. In Experiment 2 we ran another 120 subjects in a target discrimination task in which rectangle orientation varied between subjects. Using parametric statistical methods, we found object-based effects only for horizontal rectangles. Bootstrapping methods were used to measure effects in individual subjects. Significant space-based cueing effects were found in nearly all subjects in both experiments, across tasks and rectangle orientations. However, only a small number of subjects exhibited significant object-based cueing effects. Experiment 3 measured only object-based attention effects using another common paradigm and again, using bootstrapping, we found only a small number of subjects that exhibited significant object-based cueing effects. Our results show that object-based effects are more prevalent for horizontal rectangles, which is in accordance with the theory that attention may be allocated more easily along the horizontal meridian. The fact that so few individuals exhibit a significant object-based cueing effect presumably is why previous studies of this effect might have yielded inconsistent results. The results from the current study highlight the importance of considering individual subject data in

  12. Protimorové spisy v pozdním středověku a raném novověku.

    OpenAIRE

    PAMPUSCHOVÁ, Marie

    2014-01-01

    The theme of this work are late medieval and early modern time anti-plague treatises and official regulations against plague. In times when many countries and even continents were affected by plague, many city councils and rulers themself had the treatises printed in order to reduce the risk of transmission of the infection and development of the illness. The treatises adjusted regulations of towns and villages. These official decrees against plague were supplemented with plague treatises tha...

  13. Modélisation de la turbulence par approches URANS et hybride RANS-LES. Prise en compte des effets de paroi par pondération elliptique.

    OpenAIRE

    Fadai-Ghotbi, Atabak

    2007-01-01

    The aim of this work is to take into account the natural large-scale unsteadiness in separated flows at a lower cost than a LES, and to model the wall effects on turbulence using second moment closures. Following Durbin's approaches, the elliptic blending model EB-RSM reproduces the non-local blocking effect of the wall, by solving a differential equation on the pressure term. The two-component limit of turbulence is well predicted in a channel flow. This model is applied to the backstep flow...

  14. The National Shipbuilding Research Program. 1997 Ship Production Symposium, Paper Number 20: Design and Production of ANZAC Frigates for the RAN and RNZN: Progress Towards International Competitiveness

    Science.gov (United States)

    1997-04-01

    OFF SITE MODULES 1 STEEL STOCKYARD 2 PLATE BLAST & PRIME 3 NC PLATE CUTTING 4 PANEL FABRICATION 5 UNIT ASSEMBLY 7 ASSEMBLE & PRE...design. Steel for the first ANZAC frigate was cut on 27 March 1992, and the ship was launched on 16 September 1994. Contractor’s Sea Trials were

  15. And the dish ran away with the spoon: a hodgepodge of reflections, as rigorous as they are rambling, on the true subject.

    Science.gov (United States)

    Mogenson, Greg

    2018-02-01

    In this article, the topic of 'the true subject' is explored in terms of a dialectical mode thinking which is in keeping with Jung's great insight concerning psychology's lack of an Archimedean vantage-point distinct from its topics and subject matters. Evocative and expository, the emphasis is upon the performative poetics of such thinking within the sphere of our soul-making. The interpretative mode of practice presented in the article is richly illustrated with examples from Biblical texts, literary images, and proverbial sayings, as well as from the sur-real of nursery rhyme and the genre of the murder mystery. Essential insights of Jung's concerning the infinite and the finite as dimensions of self are revisited in terms of that contemporary trend of Jungian thought known as psychology as the discipline of interiority. © 2018, The Society of Analytical Psychology.

  16. Téma existenciální úzkosti a smrti v raných prózách Dina Buzzatiho

    OpenAIRE

    Barteľová, Tatiana

    2017-01-01

    The main theme of this thesis is the existential anxiety and the motive of death in the early prosaic texts of the Italian author Dino Buzzati. The first chapter is dedicated to the author's biography where mainly the early years of his literary career are emphasized. After this introductory session follows an overview of the main features of existentialism as well as its place in the context of 20th century European literature and philosophy. In the last section of the theoretical part of th...

  17. Random access procedures and radio access network (RAN) overload control in standard and advanced long-term evolution (LTE and LTE-A) networks

    DEFF Research Database (Denmark)

    Kiilerich Pratas, Nuno; Thomsen, Henning; Popovski, Petar

    2015-01-01

    In this chapter, we describe and discuss the current LTE random access procedure and the Radio Access Network Load Control solution within LTE/LTE-A. We provide an overview of the several considered load control solutions and give a detailed description of the standardized Extended Access Class B...

  18. Hadîsler Işığında Mutluluğu Kazandıran Durumlardan Bazıları

    OpenAIRE

    DÖLEK, Adem

    2014-01-01

    Tarih boyunca insanoğlunun huzur ve mutluluğu için rehber olarak birçok peygam-ber gönderilmiştir. Bu peygamberlerin sonuncusu da Hz. Muhammed (s.a.v.)‟dir. Bütün insanlığa müjdeci ve uyarıcı olarak gönderilen son Peygamber Hz. Muham-med (s.a.v.)‟in, yirmi üç yıllık peygamberlik döneminde, bütün insanların dünyevî ve uhrevî mutluluğu için çalıştığı ve bu uğurda gayret sarf ettiği bilinmektedir. Hz. Peygamber‟in bu konudaki hadîsleri araştırıldığında insana mutluluk kazandıracak ve evrensel ni...

  19. Devrim Sonrası İran Ortaokul Tarih Ders Kitaplarında Türklere İlişkin Söylemlerin Analizi

    Directory of Open Access Journals (Sweden)

    Hülya ÇELİK

    2015-10-01

    Full Text Available The Turkish-Iranian relations have come back to ancient period. In the Iranian sources it is stated that the first Turkish-Iranian relations came into being in the time of the Scythians. As being in the Ghaznavid, Seljukid and the Ottoman era in the past, today these relations continue in various dimensions in the Republic of Turkey as well. It is known that, in terms of not only from the political aspects of the peoples of the two countries but also the social and cultural aspects, the Turkish-Iranian relations are also affected. One of the most important implications of these effects is experienced in the field of education. Especially the handled forms of relationships which are experienced from the past to the present in the textbooks, affects the people of the two countries against each other directly. In this study, the current history textbooks taught at the middle school level in Iran is examined in order to determine how the expressions related to the Turks in the history textbooks of the Islamic Republic of Iran. The history textbooks of secondary level which published in 1384 hş. (2007 are composed of the subject of this study. In this study, a descriptive model was applied. In the study, in the collection, analysis and interpretation of the obtained data, qualitative research methods were used. Document review was conducted for data collection. As a result of document analysis the following conclusions were reached: While the Turks outside the boundaries of Iran are otherized the ruling Turkish dynasties are mentioned proudly. However especially against the Shiite and Shia beliefs the Ottomans were regarded as threat. Some parts of the explanations related to Turks are determined to not coincide with historical research findings

  20. Mužství a ženství v české literatuře raného novověku

    OpenAIRE

    Ratajová, Jana

    2009-01-01

    This doctoral thesis aims to analyse the gender categories of male and female in a historical perspective, focusing in particular on the following issues: 1. whether and to what extent these categories were defined in the early modern period (the construction of gender in the early modern texts, the contemporary gender norms and the theory of gender); 2. how the particular genders interrelate, whether and how the binary opposition between masculinity and feminity was being defined in that his...

  1. Koncept hlubší korelace životní v raných rukopisech Jana Patočky

    Czech Academy of Sciences Publication Activity Database

    Novotný, Karel

    2017-01-01

    Roč. 65, č. 6 (2017), s. 833-853 ISSN 0015-1831 R&D Projects: GA ČR(CZ) GA15-10832S Institutional support: RVO:67985955 Keywords : Jan Patočka * phenomenology * world * life * nature * interiority Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  2. Modelling NOX concentrations through CFD-RANS in an urban hot-spot using high resolution traffic emissions and meteorology from a mesoscale model

    Science.gov (United States)

    Sanchez, Beatriz; Santiago, Jose Luis; Martilli, Alberto; Martin, Fernando; Borge, Rafael; Quaassdorff, Christina; de la Paz, David

    2017-08-01

    Air quality management requires more detailed studies about air pollution at urban and local scale over long periods of time. This work focuses on obtaining the spatial distribution of NOx concentration averaged over several days in a heavily trafficked urban area in Madrid (Spain) using a computational fluid dynamics (CFD) model. A methodology based on weighted average of CFD simulations is applied computing the time evolution of NOx dispersion as a sequence of steady-state scenarios taking into account the actual atmospheric conditions. The inputs of emissions are estimated from the traffic emission model and the meteorological information used is derived from a mesoscale model. Finally, the computed concentration map correlates well with 72 passive samplers deployed in the research area. This work reveals the potential of using urban mesoscale simulations together with detailed traffic emissions so as to provide accurate maps of pollutant concentration at microscale using CFD simulations.

  3. Raný Sartre a problematika sociálních rolí (Early Sartre and The Problems of Social Roles

    Directory of Open Access Journals (Sweden)

    Vladimír Ješko

    2012-03-01

    Full Text Available This article wants to point out the importance and influence which early Sartre’s philosophy has on the development of the theory of social roles, which is perceived mostly as a problem of sociology and social psychology. The philosophy of early Sartre clarifies on metaphysical ground why humans have to realize themselves in society through social roles and that these roles are not fundamentally different from theatre roles. This article also points out an affinity which Sartre’s philosophy has with the view of social and cultural anthropology on social roles and their influence on this view. It points out the danger which arises from uncritical fulfillment of social roles and shows that Sartre’s early philosophy can lead to free and critical distance from realization of social roles, which prevents individuals from dogmatic fulfillment.

  4. Ostrčilovy rané písně na německé texty (1898-1899)

    Czech Academy of Sciences Publication Activity Database

    Kratochvílová, Markéta

    2016-01-01

    Roč. 5, č. 1 (2016), s. 1-13 ISSN 1803-7747 R&D Projects: GA ČR(CZ) GP14-35842P Institutional support: RVO:68378076 Keywords : Ostrčil, Otakar * Czech music * 19th –20th century * German songs * Johann Wolfgang Goethe * Friedrich Schiller * Heinrich Heine * Heidenröslein * Gefunden * Amalia * Die Nacht ist feucht und stürmisch Subject RIV: AL - Art, Architecture, Cultural Heritage

  5. Vrstevnické vztahy u dětí s poruchami chování v rané adolescenci

    OpenAIRE

    Bittnerová, Soňa

    2014-01-01

    TITLE: The peer relationships of children with behavioral disorders in early adolescence AUTHOR: Soňa Bittnerová DEPARTMENT: Department of Psychology SUPERVISOR: PhDr. Pavla Presslerová, Ph. D. ABSTRACT: In my bachelor thesis I present the issue of peer relations in the period of adolescence. The aim of this bachelor thesis is to create a probe into relationships among peers within the Dětský domov se školou Měcholupy. I tried to map the quality of the team and to find out the influence of se...

  6. Do subjective assessments of running patterns reflect objective parameters?

    Science.gov (United States)

    Lussiana, Thibault; Gindre, Cyrille; Mourot, Laurent; Hébert-Losier, Kim

    2017-08-01

    Running patterns are often categorized into subgroups according to common features before data analysis and interpretation. The Volodalen(®) method is a simple field-based tool used to classify runners into aerial or terrestrial using a 5-item subjective rating scale. We aimed to validate the Volodalen(®) method by quantifying the relationship between its subjective scores and 3D biomechanical measures. Fifty-four runners ran 30 s on a treadmill at 10, 12, 14, 16, and 18 km h(-1) while their kinematics were assessed subjectively using the Volodalen(®) method and objectively using 3D motion capture. For each runner and speed, two researchers scored the five Volodalen(®) items on a 1-to-5 scale, which addressed vertical oscillation, upper-body motion, pelvis and foot position at ground contact, and footstrike pattern. Seven 3D biomechanical parameters reflecting the subjective items were also collected and correlated to the subjective scores. Twenty-eight runners were classified as aerial and 26 as terrestrial. Runner classification did not change with speed, but the relative contribution of the biomechanical parameters to the subjective classification was speed dependent. The magnitude of correlations between subjective and objective measures ranged from trivial to very large. Five of the seven objective parameters significantly differed between aerial and terrestrial runners, and these parameters demonstrated the strongest correlations to the subjective scores. Our results support the validity of the Volodalen(®) method, whereby the visual appreciation of running gait reflected quantifiable objective parameters. Two minor modifications to the method are proposed to simplify its use and improve agreement between subjective and objective measures.

  7. Biases in the OSSOS Detection of Large Semimajor Axis Trans-Neptunian Objects

    Science.gov (United States)

    Gladman, Brett; Shankman, Cory; OSSOS Collaboration

    2017-10-01

    The accumulating but small set of large semimajor axis trans-Neptunian objects (TNOs) shows an apparent clustering in the orientations of their orbits. This clustering must either be representative of the intrinsic distribution of these TNOs, or else have arisen as a result of observation biases and/or statistically expected variations for such a small set of detected objects. The clustered TNOs were detected across different and independent surveys, which has led to claims that the detections are therefore free of observational bias. This apparent clustering has led to the so-called “Planet 9” hypothesis that a super-Earth currently resides in the distant solar system and causes this clustering. The Outer Solar System Origins Survey (OSSOS) is a large program that ran on the Canada-France-Hawaii Telescope from 2013 to 2017, discovering more than 800 new TNOs. One of the primary design goals of OSSOS was the careful determination of observational biases that would manifest within the detected sample. We demonstrate the striking and non-intuitive biases that exist for the detection of TNOs with large semimajor axes. The eight large semimajor axis OSSOS detections are an independent data set, of comparable size to the conglomerate samples used in previous studies. We conclude that the orbital distribution of the OSSOS sample is consistent with being detected from a uniform underlying angular distribution.

  8. Why is rapid automatized naming related to reading?

    Science.gov (United States)

    Georgiou, George K; Parrila, Rauno; Cui, Ying; Papadopoulos, Timothy C

    2013-05-01

    The objective of this study was to examine why rapid automatized naming (RAN) is related to reading by manipulating processes involved at the input, processing, and output stages of its production. In total, 65 children in Grade 2 and 65 in Grade 6 were assessed on serial and discrete RAN (Digits and Objects), Cancellation, RAN Yes/No, and oral and silent reading fluency. The results of regression analyses indicated that RAN is related to reading because both involve serial processing and oral production of the names of the stimuli. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. Examining the relationship between rapid automatized naming and arithmetic fluency in Chinese kindergarten children.

    Science.gov (United States)

    Cui, Jiaxin; Georgiou, George K; Zhang, Yiyun; Li, Yixun; Shu, Hua; Zhou, Xinlin

    2017-02-01

    Rapid automatized naming (RAN) has been found to predict mathematics. However, the nature of their relationship remains unclear. Thus, the purpose of this study was twofold: (a) to examine how RAN (numeric and non-numeric) predicts a subdomain of mathematics (arithmetic fluency) and (b) to examine what processing skills may account for the RAN-arithmetic fluency relationship. A total of 160 third-year kindergarten Chinese children (83 boys and 77 girls, mean age=5.11years) were assessed on RAN (colors, objects, digits, and dice), nonverbal IQ, visual-verbal paired associate learning, phonological awareness, short-term memory, speed of processing, approximate number system acuity, and arithmetic fluency (addition and subtraction). The results indicated first that RAN was a significant correlate of arithmetic fluency and the correlations did not vary as a function of type of RAN or arithmetic fluency tasks. In addition, RAN continued to predict addition and subtraction fluency even after controlling for all other processing skills. Taken together, these findings challenge the existing theoretical accounts of the RAN-arithmetic fluency relationship and suggest that, similar to reading fluency, multiple processes underlie the RAN-arithmetic fluency relationship. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Rapid Naming Speed Components and Reading Development in a Consistent Orthography

    Science.gov (United States)

    Georgiou, George K.; Papadopoulos, Timothy C.; Fella, Argyro; Parrila, Rauno

    2012-01-01

    We examined how rapid automatized naming (RAN) components--articulation time and pause time--predict word and text reading fluency in a consistent orthography (Greek). In total, 68 children were followed from Grade 2 to Grade 6 and were assessed three times on RAN (Digits and Objects), phonological awareness, orthographic processing, speed of…

  11. Development of an objective tool for the diagnosis of myxedema coma.

    Science.gov (United States)

    Chiong, Yien V; Bammerlin, Elaine; Mariash, Cary N

    2015-09-01

    Myxedema coma, a rare entity, with a reported 25%-65% mortality had no objective criteria for making the diagnosis when we began our study. We developed an objective screening tool for myxedema coma to more easily identify patients and examine the best treatment method in future prospective studies to reduce the mortality of this entity. We conducted a retrospective chart review to find all patients aged ≥18 years admitted with myxedema coma from January 1, 2005 through June 13, 2010 at Indiana University Health Methodist Hospital. On the basis of both our retrospective chart review and on literature accounts, we identified 6 criteria to diagnose myxedema coma. We identified 10 patients initially diagnosed with myxedema coma and established a control group consisting of 13 patients identified with altered mental status and increased thyroid-stimulating hormone (TSH) levels. The 6 variables we created for the screening tool were heart rate, temperature, Glasgow coma scale, TSH, free thyroxine, and precipitating factors. The screening tool has a sensitivity and specificity of about 80%. We ran a logistic regression model using the 10 study patients and 13 controls with the 6 variables. No variables alone significantly contributed to the model. However, the overall model was highly significant (P = 0.012), providing strong support for a scoring system that uses these variables simultaneously. This screening tool enables physicians to rapidly diagnose myxedema coma to expedite treatment. A more refined diagnostic tool may be used in future clinical studies designed to determine the optimal treatment. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. 2015 HAZİRAN VE KASIM SEÇİMLERİNDE SİYASAL EĞİLİM: YENİ BİR KAMUOYU ÖLÇÜMLEME ARACI OLARAK TWİTTER

    OpenAIRE

    TOKER, Huriye; Erdem, Sabri; ÖZŞARLAK, Pınar

    2017-01-01

    Günümüzde yeni neslin, düşünce ve fikirlerini ifade etme, siyasal alanda görüşlerini beyanetme, çevresindekileri politik hareketlere teşvik etme, seçilmiş siyasi liderleri sosyal medya üzerindentakip etme konularında inisiyatif alabildiğine ilişkin bulgular elde edilmektedir. Bu kapsamda2015 Haziran seçimlerine ilişkin 1011 Twitter kullanıcısının mesajları incelenerek siyasal eğilimibelirlenmeye çalışılmış ve seçilen örneklem üzerinden 364 kullanıcın Twitter mesajları 2015 Kasımseçimleri çerç...

  13. Domácí násilí z pohledu týraných žen a z pohledu personálu o ně pečujícího

    OpenAIRE

    Michalčíková, Lucie

    2010-01-01

    - 66 - ANNOTATION Author: Lucie Michalčíková Institution: Department of Social Medicine LF UK in Hradec Králové Nursing Department Title: Domestic violence from point of womens and nurses Leading tutor: PhDr. Mariana Bažantová Page count: 78 stran Attachments: 6 p íloh Year of defence: 2010 Keywords Violence, family, forms of violence, violence in family, pathological behaviour, partnership, intervention, syndrome of learned powerlessness, learned powerlessness, society, law. Anotation Bachel...

  14. « La versification d’un poème pehlevi », in : Ali Ashraf Sadeghi, ed., Tafazzoli Memorial Volume. Téhéran, 2001, pp. 39-47.

    OpenAIRE

    Fouchécour, Charles-Henri de

    2005-01-01

    Cet article est la neuvième étude de l’A., dans sa série EVLIA (Etudes sur la Versification dans les Langues Irano-Ariennes) (liste en bibliographie), destinée à montrer qu’il existe une continuité formelle allant de la versification de poèmes parthes à celle du motaqāreb propre au persan classique, en passant – c’est le cas de cet article – par la versification en moyen-perse, telle que l’A. la dégage d’un poème pehlevi que publièrent A. Tafazzoli et Sh. Shaked. L’étude est fondée sur le tex...

  15. Vliv teploty vody a intenzity světla na raný vývoj sumečka afrického v komerčním chovu

    OpenAIRE

    PROKEŠOVÁ, Markéta

    2016-01-01

    The successful production of quality early fish stages is crucial for artificial rearing fish species. Nevertheless, it is quite a problematic process, because fish as poikilothermic organisms are highly sensitive to various environmental conditions. Moreover, both fish embryos and larvae are more affected by biotic and abiotic factors (such as predation, stocking density, temperature, light, pH, salinity, oxygen saturation, feeding availability, or their interactions) than older juveniles or...

  16. Object and Objective Lost?

    DEFF Research Database (Denmark)

    Lopdrup-Hjorth, Thomas

    2015-01-01

    This paper explores the erosion and problematization of ‘the organization’ as a demarcated entity. Utilizing Foucault's reflections on ‘state-phobia’ as a source of inspiration, I show how an organization-phobia has gained a hold within Organization Theory (OT). By attending to the history...... of this organization-phobia, the paper argues that OT has become increasingly incapable of speaking about its core object. I show how organizations went from being conceptualized as entities of major importance to becoming theoretically deconstructed and associated with all kinds of ills. Through this history......, organizations as distinct entities have been rendered so problematic that they have gradually come to be removed from the center of OT. The costs of this have been rather significant. Besides undermining the grounds that gave OT intellectual credibility and legitimacy to begin with, the organization-phobia...

  17. The Mission Accessible Near-Earth Object Survey (MANOS): Project Status

    Science.gov (United States)

    Moskovitz, Nicholas; Thirouin, Audrey; Mommert, Michael; Thomas, Cristina A.; Skiff, Brian; Polishook, David; Burt, Brian; Trilling, David E.; DeMeo, Francesca E.; Binzel, Richard P.; Christensen, Eric J.; Willman, Mark; Hinkle, Mary

    2017-10-01

    The Mission Accessible Near-Earth Object Survey (MANOS) is a physical characterization survey of sub-km, low delta-v, newly discovered near-Earth objects (NEOs). MANOS aims to collect astrometry, lightcurve photometry, and reflectance spectra for a representative sample of these important target of opportunity objects in a rarely observed size range. We employ a diverse set of large aperture (2-8 meter) telescopes and observing modes (queue, remote, classical) to overcome the challenge of observing faint NEOs moving at high non-sidereal rates with short observing windows. We target approximately 10% of newly discovered NEOs every month for follow-up characterization.The first generation MANOS ran from late 2013 to early 2017, using telescopes at Lowell Observatory, NOAO, and the University of Hawaii. This resulted in the collection of data for over 500 targets. These data are continuing to provide new insights into the NEO population as a whole as well as for individual objects of interest. Science highlights include identification of the four fastest rotating minor planets found to date with rotation periods under 20 seconds, constraints on the distribution of NEO morphologies as quantified by de-biased estimates for lightcurve-derived axis ratios, and the compositional distribution of NEOs at sizes under 100 meters.The second generation MANOS will begin in late 2017 and will employ much of the same strategies while continuing to build a comprehensive dataset of NEO physical properties. This will grow the MANOS sample to ~1000 objects and provide the means to better address key questions related to understanding the physical properties of NEOs, their viability as exploration mission targets, and their relationship to Main Belt asteroids and meteorites. This continuation of MANOS will include an increased focus on spectroscopic observations at near-IR wavelengths using a new instrument called NIHTS (the Near-Infrared High-Throughput Spectrograph) at Lowell

  18. Influencing Leaders

    OpenAIRE

    Alliston, John C.

    2003-01-01

    The Institute of Agricultural Management Leadership course first ran in 2002. The two objectives were to improve the leadership qualities of existing leaders, and to give time to consider how a clear forward vision of the industry could be achieved.

  19. NCBI nr-aa BLAST: CBRC-TGUT-37-0153 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TGUT-37-0153 ref|NP_005484.2| RAN binding protein 9 [Homo sapiens] sp|Q96S59|RANB9_HUMAN Ran-bi...nding protein 9 (RanBP9) (RanBP7) (Ran-binding protein M) (RanBPM) (BPM90) (BPM-L) dbj|BAB6...2525.1| RanBPM [Homo sapiens] emb|CAI19841.1| RAN binding protein 9 [Homo sapiens] emb|CAI21594.1| RAN bindi...ng protein 9 [Homo sapiens] gb|EAW55341.1| RAN binding protein 9, isoform CRA_a [...Homo sapiens] gb|EAW55345.1| RAN binding protein 9, isoform CRA_a [Homo sapiens] NP_005484.2 0.001 35% ...

  20. MULTIPLE OBJECTS

    Directory of Open Access Journals (Sweden)

    A. A. Bosov

    2015-04-01

    Full Text Available Purpose. The development of complicated techniques of production and management processes, information systems, computer science, applied objects of systems theory and others requires improvement of mathematical methods, new approaches for researches of application systems. And the variety and diversity of subject systems makes necessary the development of a model that generalizes the classical sets and their development – sets of sets. Multiple objects unlike sets are constructed by multiple structures and represented by the structure and content. The aim of the work is the analysis of multiple structures, generating multiple objects, the further development of operations on these objects in application systems. Methodology. To achieve the objectives of the researches, the structure of multiple objects represents as constructive trio, consisting of media, signatures and axiomatic. Multiple object is determined by the structure and content, as well as represented by hybrid superposition, composed of sets, multi-sets, ordered sets (lists and heterogeneous sets (sequences, corteges. Findings. In this paper we study the properties and characteristics of the components of hybrid multiple objects of complex systems, proposed assessments of their complexity, shown the rules of internal and external operations on objects of implementation. We introduce the relation of arbitrary order over multiple objects, we define the description of functions and display on objects of multiple structures. Originality.In this paper we consider the development of multiple structures, generating multiple objects.Practical value. The transition from the abstract to the subject of multiple structures requires the transformation of the system and multiple objects. Transformation involves three successive stages: specification (binding to the domain, interpretation (multiple sites and particularization (goals. The proposed describe systems approach based on hybrid sets

  1. LES of High-Reynolds-Number Coanda Flow Separating from a Rounded Trailing Edge of a Circulation Control Airfoil

    Science.gov (United States)

    Nichino, Takafumi; Hahn, Seonghyeon; Shariff, Karim

    2010-01-01

    This slide presentation reviews the Large Eddy Simulation of a high reynolds number Coanda flow that is separated from a round trailing edge of a ciruclation control airfoil. The objectives of the study are: (1) To investigate detailed physics (flow structures and statistics) of the fully turbulent Coanda jet applied to a CC airfoil, by using LES (2) To compare LES and RANS results to figure out how to improve the performance of existing RANS models for this type of flow.

  2. Pragmatic Objectivity

    OpenAIRE

    Michele Marsonet

    2014-01-01

    Nicholas Rescher writes that “objectivity is not something we infer from the data; it is something we must presuppose. It is something that we postulate or presume from the very outset of our dealings with people’s claims about the world’s facts”. Such definition is just the opposite of objectivity conceived of in classical terms, but it cannot be equated with an idealistic viewpoint according to which objectivity is something that our mind simply creates in the process of reflection. It is, ...

  3. Multiple scattering modeling pipeline for spectroscopy and photometry of airless Solar System objects

    Science.gov (United States)

    Penttilä, Antti; Väisänen, Timo; Markkanen, Johannes; Martikainen, Julia; Gritsevich, Maria; Muinonen, Karri

    2017-10-01

    We combine numerical tools to analyze the reflectance spectra of granular materials. Our motivation comes from the lack of tools when it comes to intimate mixing of materials and modeling space-weathering effects with nano- or micron-sized inclusions. The current practice is to apply a semi-physical models such as the Hapke models (e.g., Icarus 195, 2008). These are expressed in a closed form so that they are fast to apply. The problem is that the validity of the model is not guaranteed, and the derived properties related to particle scattering can be unrealistic (JQSRT 113, 2012).Our pipeline consists of individual scattering simulation codes and a main program that chains them together. The chain for analyzing a macroscopic target with space-weathered mineral would go as: (1) Scattering properties of small inclusions inside a host matrix are derived using exact Maxwell equation solvers. From the scattering properties, we use the so-called incoherent fields and Mueller matrices as input for the next step; (2) Scattering by a regolith grain is solved using a geometrical optics method with surface reflections, internal absorption, and internal diffuse scattering; (3) The radiative transfer simulation is executed inputting the regolith grains from the previous step as the scatterers in a macroscopic planar volume element.For the most realistic asteroid reflectance model, the chain would produce the properties of a planar surface element. Then, a shadowing simulation over the surface elements would be considered, and finally the asteroid phase function would be solved by integrating the bidirectional reflectance distribution function of the planar element over the object's realistic shape model.The tools in the proposed chain already exist, and practical task for us is to tie these together into an easy-to-use public pipeline. We plan to open the pipeline as a web-based open service a dedicated server, using Django application server and Python environment for the

  4. Trusted Objects

    Energy Technology Data Exchange (ETDEWEB)

    CAMPBELL,PHILIP L.; PIERSON,LYNDON G.; WITZKE,EDWARD L.

    1999-10-27

    In the world of computers a trusted object is a collection of possibly-sensitive data and programs that can be allowed to reside and execute on a computer, even on an adversary's machine. Beyond the scope of one computer we believe that network-based agents in high-consequence and highly reliable applications will depend on this approach, and that the basis for such objects is what we call ''faithful execution.''

  5. Fashion Objects

    DEFF Research Database (Denmark)

    Andersen, Bjørn Schiermer

    2009-01-01

    This article attempts to create a framework for understanding modern fashion phenomena on the basis of Durkheim's sociology of religion. It focuses on Durkheim's conception of the relation between the cult and the sacred object, on his notion of 'exteriorisation', and on his theory of the social...... symbol in an attempt to describe the peculiar attraction of the fashion object and its social constitution. However, Durkheim's notions of cult and ritual must undergo profound changes if they are to be used in an analysis of fashion. The article tries to expand the Durkheimian cult, radically enlarging...... it without totally dispersing it; depicting it as held together exclusively by the sheer 'force' of the sacred object. Firstly, the article introduces the themes and problems surrounding Durkheim's conception of the sacred. Next, it briefly sketches an outline of fashion phenomena in Durkheimian categories...

  6. Objective thermomechanics

    CERN Document Server

    Fülöp, Tamás

    2015-01-01

    An irreversible thermodynamical theory of solids is presented where the kinematic quantities are defined in an automatically objective way. Namely, auxiliary elements like reference frame, reference time and reference configuration are avoided by formulating the motion of the continuum on spacetime directly, utilizing the Weyl-Matolcsi description of spacetime. This restricts the range of definable kinematic quantities heavily. Solids are distinguished from fluids by possessing not only an instantaneous metric tensor but a relaxed metric, too, that represents the natural geometric structure of the solid. The comparison of the instantaneous metric to the relaxed one is the basis of the definition of the elastic state variable, the elastic deformedness tensor. Thermal expansion is conceived as the temperature dependence of the relaxed metric. As opposed to this reversible type of change, plasticity means an irreversible change in the relaxed metric, and is describable via a plastic change rate tensor. The relat...

  7. Sound objects – Auditory objects – Musical objects

    DEFF Research Database (Denmark)

    Hjortkjær, Jens

    2015-01-01

    ’. In this paper, I review recent neurocognitive research suggesting that the auditory system is sensitive to structural information about real-world objects. Instead of focusing solely on perceptual sound features as determinants of auditory objects, I propose that real-world object properties are inherent......The auditory system transforms patterns of sound energy into perceptual objects but the precise definition of an ‘auditory object’ is much debated. In the context of music listening, Pierre Schaeffer argued that ‘sound objects’ are the fundamental perceptual units in ‘musical objects...

  8. Sound objects – Auditory objects – Musical objects

    DEFF Research Database (Denmark)

    Hjortkjær, Jens

    2016-01-01

    ’. In this paper, I review recent neurocognitive research suggesting that the auditory system is sensitive to structural information about real-world objects. Instead of focusing solely on perceptual sound features as determinants of auditory objects, I propose that real-world object properties are inherent......The auditory system transforms patterns of sound energy into perceptual objects but the precise definition of an ‘auditory object’ is much debated. In the context of music listening, Pierre Schaeffer argued that ‘sound objects’ are the fundamental perceptual units in ‘musical objects...

  9. Stručný dotazník dětského slovníku: vývoj a normy nástroje pro screening vývoje jazyka v raném věku

    Czech Academy of Sciences Publication Activity Database

    Smolík, Filip; Bytešníková, I.

    2017-01-01

    Roč. 61, č. 5 (2017), s. 460-473 ISSN 0009-062X R&D Projects: GA ČR GA13-26779S Grant - others:AV ČR(CZ) StrategieAV21/14 Program:StrategieAV Institutional support: RVO:68081740 Keywords : language acquisition * developmental screening * vocabulary Subject RIV: AN - Psychology Impact factor: 0.242, year: 2016

  10. Töölepingu seaduse § 37 : kas tööandja võimalus oma äranägemise järgi töötasu vähendada või turvalise paindlikkuse rakendamise positiivne näide? / Annika Rosin

    Index Scriptorium Estoniae

    Rosin, Annika

    2013-01-01

    Millistel tingimustel on võimalik tööandjal ühepoolselt töötasu vähendada, kas ja kuidas on vastav reeglistik võrreldes varasemaga muutunud ning kas sellise võimaluse andmine on kooskõlas turvalise paindlikkuse kontseptsiooniga

  11. « The Activities of Iranian Astronomers in Mongol China », in : N. Pourjavady & Ž. Vesel, éds., Sciences, techniques et instruments dans le monde iranien (Xe-XIXe siècle). Téhéran, Presses Universitaires d'Iran / Institut Français d

    OpenAIRE

    Rédaction,

    2007-01-01

    This article deals with two specifically Iranian aspects of the works that were used by the Muslim astronomers who had been brought to Beijing by the Mongols in the last third of the 13th century. Two of these works, an astronomical handbook (zīj) compiled in China on the basis of new observations and the popular astrology by Kūshyār ibn Labbān (ca. 1000), were translated into Chinese in 1383. Transliterations of the titles of some other works and of various astronomical instruments were list...

  12. Nález zbytku medem slazené potraviny ve výbavě raně středověkého hrobu v Libici nad Cidlinou-Kaníně. Zhodnocení nálezu z hlediska rekonstrukce krajiny a vegetace

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Petr; Mařík, Jan

    2006-01-01

    Roč. 58, č. 3 (2006), s. 559-569 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : pollen analysis * Early Medieval * archaeobotany Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Quasi-objects, Cult Objects and Fashion Objects

    DEFF Research Database (Denmark)

    Andersen, Bjørn Schiermer

    2011-01-01

    This article attempts to rehabilitate the concept of fetishism and to contribute to the debate on the social role of objects as well as to fashion theory. Extrapolating from Michel Serres’ theory of the quasi-objects, I distinguish two phenomenologies possessing almost opposite characteristics....... These two phenomenologies are, so I argue, essential to quasi-object theory, yet largely ignored by Serres’ sociological interpreters. They correspond with the two different theories of fetishism found in Marx and Durkheim, respectively. In the second half of the article, I introduce the fashion object...... as a unique opportunity for studying the interchange between these two forms of fetishism and their respective phenomenologies. Finally, returning to Serres, I briefly consider the theoretical consequences of introducing the fashion object as a quasi-object....

  14. Multi-objective optimization of a low specific speed centrifugal pump using an evolutionary algorithm

    Science.gov (United States)

    An, Zhao; Zhounian, Lai; Peng, Wu; Linlin, Cao; Dazhuan, Wu

    2016-07-01

    This paper describes the shape optimization of a low specific speed centrifugal pump at the design point. The target pump has already been manually modified on the basis of empirical knowledge. A genetic algorithm (NSGA-II) with certain enhancements is adopted to improve its performance further with respect to two goals. In order to limit the number of design variables without losing geometric information, the impeller is parametrized using the Bézier curve and a B-spline. Numerical simulation based on a Reynolds averaged Navier-Stokes (RANS) turbulent model is done in parallel to evaluate the flow field. A back-propagating neural network is constructed as a surrogate for performance prediction to save computing time, while initial samples are selected according to an orthogonal array. Then global Pareto-optimal solutions are obtained and analysed. The results manifest that unexpected flow structures, such as the secondary flow on the meridian plane, have diminished or vanished in the optimized pump.

  15. Why Does Rapid Naming Predict Chinese Word Reading?

    Science.gov (United States)

    Shum, Kathy Kar-man; Au, Terry Kit-fong

    2017-01-01

    Rapid automatized naming (RAN) robustly predicts early reading abilities across languages, but its underlying mechanism remains unclear. This study found that RAN associated significantly with processing speed but not with phonological awareness or orthographic knowledge in 89 Hong Kong Chinese second-graders. RAN overlaps more with processing…

  16. Cognitive Predictors of Rapid Picture Naming

    Science.gov (United States)

    Decker, Scott L.; Roberts, Alycia M.; Englund, Julia A.

    2013-01-01

    Deficits in rapid automatized naming (RAN) have been found to be a sensitive cognitive marker for children with dyslexia. However, there is a lack of consensus regarding the construct validity and theoretical neuro-cognitive processes involved in RAN. Additionally, most studies investigating RAN include a narrow range of cognitive measures. The…

  17. Challenges in simulating coastal effects on an offshore wind farm

    Science.gov (United States)

    van der Laan, M. P.; Peña, A.; Volker, P.; Hansen, K. S.; Sørensen, N. N.; Ott, S.; Hasager, C. B.

    2017-05-01

    The effect of a coastline on an offshore wind farm is investigated with a Reynolds-averaged Navier-Stokes (RANS) model. The trends of the RANS model compare relatively well with results from a mesoscale model and measurements of wind turbine power. In addition, challenges of modeling a large domain in RANS are discussed.

  18. 78 FR 5179 - Granting of Request for Early Termination of the Waiting Period Under the Premerger Notification...

    Science.gov (United States)

    2013-01-24

    ...Nation, Inc. 12/10/2012 20130190 G Clean Harbors, Inc.; Safety- Kleen, Inc.; Clean Harbors, Inc. 20130301...; Expedia, Inc.; Barry Diller. 20130445 G Freeport-McMoRan Copper & Gold Inc.; Plains Exploration & Production Company; Freeport-McMoRan Copper & Gold Inc. 20130446 G Freeport-McMoRan Copper & Gold Inc.; McMo...

  19. Evaluation of Iroquois UH-1B Stability and Control.

    Science.gov (United States)

    1982-09-01

    longitudinal tilt of the main rotor swash plate by means of a push-pull rod system which incorporates an over-centre bellcrank. A plot of the design variation...Office: DNAE 6 AMFTU RAN NOWRA 7 RANTAU 8 Superintendent, Aircraft Maintenance & Repair, C/- RAN Dockyard , GARDEN ISLAND 9 HC 723 Squadron RAN NOWRA 10

  20. Per Object statistical analysis

    DEFF Research Database (Denmark)

    2008-01-01

    This RS code is to do Object-by-Object analysis of each Object's sub-objects, e.g. statistical analysis of an object's individual image data pixels. Statistics, such as percentiles (so-called "quartiles") are derived by the process, but the return of that can only be a Scene Variable, not an Object...... an analysis of the values of the object's pixels in MS-Excel. The shell of the proceedure could also be used for purposes other than just the derivation of Object - Sub-object statistics, e.g. rule-based assigment processes....... Variable. This procedure was developed in order to be able to export objects as ESRI shape data with the 90-percentile of the Hue of each object's pixels as an item in the shape attribute table. This procedure uses a sub-level single pixel chessboard segmentation, loops for each of the objects...

  1. Natural Language Object Retrieval

    OpenAIRE

    Hu, Ronghang; Xu, Huazhe; Rohrbach, Marcus; Feng, Jiashi; Saenko, Kate; Darrell, Trevor

    2015-01-01

    In this paper, we address the task of natural language object retrieval, to localize a target object within a given image based on a natural language query of the object. Natural language object retrieval differs from text-based image retrieval task as it involves spatial information about objects within the scene and global scene context. To address this issue, we propose a novel Spatial Context Recurrent ConvNet (SCRC) model as scoring function on candidate boxes for object retrieval, integ...

  2. Object reading: text recognition for object recognition

    NARCIS (Netherlands)

    Karaoglu, S.; van Gemert, J.C.; Gevers, T.

    2012-01-01

    We propose to use text recognition to aid in visual object class recognition. To this end we first propose a new algorithm for text detection in natural images. The proposed text detection is based on saliency cues and a context fusion step. The algorithm does not need any parameter tuning and can

  3. Seeing Objects as Faces Enhances Object Detection

    Directory of Open Access Journals (Sweden)

    Kohske Takahashi

    2015-09-01

    Full Text Available The face is a special visual stimulus. Both bottom-up processes for low-level facial features and top-down modulation by face expectations contribute to the advantages of face perception. However, it is hard to dissociate the top-down factors from the bottom-up processes, since facial stimuli mandatorily lead to face awareness. In the present study, using the face pareidolia phenomenon, we demonstrated that face awareness, namely seeing an object as a face, enhances object detection performance. In face pareidolia, some people see a visual stimulus, for example, three dots arranged in V shape, as a face, while others do not. This phenomenon allows us to investigate the effect of face awareness leaving the stimulus per se unchanged. Participants were asked to detect a face target or a triangle target. While target per se was identical between the two tasks, the detection sensitivity was higher when the participants recognized the target as a face. This was the case irrespective of the stimulus eccentricity or the vertical orientation of the stimulus. These results demonstrate that seeing an object as a face facilitates object detection via top-down modulation. The advantages of face perception are, therefore, at least partly, due to face awareness.

  4. Choosing for learning objects

    NARCIS (Netherlands)

    Schoonenboom, Judith; Emans, Bruno; Meijer, Joost

    2006-01-01

    Choosing for learning objects discusses eight educational ambitions and the possible roles of learning objects in realising these ambitions. The eight educational ambitions are: (1) Creating independent learning pathways, for example for lifelong learners; (2) Making education more flexible; (3)

  5. Behavioral Objectives for English

    Science.gov (United States)

    Zoellner, Robert

    1972-01-01

    A review-critique of On Writing Behavioral Objectives for English, by John Maxwell and Anthony Lovat, in which behavioral objectives theory is dominated by a stimulus-response rather than a stimulus-response-reinforcement psychology. The reviewer questions whether behavioral objectives can be applied accurately and without distortion of meanings,…

  6. Objects in Motion

    Science.gov (United States)

    Damonte, Kathleen

    2004-01-01

    One thing scientists study is how objects move. A famous scientist named Sir Isaac Newton (1642-1727) spent a lot of time observing objects in motion and came up with three laws that describe how things move. This explanation only deals with the first of his three laws of motion. Newton's First Law of Motion says that moving objects will continue…

  7. Survivability via Control Objectives

    Energy Technology Data Exchange (ETDEWEB)

    CAMPBELL,PHILIP L.

    2000-08-11

    Control objectives open an additional front in the survivability battle. A given set of control objectives is valuable if it represents good practices, it is complete (it covers all the necessary areas), and it is auditable. CobiT and BS 7799 are two examples of control objective sets.

  8. On the Crime Object

    Science.gov (United States)

    Akutaev, Rasul M.; Magomedov, Guseyn B.

    2016-01-01

    The relevance of the research of this problem is caused by the theoretical and practical needs of a specific concept of the crime object as one of the corpus delicti signs essentially the determining and defining its object and objective side, thereby--the nature of socially dangerous act. Besides, being a facultative sign of corpus delicti, the…

  9. Alphanumeric and non-alphanumeric Rapid Automatized Naming in children with reading and/or spelling difficulties and mathematical difficulties

    NARCIS (Netherlands)

    Donker, M.; Kroesbergen, E.; Slot, E.; Van Viersen, S.; De Bree, E.

    2016-01-01

    Although poor Rapid Automatized Naming (RAN) is a risk factor for reading and/or spelling difficulties (RSD) as well as for mathematical difficulties (MD), many questions surround this relationship. The main objective of the present study was to obtain insight in the relationship between

  10. Alphanumeric and non-alphanumeric rapid automatized naming in children with reading and/or spelling difficulties and mathematical difficulties

    NARCIS (Netherlands)

    Donker, M.H.; Kroesbergen, E.H.; Slot, E.M.; Viersen, S. van; Bree, E.H. de

    2016-01-01

    Although poor Rapid Automatized Naming (RAN) is a risk factor for reading and/or spelling difficulties (RSD) as well as for mathematical difficulties (MD), many questions surround this relationship. The main objective of the present study was to obtain insight in the relationship between

  11. Samaru Journal of Information Studies -main-fx

    African Journals Online (AJOL)

    USER

    acquisition programme by the academic libraries. Thus ... own set of objectives and commitment within the ... libraries under study to identify other avenues for ... Nigerian economy ran into problems in the early ... Sciences, Social Sciences, Mathematics, Physics, ... learning, teaching and research in the university, the.

  12. Effects of Running on Depressed Adults.

    Science.gov (United States)

    Fetsch, Robert J.; Sprinkle, R. Leo

    1983-01-01

    Reviews three conceptual models of depression: (1) aggression-turned-inward; (2) object-loss; and (3) negative cognitive set, and measured the effects of group treatment emphasizing running. The reactive depression levels of adults (N=8) who ran noncompetitively for 4 weeks dropped by a significant amount. The social dimension was an important…

  13. The Maputo Development

    African Journals Online (AJOL)

    ANBR

    interview he stated that the MDC had a number of key objectives. These included the rehabilitation of .... In 1995 the department of Transport established a technical team drawn from the. Development Bank of South Africa .... This comprised an applied research, pilot project and applied training programme that ran on both ...

  14. Prevention of ochratoxin A in cereals in Europe

    DEFF Research Database (Denmark)

    Olsen, Monica; Jonsson, Nils; Magan, Naresh

    2006-01-01

    This paper describes objectives and activities of a major European Community project (OTA PREV) aimed at understanding sources of contamination of ochratoxin A in European cereals and related food-stuffs, and the development of strategies to minimise ochratoxin A in the food supply. The project ran...

  15. Rapid naming and phonemic awareness in children with reading disabilities and/or specific language impairment : Differentiating processes?

    NARCIS (Netherlands)

    De Groot, Bartholomeus J.A.; Van den Bos, Kees P.; Van der Meulen, Bieuwe F.; Minnaert, Alexander E.M.G.

    2015-01-01

    The objective of this study was to assess and compare the predictive values of group membership for rapid automatized naming (RAN) and phonemic awareness (PA) in Dutch school children with and without reading disabilities (RD) or specific language impairment (SLI). A composite word reading index and

  16. Objects, materiality and meaning

    DEFF Research Database (Denmark)

    Lenau, Torben Anker; Lindegaard, Hanne

    2008-01-01

    of the object, and the designers aim is therefore to tune both in order to achieve a desired goal. To do so the designer basically has 2 options: Alteration of the physical shape of the object and the selection of materials. Through the manipulation of shape and materials can symbolic and sensory information......The present research work investigates the relation between physical objects, their materiality, understood as the physical substances they are made from, and the communication from the objects. In product design of physical objects the communicative aspects are just as important as the function...... be written into the object. The materials are therefore carriers of communication, even though this is dependent of the cultural context and the environment which the object will be part of. However the designer has only minor influence on those....

  17. Abstract Objects of Verbs

    DEFF Research Database (Denmark)

    2014-01-01

    Verbs do often take arguments of quite different types. In an orthodox type-theoretic framework this results in an extreme polysemy of many verbs. In this article, it is shown that this unwanted consequence can be avoided when a theory of "abstract objects" is adopted according to which...... these objects represent non-objectual entities in contexts from which they are excluded by type restrictions. Thus these objects are "abstract'' in a functional rather than in an ontological sense: they function as representatives of other entities but they are otherwise quite normal objects. Three examples...... of such a representation are considered: the denotations of that-phrases are objects representing propositions, generic noun phrases denote objects standing for sorts, and infinitivals are viewed as denoting objects representing attributes, i.e., the "ordinary'' meanings of verb phrases....

  18. Early object relations into new objects.

    Science.gov (United States)

    Downey, T W

    2001-01-01

    Two strands of change are suggested by this review, one maturational, the other therapeutic or developmental (Hartmann and Kris, 1945). By "maturational" I mean to suggest energies that infuse the individual from earliest life in a manner that includes object relations, but for the healthy exercise of which object relations per se need not be of central and crucial importance. Within wide limits such energies may be delayed until growth conditions prevail without significant distortion of certain of the organism's ego functions. Therapeutic change is analogous to developmental change in that both involve the crucial presence of another to release energies. In therapeutic change these are energies that have been repressed beyond the reach of developmental dynamics. In everyday development crisis and synthesis alternate in conjunction with new and emerging objects to add to the psychological structures brought to the fore by maturation. In many instances, as we see with John, over time and in a less focussed manner, developmental changes can approximate therapeutic change and visa versa. Freud-Dann in their "experiment" pursued one line, in which the equipmental delay brought on by extremely adverse living circumstances was redressed by providing an interpersonally enriching, loving, developmentally facilitating milieu. The sketches of individual children and John's subsequent story provide a perspective into what becomes the stuff of growth and what remains the stuff of neurosis. The developmental reserves and ego resilience of these children were impressive but probably not extraordinary. Usual growth ensued as soon as they were provided with the rich soil of Bulldogs Bank instead of the desert sand of the Tereszin concentration camp. However, no one can escape such adverse circumstances without having taken in the stuff of neurosis. Affects and percepts that were not assimilatable or even available to consciousness at the time remain buried in the unconscious

  19. Cultivating objects in interaction

    DEFF Research Database (Denmark)

    Hazel, Spencer

    2014-01-01

    the interactional resources which mundane everyday objects provide interactants in the multimodal design of their turns-at-talk. Although the objects which feature in the data – for example notepads, tables, computer monitors – have practical functions within the social ecology of these institutional settings......This paper demonstrates how an initial indexing of objects through gesture and talk provides a residual basis for later indexical development across a stretch of discourse. I show how participants are able to perform an initial mobilization of affordances (Hutchby, 2001) of objects in the immediate...... surround through a combination of vocal, visual and tactile means; once indexed one way, these objects are subsequently recycled in later multimodal turn design. By tracking recurrent participant orientations to particular objects made relevant in the surround, we are able to explore further...

  20. Confinement for Active Objects

    OpenAIRE

    Florian Kammuller

    2014-01-01

    In this paper, we provide a formal framework for the security of distributed active objects. Active objects com-municate asynchronously implementing method calls via futures. We base the formal framework on a security model that uses a semi-lattice to enable multi-lateral security crucial for distributed architectures. We further provide a security type system for the programming model ASPfun of functional active objects. Type safety and a confinement property are presented. ASPfun thus reali...

  1. Objective-C

    CERN Document Server

    DeVoe, Jiva

    2011-01-01

    A soup-to-nuts guide on the Objective-C programming language. Objective-C is the language behind Cocoa and Cocoa Touch, which is the Framework of applications written for the Macintosh, iPod touch, iPhone, and iPad platforms. Part of the Developer Reference series covering the hottest Apple topics, this book covers everything from the basics of the C language to advanced aspects of Apple development. You'll examine Objective-C and high-level subjects of frameworks, threading, networking, and much more.: Covers the basics of the C language and then quickly moves onto Objective-C and more advanc

  2. Abstract Objects of Verbs

    DEFF Research Database (Denmark)

    Robering, Klaus

    2014-01-01

    Verbs do often take arguments of quite different types. In an orthodox type-theoretic framework this results in an extreme polysemy of many verbs. In this article, it is shown that this unwanted consequence can be avoided when a theory of "abstract objects" is adopted according to which...... of such a representation are considered: the denotations of that-phrases are objects representing propositions, generic noun phrases denote objects standing for sorts, and infinitivals are viewed as denoting objects representing attributes, i.e., the "ordinary'' meanings of verb phrases....

  3. What are Objects?

    Indian Academy of Sciences (India)

    Obj ect oriented development of software systems is becom- ing de-facto standard in large software projects. This article explains the motivation behind object orientation and how it promotes the use of software components. Objects as Reusable Subsystems. Can you imagine, designing afresh and fabricating every unit.

  4. Cultivating objects in interaction

    DEFF Research Database (Denmark)

    Hazel, Spencer

    2014-01-01

    is chapter explores patterns of repeated orientations to physical objects in interactants’ visuo-spatial and haptic surround. A number of examples are presented from advice-giving activities in various institutional settings, where participants-in-interaction initially draw on material objects at...

  5. Haptic object individuation

    NARCIS (Netherlands)

    Plaisier, M.A.; Bergmann Tiest, W.M.; Kappers, A.M.L.

    2010-01-01

    Item individuation, i.e., how we decide which parts belong to one object and which to another, is an important aspect of haptic perception and may be important for design of interfaces in which different buttons have to be distinguished. We daily hold several objects in our hand. Somehow, we decide

  6. Conscience and Conscientious Objections

    NARCIS (Netherlands)

    Schinkel, Anders

    2007-01-01

    In Western countries conscientious objection is usually accommodated in various ways, at least in certain areas (military conscription, medicine) and to some extent. It appears to be regarded as fundamentally different from other kinds of objection. But why? This study argues that conscientious

  7. Modelling Digital Media Objects

    DEFF Research Database (Denmark)

    Troelsgaard, Rasmus

    The goal of this thesis is to investigate two relevant issues regarding computational representation and classification of digital multi-media objects. With a special focus on music, a model for representation of objects comprising multiple heterogeneous data types is investigated. Necessary...

  8. On object-orientation

    NARCIS (Netherlands)

    Diertens, B.

    2010-01-01

    Although object-orientation has been around for several decades, its key concept abstraction has not been exploited for proper application of object-orientation in other phases of software development than the implementation phase. We mention some issues that lead to a lot of confusion and obscurity

  9. Simultanagnosia and object individuation.

    Science.gov (United States)

    Mazza, Veronica

    2017-06-06

    Simultanagnosic patients have difficulty in perceiving multiple objects when presented simultaneously. In this review article, I discuss how neuropsychological research on simultanagnosia has been inspirational for two interconnected lines of research related to the core mechanisms by which the visual system processes cluttered scenes. First, I review previous studies on enumeration tasks indicating that, despite their inability to identify multiple objects, simultanagnosic patients can enumerate up to 2-3 elements as efficiently as healthy individuals (the so-called "subitizing" phenomenon). This intriguing observation is one of the first results to support the existence of an "object individuation" mechanism that can spatially tag a limited set of objects simultaneously, and resonates with recent research on the brain dynamics of enumeration in healthy individuals. Second, I further develop the implications of the dissociation between object identification and object enumeration in simultanagnosia specifically for the distinction between object identification and individuation. The latter distinction has been the subject of recent neuroimaging research that has provided fine-grained information on the spatial as well as temporal aspects of object individuation and recognition. The lessons learned from neuropsychological research on exact enumeration in simultanagnosia can be generalized to the normal functioning of the human mind, and have provided insightful clues for cognitive neuroscience.

  10. Near Earth Objects

    DEFF Research Database (Denmark)

    Wolff, Stefan

    2006-01-01

    , Near Earth Objects: Asteroids and comets following paths that bring them near the Earth. NEOs have collided with the Earth since its formation, some causing local devastation, some causing global climate changes, yet the threat from a collision with a near Earth object has only recently been recognised...

  11. Programs as Data Objects

    DEFF Research Database (Denmark)

    This book constitutes the refereed proceedings of the Second Symposium on Programs as Data Objects, PADO 2001, held in Aarhus, Denmark, in May 2001. The 14 revised full papers presented were carefully reviewed and selected from 30 submissions. Various aspects of looking at programs as data objects...... are covered from the point of view of program analysis, program transformation, computational complexity, etc....

  12. Gamifying Video Object Segmentation.

    Science.gov (United States)

    Spampinato, Concetto; Palazzo, Simone; Giordano, Daniela

    2017-10-01

    Video object segmentation can be considered as one of the most challenging computer vision problems. Indeed, so far, no existing solution is able to effectively deal with the peculiarities of real-world videos, especially in cases of articulated motion and object occlusions; limitations that appear more evident when we compare the performance of automated methods with the human one. However, manually segmenting objects in videos is largely impractical as it requires a lot of time and concentration. To address this problem, in this paper we propose an interactive video object segmentation method, which exploits, on one hand, the capability of humans to identify correctly objects in visual scenes, and on the other hand, the collective human brainpower to solve challenging and large-scale tasks. In particular, our method relies on a game with a purpose to collect human inputs on object locations, followed by an accurate segmentation phase achieved by optimizing an energy function encoding spatial and temporal constraints between object regions as well as human-provided location priors. Performance analysis carried out on complex video benchmarks, and exploiting data provided by over 60 users, demonstrated that our method shows a better trade-off between annotation times and segmentation accuracy than interactive video annotation and automated video object segmentation approaches.

  13. Beginning Objective-C

    CERN Document Server

    Dovey, James

    2012-01-01

    Objective-C is today's fastest growing programming language, at least in part due to the popularity of Apple's Mac, iPhone and iPad. Beginning Objective-C is for you if you have some programming experience, but you're new to the Objective-C programming language and you want a modern-and fast-way forwards to your own coding projects. Beginning Objective-C offers you a modern programmer's perspective on Objective-C courtesy of two of the best iOS and Mac developers in the field today, and gets you programming to the best of your ability in this important language.  It gets you rolling fast into

  14. Space Object Query Tool

    Science.gov (United States)

    Phillips, Veronica J.

    2017-01-01

    STI is for a fact sheet on the Space Object Query Tool being created by the MDC. When planning launches, NASA must first factor in the tens of thousands of objects already in orbit around the Earth. The number of human-made objects, including nonfunctional spacecraft, abandoned launch vehicle stages, mission-related debris and fragmentation debris orbiting Earth has grown steadily since Sputnik 1 was launched in 1957. Currently, the U.S. Department of Defenses Joint Space Operations Center, or JSpOC, tracks over 15,000 distinct objects and provides data for more than 40,000 objects via its Space-Track program, found at space-track.org.

  15. Unifying Subjectivity and Objectivity

    Directory of Open Access Journals (Sweden)

    Murugesan Chandrasekaran

    2016-10-01

    Full Text Available The contribution of modern science to the progress of civilization is immeasurable. Even its tendency toward exclusive concentration on the objective world has had salutary effects of great value. Modern science has wiped away much that was merely superstitious or speculative. Its rejection of unfounded opinions and prejudices has helped the thinking mind question conventional beliefs, shed preferences and prejudices, and challenge established authority. But modern systems thinking inherited from natural science is the suppression of the subjective dimension of reality. Many complex systems are an attempt to define and represent all subjective experience in physical terms. The modern man has a bias towards objectivity. The powerful influence of sense impressions on his mind and thinking makes him ignore the subjective experience and consider only objective facts as a valid, legitimate and representation of reality. Observing objective factors that are physical is easier than observing subjective factors that are subtle. The mechanistic view of reality has led to the rejection of the role of the individual in social development as insignificant. The individuals determine the development of society. Their social power has its roots both in subjective factors and objective factors. Economy, politics, society, and culture are inseparable dimensions of a single integrated reality. Subject and object constitute an integrated whole. The mind sees them as separate and independent. Or it views one as completely subordinate to the other. Unbiased approach to the study of all human experiences may prove that subject and object are interdependent dimensions or elements of reality.

  16. On Coordinating Collaborative Objects

    Directory of Open Access Journals (Sweden)

    Abdessamad Imine

    2010-07-01

    Full Text Available A collaborative object represents a data type (such as a text document designed to be shared by a group of dispersed users. The Operational Transformation (OT is a coordination approach used for supporting optimistic replication for these objects. It allows the users to concurrently update the shared data and exchange their updates in any order since the convergence of all replicas, i.e. the fact that all users view the same data, is ensured in all cases. However, designing algorithms for achieving convergence with the OT approach is a critical and challenging issue. In this paper, we propose a formal compositional method for specifying complex collaborative objects. The most important feature of our method is that designing an OT algorithm for the composed collaborative object can be done by reusing the OT algorithms of component collaborative objects. By using our method, we can start from correct small collaborative objects which are relatively easy to handle and incrementally combine them to build more complex collaborative objects.

  17. Functional Object Analysis

    DEFF Research Database (Denmark)

    Raket, Lars Lau

    We propose a direction it the field of statistics which we will call functional object analysis. This subfields considers the analysis of functional objects defined on continuous domains. In this setting we will focus on model-based statistics, with a particularly emphasis on mixed......-effect formulations, where the observed functional signal is assumed to consist of both fixed and random functional effects. This thesis takes the initial steps toward the development of likelihood-based methodology for functional objects. We first consider analysis of functional data defined on high...

  18. [Achievement of therapeutic objectives].

    Science.gov (United States)

    Mantilla, Teresa

    2014-07-01

    Therapeutic objectives for patients with atherogenic dyslipidemia are achieved by improving patient compliance and adherence. Clinical practice guidelines address the importance of treatment compliance for achieving objectives. The combination of a fixed dose of pravastatin and fenofibrate increases the adherence by simplifying the drug regimen and reducing the number of daily doses. The good tolerance, the cost of the combination and the possibility of adjusting the administration to the patient's lifestyle helps achieve the objectives for these patients with high cardiovascular risk. Copyright © 2014 Sociedad Española de Arteriosclerosis y Elsevier España, S.L. All rights reserved.

  19. Piles of objects

    KAUST Repository

    Hsu, Shu-Wei

    2010-01-01

    We present a method for directly modeling piles of objects in multi-body simulations. Piles of objects represent some of the more interesting, but also most time-consuming portion of simulation. We propose a method for reducing computation in many of these situations by explicitly modeling the piles that the objects may form into. By modeling pile behavior rather than the behavior of all individual objects, we can achieve realistic results in less time, and without directly modeling the frictional component that leads to desired pile shapes. Our method is simple to implement and can be easily integrated with existing rigid body simulations. We observe notable speedups in several rigid body examples, and generate a wider variety of piled structures than possible with strict impulse-based simulation. © 2010 ACM.

  20. Safety objectives for 2014

    CERN Multimedia

    HSE Unit

    2014-01-01

    This is the third year in which the CERN Management has presented annual safety objectives for the Organization, the “HSE Objectives”.   The HSE objectives for 2014, which were announced by the Director-General at his traditional New Year’s address to the staff and were presented at the first Enlarged Directorate meeting of the year, have been drawn up and agreed in close collaboration between the DSOs, the HSE Unit and the DG himself. From safety in the workplace to radiation and environmental protection, the document emphasises that “Safety is a priority for CERN” and that safety policy is a key element in how the Organization is run. And, like all policies, it generates objectives that “serve as a general framework for action”. The HSE objectives are broken down into the following fields: occupational health and safety on sites and in the workplace, radiation protection, radiation safety, environmental protection, emerge...

  1. Pinocchio: Geppetto's transitional object

    National Research Council Canada - National Science Library

    Gabriele Zeloni

    2015-01-01

    .... From this perspective, the author puts forward the following hypothesis: Pinocchio is a puppet who comes to life and is therefore, from a child's perception, a transitional object according to Winnicott...

  2. Birth of the Object: Detection of Objectness and Extraction of Object Shape through Object Action Complexes

    DEFF Research Database (Denmark)

    Kraft, Dirk; Pugeault, Nicolas; Baseski, Emre

    2008-01-01

    by the robot. This also leads to the concept of an "object" as a set of features that change predictably over different frames. The system is equipped with a certain degree of generic prior knowledge about the world in terms of a sophisticated visual feature extraction process in an early cognitive vision...... system, knowledge about its own embodiment as well as knowledge about geometric relationships such as rigid body motion. This prior knowledge allows the extraction of representations that are semantically richer compared to many other approaches.......We describe a process in which the segmentation of objects as well as the extraction of the object shape becomes realized through active exploration of a robot vision system. In the exploration process, two behavioral modules that link robot actions to the visual and haptic perception of objects...

  3. Measuring Object Salience

    Directory of Open Access Journals (Sweden)

    A.D.F Clarke

    2014-08-01

    Full Text Available Over the past 15 years work on visual salience has been restricted to models of low-level, bottom-up salience that give an estimate of the salience for every pixel in an image. This study concerns the question of how to measure the salience of objects: given an image and a list of areas of interest (AOIs, can we assign salience scores to the AOIs that reflect their visual prominence? There is increasing evidence that fixations locations are best explained at an object level and an object-level notion of visual salience can easily be incorporated with other object features task relevance and concepts such as scene context. However, extracting scores for AOIs from the saliency maps output by existing models is a non-trivial task. Using simple psychophysical (1/f-noise stimuli, we demonstrate that simple methods for assigning salience score to AOIs (such as taking the maximum, mean, or sum of the relevant pixels in the salience map produce unintuitive results, such as predicting that larger objects are less salient. We also evaluate object salience models over a range of tasks and compare to empirical data. Beyond predicting the number of fixations to different objects in a scene, we also estimate the difficulty of visual search trials; and incorporate visual salience into language production tasks. We present a simple object-based salience model (based on comparing the likelihood of an AOI given the rest of the image to the likelihood of a typical patch of the same area] that gives intuitive results for the 1/f-noise stimuli and performs as well as existing methods on empirical datasets.

  4. Object Based Systems Engineering

    Science.gov (United States)

    2011-10-17

    Based Systems Engineering ( MBSE ) has shifted the emphasis of the Systems Engineering community away from documents towards view-based artifacts. These...Engineering lies primarily in these objects, not the containers that deliver them. FIGURE 1: Evolution of Systems Engineering Practice MBSE ...capture minority viewpoints and discussion threads associated with each object of interest. If the majority view doesn’t lead to success, this data may

  5. Conscientious Objection to Vaccination

    OpenAIRE

    Clarke, Steve; Giubilini, Alberto; Walker, Mary Jean

    2016-01-01

    ABSTRACT Vaccine refusal occurs for a variety of reasons. In this article we examine vaccine refusals that are made on conscientious grounds; that is, for religious, moral, or philosophical reasons. We focus on two questions: first, whether people should be entitled to conscientiously object to vaccination against contagious diseases (either for themselves or for their children); second, if so, to what constraints or requirements should conscientious objection (CO) to vaccination be subject. ...

  6. Protected Objects in Java

    DEFF Research Database (Denmark)

    Løvengreen, Hans Henrik; Schwarzer, Jens Christian

    1998-01-01

    We present an implementation of Ada 95's notion of protected objects in Java. The implementation comprises a class library supporting entry queues and a (pre-) compiler translating slightly decorated Java classes to pure Java classes utilizing the library.......We present an implementation of Ada 95's notion of protected objects in Java. The implementation comprises a class library supporting entry queues and a (pre-) compiler translating slightly decorated Java classes to pure Java classes utilizing the library....

  7. Objects of consciousness

    Directory of Open Access Journals (Sweden)

    Donald David Hoffman

    2014-06-01

    Full Text Available Current models of visual perception typically assume that human vision estimates true properties of physical objects, properties that exist even if unperceived. However, recent studies of perceptual evolution, using evolutionary games and genetic algorithms, reveal that natural selection often drives true perceptions to extinction when they compete with perceptions tuned to fitness rather than truth: Perception guides adaptive behavior; it does not estimate a preexisting physical truth. Moreover, shifting from evolutionary biology to quantum physics, there is reason to disbelieve in preexist-ing physical truths: Certain interpretations of quantum theory deny that dynamical properties of physical objects have defi-nite values when unobserved. In some of these interpretations the observer is fundamental, and wave functions are com-pendia of subjective probabilities, not preexisting elements of physical reality. These two considerations, from evolutionary biology and quantum physics, suggest that current models of object perception require fundamental reformulation. Here we begin such a reformulation, starting with a formal model of consciousness that we call a conscious agent. We develop the dynamics of interacting conscious agents, and study how the perception of objects and space-time can emerge from such dynamics. We show that one particular object, the quantum free particle, has a wave function that is identical in form to the harmonic functions that characterize the asymptotic dynamics of conscious agents; particles are vibrations not of strings but of interacting conscious agents. This allows us to reinterpret physical properties such as position, momentum, and energy as properties of interacting conscious agents, rather than as preexisting physical truths. We sketch how this approach might extend to the perception of relativistic quantum objects, and to classical objects of macroscopic scale.

  8. Objects of consciousness.

    Science.gov (United States)

    Hoffman, Donald D; Prakash, Chetan

    2014-01-01

    Current models of visual perception typically assume that human vision estimates true properties of physical objects, properties that exist even if unperceived. However, recent studies of perceptual evolution, using evolutionary games and genetic algorithms, reveal that natural selection often drives true perceptions to extinction when they compete with perceptions tuned to fitness rather than truth: Perception guides adaptive behavior; it does not estimate a preexisting physical truth. Moreover, shifting from evolutionary biology to quantum physics, there is reason to disbelieve in preexisting physical truths: Certain interpretations of quantum theory deny that dynamical properties of physical objects have definite values when unobserved. In some of these interpretations the observer is fundamental, and wave functions are compendia of subjective probabilities, not preexisting elements of physical reality. These two considerations, from evolutionary biology and quantum physics, suggest that current models of object perception require fundamental reformulation. Here we begin such a reformulation, starting with a formal model of consciousness that we call a "conscious agent." We develop the dynamics of interacting conscious agents, and study how the perception of objects and space-time can emerge from such dynamics. We show that one particular object, the quantum free particle, has a wave function that is identical in form to the harmonic functions that characterize the asymptotic dynamics of conscious agents; particles are vibrations not of strings but of interacting conscious agents. This allows us to reinterpret physical properties such as position, momentum, and energy as properties of interacting conscious agents, rather than as preexisting physical truths. We sketch how this approach might extend to the perception of relativistic quantum objects, and to classical objects of macroscopic scale.

  9. Objects of consciousness

    Science.gov (United States)

    Hoffman, Donald D.; Prakash, Chetan

    2014-01-01

    Current models of visual perception typically assume that human vision estimates true properties of physical objects, properties that exist even if unperceived. However, recent studies of perceptual evolution, using evolutionary games and genetic algorithms, reveal that natural selection often drives true perceptions to extinction when they compete with perceptions tuned to fitness rather than truth: Perception guides adaptive behavior; it does not estimate a preexisting physical truth. Moreover, shifting from evolutionary biology to quantum physics, there is reason to disbelieve in preexisting physical truths: Certain interpretations of quantum theory deny that dynamical properties of physical objects have definite values when unobserved. In some of these interpretations the observer is fundamental, and wave functions are compendia of subjective probabilities, not preexisting elements of physical reality. These two considerations, from evolutionary biology and quantum physics, suggest that current models of object perception require fundamental reformulation. Here we begin such a reformulation, starting with a formal model of consciousness that we call a “conscious agent.” We develop the dynamics of interacting conscious agents, and study how the perception of objects and space-time can emerge from such dynamics. We show that one particular object, the quantum free particle, has a wave function that is identical in form to the harmonic functions that characterize the asymptotic dynamics of conscious agents; particles are vibrations not of strings but of interacting conscious agents. This allows us to reinterpret physical properties such as position, momentum, and energy as properties of interacting conscious agents, rather than as preexisting physical truths. We sketch how this approach might extend to the perception of relativistic quantum objects, and to classical objects of macroscopic scale. PMID:24987382

  10. [Medicine and conscientious objection].

    Science.gov (United States)

    Martínez, K

    2007-01-01

    Conscientious objection to democratically accepted laws in democratic societies is a fact, both among citizens and among professionals. Due respect for laws is a prima facie duty in these societies. But democratic justice must at the same time respect peoples' conscience for it constitutes the ethical identity of individuals. And both law and ethics are necessary - although neither of them is sufficient - for its realization. The problem of conscientious objection among healthcare professionals is analysed from this standpoint and the conclusion is that objection is not an absolute right to exemption from several duties, but that the responsibility of the professional and of the institutions towards the citizenry must always be taken into account. Some solutions are suggested that try to protect both the professionals and the citizens in a bi-directional way.

  11. Pinocchio: Geppetto's transitional object

    Directory of Open Access Journals (Sweden)

    Gabriele Zeloni

    2015-01-01

    Full Text Available The literature has been considered by Freud and others after him, a form of unaware exploration of mind that can leads to discoveries similar to psychoanalysis’s discoveries. From this perspective, the author puts forward the following hypothesis: Pinocchio is a puppet who comes to life and is therefore, from a child's perception, a transitional object according to Winnicott. Consequently Geppetto is nothing more than the involuntary representation of any child interacting with the transitional object. The author explains the results of the analysis of the text in support of the hypothesis and reflects on the impact of The adventure of Pinocchio on the reader.

  12. Learning Objects Web

    DEFF Research Database (Denmark)

    Blåbjerg, Niels Jørgen

    2005-01-01

    Learning Objects Web er et DEFF projekt som Aalborg Universitetsbibliotek har initieret. Projektet tager afsæt i de resultater og erfaringer som er opnået med vores tidligere projekt Streaming Webbased Information Modules (SWIM). Vi har et internationalt netværk af interessenter som giver os...... sparring og feedback i forhold til udviklingskoncept både omkring de teoretiske rammer og i forhold til praktisk anvendelse af vores undervisningskoncept. Med disse rygstød og input har vi forfulgt ønsket om at videreudvikle SWIM i det nye projekt Learning Objects Web. Udgivelsesdato: juni...

  13. The Language of Objects

    DEFF Research Database (Denmark)

    Eskildsen, Kasper Risbjerg

    2012-01-01

    . The arrangement of artifacts not only helped him formulate his theories, but also allowed him to present his arguments in a language of objects. At the same time, Thomsen's definition of archaeology as a museum science placed his branch of archaeology in a closer relationship with other museum sciences...... themselves to histories of texts and therefore abandoned the earliest human history. Instead, he proposed a new history of objects, which included the entire history of humankind. Thomsen's work as director of the Royal Museum of Nordic Antiquities in Copenhagen was especially important for this renewal...

  14. Turning subjective into objective

    DEFF Research Database (Denmark)

    Cardoso, Maria João; Cardoso, Jaime; Amaral, Natália

    2007-01-01

    Twelve expert observers from nine different countries convened in a workshop to evaluate the validity of the Breast Cancer Conservative Treatment. Cosmetic results (BCCT.core) software, an objective method for the aesthetic evaluation of breast cancer conservative treatment. Experts were initiall...

  15. Gender Object Identification Test.

    Science.gov (United States)

    Sigmon, Scott B.

    This test was designed primarily for the purpose of assisting social psychologists in researching sex roles and/or sex differences when a nonverbal instrument is desired. The hypothesis was that some objects would be easier for members of one gender to name. The subjects were 30 female and 20 male undergraduate students. Pictures of 65 commercial…

  16. Robust video object cosegmentation.

    Science.gov (United States)

    Wang, Wenguan; Shen, Jianbing; Li, Xuelong; Porikli, Fatih

    2015-10-01

    With ever-increasing volumes of video data, automatic extraction of salient object regions became even more significant for visual analytic solutions. This surge has also opened up opportunities for taking advantage of collective cues encapsulated in multiple videos in a cooperative manner. However, it also brings up major challenges, such as handling of drastic appearance, motion pattern, and pose variations, of foreground objects as well as indiscriminate backgrounds. Here, we present a cosegmentation framework to discover and segment out common object regions across multiple frames and multiple videos in a joint fashion. We incorporate three types of cues, i.e., intraframe saliency, interframe consistency, and across-video similarity into an energy optimization framework that does not make restrictive assumptions on foreground appearance and motion model, and does not require objects to be visible in all frames. We also introduce a spatio-temporal scale-invariant feature transform (SIFT) flow descriptor to integrate across-video correspondence from the conventional SIFT-flow into interframe motion flow from optical flow. This novel spatio-temporal SIFT flow generates reliable estimations of common foregrounds over the entire video data set. Experimental results show that our method outperforms the state-of-the-art on a new extensive data set (ViCoSeg).

  17. The Object of Research

    DEFF Research Database (Denmark)

    Bean, Jonathan; Figueiredo, Bernardo; Pico Larsen, Hanne

    2017-01-01

    explicates the role of objects in supporting this patterning. We explain how an in-situ diary tool (dscout, in our case) can be useful to support this approach. We demonstrate our methodological approach in the context of the Red Rooster Harlem, a cosmopolitan restaurant in New York, owned by the celebrity...

  18. The Road to Objects

    Directory of Open Access Journals (Sweden)

    Graham Harman

    2011-09-01

    Full Text Available Harman presents an outline of how object-oriented ontology (OOO differentiates itself from other branches of speculative realism. Can OOO steer philosophy from an epistemological project that tends to reduce the discipline to "a series of small-time drug busts"?

  19. Testing object Interactions

    NARCIS (Netherlands)

    Grüner, Andreas

    2010-01-01

    In this thesis we provide a unit testing approach for multi-purposes object-oriented programming languages in the style of Java and C#. Our approach includes the definition of a test specification language which results from extending the programming language with new designated specification

  20. Big Java late objects

    CERN Document Server

    Horstmann, Cay S

    2012-01-01

    Big Java: Late Objects is a comprehensive introduction to Java and computer programming, which focuses on the principles of programming, software engineering, and effective learning. It is designed for a two-semester first course in programming for computer science students.

  1. Forecasters' Objectives and Strategies

    DEFF Research Database (Denmark)

    Marinovic, Iván; Ottaviani, Marco; Sørensen, Peter Norman

    2013-01-01

    This chapter develops a unified modeling framework for analyzing the strategic behavior of forecasters. The theoretical model encompasses reputational objectives, competition for the best accuracy, and bias. Also drawing from the extensive lit- erature on analysts, we review the empirical evidenc...

  2. PENGARUH LATIHAN FARTLEK DENGAN TREADMILL DAN LARI DI LAPANGAN TERHADAP DAYA TAHAN KARDIORESPIRASI

    Directory of Open Access Journals (Sweden)

    Maya Kurnia

    2013-04-01

    Abstract The objective of this study is to reveal the effect of fartlek with treadmill, running, and vital lung capacity on respiratory endurance. The study used the experiment factorial 2x2 block design. The data were collected using the respiratory endurance test (using the twelve minutes by Cooper’s test with maximal distance which can be taken within twelve minutes. The results of this study are as follows: (1 There is a difference in respiratory endurance between those who were involved in fartlek with treadmill with those who ran. The respiratory endurance is better for those who ran than those who used treadmill. (2 There is a difference in respiratory endurance between those who have low vital lung capacity with those who have high vital lung capacity. The respiratory endurance is better for those who have high vital lung capacity than those who have low vital lung capacity. (3 There is no interaction between those who were involved in fartlek with treadmill, running, and vital lung capacity in respiratory endurance. Members who were involved in fartlek with ran and have low vital lung capacity, who were involved in fartlek with treadmill and have high vital lung capacity, and who were involved in fartlek with ran and have high vital lung capacity is not different significance. Keywords: fartlek training, vital lung capacity, respiratory endurance.

  3. Part Objects and Their Location

    DEFF Research Database (Denmark)

    Madsen, Ole Lehrmann; Møller-Pedersen, Birger

    1992-01-01

    The notion of location of part objects is introduced, yielding a reference to the containing object. Combined with locally defined objects and classes (block structure), singularly defined part objects, and references to part objects, it is a powerful language mechanism for defining objects...... with different aspects or roles. The use of part objects for inheritance of code is also explored....

  4. Objectives and Outcomes

    Energy Technology Data Exchange (ETDEWEB)

    Segalman, D.J.

    1998-11-30

    I have recently become involved in the ABET certification process under the new system - ABET 2000. This system relies heavily on concepts of Total Quality Management (TQM). It encourages each institution to define its objectives in terms of its own mission and then create a coherent program based on it. The prescribed steps in setting up the new system at an engineering institution are: o identification of constituencies G definition of mission. It is expected that the department's mission will be consistent with that of the overall institution, but containing some higher resolution language appropriate to that particular discipline of the engineering profession. o statement of objectives consistent with the mission 3G~~\\vED " enumeration of desired, and preferably measurable, outcomes of the process that would ~ `=. verify satisfaction of the objectives. ~~~ 07 !398 o establish performance standards for each outcome. o creation of appropriate feedback loops to assure that the objectives are still consistent with Q$YT1 the mission, that the outcomes remain consistent with the objectives, and that the curriculum and the teaching result in those outcomes. It is my assertion that once the institution verbalizes a mission, enumerated objectives naturally flow from that mission. (We shall try to demonstrate by example.) Further, if the mission uses the word "engineer", one would expect that word also to appear in at least one of the objectives. The objective of producing engineers of any sort must -by decree - involve the presence of the ABET criteria in the outcomes list. In other words, successful satisfaction of the ABET items a-k are a necessary subset of the measure of success in producing engineers. o We shall produce bachelor level engineers whose training in the core topics of chemical (or electrical, or mechanical) engineering is recognized to be among the best in the nation. o We shall provide an opportunity for our students to gain

  5. Almanca ve Türkçede Düz ve Dolaylı Tümleçler Direct And Indirect Objects In German And Turkish

    Directory of Open Access Journals (Sweden)

    Umut BALCI

    2013-03-01

    distinction between directand indirect objects. Bu çalışmanın çıkış noktasını yabancı dil eğitiminde dört temel becerinin (dinleme, okuma, yazma, konuşma temel özellikleri ve bu becerilerin geliştirilmesi için kullanılabilecek yöntemler oluşturmaktadır. Dil öğrenimi dört temel becerinin eşit oranda kullanımı ve geliştirilmesine bağlı olmasına rağmen, bu çalışmada dilbilgisi öğretimi üzerine ağırlık verilmektedir. Özellikle konuşma ve yazma becerileriyle direk ilintili olan dilbilgisi öğretimi konusunda bazı yöntemlerde dil öğrenimini zorlaştıran gereksiz bilgilere yer verilmektedir. Bu noktadan hareketle bu çalışmada, dilbilgisinin alt konularından biri olan düz ve dolaylı tümleçlerin dilbilgisi kitaplarında ele alınış şekli üzerinde durulmaktadır.Nesneler, dilin kaynaşmalı, eklemeli ya da bükümlü oluşuna göre morfolojik, konumsal ya da yapısal olarak tanımlanan sözdizimsel işlevlerdir ve cümlede, yüklemin gösterdiği eylemle /oluşla /durumla ilgili olan kişi ya da konu olarak görünürler. Cümlede anlatılmak isteneni tümlerler, bu yüzden Türkçede tümleç diye adlandırılırlar. Geleneksel Türkolojide nesne, belirli ya da belirsiz akuzatif durumunda olabilen ve geçişli eylemi tümleyen cümle öğesi olarak tanımlanmaktadır. Almanca bilimsel dilbilgisi ile Türkçe bilimsel ve eğitsel dilbilgisi kitaplarında düz ve dolaylı tümleç ayrımı yapılmakta ve akuzatif tümleçler dolaylı tümleç, datif tümleçler ise düz / dolaysız tümleç olarak kabul edilmektedir. Ancak bu ayrım kimseye yaramamakta ve karışıklıklara neden olmaktadır; çünkü tutarlı ölçütlere dayanmamaktadır. Ayrıca Almanca öğretiminde düz tümleç / dolaylı tümleç ayrımı yapılmaz; buna karşılık Türkçe öğretiminde ve dilbilgisinde bu ayrıma çok önem verilmektedir. Tutarlı ölçütlere dayanmayan bu ayrım anadili Türkçe olan kişilerin yabancı dil öğrenimini de zorla

  6. Object-Oriented Education

    DEFF Research Database (Denmark)

    Pasgaard, Niels Jakob

    Education is traditionally seen as a teleological discipline. Teaching is always done with a purpose in mind. Thus, teaching can be said to be an intentional practice. With a popular Danish expression, one may say that teaching is to want something with someone (Nepper Larsen 2016). In recent years...... tradition, where predefined learning-objectives form the basis for the selection of content and methods of teaching. However, the idea of letting such learning-objectives form the basis for teaching, now also permeates the educational policies of the European Union (European Commision 2011). The spread......, Bogost 2012, Bryant 2014), the article presents a critique of this development. The criticism is based on a questioning of the idea that education should be understood as wanting something with someone. Instead, it is argued that education is the art of introducing Something for someone. The article aims...

  7. Conscientious objection in Italy.

    Science.gov (United States)

    Minerva, Francesca

    2015-02-01

    The law regulating abortion in Italy gives healthcare practitioners the option to make a conscientious objection to activities that are specific and necessary to an abortive intervention. Conscientious objectors among Italian gynaecologists amount to about 70%. This means that only a few doctors are available to perform abortions, and therefore access to abortion is subject to constraints. In 2012 the International Planned Parenthood Federation European Network (IPPF EN) lodged a complaint against Italy to the European Committee of Social Rights, claiming that the inadequate protection of the right to access abortion implies a violation of the right to health. In this paper I will discuss the Italian situation with respect to conscientious objection to abortion and I will suggest possible solutions to the problem. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  8. DOLIB: Distributed Object Library

    Energy Technology Data Exchange (ETDEWEB)

    D' Azevedo, E.F.

    1994-01-01

    This report describes the use and implementation of DOLIB (Distributed Object Library), a library of routines that emulates global or virtual shared memory on Intel multiprocessor systems. Access to a distributed global array is through explicit calls to gather and scatter. Advantages of using DOLIB include: dynamic allocation and freeing of huge (gigabyte) distributed arrays, both C and FORTRAN callable interfaces, and the ability to mix shared-memory and message-passing programming models for ease of use and optimal performance. DOLIB is independent of language and compiler extensions and requires no special operating system support. DOLIB also supports automatic caching of read-only data for high performance. The virtual shared memory support provided in DOLIB is well suited for implementing Lagrangian particle tracking techniques. We have also used DOLIB to create DONIO (Distributed Object Network I/O Library), which obtains over a 10-fold improvement in disk I/O performance on the Intel Paragon.

  9. DOLIB: Distributed Object Library

    Energy Technology Data Exchange (ETDEWEB)

    D`Azevedo, E.F.; Romine, C.H.

    1994-10-01

    This report describes the use and implementation of DOLIB (Distributed Object Library), a library of routines that emulates global or virtual shared memory on Intel multiprocessor systems. Access to a distributed global array is through explicit calls to gather and scatter. Advantages of using DOLIB include: dynamic allocation and freeing of huge (gigabyte) distributed arrays, both C and FORTRAN callable interfaces, and the ability to mix shared-memory and message-passing programming models for ease of use and optimal performance. DOLIB is independent of language and compiler extensions and requires no special operating system support. DOLIB also supports automatic caching of read-only data for high performance. The virtual shared memory support provided in DOLIB is well suited for implementing Lagrangian particle tracking techniques. We have also used DOLIB to create DONIO (Distributed Object Network I/O Library), which obtains over a 10-fold improvement in disk I/O performance on the Intel Paragon.

  10. Object relational mapping frameworks

    OpenAIRE

    Patrný, Vojtěch

    2008-01-01

    This paper is about Java object relational frameworks and related processes. The goal of this work consists of showing design patterns for ORM, introducing Java ORM standards along with the main implementations, finding criteria for comparison of ORM frameworks and showing working ORM example in a case study. This paper has the following structure: The first part of this paper discusses main ORM design patters, approaches to ORM and performance related features of Java ORM frameworks. Next pa...

  11. Dropped object protection analyses

    OpenAIRE

    Nilsen, Ingve

    2014-01-01

    Master's thesis in Offshore structural engineering Impact from dropped object is a typical accident action (NOKSOK N-004, 2013). Hence, the DOP structure is to be analyzed in an accidental limit state (ALS) design practice, which means that a non-linear finite element analysis can be applied. The DOP structure will be based on a typical DOP structure. Several FEM analyses are performed for the DOP structure. Different shapes size and weights and various impact positions are used for si...

  12. Suggestive Objects at Work

    DEFF Research Database (Denmark)

    Ratner, Helene Gad

    2009-01-01

    In Western secular societies, spiritual life is no longer limited to classical religious institutions but can also be found at workplace organizations. While spirituality is conventionally understood as a subjective and internal process, this paper proposes the concept of ‘suggestive objects’, co...... scaffolding. This has deep implications for our understanding of the sacred, including a better appreciation of the way that suggestive objects make the sacred durable, the way they organize it....

  13. War Journalism and 'Objectivity'

    Directory of Open Access Journals (Sweden)

    Annabel McGoldrick

    2006-10-01

    Full Text Available This article opens by considering an apparent paradox. Many professional journalists, working on many media in many countries, consider themselves 'objective'. They do not, at least, set out to skew their coverage of important issues in favour of one side or the other. And yet much of their coverage of conflicts shows a discernible dominant pattern of War Journalism - biased in favour of war. This is not because of a lack of objectivity, the article suggests, but a surfeit. The set of conventions many editors and reporters regard as defining 'objective' journalism arose in response to economic and political conditions which rewarded news that could commend itself as unobjectionable to the maximum number of potential customers. Three of the most important conventions privilege official sources; a dualistic construction of stories and event, over process. Each of these, when applied to the representation of conflicts, leads readers and audiences - or leaves them - to over-value violent, reactive responses and under-value non-violent, developmental responses. Industry conventions sit uneasily alongside equally time-honoured expectations of journalism. These are encoded in rules and regulations governing the content of broadcast news, in many jurisdictions which have a public service concept for radio and television. In some respects, War Journalism can be shown to make it more difficult for broadcast news services to fulfil their public service obligations. Awareness is now growing, of the tension between these two pressures on journalism and its influence on the way pressing public debates are shaped and mediated. More Peace Journalism would help to bring public service news back into line with legitimate public expectations.

  14. Numerical Analysis Objects

    Science.gov (United States)

    Henderson, Michael

    1997-08-01

    The Numerical Analysis Objects project (NAO) is a project in the Mathematics Department of IBM's TJ Watson Research Center. While there are plenty of numerical tools available today, it is not an easy task to combine them into a custom application. NAO is directed at the dual problems of building applications from a set of tools, and creating those tools. There are several "reuse" projects, which focus on the problems of identifying and cataloging tools. NAO is directed at the specific context of scientific computing. Because the type of tools is restricted, problems such as tools with incompatible data structures for input and output, and dissimilar interfaces to tools which solve similar problems can be addressed. The approach we've taken is to define interfaces to those objects used in numerical analysis, such as geometries, functions and operators, and to start collecting (and building) a set of tools which use these interfaces. We have written a class library (a set of abstract classes and implementations) in C++ which demonstrates the approach. Besides the classes, the class library includes "stub" routines which allow the library to be used from C or Fortran, and an interface to a Visual Programming Language. The library has been used to build a simulator for petroleum reservoirs, using a set of tools for discretizing nonlinear differential equations that we have written, and includes "wrapped" versions of packages from the Netlib repository. Documentation can be found on the Web at "http://www.research.ibm.com/nao". I will describe the objects and their interfaces, and give examples ranging from mesh generation to solving differential equations.

  15. Propelling soft objects

    Science.gov (United States)

    Boukellal, Hakim; Plastino, Julie; Noireaux, Vincent; Sykes, Cécile

    2003-03-01

    Cells move by the action of specific proteins or small molecules that assemble and interact, constituting a dynamic network called the cytoskeleton. Actin, one of the major components of eucaryotic cells, exists as filaments (semi-flexible polymers) or as monomers. Local assembly of the actin network leads to cell movement as well as to the propulsion of objects like bacteria or liposomes within cells. In order to understand the force generated for this propulsion, we use biomimetic experimental systems that allow for the control of physical parameters. We show evidence for the role of elasticity in the propulsion mechanism. To cite this article: H. Boukellal et al., C. R. Physique 4 (2003).

  16. Kuiper Belt Objects

    Science.gov (United States)

    Jewitt, David

    The region of the solar system immediately beyond Neptune's orbit is densely populated with small bodies. This region, known as the Kuiper Belt, consists of objects that may predate Neptune, the orbits of which provide a fossil record of processes operative in the young solar system. The Kuiper Belt contains some of the Solar System's most primitive, least thermally processed matter. It is probably the source of the short-period comets and Centaurs, and may also supply collisionally generated interplanetary dust. I discuss the properties of the Kuiper Belt and provide an overview of the outstanding scientific issues.

  17. Managing Permanent Objects

    Science.gov (United States)

    1984-11-01

    pe,ttlca ItI Mamaging Faaaet Objects 1 commen main memory. Note that in the case of shared man memory, the thing that enabled sharing to be...u.ussed. 3.8.1 Non-e.•"t.ndz We have already diwxmd pairs. One additionrl item about pais is that they are often chained togtther by their edr to form a...that the garbage collector can be invoked 7 Unfortunfately Aegis does not supply the m*casary functicnality wo do this, but It would not be difcult so

  18. Conscientious Objection to Vaccination

    Science.gov (United States)

    Clarke, Steve; Giubilini, Alberto

    2016-01-01

    ABSTRACT Vaccine refusal occurs for a variety of reasons. In this article we examine vaccine refusals that are made on conscientious grounds; that is, for religious, moral, or philosophical reasons. We focus on two questions: first, whether people should be entitled to conscientiously object to vaccination against contagious diseases (either for themselves or for their children); second, if so, to what constraints or requirements should conscientious objection (CO) to vaccination be subject. To address these questions, we consider an analogy between CO to vaccination and CO to military service. We argue that conscientious objectors to vaccination should make an appropriate contribution to society in lieu of being vaccinated. The contribution to be made will depend on the severity of the relevant disease(s), its morbidity, and also the likelihood that vaccine refusal will lead to harm. In particular, the contribution required will depend on whether the rate of CO in a given population threatens herd immunity to the disease in question: for severe or highly contagious diseases, if the population rate of CO becomes high enough to threaten herd immunity, the requirements for CO could become so onerous that CO, though in principle permissible, would be de facto impermissible. PMID:28008636

  19. Conscientious Objection to Vaccination.

    Science.gov (United States)

    Clarke, Steve; Giubilini, Alberto; Walker, Mary Jean

    2017-03-01

    Vaccine refusal occurs for a variety of reasons. In this article we examine vaccine refusals that are made on conscientious grounds; that is, for religious, moral, or philosophical reasons. We focus on two questions: first, whether people should be entitled to conscientiously object to vaccination against contagious diseases (either for themselves or for their children); second, if so, to what constraints or requirements should conscientious objection (CO) to vaccination be subject. To address these questions, we consider an analogy between CO to vaccination and CO to military service. We argue that conscientious objectors to vaccination should make an appropriate contribution to society in lieu of being vaccinated. The contribution to be made will depend on the severity of the relevant disease(s), its morbidity, and also the likelihood that vaccine refusal will lead to harm. In particular, the contribution required will depend on whether the rate of CO in a given population threatens herd immunity to the disease in question: for severe or highly contagious diseases, if the population rate of CO becomes high enough to threaten herd immunity, the requirements for CO could become so onerous that CO, though in principle permissible, would be de facto impermissible. © 2016 The Authors Bioethics Published by John Wiley & Sons Ltd.

  20. Cost object in accounting

    Directory of Open Access Journals (Sweden)

    Gertruda Świderska

    2016-07-01

    Full Text Available In Polish literature in the field of accounting there are many synonymous terms such as the object of cost calculation, cost unit, or cost driver. Their definitions are often very similar, and their use in certain cir-cumstances unclear. This article aims to answer the question whether the term costs object meaning „something whose cost is of interest to accounting information users”, can replace previously used terms. The analysis applies to literature in Polish, in which different schools have developed their own terms, which is connected with the tradition of schools of accounting in Poland and the evolution of the con-cepts. The analysis aims to verify the hypothesis that for many synonymous terms used in publications in the field of accounting a universal solution can be proposed, taking into account the technological pro-gress and changing user needs. The research methods used include a systematic review of literature in Polish from the period 1966 to 2016 and an analysis of the terms.

  1. Hardware Objects for Java

    DEFF Research Database (Denmark)

    Schoeberl, Martin; Thalinger, Christian; Korsholm, Stephan

    2008-01-01

    Java, as a safe and platform independent language, avoids access to low-level I/O devices or direct memory access. In standard Java, low-level I/O it not a concern; it is handled by the operating system. However, in the embedded domain resources are scarce and a Java virtual machine (JVM) without...... in three quite different JVMs: in the Java processor JOP, the JIT compiler CACAO, and in the interpreting embedded JVM SimpleRTJ.......Java, as a safe and platform independent language, avoids access to low-level I/O devices or direct memory access. In standard Java, low-level I/O it not a concern; it is handled by the operating system. However, in the embedded domain resources are scarce and a Java virtual machine (JVM) without...... an underlying middleware is an attractive architecture. When running the JVM on bare metal, we need access to I/O devices from Java; therefore we investigate a safe and efficient mechanism to represent I/O devices as first class Java objects, where device registers are represented by object fields. Access...

  2. Fundamentals of Object Databases Object-Oriented and Object-Relational Design

    CERN Document Server

    Dietrich, Suzanne

    2010-01-01

    Object-oriented databases were originally developed as an alternative to relational database technology for the representation, storage, and access of non-traditional data forms that were increasingly found in advanced applications of database technology. After much debate regarding object-oriented versus relational database technology, object-oriented extensions were eventually incorporated into relational technology to create object-relational databases. Both object-oriented databases and object-relational databases, collectively known as object databases, provide inherent support for object

  3. ARTEMIS Science Objectives

    Science.gov (United States)

    Sibeck, D. G.; Angelopoulos, V.; Brain, D. A.; Delory, G. T.; Eastwood, J. P.; Farrell, W. M.; Grimm, R. E.; Halekas, J. S.; Hasegawa, H.; Hellinger, P.; hide

    2011-01-01

    NASA's two spacecraft ARTEMIS mission will address both heliospheric and planetary research questions, first while in orbit about the Earth with the Moon and subsequently while in orbit about the Moon. Heliospheric topics include the structure of the Earth's magnetotail; reconnection, particle acceleration, and turbulence in the Earth's magnetosphere, at the bow shock, and in the solar wind; and the formation and structure of the lunar wake. Planetary topics include the lunar exosphere and its relationship to the composition of the lunar surface, the effects of electric fields on dust in the exosphere, internal structure of the Moon, and the lunar crustal magnetic field. This paper describes the expected contributions of ARTEMIS to these baseline scientific objectives.

  4. Breaking Object Correspondence Across Saccadic Eye Movements Deteriorates Object Recognition.

    Science.gov (United States)

    Poth, Christian H; Herwig, Arvid; Schneider, Werner X

    2015-01-01

    Visual perception is based on information processing during periods of eye fixations that are interrupted by fast saccadic eye movements. The ability to sample and relate information on task-relevant objects across fixations implies that correspondence between presaccadic and postsaccadic objects is established. Postsaccadic object information usually updates and overwrites information on the corresponding presaccadic object. The presaccadic object representation is then lost. In contrast, the presaccadic object is conserved when object correspondence is broken. This helps transsaccadic memory but it may impose attentional costs on object recognition. Therefore, we investigated how breaking object correspondence across the saccade affects postsaccadic object recognition. In Experiment 1, object correspondence was broken by a brief postsaccadic blank screen. Observers made a saccade to a peripheral object which was displaced during the saccade. This object reappeared either immediately after the saccade or after the blank screen. Within the postsaccadic object, a letter was briefly presented (terminated by a mask). Observers reported displacement direction and letter identity in different blocks. Breaking object correspondence by blanking improved displacement identification but deteriorated postsaccadic letter recognition. In Experiment 2, object correspondence was broken by changing the object's contrast-polarity. There were no object displacements and observers only reported letter identity. Again, breaking object correspondence deteriorated postsaccadic letter recognition. These findings identify transsaccadic object correspondence as a key determinant of object recognition across the saccade. This is in line with the recent hypothesis that breaking object correspondence results in separate representations of presaccadic and postsaccadic objects which then compete for limited attentional processing resources (Schneider, 2013). Postsaccadic object recognition is

  5. Spelling well despite developmental language disorder: what makes it possible?

    Science.gov (United States)

    Rakhlin, Natalia; Cardoso-Martins, Cláudia; Kornilov, Sergey A; Grigorenko, Elena L

    2013-10-01

    The goal of the study was to investigate the overlap between developmental language disorder (DLD) and developmental dyslexia, identified through spelling difficulties (SD), in Russian-speaking children. In particular, we studied the role of phoneme awareness (PA), rapid automatized naming (RAN), pseudoword repetition (PWR), morphological (MA), and orthographic awareness (OA) in differentiating between children with DLD who have SD from children with DLD who are average spellers by comparing the two groups to each other, to typically developing children as well as children with SD but without spoken language deficits. One hundred forty-nine children, aged 10.40 to 14.00 years, participated in the study. The results indicated that the SD, DLD, and DLD/SD groups did not differ from each other on PA and RAN Letters and underperformed in comparison to the control groups. However, whereas the children with written language deficits (SD and DLD/SD groups) underperformed on RAN Objects and Digits, PWR, OA, and MA, the children with DLD and no SD performed similarly to the children from the control groups on these measures. In contrast, the two groups with spoken language deficits (DLD and DLD/SD) underperformed on RAN Colors in comparison to the control groups and the group of children with SD only. The results support the notion that those children with DLD who have unimpaired PWR and RAN skills are able to overcome their weaknesses in spoken language and PA and acquire basic literacy on a par with their age peers with typical language. We also argue that our findings support a multifactorial model of DLD.

  6. An Acute Lateral Ankle Sprain Significantly Decreases Physical Activity across the Lifespan

    Directory of Open Access Journals (Sweden)

    Tricia Hubbard-Turner, Erik A. Wikstrom, Sophie Guderian, Michael J. Turner

    2015-09-01

    Full Text Available We do not know the impact an ankle sprain has on physical activity levels across the lifespan. With the negative consequences of physical inactivity well established, understanding the effect of an ankle sprain on this outcome is critical. The objective of this study was to measure physical activity across the lifespan after a single ankle sprain in an animal model. Thirty male mice (CBA/J were randomly placed into one of three groups: the transected calcaneofibular ligament (CFL group, the transected anterior talofibular ligament (ATFL/CFL group, and a SHAM group. Three days after surgery, all of the mice were individually housed in a cage containing a solid surface running wheel. Physical activity levels were recorded and averaged every week across the mouse’s lifespan. The SHAM mice ran significantly more distance each day compared to the remaining two running groups (post hoc p = 0.011. Daily duration was different between the three running groups (p = 0.048. The SHAM mice ran significantly more minutes each day compared to the remaining two running groups (post hoc p=0.046 while the ATFL/CFL mice ran significantly less minutes each day (post hoc p = 0.028 compared to both the SHAM and CFL only group. The SHAM mice ran at a faster daily speed versus the remaining two groups of mice (post hoc p = 0.019 and the ATFL/CFL mice ran significantly slower each day compared to the SHAM and CFL group (post hoc p = 0.005. The results of this study indicate that a single ankle sprain significantly decreases physical activity across the lifespan in mice. This decrease in physical activity can potentially lead to the development of numerous chronic diseases. An ankle sprain thus has the potential to lead to significant long term health risks if not treated appropriately.

  7. Breaking object correspondence across saccadic eye movements deteriorates object recognition

    Directory of Open Access Journals (Sweden)

    Christian H. Poth

    2015-12-01

    Full Text Available Visual perception is based on information processing during periods of eye fixations that are interrupted by fast saccadic eye movements. The ability to sample and relate information on task-relevant objects across fixations implies that correspondence between presaccadic and postsaccadic objects is established. Postsaccadic object information usually updates and overwrites information on the corresponding presaccadic object. The presaccadic object representation is then lost. In contrast, the presaccadic object is conserved when object correspondence is broken. This helps transsaccadic memory but it may impose attentional costs on object recognition. Therefore, we investigated how breaking object correspondence across the saccade affects postsaccadic object recognition. In Experiment 1, object correspondence was broken by a brief postsaccadic blank screen. Observers made a saccade to a peripheral object which was displaced during the saccade. This object reappeared either immediately after the saccade or after the blank screen. Within the postsaccadic object, a letter was briefly presented (terminated by a mask. Observers reported displacement direction and letter identity in different blocks. Breaking object correspondence by blanking improved displacement identification but deteriorated postsaccadic letter recognition. In Experiment 2, object correspondence was broken by changing the object’s contrast-polarity. There were no object displacements and observers only reported letter identity. Again, breaking object correspondence deteriorated postsaccadic letter recognition. These findings identify transsaccadic object correspondence as a key determinant of object recognition across the saccade. This is in line with the recent hypothesis that breaking object correspondence results in separate representations of presaccadic and postsaccadic objects which then compete for limited attentional processing resources (Schneider, 2013. Postsaccadic

  8. Multiple mediation analysis of the relationship between rapid naming and reading

    DEFF Research Database (Denmark)

    Poulsen, Mads; Juul, Holger; Elbro, Carsten

    2015-01-01

    for the RAN-reading correlation. One hundred and sixty-nine preschool students were given measures of RAN and additional measures of phonological awareness, lexical search speed, letter knowledge, and paired associate learning. Their reading skills were tested a year later along with speed of processing......It is well established that rapid automatised naming (RAN) correlates with reading ability. Despite several attempts, no single component process (mediator) has been identified that fully accounts for the correlation. The present paper estimated the explanatory value of several mediators....... The influence of the mediators on the RAN-reading correlation was estimated as indirect effects in mediation analyses. Phonological awareness and letter knowledge significantly mediated the RAN-reading relationship, each accounted for a moderate part of the correlation between RAN and reading fluency. Thus...

  9. Gclust Server: 90010 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 90010 CEL_K01G5.4_17553976 Cluster Sequences Related Sequences(255) 215 ran-1: asso...ciated with RAN (nuclear import/export) function family member (ran-1) 1 1.00e-60 0.0 0.0 0.0 0.0 0.0 12.5 Show 90010 Clus...ter ID 90010 Sequence ID CEL_K01G5.4_17553976 Link to cluster sequences Cluster Sequences Link...nnotation ran-1: associated with RAN (nuclear import/export) function family member (ran-1) Number of Sequences 1 Homologs 1 Clus...ngi) (8species) (%) 12.5 Number of Sequences for each species CEL: 1 Species not appearing in this cluster A

  10. Data quality objectives

    Energy Technology Data Exchange (ETDEWEB)

    Haeberer, F. [Environmental Protection Agency, Washington, DC (United States)

    1993-12-31

    The U.S. Environmental Protection Agency (EPA) spends about $500 million annually in collecting environmental data for scientific research and regulatory decision making. In addition, the regulated community may spend as much as ten times more each year in responding to EPA compliance requirements. Among the EPA and the regulated community there are several important common concerns: both want to make informed decisions using the right type, quality, and quantity of data. Collecting new data is very resource intensive to all parties. Neither EPA nor the regulated community can afford to collect more or {open_quotes}better{close_quotes} data than are really needed; the Data Quality Objectives (DQO) process is a systematic planning tool for ensuring that the right data will be collected for arriving at a decision within the desired confidence constraints. Using the DQO process to plan environmental data collections can help improve their effectiveness and efficiency, and enhance the defensibility of the decisions for which the data are used.

  11. Beyond the Object

    Directory of Open Access Journals (Sweden)

    2007-01-01

    Full Text Available Object orientation (OO is regained not only in all components of integrate development media but it remarks in the rest of software world from operating system to last application domain - of course, with different intensity and success. A clear prove of OO application in all situations is the development of a wide range of industrial applications. OO technology allows drawing of relation between the geometry, topology and dimensions of data on a class hierarchy; thus, the observation of the amount of data gained by research in many scientific domains is facilitated through class libraries both for graphic primitives and for events examination. In conformity to all waiting, OO asserts in every distributive system, there are very important the applications for making open systems customer-server and dis-tributed applications in Java. Finally OO application in robot's programming and modeling needn't be omitted. However, far to be panacea, OO has also shades which will be researched so on.

  12. [Abortion and conscientious objection].

    Science.gov (United States)

    Czarkowski, Marek

    2015-03-01

    Polish laws specify the parties responsible for lawful medical care in the availability of abortion differently than the Resolution of the Council of Europe. According to Polish regulations they include all Polish doctors while according to the Resolution, the state. Polish rules should not discriminate against anyone in connection with his religion or belief, even more so because the issue of abortion is an example of an unresolved ethical dispute. The number of lawful abortion in Poland does not exceed 1000 per year and can be carried out by only a few specialists contracted by the National Health Fund. Sufficient information and assistance should be provided to all pregnant women by the National Health Fund. The participation of all physicians in the informing process is not necessary, as evidenced by the lack of complaints to provide information on where in vitro fertilization treatment can be found - until recently only available when paid for by the individual and performed in much larger numbers than abortion. Entities performing this paid procedure made sure to provide information on their own. The rejection of the right to the conscientious objection clause by negating the right to refuse information may lead some to give up the profession or cause the termination of certain professionals on the basis of the professed worldview. Meanwhile, doctors are not allowed to be discriminated against on the basis of their conscience or religion. © 2015 MEDPRESS.

  13. Target-object integration, attention distribution, and object orientation interactively modulate object-based selection.

    Science.gov (United States)

    Al-Janabi, Shahd; Greenberg, Adam S

    2016-10-01

    The representational basis of attentional selection can be object-based. Various studies have suggested, however, that object-based selection is less robust than spatial selection across experimental paradigms. We sought to examine the manner by which the following factors might explain this variation: Target-Object Integration (targets 'on' vs. part 'of' an object), Attention Distribution (narrow vs. wide), and Object Orientation (horizontal vs. vertical). In Experiment 1, participants discriminated between two targets presented 'on' an object in one session, or presented as a change 'of' an object in another session. There was no spatial cue-thus, attention was initially focused widely-and the objects were horizontal or vertical. We found evidence of object-based selection only when targets constituted a change 'of' an object. Additionally, object orientation modulated the sign of object-based selection: We observed a same-object advantage for horizontal objects, but a same-object cost for vertical objects. In Experiment 2, an informative cue preceded a single target presented 'on' an object or as a change 'of' an object (thus, attention was initially focused narrowly). Unlike in Experiment 1, we found evidence of object-based selection independent of target-object integration. We again found that the sign of selection was modulated by the objects' orientation. This result may reflect a meridian effect, which emerged due to anisotropies in the cortical representations when attention is oriented endogenously. Experiment 3 revealed that object orientation did not modulate object-based selection when attention was oriented exogenously. Our findings suggest that target-object integration, attention distribution, and object orientation modulate object-based selection, but only in combination.

  14. Haptic perception of mutiple objects

    NARCIS (Netherlands)

    Plaisier, M.A.

    2010-01-01

    In this thesis a series of investigations into haptic (touch) perception of multiple objects is presented. When we hold a collection of objects in our hand, we can extract different types of information about these objects. We can, for instance, identify which objects we are holding. The first

  15. Aggregating and Disaggregating Flexibility Objects

    DEFF Research Database (Denmark)

    Siksnys, Laurynas; Valsomatzis, Emmanouil; Hose, Katja

    2015-01-01

    of such objects while preserving flexibility. Hence, this paper formally defines the concept of flexibility objects (flex-objects) and provides a novel and efficient solution for aggregating and disaggregating flex-objects. Out of the broad range of possible applications, this paper will focus on smart grid...... the energy domain show that the proposed solutions provide good performance while satisfying the strict requirements....

  16. Challenges of conservation: working objects

    Directory of Open Access Journals (Sweden)

    Professor Elizabeth Pye

    2016-11-01

    Full Text Available This paper discusses the concepts and practice of museum conservation, and the role of conservation in preserving both material and significance of objects. It explores the conservation of science and industry collections and the fact that the significance of many of these objects lies in their operation. It considers alternatives to operating original objects but emphasises the value of experiencing the real thing, and argues that visitors should be given greater physical access to museum objects, including being enabled to handle and work functioning objects. It finishes by calling for research into the effects of operation on the objects themselves, and into what constitutes a satisfying experience of working objects.

  17. Hageri alustas oreli taastamisega / Inge Põlma

    Index Scriptorium Estoniae

    Põlma, Inge

    2009-01-01

    1851. aastal eesti orelimeistri Carl Tantoni valmistatud ja 1892. aastal Gustav Terkmanni poolt kohendatud Hageri Lambertuse kiriku oreli restaureerimisest, ekspertiisi tegi rootsi organist Göran Grahn

  18. Response variability in rapid automatized naming predicts reading comprehension.

    Science.gov (United States)

    Li, James J; Cutting, Laurie E; Ryan, Matthew; Zilioli, Monica; Denckla, Martha B; Mahone, E Mark

    2009-10-01

    A total of 37 children ages 8 to 14 years, screened for word-reading difficulties (23 with attention-deficit/hyperactivity disorder, ADHD; 14 controls) completed oral reading and rapid automatized naming (RAN) tests. RAN trials were segmented into pause and articulation time and intraindividual variability. There were no group differences on reading or RAN variables. Color- and letter-naming pause times and number-naming articulation time were significant predictors of reading fluency. In contrast, number and letter pause variability were predictors of comprehension. Results support analysis of subcomponents of RAN and add to literature emphasizing intraindividual variability as a marker for response preparation, which has relevance to reading comprehension.

  19. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rans ... isomerase [Xanthomonas oryzae pv. oryzae KACC10331] ... Length = 138 ... Query: 4 ... IATF...DTSRGPIVVALYPEKAPLTVANFVNLAKRGFYNGLSFHRVIADFMIQXXXXXXXXX 63 ... IATFDTSRGP...IVVALYPEKAPLTVANFVNLAKRGFYNGLSFHRVIADFMIQ ... Sbjct: 1 ... IATFDTSRGPIVVALYPEKAPLTVANFVNLAKRGFYNGLSFHRVIA

  20. Object-Interviews: Folding, Unfolding, and Refolding Perceptions of Objects

    Directory of Open Access Journals (Sweden)

    Susan Naomi Nordstrom PhD

    2013-02-01

    Full Text Available This article describes the object-interview as a Deleuzian space in which subjects and objects, living and nonliving, entangle together. I developed the object-interview to understand the connections that 11 Midwestern family history genealogists made between objects (e.g., documents, photographs, and other artifacts and their ancestors. The object-interview suggests an alternative way to think and do qualitative interviews informed by poststructural theories. The method draws on French philosopher Deleuze's concepts of the fold, events, and a life, as well as conventional qualitative interview literature. Deleuze's concepts offer a way to rethink objects and subjects as fibrous, connective, and folding entities in qualitative interviews. Such a rethinking offers an alternative to subject-centered conventional qualitative interviews in which subjects are teased apart from objects and subjects primarily produce knowledge. The object-interview, then, is a Deleuzian space in which the supposed distinctions between subjects and objects, as well as other binary divisions, become indistinct, or entangled, as both subjects and objects produce knowledge. That space enabled me to create the concept ensemble of life—a constantly shifting group of objects associated with a person's life. In this article, I describe the theoretical entanglement of the object-interview, the object-interview itself, the data it produced in my dissertation study, and the significance of the method to the field of qualitative research methods.

  1. Healthcare responsibilities and conscientious objection.

    Science.gov (United States)

    Cook, Rebecca J; Olaya, Mónica Arango; Dickens, Bernard M

    2009-03-01

    The Constitutional Court of Colombia has issued a decision of international significance clarifying legal duties of providers, hospitals, and healthcare systems when conscientious objection is made to conducting lawful abortion. The decision establishes objecting providers' duties to refer patients to non-objecting providers, and that hospitals, clinics, and other institutions have no rights of conscientious objection. Their professional and legal duties are to ensure that patients receive timely services. Hospitals and other administrators cannot object, because they do not participate in the procedures they are obliged to arrange. Objecting providers, and hospitals, must maintain knowledge of non-objecting providers to whom their patients must be referred. Accordingly, medical schools must adequately train, and licensing authorities approve, non-objecting providers. Where they are unavailable, midwives and perhaps nurse practitioners may be trained, equipped, and approved for appropriate service delivery. The Court's decision has widespread implications for how healthcare systems must accommodate conscientious objection and patients' legal rights.

  2. Making CORBA objects persistent: The object database adapter approach

    Energy Technology Data Exchange (ETDEWEB)

    Reverbel, F.C.R.

    1997-05-01

    In spite of its remarkable successes in promoting standards for distributed object systems, the Object Management Group (OMG) has not yet settled the issue of object persistence in the Object Request Broker (ORB) environment. The Common Object Request Broker Architecture (CORBA) specification briefly mentions an Object-Oriented Database Adapter that makes objects stored in an object-oriented database accessible through the ORB. This idea is pursued in the Appendix B of the ODMG standard, which identifies a number of issues involved in using an Object Database Management System (ODBMS) in a CORBA environment, and proposes an Object Database Adapter (ODA) to realize the integration of the ORB with the ODBMS. This paper discusses the design and implementation of an ODA that integrates an ORB and an ODBMS with C++ bindings. For the author`s purposes, an ODBMS is a system with programming interfaces. It may be a pure object-oriented DBMS (an OODBMS), or a combination of a relational DBMS and an object-relational mapper.

  3. Single versus multiple objective(s) decision making: an application ...

    African Journals Online (AJOL)

    Single objective approach is most widely used whereas consideration of multiple objectives is the rule rather than an exception in many real life decision-making circumstances. This paper, therefore, investigates whether or not single and multiple criteria/objective approaches necessarily lead to differing conclusions.

  4. Minimum Delay Moving Object Detection

    KAUST Repository

    Lao, Dong

    2017-01-08

    We present a general framework and method for detection of an object in a video based on apparent motion. The object moves relative to background motion at some unknown time in the video, and the goal is to detect and segment the object as soon it moves in an online manner. Due to unreliability of motion between frames, more than two frames are needed to reliably detect the object. Our method is designed to detect the object(s) with minimum delay, i.e., frames after the object moves, constraining the false alarms. Experiments on a new extensive dataset for moving object detection show that our method achieves less delay for all false alarm constraints than existing state-of-the-art.

  5. Objective Tests and Their Construction

    Science.gov (United States)

    Dimes, R. E.

    1973-01-01

    Summarizes classifications of educational objectives, types of test items, and principles underlying the construction of tests. Indicates that a combination of essay and objective tests is preferable in the overall evaluation of a course. (CC)

  6. Two Types of Visual Objects

    Directory of Open Access Journals (Sweden)

    Skrzypulec Błażej

    2015-06-01

    Full Text Available While it is widely accepted that human vision represents objects, it is less clear which of the various philosophical notions of ‘object’ adequately characterizes visual objects. In this paper, I show that within contemporary cognitive psychology visual objects are characterized in two distinct, incompatible ways. On the one hand, models of visual organization describe visual objects in terms of combinations of features, in accordance with the philosophical bundle theories of objects. However, models of visual persistence apply a notion of visual objects that is more similar to that endorsed in philosophical substratum theories. Here I discuss arguments that might show either that only one of the above notions of visual objects is adequate in the context of human vision, or that the category of visual objects is not uniform and contains entities properly characterized by different philosophical conceptions.

  7. Object Knowledge Modulates Colour Appearance

    Directory of Open Access Journals (Sweden)

    Christoph Witzel

    2011-01-01

    Full Text Available We investigated the memory colour effect for colour diagnostic artificial objects. Since knowledge about these objects and their colours has been learned in everyday life, these stimuli allow the investigation of the influence of acquired object knowledge on colour appearance. These investigations are relevant for questions about how object and colour information in high-level vision interact as well as for research about the influence of learning and experience on perception in general. In order to identify suitable artificial objects, we developed a reaction time paradigm that measures (subjective colour diagnosticity. In the main experiment, participants adjusted sixteen such objects to their typical colour as well as to grey. If the achromatic object appears in its typical colour, then participants should adjust it to the opponent colour in order to subjectively perceive it as grey. We found that knowledge about the typical colour influences the colour appearance of artificial objects. This effect was particularly strong along the daylight axis.

  8. Object knowledge modulates colour appearance

    Science.gov (United States)

    Witzel, Christoph; Valkova, Hanna; Hansen, Thorsten; Gegenfurtner, Karl R

    2011-01-01

    We investigated the memory colour effect for colour diagnostic artificial objects. Since knowledge about these objects and their colours has been learned in everyday life, these stimuli allow the investigation of the influence of acquired object knowledge on colour appearance. These investigations are relevant for questions about how object and colour information in high-level vision interact as well as for research about the influence of learning and experience on perception in general. In order to identify suitable artificial objects, we developed a reaction time paradigm that measures (subjective) colour diagnosticity. In the main experiment, participants adjusted sixteen such objects to their typical colour as well as to grey. If the achromatic object appears in its typical colour, then participants should adjust it to the opponent colour in order to subjectively perceive it as grey. We found that knowledge about the typical colour influences the colour appearance of artificial objects. This effect was particularly strong along the daylight axis. PMID:23145224

  9. Minimum Delay Moving Object Detection

    KAUST Repository

    Lao, Dong

    2017-11-09

    We present a general framework and method for detection of an object in a video based on apparent motion. The object moves relative to background motion at some unknown time in the video, and the goal is to detect and segment the object as soon it moves in an online manner. Due to unreliability of motion between frames, more than two frames are needed to reliably detect the object. Our method is designed to detect the object(s) with minimum delay, i.e., frames after the object moves, constraining the false alarms. Experiments on a new extensive dataset for moving object detection show that our method achieves less delay for all false alarm constraints than existing state-of-the-art.

  10. Multidisciplinary Optimization Object Library Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The development of a library of Common MDO Objects is proposed, in which the software objects will automate a variety of recurring problems in the development of MDO...

  11. Object tracking with stereo vision

    Science.gov (United States)

    Huber, Eric

    1994-01-01

    A real-time active stereo vision system incorporating gaze control and task directed vision is described. Emphasis is placed on object tracking and object size and shape determination. Techniques include motion-centroid tracking, depth tracking, and contour tracking.

  12. Object Knowledge Modulates Colour Appearance

    OpenAIRE

    Witzel, Christoph; Valkova, Hanna; Hansen, Thorsten; Gegenfurtner, Karl R.

    2011-01-01

    We investigated the memory colour effect for colour diagnostic artificial objects. Since knowledge about these objects and their colours has been learned in everyday life, these stimuli allow the investigation of the influence of acquired object knowledge on colour appearance. These investigations are relevant for questions about how object and colour information in high-level vision interact as well as for research about the influence of learning and experience on perception in general. In o...

  13. A Model for Concurrent Objects

    DEFF Research Database (Denmark)

    Sørensen, Morten U.

    1996-01-01

    We present a model for concurrent objects where obejcts interact by taking part in common events that are closely matched to form call-response pairs, resulting in resulting in rendez-vous like communications. Objects are built from primitive objects by parallel composition, encapsulation and hid...

  14. Clustering objects from multiple collections

    NARCIS (Netherlands)

    Hollink, V.; van Someren, M.; de Boer, V.

    2009-01-01

    Clustering methods cluster objects on the basis of a similarity measure between the objects. In clustering tasks where the objects come from more than one collection often part of the similarity results from features that are related to the collections rather than features that are relevant for the

  15. Objects as Temporary Autonomous Zones

    Directory of Open Access Journals (Sweden)

    Tim Morton

    2011-09-01

    Full Text Available From Hakim Bey's instructions on creating temporary autonomous zones we see an oscillation "between performance art and politics, circus clowning and revolution." In this essay Tim Morton discusses anarchist politics as, "the creation of fresh objects in a reality without a top or a bottom object, or for that matter a middle object."

  16. Overview of the Microscope Objective

    Science.gov (United States)

    Niu, Ruijuan

    Microscopes are widely used in research and industry. The objective lens is the most significant part of the microscope. Some characteristics and different types of microscope objectives are discussed in this thesis. The markings on the objective indicate some main optical characteristics. However, it is not always possible to know the materials, the radius or the thickness of each surface in an objective lens and it is not easy to simulate an objective without this data. In this thesis, we build a first order model which can simulate a refractive microscope objective when the magnification and numerical aperture are known. The model contains a thin lens made by two standard surfaces and also simulates the principal planes. This model provides more accurate ray heights and it is aplanatic. Some design examples of an objective lens are also discussed in order to get a better understanding of design and optimization considerations.

  17. Object recognition memory in zebrafish.

    Science.gov (United States)

    May, Zacnicte; Morrill, Adam; Holcombe, Adam; Johnston, Travis; Gallup, Joshua; Fouad, Karim; Schalomon, Melike; Hamilton, Trevor James

    2016-01-01

    The novel object recognition, or novel-object preference (NOP) test is employed to assess recognition memory in a variety of organisms. The subject is exposed to two identical objects, then after a delay, it is placed back in the original environment containing one of the original objects and a novel object. If the subject spends more time exploring one object, this can be interpreted as memory retention. To date, this test has not been fully explored in zebrafish (Danio rerio). Zebrafish possess recognition memory for simple 2- and 3-dimensional geometrical shapes, yet it is unknown if this translates to complex 3-dimensional objects. In this study we evaluated recognition memory in zebrafish using complex objects of different sizes. Contrary to rodents, zebrafish preferentially explored familiar over novel objects. Familiarity preference disappeared after delays of 5 mins. Leopard danios, another strain of D. rerio, also preferred the familiar object after a 1 min delay. Object preference could be re-established in zebra danios by administration of nicotine tartrate salt (50mg/L) prior to stimuli presentation, suggesting a memory-enhancing effect of nicotine. Additionally, exploration biases were present only when the objects were of intermediate size (2 × 5 cm). Our results demonstrate zebra and leopard danios have recognition memory, and that low nicotine doses can improve this memory type in zebra danios. However, exploration biases, from which memory is inferred, depend on object size. These findings suggest zebrafish ecology might influence object preference, as zebrafish neophobia could reflect natural anti-predatory behaviour. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Graspable objects shape number processing

    Directory of Open Access Journals (Sweden)

    Mariagrazia eRanzini

    2011-12-01

    Full Text Available The field of numerical cognition represents an interesting case for action-based theories of cognition, since number is a special kind of abstract concept. Several studies have shown that within the parietal lobes adjacent neural regions code numerical magnitude and grasping-related information. This anatomical proximity between brain areas involved in number and sensorimotor processes may account for interactions between numerical magnitude and action. In particular, recent studies has demonstrated a causal role of action perception on numerical magnitude processing. If objects are represented in terms of actions (affordances, the causal role of action on number processing should extend to the case of objects affordances. This study investigates the relationship between numbers and objects affordances in two experiments, without (Experiment 1 or with (Experiment 2 a motor action execution (i.e., participants were asked to hold an object in their hands during the task. The task consisted in repeating aloud the odd or even digit within a pair depending on the type of the preceding or following object. Order of presentation (object-number vs. number-object, object type (graspable vs. ungraspable, object size (small vs. large, and Numerical magnitude (small vs. large were manipulated for each experiment. Experiment 1 showed a facilitation – in terms of quicker responses - for graspable over ungraspable objects preceded by numbers, and an effect of numerical magnitude after the presentation of graspable objects. Experiment 2 demonstrated that the action execution enhanced overall the sensitivity to numerical magnitude, however interfering with the effects of objects affordances on number processing. Overall, these findings demonstrate that numbers and graspable objects communicate with each other, supporting the view that abstract concepts may be grounded in motor experience.

  19. Single versus Multiple Objective(s) Decision Making: An Application ...

    African Journals Online (AJOL)

    Rahel

    Keywords: Single versus Multiple Criteria/Objectives; Linear Programming, Goal. Programming; Subsistence Farms .... rule-of-thumb for balancing environmental, employment and other objectives or is non-optimal, .... total fuel or energy need of the household is determined from the dataset on the basis of fuel wood need ...

  20. Relations among Early Object Recognition Skills: Objects and Letters

    Science.gov (United States)

    Augustine, Elaine; Jones, Susan S.; Smith, Linda B.; Longfield, Erica

    2015-01-01

    Human visual object recognition is multifaceted and comprised of several domains of expertise. Developmental relations between young children's letter recognition and their 3-dimensional object recognition abilities are implicated on several grounds but have received little research attention. Here, we ask how preschoolers' success in recognizing…

  1. Channels as Objects in Concurrent Object-Oriented Programming

    Directory of Open Access Journals (Sweden)

    Joana Campos

    2011-10-01

    Full Text Available There is often a sort of a protocol associated to each class, stating when and how certain methods should be called. Given that this protocol is, if at all, described in the documentation accompanying the class, current mainstream object-oriented languages cannot provide for the verification of client code adherence against the sought class behaviour. We have defined a class-based concurrent object-oriented language that formalises such protocols in the form of usage types. Usage types are attached to class definitions, allowing for the specification of (1 the available methods, (2 the tests clients must perform on the result of methods, and (3 the object status - linear or shared - all of which depend on the object's state. Our work extends the recent approach on modular session types by eliminating channel operations, and defining the method call as the single communication primitive in both sequential and concurrent settings. In contrast to previous works, we define a single category for objects, instead of distinct categories for linear and for shared objects, and let linear objects evolve into shared ones. We introduce a standard sync qualifier to prevent thread interference in certain operations on shared objects. We formalise the language syntax, the operational semantics, and a type system that enforces by static typing that methods are called only when available, and by a single client if so specified in the usage type. We illustrate the language via a complete example.

  2. Refining Visually Detected Object poses

    DEFF Research Database (Denmark)

    Holm, Preben; Petersen, Henrik Gordon

    2010-01-01

    to the particular object and in order to handle the demand for flexibility, there is an increasing demand for avoiding such dedicated mechanical alignment systems. Rather, it would be desirable to automatically locate and grasp randomly placed objects from tables, conveyor belts or even bins with a high accuracy......Automated industrial assembly today require that the 3D position and orientation (hereafter ''pose`) of the objects to be assembled are known precisely. Today this precision is mostly established by a dedicated mechanical object alignment system. However, such systems are often dedicated...... that enables direct assembly. Conventional vision systems and laser triangulation systems can locate randomly placed known objects (with 3D CAD models available) with some accuracy, but not necessarily a good enough accuracy. In this paper, we present a novel method for refining the pose accuracy of an object...

  3. Objective interpretation as conforming interpretation

    OpenAIRE

    Lidka Rodak

    2011-01-01

    The practical discourse willingly uses the formula of “objective interpretation”, with no regards to its controversial nature that has been discussed in literature.The main aim of the article is to investigate what “objective interpretation” could mean and how it could be understood in the practical discourse, focusing on the understanding offered by judicature.The thesis of the article is that objective interpretation, as identified with textualists’ position, is not possible to uphold, and ...

  4. Bayesian Tracking of Visual Objects

    Science.gov (United States)

    Zheng, Nanning; Xue, Jianru

    Tracking objects in image sequences involves performing motion analysis at the object level, which is becoming an increasingly important technology in a wide range of computer video applications, including video teleconferencing, security and surveillance, video segmentation, and editing. In this chapter, we focus on sequential Bayesian estimation techniques for visual tracking. We first introduce the sequential Bayesian estimation framework, which acts as the theoretic basis for visual tracking. Then, we present approaches to constructing representation models for specific objects.

  5. Ferromagnetic Objects Magnetovision Detection System

    Directory of Open Access Journals (Sweden)

    Michał Nowicki

    2013-12-01

    Full Text Available This paper presents the application of a weak magnetic fields magnetovision scanning system for detection of dangerous ferromagnetic objects. A measurement system was developed and built to study the magnetic field vector distributions. The measurements of the Earth’s field distortions caused by various ferromagnetic objects were carried out. The ability for passive detection of hidden or buried dangerous objects and the determination of their location was demonstrated.

  6. Object Based Systems Engineering (OBSE)

    Science.gov (United States)

    2011-10-27

    these objects, containers can be reproduced as desired.  MBSE proponents and initiatives clearly have Object Based System Engineering as their...multiple, diverse SE methods. 1970 Paper Documents 1980 OBSE MBSE E-Documents 1990 2000 2010 2020 TECHNOI.DGY DRNEN. WARRGHTER FOCUSED. 8...includes the derivation rationale, i.e. How? or Why?  Capture minority viewpoints and discussion threads for each object of interest. • Lessons

  7. Delinquency and association with behavioral disorders and substance abuse

    OpenAIRE

    Gustavo Manoel Schier Dória; Sérgio Antonio Antoniuk; Francisco Baptista Assumpção Junior; Daniele Nascimento Fajardo; Maurício Nasser Ehlke

    2015-01-01

    Objective: to determine the incidence and associations of attention deficit-hyperactivity disorder (ADHD), conduct disorder (CD), and substance abuse disorder (SAD) in adolescents in conflict with the law in a Brazilian cohort. Methods: the Brazilian version of the Schedule for Affective Disorders and Schizophrenia for School Aged-Children (K-SADS-PL) was administered to 69 adolescent boys who were incarcerated for 45 days in the city of Curitiba, Brazil. Results: mean age was 15.5 years (ran...

  8. Leicester Cinema History

    OpenAIRE

    Jones, Matthew; Chibnall, S.; Ercole, Pier; Porter, Laraine; Hanson, Stuart; Acciari, Monia

    2017-01-01

    This public exhibition, housed in the DMU Heritage Centre, ran from February to May 2017. It charted the development, decline and resurgence of Leicester's cinema culture through a large map displaying the cinemas within the city and panels dedicated to the various types of cinemas that have operated in the surrounding area. Produced collaboratively by members of the Cinema and Television History (CATH) Research Centre, the exhibition also featured objects and historical artefacts drawn from ...

  9. CERT tribal internship program. Final intern report: Melinda Jacquez, 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-09-01

    The purpose of the intern project was to write a comprehensive booklet on all state legislation proposed in 1995 on Native American issues. A second purpose was to contact tribal governments and request an ordinance, law or resolution on hazardous and nuclear waste transportation. This intern report contains a summary of bills proposed in 37 state legislatures pertaining to Native American issues. Time ran out before the second project objective could be met.

  10. Personal Computer Local Area Network Security in an Academic Environment

    Science.gov (United States)

    1989-12-01

    AND JUSTIFICATION The San Francisco Examiner ran an article by John Dvorak on Sunday August 6th titled "Viruses Make Me Sick". The author speaks of the...humidity or foreign object destruction (e.g. a drink spilled into the keyboard ). Unfortunately, these areas can be tough to guard against. User training is...inserted into a floppy drive or a favorite soft drink is placed two inches from a keyboard . Instead, upon introduc- tion to the network labs

  11. Design and methods of the GLYNDIET study: assessing the role of glycemic index on weight loss and metabolic risk markers

    OpenAIRE

    Martí Juanola-Falgarona; Núria Ibarrola-Jurado; Jordi Salas-Salvadó; Antoni Rabassa-Soler; Monica Bulló

    2013-01-01

    Background: Glycemic index and/or glycemic load have been explored as an alternative for the prevention and/or management of obesity, cardiovascular disease, type 2 diabetes mellitus, and cancer. Objective: The purpose of the manuscript is to describe the design and methods used in the GLYNDIET Project, a study designed to simultaneously address the questions related to the exactly role of low glycaemic index carbohydrates has on weight loss. Methods: This study was designed as a 6-months ran...

  12. Cognition, action, and object manipulation.

    Science.gov (United States)

    Rosenbaum, David A; Chapman, Kate M; Weigelt, Matthias; Weiss, Daniel J; van der Wel, Robrecht

    2012-09-01

    Although psychology is the science of mental life and behavior, little attention has been paid to the means by which mental life is translated into behavior. One domain in which links between cognition and action have been explored is the manipulation of objects. This article reviews psychological research on this topic, with special emphasis on the tendency to grasp objects differently depending on what one plans to do with the objects. Such differential grasping has been demonstrated in a wide range of object manipulation tasks, including grasping an object in a way that reveals anticipation of the object's future orientation, height, and required placement precision. Differential grasping has also been demonstrated in a wide range of behaviors, including 1-hand grasps, 2-hand grasps, walking, and transferring objects from place to place as well as from person to person. The populations in which the tendency has been shown are also diverse, including nonhuman primates as well as human adults, children, and babies. The tendency is compromised in a variety of clinical populations and in children of a surprisingly advanced age. Verbal working memory is compromised as well if words are memorized while object manipulation tasks are performed; the recency portion of the serial position curve is reduced in this circumstance. In general, the research reviewed here points to rich connections between cognition and action as revealed through the study of object manipulation. Other implications concern affordances, Donders' law, naturalistic observation, and the teaching of psychology. (PsycINFO Database Record (c) 2012 APA, all rights reserved).

  13. Exploring Power with Object Theatre

    DEFF Research Database (Denmark)

    Ryöppy, Merja; Ylirisku, Salu; Knutz, Eva

    2017-01-01

    This paper explores Object Theatre as an approach to address power in design. We understand power as a relational activity that emerges and is upheld through particular ways of relating (Elias, 1991; Stacey, 2007). The spontaneity in participant actions through Object Theatre exercises renders...... processes of relating tangible and negotiable. In this study Object Theatre was applied in exploration of a new walking aid for elderly people. We argue that the shift in perspective that Object Theatre allows designers to achieve can be effectively harnessed to explore issues arising from power relating...

  14. Minimum Delay Moving Object Detection

    KAUST Repository

    Lao, Dong

    2017-05-14

    This thesis presents a general framework and method for detection of an object in a video based on apparent motion. The object moves, at some unknown time, differently than the “background” motion, which can be induced from camera motion. The goal of proposed method is to detect and segment the object as soon it moves in an online manner. Since motion estimation can be unreliable between frames, more than two frames are needed to reliably detect the object. Observing more frames before declaring a detection may lead to a more accurate detection and segmentation, since more motion may be observed leading to a stronger motion cue. However, this leads to greater delay. The proposed method is designed to detect the object(s) with minimum delay, i.e., frames after the object moves, constraining the false alarms, defined as declarations of detection before the object moves or incorrect or inaccurate segmentation at the detection time. Experiments on a new extensive dataset for moving object detection show that our method achieves less delay for all false alarm constraints than existing state-of-the-art.

  15. Identification of computer graphics objects

    Directory of Open Access Journals (Sweden)

    Rossinskyi Yu.M.

    2016-04-01

    Full Text Available The article is devoted to the use of computer graphics methods in problems of creating drawings, charts, drafting, etc. The widespread use of these methods requires the development of efficient algorithms for the identification of objects of drawings. The article analyzes the model-making algorithms for this problem and considered the possibility of reducing the time using graphics editing operations. Editing results in such operations as copying, moving and deleting objects specified images. These operations allow the use of a reliable identification of images of objects methods. For information on the composition of the image of the object along with information about the identity and the color should include information about the spatial location and other characteristics of the object (the thickness and style of contour lines, fill style, and so on. In order to enable the pixel image analysis to structure the information it is necessary to enable the initial code image objects color. The article shows the results of the implementation of the algorithm of encoding object identifiers. To simplify the process of building drawings of any kind, and reduce time-consuming, method of drawing objects identification is proposed based on the use as the ID information of the object color.

  16. 43 CFR 10.7 - Disposition of unclaimed human remains, funerary objects, sacred objects, or objects of cultural...

    Science.gov (United States)

    2010-10-01

    ..., funerary objects, sacred objects, or objects of cultural patrimony. 10.7 Section 10.7 Public Lands... REGULATIONS Human Remains, Funerary Objects, Sacred Objects, or Objects of Cultural Patrimony From Federal or... of cultural patrimony. ...

  17. Unsupervised Primary Object Discovery in Videos Based on Evolutionary Primary Object Modeling With Reliable Object Proposals.

    Science.gov (United States)

    Koh, Yeong Jun; Kim, Chang-Su

    2017-11-01

    A novel primary object discovery (POD) algorithm, which uses reliable object proposals while exploiting the recurrence property of a primary object in a video sequence, is proposed in this paper. First, we generate both color-based and motion-based object proposals in each frame, and extract the feature of each proposal using the random walk with restart simulation. Next, we estimate the foreground confidence for each proposal to remove unreliable proposals. By superposing the features of the remaining reliable proposals, we construct the primary object models. To this end, we develop the evolutionary primary object modeling technique, which exploits the recurrence property of the primary object. Then, using the primary object models, we choose the main proposal in each frame and find the location of the primary object by merging the main proposal with candidate proposals selectively. Finally, we refine the discovered bounding boxes by exploiting temporal correlations of the recurring primary object. Extensive experimental results demonstrate that the proposed POD algorithm significantly outperforms conventional algorithms.

  18. Welding. Performance Objectives. Basic Course.

    Science.gov (United States)

    Vincent, Kenneth

    Several intermediate performance objectives and corresponding criterion measures are listed for each of eight terminal objectives for a basic welding course. The materials were developed for a 36-week (2 hours daily) course developed to teach the fundamentals of welding shop work, to become familiar with the operation of the welding shop…

  19. Welding. Performance Objectives. Intermediate Course.

    Science.gov (United States)

    Vincent, Kenneth

    Several intermediate performance objectives and corresponding criterion measures are listed for each of nine terminal objectives for an intermediate welding course. The materials were developed for a 36-week (3 hours daily) course designed to prepare the student for employment in the field of welding. Electric welding and specialized (TIG & MIG)…

  20. Designing Instruction with Learning Objects.

    Science.gov (United States)

    Hamel, Cheryl J.; Ryan-Jones, David

    2002-01-01

    Discussion of online learning and standards for web-based and computer-based courseware focuses on learning objects, defined here as small, stand-alone units of instruction that can be tagged with descriptors and stored for reuse in various instructional contexts. Presents principles of learning object design and guidelines for assuring that…

  1. Objective interpretation as conforming interpretation

    Directory of Open Access Journals (Sweden)

    Lidka Rodak

    2011-12-01

    Full Text Available The practical discourse willingly uses the formula of “objective interpretation”, with no regards to its controversial nature that has been discussed in literature.The main aim of the article is to investigate what “objective interpretation” could mean and how it could be understood in the practical discourse, focusing on the understanding offered by judicature.The thesis of the article is that objective interpretation, as identified with textualists’ position, is not possible to uphold, and should be rather linked with conforming interpretation. And what this actually implies is that it is not the virtue of certainty and predictability – which are usually associated with objectivity- but coherence that makes the foundation of applicability of objectivity in law.What could be observed from the analyses, is that both the phenomenon of conforming interpretation and objective interpretation play the role of arguments in the interpretive discourse, arguments that provide justification that interpretation is not arbitrary or subjective. With regards to the important part of the ideology of legal application which is the conviction that decisions should be taken on the basis of law in order to exclude arbitrariness, objective interpretation could be read as a question “what kind of authority “supports” certain interpretation”? that is almost never free of judicial creativity and judicial activism.One can say that, objective and conforming interpretation are just another arguments used in legal discourse.

  2. Introducing Object-Oriented Programming

    DEFF Research Database (Denmark)

    Caspersen, Michael Edelgaard

    2008-01-01

    The practice of teaching programming at universities, colleges and high schools went through a major change roughly in the mid 1990s: The teaching of objectorientation in introductory courses slowly became mainstream. Fairly soon, the Object First or Objects Early school of thought was formulated...

  3. Learning Objects: Conditions for Viability

    Science.gov (United States)

    Liber, O.

    2005-01-01

    This article elaborates the factors that have led to the emergence of the concept of learning objects as the predominant model for digital learning materials, examining the problems that they address. It suggests that while there do appear to be real benefits, for a learning object model to be successful there needs to be a thriving learning…

  4. Object Oriented Programming in Director

    Directory of Open Access Journals (Sweden)

    Marian DARDALA

    2006-01-01

    Full Text Available Director is one of the most popular authoring software. As software for developing multimedia applications, Director is an object oriented programming environment. A very important issue to develop multimedia applications is the designing of their own classes. This paper presents the particular aspects concerning the available facilities offered by Lingo to design classes and to generate objects.

  5. Designing active objects in DEGAS

    NARCIS (Netherlands)

    J.F.P. van den Akker; A.P.J.M. Siebes (Arno)

    1997-01-01

    textabstractThis report discusses application design for active databases, in particular for the active object-based database programming language DEGAS. In DEGAS one modularisation principle, the object, is applied to all elements of the application, including rules. We discuss a design process

  6. DEGAS: Capturing dynamics in objects

    NARCIS (Netherlands)

    J.F.P. van den Akker; A.P.J.M. Siebes (Arno)

    1996-01-01

    textabstractIn this paper we introduce Degas (Dynamic Entities Get Autonomous Status), an active temporal data model based on autonomous objects. The active dimension of Degas means that we define the behaviour of objects in terms of production rules. The temporal dimension means that the history of

  7. What Makes an Object Memorable?

    KAUST Repository

    Dubey, Rachit

    2016-02-19

    Recent studies on image memorability have shed light on what distinguishes the memorability of different images and the intrinsic and extrinsic properties that make those images memorable. However, a clear understanding of the memorability of specific objects inside an image remains elusive. In this paper, we provide the first attempt to answer the question: what exactly is remembered about an image? We augment both the images and object segmentations from the PASCAL-S dataset with ground truth memorability scores and shed light on the various factors and properties that make an object memorable (or forgettable) to humans. We analyze various visual factors that may influence object memorability (e.g. color, visual saliency, and object categories). We also study the correlation between object and image memorability and find that image memorability is greatly affected by the memorability of its most memorable object. Lastly, we explore the effectiveness of deep learning and other computational approaches in predicting object memorability in images. Our efforts offer a deeper understanding of memorability in general thereby opening up avenues for a wide variety of applications. © 2015 IEEE.

  8. Classification of Building Object Types

    DEFF Research Database (Denmark)

    Jørgensen, Kaj Asbjørn

    2011-01-01

    be managed by software applications and on the basis of building models. Classification systems with taxonomies of building object types have many application opportunities but can still be beneficial in data exchange between building construction partners. However, this will be performed by new methods...... and in strong connection with databases holding a wide range of object types....

  9. Aesthetic properties of everyday objects.

    Science.gov (United States)

    Stich, Christine; Knäuper, Bärbel; Eisermann, Jens; Leder, Helmut

    2007-06-01

    This research addresses whether one underlying concept of appreciation exists across different classes of objects. Three studies were done. To identify aesthetic properties relevant for the aesthetic judgment of everyday objects and paintings, in Study 1 expert interviews were conducted with 12 interior designers, object-oriented designers and architects, and 12 students of art history. In Study 2, multidimensional unfolding (MDU) was used to examine whether common judgment criteria can be identified for the objects of the different classes. A sample of 217 German subjects participated. 2- or 3-dimensional MDU solutions resulted for each object class. The identified dimensions were labeled using the aesthetic properties derived from the expert interviews (Study 1). These dimensions represent relevant dimensions of aesthetic judgment on which object properties vary. Study 2 suggested that people use different dimensions of aesthetic judgment for different object classes. The identified dimensions were then used to construct three sets of systematically varied everyday objects and one set of systematically varied paintings. Using this stimulus material in Study 3, conjoint analysis indicated these dimensions are differentially important for the overall aesthetic judgment.

  10. Object manipulation facilitates kind-based object individuation of shape-similar objects

    DEFF Research Database (Denmark)

    Kingo, Osman Skjold; Krøjgaard, Peter

    2011-01-01

    Five experiments investigated the importance of shape and object manipulation when 12-month-olds were given the task of individuating objects representing exemplars of kinds in an event-mapping design. In Experiments 1 and 2, results of the study from Xu, Carey, and Quint (2004, Experiment 4) were...... partially replicated, showing that infants were able to individuate two natural-looking exemplars from different categories, but not two exemplars from the same category. In Experiment 3, infants failed to individuate two shape-similar exemplars (from Pauen, 2002a) from different categories. However......, Experiment 4 revealed that allowing infants to manipulate objects shortly before the individuation task enabled them to individuate shape-similar objects from different categories. In Experiment 5, allowing object manipulation did not induce infants to individuate natural-looking objects from the same...

  11. Revealing Nonclassicality of Inaccessible Objects

    Science.gov (United States)

    Krisnanda, Tanjung; Zuppardo, Margherita; Paternostro, Mauro; Paterek, Tomasz

    2017-09-01

    Some physical objects are hardly accessible to direct experimentation. It is then desirable to infer their properties based solely on the interactions they have with systems over which we have control. In this spirit, here we introduce schemes for assessing the nonclassicality of the inaccessible objects as characterized by quantum discord. We consider two probes individually interacting with the inaccessible object but not with each other. The schemes are based on monitoring entanglement dynamics between the probes. Our method is robust and experimentally friendly, as it allows the probes and the object to be open systems and makes no assumptions about the initial state, dimensionality of involved Hilbert spaces, and details of the probe-object Hamiltonian. We apply our scheme to a membrane-in-the-middle optomechanical system, to detect system-environment correlations in open system dynamics as well as nonclassicality of the environment, and we foresee potential benefits for the inference of the nonclassical nature of gravity.

  12. The Surrealist Collection of Objects

    Directory of Open Access Journals (Sweden)

    Pérez, Leticia

    2010-01-01

    Full Text Available In this article I shall discuss the Surrealist collection of objects as a form of art which arises out of mass production forces of the new era. These goods, deeply rooted in the capitalist laws of use-, exchange- and surplus-value, carry in themselves two materialist approaches which end in dialectical materialism. On the one hand, they epitomize the supreme forces of commodity fetishism ingrained in capitalist structures; on the other hand, they arouse unconscious desires which respond to the needs of the society of consumption. Thus, I will explore the act of object-collecting in the most radical Surrealist practices (dream objects, found objects, poème-objets, calligrammes, readymades and Surrealist objects as a way to not only delve into a new art, but also to reflect on societal ongoing transformations and paradoxes.

  13. Scientists' views about communication objectives.

    Science.gov (United States)

    Besley, John C; Dudo, Anthony; Yuan, Shupei

    2017-08-01

    This study looks at how United States-based academic scientists from five professional scientific societies think about eight different communication objectives. The degree to which scientists say they would prioritize these objectives in the context of face-to-face public engagement is statistically predicted using the scientists' attitudes, normative beliefs, and efficacy beliefs, as well as demographics and past communication activity, training, and past thinking about the objectives. The data allow for questions about the degree to which such variables consistently predict views about objectives. The research is placed in the context of assessing factors that communication trainers might seek to reshape if they wanted get scientists to consider choosing specific communication objectives.

  14. Object-Oriented Type Systems

    DEFF Research Database (Denmark)

    Schwartzbach, Michael Ignatieff; Palsberg, Jens

    a type system that generalizes and explains them. The theory is based on an idealized object-oriented language called BOPL (Basic Object Programming Language), containing common features of the above languages. A type system, type inference algorithm, and typings of inheritance and genericity...... are provided for BOPL. Throughout, the results are related to the languages on which BOPL is based. This text offers advanced undergraduates and professional software developers a sound understanding of the key aspects of object-oriented type systems. All algorithms are implemented in a freely available......Object-Oriented Type Systems Jens Palsberg and Michael I. Schwartzbach Aarhus University, Denmark Type systems are required to ensure reliability and efficiency of software. For object-oriented languages, typing is an especially challenging problem because of inheritance, assignment, and late...

  15. Object-Oriented Type Systems

    DEFF Research Database (Denmark)

    Schwartzbach, Michael Ignatieff; Palsberg, Jens

    are provided for BOPL. Throughout, the results are related to the languages on which BOPL is based. This text offers advanced undergraduates and professional software developers a sound understanding of the key aspects of object-oriented type systems. All algorithms are implemented in a freely available......Object-Oriented Type Systems Jens Palsberg and Michael I. Schwartzbach Aarhus University, Denmark Type systems are required to ensure reliability and efficiency of software. For object-oriented languages, typing is an especially challenging problem because of inheritance, assignment, and late...... a type system that generalizes and explains them. The theory is based on an idealized object-oriented language called BOPL (Basic Object Programming Language), containing common features of the above languages. A type system, type inference algorithm, and typings of inheritance and genericity...

  16. Experimental Object-Oriented Modelling

    DEFF Research Database (Denmark)

    Hansen, Klaus Marius

    and discuss techniques for handling and representing uncertainty when modelling in experimental system development. These techniques are centred on patterns and styles for handling uncertainty in object-oriented software architectures. Tools We present the Knight tool designed for collaborative modelling......This thesis examines object-oriented modelling in experimental system development. Object-oriented modelling aims at representing concepts and phenomena of a problem domain in terms of classes and objects. Experimental system development seeks active experimentation in a system development project...... through, e.g., technical prototyping and active user involvement. We introduce and examine “experimental object-oriented modelling” as the intersection of these practices. The contributions of this thesis are expected to be within three perspectives on models and modelling in experimental system...

  17. Complex perspectives on learning objectives

    DEFF Research Database (Denmark)

    Mørcke, Anne Mette; Wichmann-Hansen, Gitte; Guldbrand Nielsen, Dorte

    2006-01-01

    OBJECTIVE To understand core curriculum design and involvement of stakeholders.METHODS Twelve homogeneous focus group interviews with a total of 88 students, house officers, seniordoctors and nurses concerning an undergraduate emergency medicine curriculum. Following content coding of transcripts...... opposite perspectives: objectives as context-free theory-based rules versus objectives as personal practice-based guidelines. The students favoured theory-based objectives, which should be defined by experts conclusively as minimum levels and checklists. The senior doctors preferred practice......-based objectives, which should be decided in a collaborative, local, continuous process, and should be expressed as ideals and expectations. The house officers held both perspectives. Adding to complexity, participants also interpreted competence inconsistently and mixed concepts such as knowledge, observation...

  18. Object-Oriented Type Systems

    DEFF Research Database (Denmark)

    Schwartzbach, Michael Ignatieff; Palsberg, Jens

    a type system that generalizes and explains them. The theory is based on an idealized object-oriented language called BOPL (Basic Object Programming Language), containing common features of the above languages. A type system, type inference algorithm, and typings of inheritance and genericity......Object-Oriented Type Systems Jens Palsberg and Michael I. Schwartzbach Aarhus University, Denmark Type systems are required to ensure reliability and efficiency of software. For object-oriented languages, typing is an especially challenging problem because of inheritance, assignment, and late...... are provided for BOPL. Throughout, the results are related to the languages on which BOPL is based. This text offers advanced undergraduates and professional software developers a sound understanding of the key aspects of object-oriented type systems. All algorithms are implemented in a freely available...

  19. Medical image segmentation using object atlas versus object cloud models

    Science.gov (United States)

    Phellan, Renzo; Falcão, Alexandre X.; Udupa, Jayaram K.

    2015-03-01

    Medical image segmentation is crucial for quantitative organ analysis and surgical planning. Since interactive segmentation is not practical in a production-mode clinical setting, automatic methods based on 3D object appearance models have been proposed. Among them, approaches based on object atlas are the most actively investigated. A key drawback of these approaches is that they require a time-costly image registration process to build and deploy the atlas. Object cloud models (OCM) have been introduced to avoid registration, considerably speeding up the whole process, but they have not been compared to object atlas models (OAM). The present paper fills this gap by presenting a comparative analysis of the two approaches in the task of individually segmenting nine anatomical structures of the human body. Our results indicate that OCM achieve a statistically significant better accuracy for seven anatomical structures, in terms of Dice Similarity Coefficient and Average Symmetric Surface Distance.

  20. Interactive effects of age and exercise on adiposity measures of41,582 physically active women

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Paul T.; Satariano William A.

    2004-06-01

    The objective of this report is to assess in women whether exercise affects the estimated age-related increase in adiposity, and contrariwise, whether age affects the estimated exercise-related decrease in adiposity. Cross-sectional analyses of 64,911 female runners who provided data on their body mass index (97.6 percent), waist (91.1percent), and chest circumferences (77.9 percent). Age affected the relationships between vigorous exercise and adiposity. The decline in BMI per km/wk run was linear in 18-25 year olds (-0.023+-0.002 kg/m2 perkm run) and became increasingly nonlinear (convex or upwardly concave) with age. The waist, hip and chest circumferences declined significantly with running distance across all age groups, but the declines were 52-58 percent greater in older than younger women (P<10-5). The relationships between body circumferences and running distance became increasingly convexity (upward concavity) in older women. Conversely, vigorous exercise diminished the apparent increase in adiposity with age. The rise in average BMI with age was greatest in women who ran less than 8 km/week (0.065+-0.005 kg/m2 per y), intermediate of women who ran 8-16km/wk (0.025+-0.004kg/m2 per y) or 16-32 km/wk (0.022+-0.003 kg/m2 pery), and least in those who averaged over 32 km/wk (0.017+-0.001 kg/m2 pery). Before age 45, waist circumference rose 0.055+-0.026 cm in for those who ran 0-8 km/wk, showed no significant change for those who ran 8-40km./wk, and declined -0.057+-0.012 and -0.069+-0.014 cm per year in those who ran 40 -56 and over 56 km/wk. The rise in hip and chest circumferences with age were significantly greater in women who ran under eight km/wk than longer distance runners for hip (0.231+-0.018 vs0.136+-0.004 cm/year) and chest circumferences (0.137+-0.013 vs0.053+-0.003 cm/year). These cross-sectional associations suggest that in women, age and vigorous exercise interact with each other in affecting adiposity. The extent that these cross

  1. Probabilistic object and viewpoint models for active object recognition

    CSIR Research Space (South Africa)

    Govender, N

    2013-09-01

    Full Text Available Feature Transform (SIFT) [10] detector and descriptor to extract relevant object features. SIFT is robust to changes in illumination and affine transformation. Further, the features extracted from the training images are inputted directly into a vocabulary... for the object’s identity but not for pose. Also, the boosting and support vector machines strategy of [14] estimates both object and pose, but uses substantially uncluttered test data. Following [12], we also make use of a vocabulary tree representation [11...

  2. Multiparty Compatibility for Concurrent Objects

    Directory of Open Access Journals (Sweden)

    Roly Perera

    2016-06-01

    Full Text Available Objects and actors are communicating state machines, offering and consuming different services at different points in their lifecycle. Two complementary challenges arise when programming such systems. When objects interact, their state machines must be "compatible", so that services are requested only when they are available. Dually, when objects refine other objects, their state machines must be "compliant", so that services are honoured whenever they are promised. In this paper we show how the idea of multiparty compatibility from the session types literature can be applied to both of these problems. We present an untyped language in which concurrent objects are checked automatically for compatibility and compliance. For simple objects, checking can be exhaustive and has the feel of a type system. More complex objects can be partially validated via test cases, leading to a methodology closer to continuous testing. Our proof-of-concept implementation is limited in some important respects, but demonstrates the potential value of the approach and the relationship to existing software development practices.

  3. An object-color space.

    Science.gov (United States)

    Logvinenko, Alexander D

    2009-10-05

    Putting aside metaphorical meanings of the term, color space is understood as a vector space, where lights having the same color (i.e., subjectively indistinguishable) are represented as a point. The CIE 1931 color space, empirically based on trichromatic color measurements, is a classical example. Its derivatives, such as CIELAB and sRGB, have been successfully used in many applications (e.g., in color management). However, having been designed for presenting the color of self-luminous objects, these spaces are less suitable for presenting color of reflecting objects. Specifically, they can be used to represent color of objects only for a fixed illumination. Here I put forward a color space to represent the color of objects independently of illumination. It is based on an ideal color atlas comprising the reflectance spectra taking two values: k or 1 - k (0 color atlas is complete; that is, every reflecting object is metameric to some element of the atlas. When illumination alters, the classes of metameric reflectance spectra are reshuffled but in each class there is exactly one element of the atlas. Hence, the atlas can uniquely represent the metameric classes irrespective of illumination. Each element of the atlas (thus, object color) is specified by three numbers: (i) lambda = (lambda(1) + lambda(2))/2, which correlates well with hue of object color (as dominant wavelength correlates with hue of light color); (ii) delta =/lambda(1) - lambda/, which correlates with whiteness/blackness; and (iii) alpha =/1 - 2k/, which correlates with chroma of object color (as colorimetric purity correlates with saturation of light color). Using a geographical coordinate system, each element of the atlas (thus, each object color) is geometrically represented as a radius vector so that its length equals alpha, the latitude and longitude being proportional to delta and lambda, respectively.

  4. Conscientious objection in health care

    Directory of Open Access Journals (Sweden)

    Kuře Josef

    2016-12-01

    Full Text Available The paper deals with conscientious objection in health care, addressing the problems of scope, verification and limitation of such refusal, paying attention to ideological agendas hidden behind the right of conscience where the claimed refusal can cause harm or where such a claim is an attempt to impose certain moral values on society or an excuse for not providing health care. The nature of conscientious objection will be investigated and an ethical analysis of conscientious objection will be conducted. Finally some suggestions for health care policy will be proposed.

  5. PHP Objects, Patterns, and Practice

    CERN Document Server

    Zandstra, Matt

    2010-01-01

    This book takes you beyond the PHP basics to the enterprise development practices used by professional programmers. Updated for PHP 5.3 with new sections on closures, namespaces, and continuous integration, this edition will teach you about object features such as abstract classes, reflection, interfaces, and error handling. You'll also discover object tools to help you learn more about your classes, objects, and methods. Then you'll move into design patterns and the principles that make patterns powerful. You'll learn both classic design patterns and enterprise and database patterns with easy

  6. Simulations of Turbulent Momentum and Scalar Transport in Non-Reacting Confined Swirling Coaxial Jets

    Science.gov (United States)

    Shih, Tsan-Hsing; Liu, Nan-Suey; Moder, Jeffrey P.

    2015-01-01

    This paper presents the numerical simulations of confined three-dimensional coaxial water jets. The objectives are to validate the newly proposed nonlinear turbulence models of momentum and scalar transport, and to evaluate the newly introduced scalar APDF and DWFDF equation along with its Eulerian implementation in the National Combustion Code (NCC). Simulations conducted include the steady RANS, the unsteady RANS (URANS), and the time-filtered Navier-Stokes (TFNS); both without and with invoking the APDF or DWFDF equation. When the APDF (ensemble averaged probability density function) or DWFDF (density weighted filtered density function) equation is invoked, the simulations are of a hybrid nature, i.e., the transport equations of energy and species are replaced by the APDF or DWFDF equation. Results of simulations are compared with the available experimental data. Some positive impacts of the nonlinear turbulence models and the Eulerian scalar APDF and DWFDF approach are observed.

  7. Simulations of Turbulent Momentum and Scalar Transport in Confined Swirling Coaxial Jets

    Science.gov (United States)

    Shih, Tsan-Hsing; Liu, Nan-Suey

    2014-01-01

    This paper presents the numerical simulations of confined three dimensional coaxial water jets. The objectives are to validate the newly proposed nonlinear turbulence models of momentum and scalar transport, and to evaluate the newly introduced scalar APDF and DWFDF equation along with its Eulerian implementation in the National Combustion Code (NCC). Simulations conducted include the steady RANS, the unsteady RANS (URANS), and the time-filtered Navier-Stokes (TFNS) with and without invoking the APDF or DWFDF equation. When the APDF or DWFDF equation is invoked, the simulations are of a hybrid nature, i.e., the transport equations of energy and species are replaced by the APDF or DWFDF equation. Results of simulations are compared with the available experimental data. Some positive impacts of the nonlinear turbulence models and the Eulerian scalar APDF and DWFDF approach are observed.

  8. Advancement Planning: An Objectives View.

    Science.gov (United States)

    Druck, Kalman B.

    1986-01-01

    Planning must revolve around objectives related to students, faculty, money, and political support. When it is understood that all of the institution's advancement activity should help produce these four things, planning is easy. (MLW)

  9. On the Aging of Objects

    DEFF Research Database (Denmark)

    Andersen, Bjørn Schiermer

    2016-01-01

    The article seeks to develop a new conceptual framework suitable for analysing the ageing processes of objects in modern culture. The basic intuition is that object experience cannot be analysed separately from collective participation. The article focuses on the question of the ‘timeless’ nature...... of modernist design and seeks to understand why modernist objects age more slowly than other objects. First, inspired by the late Durkheim’s account of symbolism, I turn to the experiential effects of collective embeddedness. Second, I enter the field of architectural practices and architectural theory....... Visiting early modernist ideologue Adolf Loos, I seek to understand the modernist attitude as a direct response to experiences of the acceleration of ageing processes characteristic of modern culture. I then try to show how Loos’s explicit awareness of the collective dimension is ignored by the subsequent...

  10. Delphi FND Application Object Library -

    Data.gov (United States)

    Department of Transportation — Delphi FND Application Object Library contains the following data elements, but are not limited to temporary data tables for the logged in session, information about...

  11. Foreign Objects in the Rectum

    Science.gov (United States)

    ... Rectum Anal Fissure Anal Itching Anorectal Abscess Anorectal Fistula Foreign Objects in the Rectum Hemorrhoids Levator Syndrome Pilonidal Disease Proctitis Rectal Prolapse (See also Overview of the Anus and ...

  12. Object-Oriented Type Systems

    DEFF Research Database (Denmark)

    Schwartzbach, Michael Ignatieff; Palsberg, Jens

    Object-Oriented Type Systems Jens Palsberg and Michael I. Schwartzbach Aarhus University, Denmark Type systems are required to ensure reliability and efficiency of software. For object-oriented languages, typing is an especially challenging problem because of inheritance, assignment, and late...... binding. Existing languages employ different type systems, and it can be difficult to compare, evaluate and improve them, since there is currently no uniform theory for such languages. This book provides such a theory. The authors review the type systems of Simula, Smalltalk, C++ and Eiffel and present...... a type system that generalizes and explains them. The theory is based on an idealized object-oriented language called BOPL (Basic Object Programming Language), containing common features of the above languages. A type system, type inference algorithm, and typings of inheritance and genericity...

  13. Conscientious objection and emergency contraception.

    Science.gov (United States)

    Card, Robert F

    2007-06-01

    This article argues that practitioners have a professional ethical obligation to dispense emergency contraception, even given conscientious objection to this treatment. This recent controversy affects all medical professionals, including physicians as well as pharmacists. This article begins by analyzing the option of referring the patient to another willing provider. Objecting professionals may conscientiously refuse because they consider emergency contraception to be equivalent to abortion or because they believe contraception itself is immoral. This article critically evaluates these reasons and concludes that they do not successfully support conscientious objection in this context. Contrary to the views of other thinkers, it is not possible to easily strike a respectful balance between the interests of objecting providers and patients in this case. As medical professionals, providers have an ethical duty to inform women of this option and provide emergency contraception when this treatment is requested.

  14. Transient heating of moving objects

    Directory of Open Access Journals (Sweden)

    E.I. Baida

    2014-06-01

    Full Text Available A mathematical model of transient and quasistatic heating of moving objects by various heat sources is considered. The mathematical formulation of the problem is described, examples of thermal calculation given.

  15. Laser sources for object illumination

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht, G.F. [Lawrence Livermore National Lab., CA (United States)

    1994-11-15

    The considerations which formulate the specifications for a laser illuminator are explained, using the example of an underwater object. Depending on the parameters which define the scenario, widely varying laser requirements result.

  16. Integrated Multidisciplinary Optimization Objects Project

    Data.gov (United States)

    National Aeronautics and Space Administration — M4 Engineering proposes to implement physics-based, multidisciplinary analysis and optimization objects that will be integrated into a Python, open-source framework...

  17. Conscientious objection in medical practice

    National Research Council Canada - National Science Library

    Beca, Juan Pablo I; Astete, Carmen A

    2015-01-01

    .... This conscientious objection, accepted as a personal right and recognized by several legislations and medical ethics codes, is valid only if it has been reasonably justified and declared in advance...

  18. Incremental Visualizer for Visible Objects

    DEFF Research Database (Denmark)

    Bukauskas, Linas; Bøhlen, Michael Hanspeter

    path. IVVO is the novel solution which allows data to be visualized and loaded on the fly from the database and which regards visibilities of objects. We run a set of experiments to convince that IVVO is feasible in terms of I/O operations and CPU load. We consider the example of data which uses......This paper discusses the integration of database back-end and visualizer front-end into a one tightly coupled system. The main aim which we achieve is to reduce the data pipeline from database to visualization by using incremental data extraction of visible objects in a fly-through scenarios. We...... also argue that passing only relevant data from the database will substantially reduce the overall load of the visualization system. We propose the system Incremental Visualizer for Visible Objects (IVVO) which considers visible objects and enables incremental visualization along the observer movement...

  19. Exotic objects of atomic physics

    Science.gov (United States)

    Eletskii, A. V.

    2017-11-01

    There has been presented a short survey of physical properties, methods of production and exploration as well as directions of practical usage of the objects of atomic physics which are not yet described in detail in modern textbooks and manuals intended for students of technical universities. The family of these objects includes negative and multicharged ions, Rydberg atoms, excimer molecules, clusters. Besides of that, in recent decades this family was supplemented with new nanocarbon structures such as fullerenes, carbon nanotubes and graphene. The textbook “Exotic objects of atomic physics” [1] edited recently contains some information on the above-listed objects of the atomic physics. This textbook can be considered as a supplement to classic courses of atomic physics teaching in technical universities.

  20. Object-Oriented Type Systems

    DEFF Research Database (Denmark)

    Schwartzbach, Michael Ignatieff; Palsberg, Jens

    a type system that generalizes and explains them. The theory is based on an idealized object-oriented language called BOPL (Basic Object Programming Language), containing common features of the above languages. A type system, type inference algorithm, and typings of inheritance and genericity...... binding. Existing languages employ different type systems, and it can be difficult to compare, evaluate and improve them, since there is currently no uniform theory for such languages. This book provides such a theory. The authors review the type systems of Simula, Smalltalk, C++ and Eiffel and present......Object-Oriented Type Systems Jens Palsberg and Michael I. Schwartzbach Aarhus University, Denmark Type systems are required to ensure reliability and efficiency of software. For object-oriented languages, typing is an especially challenging problem because of inheritance, assignment, and late...

  1. SOLO: Self Organizing Live Objects

    Science.gov (United States)

    2008-12-01

    1 SOLO: Self Organizing Live Objects Qi Huang1, 2 (contact, tel. +16073519956), Ken Birman2 1School of Computer Science & Technology...levels of performance, relia- bility, or other QoS objectives. Here, we describe SOLO, a new platform we’re constructing as part of Cornell’s Live ...scenarios that would be expected in wide-area environments. Category: Regular paper for the PDS track (5700 words). Keywords: Self-organization, Live

  2. Well-Being and Objectivity

    Directory of Open Access Journals (Sweden)

    Jakub Bożydar Wiśniewski

    2011-03-01

    Full Text Available In this paper, I investigate the issue of whether there exists an objective element of well-being, completely independent of anyone’s desires, interests and preferences. After rejecting health-based and convention-based approaches to objectivity, I conclude that the element in question consists in respecting autonomy, voluntariness of every purposive agent and the principle of non-aggression.

  3. Objective assessment of technical skill.

    Science.gov (United States)

    MacRae, Helen M

    2011-01-01

    Objective assessment of technical skill is an important component of skills training: trainees require that deficiencies are clearly and objectively identified if a model of deliberate practice with feedback on skill acquisition is to be employed. There are several types of reliable and valid assessments for technical skill currently available. Copyright © 2010 Royal College of Surgeons of Edinburgh (Scottish charity number SC005317) and Royal College of Surgeons in Ireland. Published by Elsevier Ltd. All rights reserved.

  4. How action influences object perception.

    Science.gov (United States)

    Chan, David; Peterson, Mary A; Barense, Morgan D; Pratt, Jay

    2013-01-01

    Although object perception is typically associated with the parvocellular (P) pathway, a form of fast "gist" object perception may be due to activity in the magnocellular (M) pathway (Kveraga et al., 2007). Because the M-pathway is typically associated with action, we hypothesized that manipulations of action would influence speeded object perception. In three experiments, participants indicated whether the objects shown in low and high spatial frequency (HSF) images were larger or smaller than a prototypical shoebox. In Experiment 1, participants used a proximal (hands on monitor) or distal (hands on keyboard) hand posture in separate blocks. In Experiment 2, only the proximal hand posture was used, but the hands were either action oriented with palms in (palms toward the stimuli) or non-action oriented with palms out (palms away from the stimuli). In Experiment 3, we used the palms-in proximal hand posture but manipulated the type of visual stimuli such that they were either action oriented (easily grasped) or non-action oriented (not easily grasped). In all three experiments, the advantage in identifying the low spatial frequency (LSF) images was greater when action was primed (proximal hands, palms-in, graspable). Together, these experiments show that the M-pathway is involved in rapid "gist" object perception, and this type of object perception is influenced by action.

  5. Implications of perspective in teaching objects first and object design

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak

    2005-01-01

    There are an increasing number of books published on the important topics of "object-oriented programming" and "object-oriented design" for use in education. However, object-orientation can be viewed from a number of different perspectives---each perspective having its benefits and liabilities....... A perspective has a strong influence on the kind of designs students can and will produce, the kind of domains that are easy or difficult to analyze, and the kind of frame of reference in which design techniques are understood and applied. In this paper we argue that most books make an implicit choice...... of perspective with the unfortunate effect that our students leave our courses with limited design abilities. We present a coarse-grained classification, discuss implications of perspective in a teaching context, and illustrate consequences using a small case study. Our main point is that teachers should...

  6. Object-Tool-Actor Interaction: Object Information Drives Intended Action.

    Science.gov (United States)

    Gonzalez, Dave A; Scharoun, Sara M; Cinelli, M E; Bryden, P J; Lyons, J L; Roy, Eric A

    2018-01-01

    Tool use is typically explored via actor-tool interactions. However, the target-object (that which is being acted on) may influence perceived action possibilities and thereby guide action. Three different tool-target-object pairings were tested (Experiment 1). The hammering action demonstrated the greatest sensitivity and therefore subsequently used to further investigate target-object pairings. The hammer was removed as an option and instructions were provided using pictorial (Experiment 2), written (Experiment 3), and both pictorial and written formats (Experiment 4). The designed tool is chosen when available (Experiment 1) and when removed as a choice (i.e., the hammer), participants perform the same action associated with the designed tool (i.e., hammering) regardless of instruction method (Experiments 2, 3, and 4).

  7. Practical Implementation of Cooperative RRM for IMT-Advanced Systems

    DEFF Research Database (Denmark)

    Mihovska, Albena D.; Tragos, Elias; Kyriazakos, Sofoklis

    2008-01-01

    This paper describes a practical implementation of a radio resource management (RRM) framework for support of cooperation between radio access networks (RANs). The platform supports the inter-working between a next generation RAN and legacy systems (i.e., WLAN, UMTS). The platform is based on rea...

  8. Hybrid LES – Review and assessment

    Indian Academy of Sciences (India)

    models can be found in Johnson (1998), Peyret & Krause (2000), Pope (2000) and Wilcox. (2006). RANS solutions are used successfully in solving engineering applications that use fairly complex flow configurations. However, RANS approach suffers from a limitation that the model is not able to represent the effects of ...

  9. Tropical Journal of Pharmaceutical Research - Vol 15, No 7 (2016)

    African Journals Online (AJOL)

    Methotrexate nanoparticle delivery system for treatment of inflammatory bowel disease in pediatric patients · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gang Liu, Dun-Chen Li, Ping-Ping Li, Ran-Ran Li, Shu-Ying Chen, 1361-1368.

  10. A Study of Ionic Transport Through Randomly-Aligned Silica Nanospring Using Electrochemical Impedance Spectroscopy

    Science.gov (United States)

    Timalsina, Yukta P.; Branen, Joshua; Aston, Eric; Noren, Ken; McIlroy, David N.

    2011-03-01

    A study of ionic transport through randomly aligned (silica) nanospring (RANS) using electrochemical impedance spectroscopy is presented. The device used for this study is a parallel plate capacitor consisting of two conducting surfaces with RANS as the dielectric spacer layer. The device response is evaluated with test solutions consisting of sodium chloride in a phosphate buffer. The experimental impedance data is analyzed using a model equivalent resistor-inductor-capacitor (RLC) circuit. The solution resistance through RANS and electric double layer formed at solution- electrode interface are elements of equivalent circuit that are more responsive and are more likely to be affected by changes of ionic concentrations. From our analysis we have determined that an electric double layer forms at the solution- RANS interface, which acts as a barrier to diffusion of ions from the solution into the RANS, and vice versa. We have also determined that ion diffusion is impeded by the RANS, as illustrated by changes in the resistance of the element of the equivalent circuit that corresponds to diffusion of ions through the RANS. The linear response of the RANS-based device below 10 kHz is potentially useful for many sensing applications.

  11. Download this PDF file

    African Journals Online (AJOL)

    grethas

    For the other body weights and growth rates, fixed effects for stud, year of birth, management group (kids ran in veld, received no supplementation; kids ran on pastures), rearing status of the kid, age of dam and a covariate for age of the kid at each body weight, were included. For the reproductive parameters, fixed effects for.

  12. Large-eddy simulation of atmospheric flow over complex terrain

    DEFF Research Database (Denmark)

    Bechmann, Andreas

    2007-01-01

    of the incompressible Reynolds-averaged Navier-Stokes equations (RANS). The k - #epsilon# model is traditionally used for RANS computations, but is here developed to also enable LES. LES is able to provide detailed descriptions of a wide range of engineering flows at low Reynolds numbers. For atmospheric flows, however...

  13. The Relationships among Cognitive Correlates and Irregular Word, Non-Word, and Word Reading

    Science.gov (United States)

    Abu-Hamour, Bashir; University, Mu'tah; Urso, Annmarie; Mather, Nancy

    2012-01-01

    This study explored four hypotheses: (a) the relationships among rapid automatized naming (RAN) and processing speed (PS) to irregular word, non-word, and word reading; (b) the predictive power of various RAN and PS measures, (c) the cognitive correlates that best predicted irregular word, non-word, and word reading, and (d) reading performance of…

  14. Beyond Phonology: Visual Processes Predict Alphanumeric and Nonalphanumeric Rapid Naming in Poor Early Readers

    Science.gov (United States)

    Kruk, Richard S.; Luther Ruban, Cassia

    2018-01-01

    Visual processes in Grade 1 were examined for their predictive influences in nonalphanumeric and alphanumeric rapid naming (RAN) in 51 poor early and 69 typical readers. In a lagged design, children were followed longitudinally from Grade 1 to Grade 3 over 5 testing occasions. RAN outcomes in early Grade 2 were predicted by speeded and nonspeeded…

  15. Challenges in simulating coastal effects on an offshore wind farm

    DEFF Research Database (Denmark)

    van der Laan, Paul; Peña, Alfredo; Volker, Patrick

    2017-01-01

    The effect of a coastline on an offshore wind farm is investigated with a Reynolds-averaged Navier-Stokes (RANS) model. The trends of the RANS model compare relatively well with results from a mesoscale model and measurements of wind turbine power. In addition, challenges of modeling a large domain...

  16. How well Do Phonological Awareness and Rapid Automatized Naming Correlate with Chinese Reading Accuracy and Fluency? A Meta-Analysis

    Science.gov (United States)

    Song, Shuang; Georgiou, George K.; Su, Mengmeng; Hua, Shu

    2016-01-01

    Previous meta-analyses on the relationship between phonological awareness, rapid automatized naming (RAN), and reading have been conducted primarily in English, an atypical alphabetic orthography. Here, we aimed to examine the association between phonological awareness, RAN, and word reading in a nonalphabetic language (Chinese). A random-effects…

  17. Training Letter and Orthographic Pattern Recognition in Children with Slow Naming Speed

    Science.gov (United States)

    Conrad, Nicole J.; Levy, Betty Ann

    2011-01-01

    Although research has established that performance on a rapid automatized naming (RAN) task is related to reading, the nature of this relationship is unclear. Bowers (2001) proposed that processes underlying performance on the RAN task and orthographic knowledge make independent and additive contributions to reading performance. We examined the…

  18. A ProCoS II Project Final Report: ESPRIT Basic Research project 707

    DEFF Research Database (Denmark)

    Bowen, J. P.; Hoare, C. A. R.; Langmaack, Hans

    1996-01-01

    An overview of the research and associated activities of the Europeancollaborative ESPRIT Basic Research ProCoS II project (no. 7071) on``Provably Correct Systems'' which ran from 1992 to 1995 is presented.This was a follow-on project to ProCoS (no. 3104) and ran inparallel with the ProCoS Working...

  19. Study on Morphological Awareness and Rapid Automatized Naming through Word Reading and Comprehension in Normal and Disabled Reading Arabic-Speaking Children

    Science.gov (United States)

    Layes, Smail; Lalonde, Robert; Rebaï, Mohamed

    2017-01-01

    This study explored the role and extent of the involvement of morphological awareness (MA) in contrast to rapid automatized naming (RAN) in word reading and comprehension of Arabic as a morphologically based orthography. We gave measures of word reading, reading comprehension, MA, and RAN in addition to a nonverbal mental ability test to 3 groups…

  20. Economic Adjustment/Conversion

    Science.gov (United States)

    1985-07-01

    Angeles area of California, but appears to have had minimal lasting employment impact. 75 Rockwell established an outplacement center and ran job fairs...Fairchild ran job search workshops and outplacement activities at the plant. A Worker Resource Center, established in May, 1984, with a $45,000 JTPA Title III