
Sample records for ramosissima poaceae sobre

  1. Interferência de populações de Euphorbia heterophylla e Ipomoea ramosissima isoladas ou em misturas sobre a cultura de soja Interference of populations of Euphorbia heterophylla and Ipomoea ramosissima isolated or in mixture in soybean crop

    Directory of Open Access Journals (Sweden)

    M.A. Rizzardi


    Full Text Available Dentre as principais espécies daninhas que infestam as lavouras de soja do sul do Brasil, destacam-se Euphorbia heterophylla (leiteira e, mais recentemente, Ipomoea ramosissima (corda-de-viola. Objetivou-se avaliar a habilidade competitiva relativa entre espécies daninhas e soja e quantificar a interferência de infestações mistas de leiteira e corda-de-viola quando em convivência com plantas de soja. Foram conduzidos dois experimentos, comparando associações de leiteira ou corda-de-viola com soja, utilizando-se cinco proporções de plantas de leiteira e soja ou corda-de-viola e soja (0:8; 2:6; 4:4; 6:2; 8:0. Em um terceiro experimento, mantiveram-se constantes quatro plantas de soja por vaso e utilizaram-se cinco proporções de plantas de leiteira e corda-de-viola (0:8; 2:6; 4:4; 6:2; 8:0, estabelecidas em duas épocas de emergência das plantas daninhas em relação à soja. Verificou-se que a redução na biomassa da soja é mais intensa quando em presença de corda-de-viola do que de leiteira e, principalmente, em situações nas quais a planta daninha se estabelece antes que a cultura. Quando em infestação mista, corda-de-viola é mais competitiva do que leiteira.Euphorbia heterophylla (wild poinsettia, and, more recently, Ipomoea ramosissima (morningglory are among the main weeds infesting soybean crop in southern Brazil. This work aimed to evaluate the effects of wild poinsettia and morningglory as single or mixed populations in coexistence with soybean. Two experimentswere conducted to compare associations of wild poinsettia or moningglory with soybean, using five ratios of wild poinsettia plants and soybean or morningglory (0:8, 2:6, 4:4, 6:2 and 8:0. In a third experiment, four soybean plants per pot were kept constant and five ratios of of wild poinsettia and moningglory plants were used (0:8, 2:6, 4:4, 6:2 and 8:0, established in two weed emergence periods related to the soybean. The results indicated that a higher

  2. Proposal to conserve Tamarix ramosissima against T. pentandra Tamaricaceae) (United States)

    Ledebour described Tamarix ramosissima in 1829 from plants collected in Kazakhstan (Lake Noor Zaisan). In the protologue he overlooked T. pentandra Pall. (l.c.) and T. pallasii Desv. (l.c.), two earlier names which apply to the same biological entity, also widespread through Central and Western Asia...

  3. [Spatial distribution of Tamarix ramosissima aboveground biomass and water consumption in the lower reaches of Heihe River, Northwest China]. (United States)

    Peng, Shou-Zhang; Zhao, Chuan-Yan; Peng, Huan-Hua; Zheng, Xiang-Lin; Xu, Zhong-Lin


    Based on the field observation on the Tamarix ramosissima populations in the lower reaches of Heihe River, the relationship models between the aboveground biomass of T. ramosissima and its morphological features (basal diameter, height, and canopy perimeter) were built. In the mean time, the land use/cover of the study area was classified by the decision tree classification with high resolution image (QuickBird), the distribution of T. ramosissima was extracted from classification map, and the morphological feature (canopy perimeter) of T. ramosissima was calculated with ArcGIS 9.2. On the bases of these, the spatial distribution of T. ramosissima aboveground biomass in the study area was estimated. Finally, the spatial distribution of the water consumption of T. ramosissima in the study area was calculated by the transpiration coefficient (300) and the aboveground biomass. The results showed that the aboveground biomass of T. ramosissima was 69644.7 t, and the biomass per unit area was 0.78 kg x m(-2). Spatially, the habitats along the banks of Heihe River were suitable for T. ramosissima, and thus, this tree species had a high biomass. The total amount of water consumption of T. ramosissima in the study area was 2.1 x 10(7) m3, and the annual mean water consumption of T. ramosissima ranged from 30 mm to 386 mm.

  4. Physiological and morphological responses of Tamarix ramosissima and Populus euphratica to altered groundwater availability. (United States)

    Li, J; Yu, B; Zhao, C; Nowak, Robert S; Zhao, Z; Sheng, Y; Li, J


    Riparian plants in arid areas are subject to frequent hydrological fluctuations induced through natural flow variation and water use by humans. Although many studies have focused on the success of Tamarix ramosissima Ledeb. in its invaded ranges, its major competitor in its home range, Populus euphratica Oliv., historically has dominated riparian forests where both species occur naturally. Thus, identifying ecophysiological differences between T. ramosissima and its co-evolved competitor under varying hydrological conditions may help us understand how flow regimes affect dominance in its home range and promote invasion in new ranges. We examined ecophysiological responses of T. ramosissima and P. euphratica, which are both native to the Tarim River Basin, northwest China, to experimental alterations in groundwater. Seedlings of both species were grown in lysimeters, first under well-watered conditions and then exposed to different groundwater treatments: inundation, drought, and relatively shallow, moderate and deep groundwater. Under inundation, T. ramosissima showed little growth whereas P. euphratica died after ~45 days. Droughted seedlings of both species suffered from considerable water stress evidenced by slow growth, decreased total leaf area and specific leaf area, and decreased xylem water potential (ψ), maximum photosynthetic rate and carboxylation efficiency. Both species had better ecophysiological performances under shallow and moderate groundwater conditions. When groundwater declined below rooting depth, seedlings of both species initially experienced decreased ψ, but ψ of T. ramosissima recovered late in the experiment whereas P. euphratica maintained decreased ψ. This ability of T. ramosissima to recover from water deficit might result from its rapid root elongation and subsequent ability to acquire groundwater, which in turn likely provides ecophysiological advantages over P. euphratica. Our results suggest that recent groundwater declines

  5. Diuretic activity of Linaria ramosissima (wall.) Janch. leaves in albino rats (United States)

    Pandya, Preeti N.; Aghera, Hetal B.; Ashok, B. K.; Acharya, Rabinarayan


    Linaria ramosissima (Wall.) Janch., Scrophulariaceae, a folklore plant, has been claimed for its diuretic activities by traditional practitioners. The present study was undertaken to investigate the diuretic activity of L. ramosissima leaves in albino rats. Suspension of leaf powder in 2% gum acacia was administered to experimental rats orally at doses of 450 mg/kg. The diuretic effect was evaluated by measuring the urine volume, pH of urine, and urinary electrolyte excretion. Administration of the test drug increased the urine volume in a non-significant manner, while it enhanced the urinary excretion of sodium, chloride, and potassium significantly, in comparison to the control group. From the present study it can be concluded that the leaves of L. ramosissima have a significant diuretic activity. PMID:23723679

  6. [Seasonal variation of Tamarix ramosissima and Populus euphratica water potentials in southern fringe of Taklamakan Desert]. (United States)

    Zeng, Fanjiang; Zhang, Ximing; Li, Xiangyi; Foetzki, Andrea; Runge, Michael


    The measurement of the seasonal and diurnal variations of Tamarix ramosissima and Populus euphratica water potentials in the southern fringe of Taklamakan Desert indicated that there was no apparent water stress for the two species during their growth period, with little change of predawn water potential and some extent decrease of midday water potential. Irrigation once or thinning had no significant effects on the water status of the plants, while groundwater appeared to be a prerequisite for the survival and growth of these species. It is very important to ensure a stable groundwater table for the restoration of Tamarix ramosissima and Populus euphratica in this area.

  7. [Stem sap flow and water consumption of Tamarix ramosissima in hinterland of Taklimakan Desert]. (United States)

    Xu, Hao; Zhang, Xi-Ming; Yan, Hai-Long; Yao, Shi-Jun


    From April to November 2005, the stem sap flow and water consumption of Tamarix ramosissima in the hinterland of Taklimakan Desert was measured by Flow-32 System. The results showed that, in the extremely arid hinterland of Taklimakan Desert and under enough water supply, the average daily water consumption of T. ramosissima with a stem diameter of 3.5 cm and 2.0 cm was 6.322 kg and 1.179 kg, respectively in one growth season. The stem sap flow of T. ramosissima presented a single-peaked curve, with an obvious day and night variation rhythm and fluctuated with environment factors. Under enough water supply, the environmenal factors such as total radiation, wind speed and air temperature were the main factors affecting the stem sap flow, and the dynamics of stem sap flow could be predicted by the liner regression model based on total radiation and wind speed. Because of the extremely arid environment and enough water supply, T. ramosissima had a relatively higher stem sap flow rate and a great water consumption.

  8. Floristics and physiognomy determine migrant landbird response to Tamarisk (Tamarix ramosissima) invasion in riparian areas (United States)

    Hira A. Walker


    I investigated the relative importance of floristics and physiognomy in determining community organization of autumn-migrating landbirds in a riparian corridor in New Mexico invaded by Tamarisk (Tamarix ramosissima). All six avian measures were associated with floristics, physiognomy, or both. However, usefulness in predicting migrant parameters...


    Perchlorate ion (CIO4-) has been identified in samples of dormant salt cedar (Tamarix ramosissima) growing in the Las vegas Wash. Perchlorate is an oxidenat, but its reduction is kineticaly hindered. CXoncern over thyrpoid effects caused the Environmental Protection Agency (EPA...

  10. Blackbrush (Coleogyne ramosissima Torr.): State of our knowledge and future challenges [Chapter 10 (United States)

    Rosemary L. Pendleton; Burton K. Pendleton; Susan E. Meyer; Bryce Richardson; Todd Esque; Stanley G. Kitchen


    Blackbrush (Coleogyne ramosissima Torr.) is a regionally dominant shrub species found in the transition zone between North American warm and cold deserts where it occupies millions of hectares on National Park Service, Bureau of Land Management, and National Forest lands. Blackbrush habitat is under severe threat of loss from the combined effects of exotic annual...

  11. Modeling aboveground biomass of Tamarix ramosissima in the Arkansas River Basin of Southeastern Colorado, USA (United States)

    Evangelista, P.; Kumar, S.; Stohlgren, T.J.; Crall, A.W.; Newman, G.J.


    Predictive models of aboveground biomass of nonnative Tamarix ramosissima of various sizes were developed using destructive sampling techniques on 50 individuals and four 100-m2 plots. Each sample was measured for average height (m) of stems and canopy area (m2) prior to cutting, drying, and weighing. Five competing regression models (P < 0.05) were developed to estimate aboveground biomass of T. ramosissima using average height and/or canopy area measurements and were evaluated using Akaike's Information Criterion corrected for small sample size (AICc). Our best model (AICc = -148.69, ??AICc = 0) successfully predicted T. ramosissima aboveground biomass (R2 = 0.97) and used average height and canopy area as predictors. Our 2nd-best model, using the same predictors, was also successful in predicting aboveground biomass (R2 = 0.97, AICc = -131.71, ??AICc = 16.98). A 3rd model demonstrated high correlation between only aboveground biomass and canopy area (R2 = 0.95), while 2 additional models found high correlations between aboveground biomass and average height measurements only (R2 = 0.90 and 0.70, respectively). These models illustrate how simple field measurements, such as height and canopy area, can be used in allometric relationships to accurately predict aboveground biomass of T. ramosissima. Although a correction factor may be necessary for predictions at larger scales, the models presented will prove useful for many research and management initiatives.


    Directory of Open Access Journals (Sweden)

    Desy Yanuarita Wulandari


    Full Text Available Poaceae known as plants used as food ingredients in Indonesian. One area thas has high level diversity of plants Poaceae is Tahura R. Soerjo. Morphological characterization Poaceae in that region are still rare. The Goal for this research are to identify Poaceae tribes, and make photography Poaceae data that can be used as a supplement on Diversity of Plants course. This study included descriptive exploratory study with free cruising method. The species Poaceae has identified are Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflor. Suku Poaceae dikenal sebagai tumbuhan yang dimanfaatkan sebagai bahan pangan masyarakat Indonesia. Salah satu daerah yang memiliki tingkat keanekaragaman tumbuhan Poaceae adalah di Tahura R. Soerjo. Karakterisasi morfologi terkait suku Poaceae di daerah tersebut masih sedikit. Tujuan dalam penelitian ini adalah untuk identifikasi suku Poaceae, membuat data fotografi suku Poaceae sehingga dapat digunakan sebagai suplemen keanekaragaman tumbuhan. Penelitian ini termasuk penelitian deskriptif eksploratif dengan metode jelajah bebas. Sebelas spesies suku Poaceae yang telah teridentifikasi, yaitu Bambusa multiplex, Dendrocalamus asper, Digitaria radicosa, Echinochloa sp, Eragrostis unioloides, Lophatherum gracile, Oplismenus burmanni, Paspalidium flavidum, Pennisetum alopecuroides, Phragmites karka, Setaria parviflora.

  13. The Relation between Soil Parameters and Growth Characteristics of Tamarix ramosissima in Abyaneh, Isfahan Province

    Directory of Open Access Journals (Sweden)

    SayedHamid Matinkhah


    Full Text Available Vegetative characteristics of plant species are strongly dependent on habitat environmental conditions. Most Salt cedar (Tamarix ramosissima individuals grow on unsuitable soil and climate conditions. One of the important habitats of this species is near Abyaneh in Isfahan Province. To investigate the relation of edaphic factors on the growth of T. ramosissima, three plots 400m2 in area were randomly placed in this region. In each plot, crown cover and mean height of each tree were measured. Chemical and physical properties of soil were evaluated in two depths (0-20, 20-40cm. The relation between soil and vegetation was assessed using ordination method and RDA. The results suggest that in the upper depth, organic matter and saturation percentage (%SP have a strong positive correlation with vegetative factors of T. ramosissima including canopy cover and mean height. On the other hand, in lower depth pH, %CaSO4 factors have higher correlation with plants factors compared to upper depth. Therefore, organic matter in upper layer and saturation percentage (%SP have more correlation with vegetative factors. This suggests the importance of studying these two soil depths. In the restoration projects on this species, it is necessary to consider the abovementioned soil factors.

  14. Salicornia ramosissima: Secondary metabolites and protective effect against acute testicular toxicity

    Directory of Open Access Journals (Sweden)

    Daniela Ferreira


    Full Text Available Salicornia ramosissima J. Woods is a salt tolerant plant currently used in the human diet, whose genus not only displays great potential as a crop plant in deserts and highly saline soils, but also has value in traditional medicine and exhibits promising biological activities. The present study was designed to evaluate the effect of S. ramosissima ethanolic extract on carbon tetrachloride (CCl4-induced testicular damage in a mouse model and identify secondary metabolites present in the tested extract. The histopathological analysis showed that the treatment with the ethanolic extract prior to CCl4 administration prevented significantly the architectural disorder of seminiferous epithelium and germ cell exfoliation. The phytochemical study allowed the identification of known phenolic and aliphatic compounds [ethyl linolenoate (1, sitostanol (2, octadecyl (3 and eicosanyl (4 (E-ferulates, ethyl (E-2-hydroxycinnamate (5, scopoletin (6, a triacylglycerol of tetracosanoic acid (7], and three new compounds: saliramoester, a long chain triester (8, saliramophenone, a propiophenone derivative (9 and saliramopyrrole a pyrrole-3-carbaldehyde derivative (10. Their chemical structures were elucidated using detailed spectroscopic studies (1D and 2D NMR and MS. These results enhance the value of S. ramosissima as an excellent source of structurally interesting phytochemicals and as protective agent against testicular toxicity.


    Directory of Open Access Journals (Sweden)

    Diego Giraldo-Cañas


    distribución asociada con la altura sobre el nivel del mar y/o con la precipitación; así tenemos que las Panicoideae son más diversas en las tierras bajas y húmedas y en áreas abiertas de zonas subandinas, las Pooideae en las tierras alto-andinas (páramos, las Chloridoideae en las áreas secas, los bambúes herbáceos en la Región Amazónica y los bambúes leñosos en la Región Andina. Las Poaceae constituyen la sexta familia más rica en la flora de Colombia, después de las Orchidaceae, las Asteraceae, las Rubiaceae, las Fabaceae y las Melastomataceae.

  16. Palynomorphological features of Suaeda acuminata (C.A. Mey. Moq., Suaeda prostrata Pall. and Tamarix ramosissima Ledeb.

    Directory of Open Access Journals (Sweden)

    Tatyana I. Tsymbalyuk


    Full Text Available The pollen morphology of Suaeda acuminata , S. prostratа and Tamarix ramosissima from Ukrainian flora has been studied with light and scanning electron microscopy. The main morphological features of pollen grains of three taxa, which spread within halophytes vegetation, are determined. The results has considered as potential useful for identification of the fossil pollen under paleopalynological or paleoecological study.

  17. In Vitro and In Silico Antidiabetic and Antimicrobial Evaluation of Constituents from Kickxia ramosissima (Nanorrhinum ramosissimum

    Directory of Open Access Journals (Sweden)

    Luc Pieters


    Full Text Available Background and Aims:Kickxia ramosissima (Wall. Janch (or Nanorrhinum ramosissimum (Wall. Betsche is a well-known medicinal plant in Pakistan that is traditionally used in diabetic and inflammatory conditions. Because little information is available on its phytochemical composition, a range of constituents were isolated and evaluated in vitro in assays related to the traditional use.Methods: Dried whole plant material was extracted and chromatographically fractionated. Isolated constituents were evaluated in silico and in vitro in assays related to the traditional use against diabetes (inhibition of α-glucosidase activity; inhibition of advanced glycation endproducts and in inflammatory conditions (inhibition of AAPH induced linoleic acid peroxidation, inhibition of 15-LOX, antimicrobial activity.Results: Phytochemical analysis of the extracts and fractions led to isolation of 7 compounds, including the iridoids kickxiasine (being a new compound, mussaenosidic acid, mussaenoside and linarioside; the flavonoids pectolinarigenin and pectolinarin; and 4-hydroxy-benzoic acid methyl ester. The iridoids showed weak antiglycation activity. The flavonoids, however, showed interesting results as pectolinarigenin was highly active compared to pectolinarin. In the α-glucosidase inhibition assay, only weak activity was observed for the iridoids. However, the flavonoid pectolinarigenin showed good activity, followed by pectolinarin. In the 15-LOX experiment, moderate inhibition was recorded for most compounds, the iridoids mussaenosidic acid and mussaenoside being the most active. In the AAPH assay, weak or no inhibition was recorded for all compounds. The in silico assays for the α-glucosidase and 15-LOX assays confirmed the results of respective in vitro assays. Pectolinarigenin showed moderate antimicrobial activity against Staphylococcus aureus, Plasmodium falciparum K1, and Trypanosoma cruzi, but it was not cytotoxic on a human MRC-5 cell line

  18. Forma de crecimiento en Leptochloa Chloridiformis (Poaceae

    Directory of Open Access Journals (Sweden)

    Mariel G. Perreta


    Full Text Available Perreta, M. G., Tivano, J. C. & Vegetti, A. C. 2000. Forma de crecimiento en Leptochloachloridiformis (Poaceae. Darwiniana 38(3-4: 219-226.El objetivo de este trabajo fue analizar la forma de crecimiento de Leptochloa chloridiformis (Hack.Parodi. En esta especie perenne la ramificación ocurre principalmente a través de yemas axilarespresentes en la zona de innovación. Este sistema de ramificación genera una planta cespitosa, en la cual lasconexiones entre unidades estructurales son rizomas cortos. Dependiendo de su posición estas conexio-nes muestran diferentes tendencias en relación a la desarticulación estructural. En algunas plantas seobservó ramificación en la zona de entrenudos largos posiblemente debido a cambios ambientalesrelacionados con las distintas estaciones

  19. Effects of pollutant accumulation by the invasive weed saltcedar (Tamarix ramosissima) on the biological control agent Diorhabda elongata (Coleoptera: Chrysomelidae). (United States)

    Sorensen, Mary A; Parker, David R; Trumble, John T


    Hydroponic greenhouse studies were used to investigate the effect of four anthropogenic pollutants (perchlorate (ClO4(-)), selenium (Se), manganese (Mn), and hexavalent chromium (Cr (VI))) on the biological control agent Diorhabda elongata Brullé. Contaminant concentrations were quantified for experimental Tamarix ramosissima Ledab. plants and D. elongata beetles. Growth of larvae was significantly reduced by Se contamination, but was not affected by the presence of perchlorate, Mn, or Cr (VI). All of the contaminants were transferred from plants to D. elongata beetles. Only Cr (VI) was accumulated at greater levels in beetles than in their food. Because T. ramosissima grows in disturbed areas, acquires salts readily, and utilizes groundwater, this plant is likely to accumulate anthropogenic pollutants in contaminated areas. This study is one of the first to investigate the potential of an anthropogenic pollutant to influence a weed biological control system.

  20. Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae

    Directory of Open Access Journals (Sweden)

    Hugo F Gutiérrez


    Full Text Available Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve lectotipificaciones: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P. pringlei Leeke, P. tristachyum (Kunth Spreng. subsp. boliviense Chase, y se propone un nombre nuevo para Gymnotrix crinita Kunth.Nomenclatural novelties in Cenchrus s.l. (Poaceae: Panicoideae: Paniceae. Recent phylogenetic studies with morphological and molecular data provided evidence on the monophyly of the genera Cenchrus, Pennisetum and Odontelytrum. Therefore, these studies propose the unification and transfer of species of Pennisetum and Odontelytrum to the genus Cenchrus, which has priority. Nomenclatural problems were detected when conducting a preliminary taxonomic revision of the genus Cenchrus s.l. from America (Gutiérrez, in preparation. To resolve these inconveniences, nine lectotypifications: Cenchrus bambusoides Caro & E.A. Sánchez, C. brevisetus E. Fourn., C. pennisetiformis Hochst. & Steud. var. intermedia Chiov., C. roseus E. Fourn., Gymnotrix mexicana E. Fourn., Hymenachne montana Griseb., Pennisetum amoenum Hochst. ex A. Rich., P. cenchroides Rich. var. hamphilahense Terracc., P. ciliare (L. Link var. anachoreticum Chiov., P. petraeum Steud., P

  1. La familia Poaceae del distrito de Arahuay (Canta, Lima, Perú

    Directory of Open Access Journals (Sweden)

    Paúl Gonzáles


    Full Text Available Se reportan para el distrito de Arahuay (Canta, Lima, Perú (zona baja y media un total de 49 especies de la familia Poaceae agrupadas en 28 géneros, 14 tribus y 4 subfamilias. El género Poa es el más diverso con cinco especies, seguido por Eragrostis y Nassella con cuatro especies cada una. Las especies Calamagrostis spiciformis Hack. ex Stuck., Chloris halophila Parodi, Lamprothyrsus peruvianus Hitchc., Festuca glyceriantha Pilg., Lolium multiflorum Lam. y Poa supina Schrad. son nuevos reportes para el departamento de Lima. Se presentan claves dicotómicas para la determinación de los géneros y para las especies en los casos pertinentes. Para cada especie se incluye datos sobre su hábitat, distribución y el material estudiado.

  2. Foliar water uptake of Tamarix ramosissima from an atmosphere of high humidity. (United States)

    Li, Shuang; Xiao, Hong-lang; Zhao, Liang; Zhou, Mao-Xian; Wang, Fang


    Many species have been found to be capable of foliar water uptake, but little research has focused on this in desert plants. Tamarix ramosissima was investigated to determine whether its leaves can directly absorb water from high humidity atmosphere and, if they can, to understand the magnitude and importance of foliar water uptake. Various techniques were adopted to demonstrate foliar water uptake under submergence or high atmospheric humidity. The mean increase in leaf water content after submergence was 29.38% and 20.93% for mature and tender leaves, respectively. In the chamber experiment, obvious reverse sap flow occurred when relative humidity (RH) was persistently above 90%. Reverse flow was recorded first in twigs, then in branches and stems. For the stem, the percentage of negative sap flow rate accounting for the maximum value of sap flow reached 10.71%, and its amount accounted for 7.54% of diurnal sap flow. Small rainfall can not only compensate water loss of plant by foliar uptake, but also suppress transpiration. Foliar uptake can appear in the daytime under certain rainfall events. High atmospheric humidity is beneficial for enhancing the water status of plants. Foliar uptake should be an important strategy of water acquisition for desert plants.

  3. Pontibacter brevis sp. nov., isolated from rhizosphere soil of Tamarix ramosissima. (United States)

    Osman, Ghenijan; Gao, Yan; Wang, Ning; Mahmud, Otkur; Sun, Jian; Zhang, Tao; Zhan, Faqiang; Zhang, Zhidong; Lou, Kai


    A Gram-stain-negative, oval-shaped and light pink pigmented bacterium, designated XAAS-2 T , was isolated from rhizosphere soil of Tamarix ramosissima. The sole respiratory quinone of the type strain XAAS-2 T was MK-7, and the principal cellular fatty acids were summed feature 4 (iso-C17 : 1 I and/or anteiso-C17 : 1 B) and iso-C15 : 0. The major polar lipids were phosphatidylethanolamine and two unidentified lipids. 16S rRNA gene sequence analysis indicated that strain XAAS-2 T belonged to the genus Pontibacter within the family Cytophagaceae with sequence similarities of 93.9-97.1 % to other type species of the genus Pontibacter and to Pontibacter xinjiangensis CCTCC AB 207200 T as the closest neighbour. The DNA G+C content of strain XAAS-2 T was 50.6 mol%. The level of DNA-DNA relatedness of XAAS-2 T and P. xinjiangensis CCTCC AB 207200 T was 47.5 % (sd=3.27). Phenotypic and genotypic data suggested that strain XAAS-2 T represents a novel species of the genus Pontibacter, for which the name Pontibacterbrevis sp. nov. is proposed, with the type strain XAAS-2 T (=CCTCC AB 2016135 T =JCM 31443 T ).

  4. Foliar Water Uptake of Tamarix ramosissima from an Atmosphere of High Humidity

    Directory of Open Access Journals (Sweden)

    Shuang Li


    Full Text Available Many species have been found to be capable of foliar water uptake, but little research has focused on this in desert plants. Tamarix ramosissima was investigated to determine whether its leaves can directly absorb water from high humidity atmosphere and, if they can, to understand the magnitude and importance of foliar water uptake. Various techniques were adopted to demonstrate foliar water uptake under submergence or high atmospheric humidity. The mean increase in leaf water content after submergence was 29.38% and 20.93% for mature and tender leaves, respectively. In the chamber experiment, obvious reverse sap flow occurred when relative humidity (RH was persistently above 90%. Reverse flow was recorded first in twigs, then in branches and stems. For the stem, the percentage of negative sap flow rate accounting for the maximum value of sap flow reached 10.71%, and its amount accounted for 7.54% of diurnal sap flow. Small rainfall can not only compensate water loss of plant by foliar uptake, but also suppress transpiration. Foliar uptake can appear in the daytime under certain rainfall events. High atmospheric humidity is beneficial for enhancing the water status of plants. Foliar uptake should be an important strategy of water acquisition for desert plants.

  5. Effect of soil salinity and nutrient levels on the community structure of the root-associated bacteria of the facultative halophyte, Tamarix ramosissima, in southwestern United States. (United States)

    Taniguchi, Takeshi; Imada, Shogo; Acharya, Kumud; Iwanaga, Fumiko; Yamanaka, Norikazu


    Tamarix ramosissima is a tree species that is highly resistant to salt and drought. The Tamarix species survives in a broad range of environmental salt levels, and invades major river systems in southwestern United States. It may affect root-associated bacteria (RB) by increasing soil salts and nutrients. The effects of RB on host plants may vary even under saline conditions, and the relationship may be important for T. ramosissima. However, to the best of our knowledge, there have been no reports relating to T. ramosissima RB and its association with salinity and nutrient levels. In this study, we have examined this association and the effect of arbuscular mycorrhizal colonization of T. ramosissima on RB because a previous study has reported that colonization of arbuscular mycorrhizal fungi affected the rhizobacterial community (Marschner et al., 2001). T. ramosissima roots were collected from five locations with varying soil salinity and nutrient levels. RB community structures were examined by terminal restriction fragment (T-RF) length polymorphism, cloning, and sequencing analyses. The results suggest that RB richness, or the diversity of T. ramosissima, have significant negative relationships with electrical conductivity (EC), sodium concentration (Na), and the colonization of arbuscular mycorrhizal fungi, but have a significant positive relationship with phosphorus in the soil. However, at each T-RF level, positive correlations between the emergence of some T-RFs and EC or Na were observed. These results indicate that high salinity decreased the total number of RB species, but some saline-tolerant RB species multiplied with increasing salinity levels. The ordination scores of nonmetric multidimensional scale analysis of RB community composition show significant relationships with water content, calcium concentration, available phosphorus, and total nitrogen. These results indicate that the RB diversity and community composition of T. ramosissima are affected

  6. Nature of ergastic substances in some Poaceae seeds | Idu | African ...

    African Journals Online (AJOL)

    Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and protein and were devoid of tannins and inulin. Only 12 seed samples indicated the presence of alkaloids. The Positively ...

  7. Nature of ergastic substances in some Poaceae seeds

    African Journals Online (AJOL)

    ajl yemi


    Aug 29, 2011 ... 2Department of Botany, Ambrose Alli University, PMB. 14, Ekpoma, Edo State, Nigeria. Accepted 6 May, 2011. Seeds of 48 species of Poaceae were examined for the presence of alkaloid, protein, fats and oil, inulin, starch and tannins. All taxa investigated indicated the presence of starch, fats and oils and ...

  8. Seedling ecology and restoration of blackbrush (Coleogyne ramosissima) in the Mojave Desert, United States (United States)

    Jones, Lisa C.; Schwinning, Susanne; Esque, Todd C.


    Increases in fire frequency are disrupting many ecological communities not historically subjected to fire. In the southwestern United States, the blackbrush (Coleogyne ramosissima) community is among the most threatened, often replaced by invasive annual grasses after fire. This long-lived shrub is vulnerable because it recruits sporadically, partially due to mast seeding and the absence of a seed bank. The goal of this study was to evaluate if shrub restoration can be enhanced by identifying and ameliorating recruitment limitations. Specifically, we tested the effect of encapsulating seeds in predation-deterring “seed balls.” We also tested the effects of nurse plants and mammalian exclusion cages on seedling emergence, growth, and survivorship. These experiments were conducted in a full-factorial design across three sites differing in elevation. Over 2 years, 13% of all planted seeds emerged and the effect of seed balls was overwhelmingly negative because of low emergence. Nurse plants had overall positive effects at Low Elevation, but negative effects at Mid- and High Elevation. Emergence and survival were highest in caged plots everywhere, and effect sizes increased with elevation. Interactions between the cage and the nurse plant treatments indicated that nurse plants tended to attract mammalian predators, lowering emergence and seedling survivorship, particularly at higher elevations. Findings conform to the stress-gradient hypothesis in that interactions among seedlings and mature plants shifted from facilitation to competition as environmental stress decreased with increasing elevation, suggesting that they are transferable to ecologically similar communities elsewhere. Knowledge of site-specific recruitment limitations can help minimize ineffective restoration efforts.

  9. Influence of alkaline hydrothermal pretreatment on shrub wood Tamarix ramosissima: Characteristics of degraded lignin

    International Nuclear Information System (INIS)

    Xiao, Ling-Ping; Bai, Yuan-Yuan; Shi, Zheng-Jun; Lu, Qiang; Sun, Run-Cang


    The objective of this work was to evaluate the influence of alkaline hydrothermal (AH) pretreatment on the physicochemical properties of the degraded lignins, attempt to upgrade the potential of lignin for value-added chemicals and fuel production. For this purpose, shrub wood Tamarix ramosissima lignin was fractionated using a two-stage process based on an AH pretreatment followed by an alkaline ethanol post-treatment. The recovered lignin fractions were investigated by comparison with milled wood lignin (MWL) in terms of fractionation yield, carbohydrate composition, gel permeation chromatography, Fourier transform infrared spectroscopy, 13 C and 2D heteronuclear single quantum correlation nuclear magnetic resonance, as well as pyrolysis-gas chromatography/mass spectrometry. The result showed that AH pretreatment led to the degradation of β-O-4 linkages and consequently the increased severity caused a release of more S-units lignin fractions with molecular weights between 1300 and 2500 g/mol in the liquid but higher molecular weights (3000–4400 g/mol) in the residues. Moreover, it was found that the lignin syringyl-to-guaiacyl (S/G) ratios from analytical pyrolysis slightly changed after AH pretreatment (S/G, 1.8–2.3) but higher than those of MWL (S/G, 1.7). Overall, the present study demonstrates that these lignins dissolved during AH pretreatment and those recovered from the solid residues isolated with alkaline ethanol post-treatment could be profitably exploited as feedstock in integrated forest biorefineries, rather than traditional use as low-value energy sources.- Highlights: • Alkaline hydrothermal pretreatment and alkaline ethanol post-treatment were proposed. • The influence of AH pretreatment on the lignin structural changes was characterized. • Aryl-O-ether linkages of lignin were extensively cleaved. • Lignin recovered from solid residue is a potential resource for the production of value-added chemicals

  10. Effects of pollutant accumulation by the invasive weed saltcedar (Tamarix ramosissima) on the biological control agent Diorhabda elongata (Coleoptera: Chrysomelidae)

    International Nuclear Information System (INIS)

    Sorensen, Mary A.; Parker, David R.; Trumble, John T.


    Hydroponic greenhouse studies were used to investigate the effect of four anthropogenic pollutants (perchlorate (ClO 4 - ), selenium (Se), manganese (Mn), and hexavalent chromium (Cr (VI))) on the biological control agent Diorhabda elongata Brulle. Contaminant concentrations were quantified for experimental Tamarix ramosissima Ledab. plants and D. elongata beetles. Growth of larvae was significantly reduced by Se contamination, but was not affected by the presence of perchlorate, Mn, or Cr (VI). All of the contaminants were transferred from plants to D. elongata beetles. Only Cr (VI) was accumulated at greater levels in beetles than in their food. Because T. ramosissima grows in disturbed areas, acquires salts readily, and utilizes groundwater, this plant is likely to accumulate anthropogenic pollutants in contaminated areas. This study is one of the first to investigate the potential of an anthropogenic pollutant to influence a weed biological control system. - The presence of Se, but not perchlorate, Mn, or Cr (VI), in foliage of the invasive weed saltcedar was shown to reduce growth of the biological control agent Diorhabda elongata

  11. Effects of pollutant accumulation by the invasive weed saltcedar (Tamarix ramosissima) on the biological control agent Diorhabda elongata (Coleoptera: Chrysomelidae)

    Energy Technology Data Exchange (ETDEWEB)

    Sorensen, Mary A. [Department of Entomology, University of California, Riverside, CA 92521 (United States)], E-mail:; Parker, David R. [Department of Environmental Science, University of California, Riverside, CA 92521 (United States); Trumble, John T. [Department of Entomology, University of California, Riverside, CA 92521 (United States)


    Hydroponic greenhouse studies were used to investigate the effect of four anthropogenic pollutants (perchlorate (ClO{sub 4}{sup -}), selenium (Se), manganese (Mn), and hexavalent chromium (Cr (VI))) on the biological control agent Diorhabda elongata Brulle. Contaminant concentrations were quantified for experimental Tamarix ramosissima Ledab. plants and D. elongata beetles. Growth of larvae was significantly reduced by Se contamination, but was not affected by the presence of perchlorate, Mn, or Cr (VI). All of the contaminants were transferred from plants to D. elongata beetles. Only Cr (VI) was accumulated at greater levels in beetles than in their food. Because T. ramosissima grows in disturbed areas, acquires salts readily, and utilizes groundwater, this plant is likely to accumulate anthropogenic pollutants in contaminated areas. This study is one of the first to investigate the potential of an anthropogenic pollutant to influence a weed biological control system. - The presence of Se, but not perchlorate, Mn, or Cr (VI), in foliage of the invasive weed saltcedar was shown to reduce growth of the biological control agent Diorhabda elongata.

  12. Comparison of respiratory and growth characteristics of two co-occurring shrubs from a cold desert, Coleogyne ramosissima (blackbrush) and Atriplex confertifolia (shadscale) (United States)

    H. A. Summers; B. N. Smith; L. D. Hansen


    Coleogyne ramosissima Torr. (blackbrush) and Atriplex confertifolia [Torr. & Frem.] Wats. (shadscale) are cold desert shrubs from different families. Despite very different life histories they often grow in close geographic proximity in the Great Basin and the Colorado Plateau between 800 and 2000 m elevation. The purpose of...

  13. Poaceae pollen as the leading aeroallergen worldwide: A review. (United States)

    García-Mozo, H


    The Poaceae family comprises over 12 000 wind-pollinated species, which release large amounts of pollen into the atmosphere. Poaceae pollen is currently regarded as the leading airborne biological pollutant and the chief cause of pollen allergy worldwide. Sensitization rates vary by country, and those variations are reviewed here. Grass pollen allergens are grouped according to their protein structure and function. In Poaceae, although species belonging to different subfamilies are characterized by distinct allergen subsets, there is a considerable degree of cross-reactivity between many species. Cross-reactivity between grass pollen protein and fresh fruit pan-allergens is associated with the appearance of food allergies. The additional influence of urban pollution may prompt a more severe immunological response. The timing and the intensity of the pollen season are governed by species genetics, but plant phenology is also influenced by climate; as a result, climate changes may affect airborne pollen concentrations. This article reviews the findings of worldwide research which has highlighted the major impact of climate change on plant phenology and also on the prevalence and severity of allergic disease. © 2017 EAACI and John Wiley and Sons A/S. Published by John Wiley and Sons Ltd.

  14. Tamaractam, a New Bioactive Lactam from Tamarix ramosissima, Induces Apoptosis in Rheumatoid Arthritis Fibroblast-Like Synoviocytes. (United States)

    Yao, Yao; Jiang, Cheng-Shuai; Sun, Na; Li, Wei-Qi; Niu, Yang; Han, Huai-Qin; Miao, Zhen-Hua; Zhao, Xun-Xia; Zhao, Jing; Li, Juan


    Chemical investigation of Tamarix ramosissima Ledeb, a traditional herbal medicine used for rheumatoid arthritis (RA) treatment in northwest China, led to the discovery of a new phenolic aromatic rings substituted lactam, tamaractam ( 1 ), together with the previously reported compounds cis - N -feruloyl-3- O -methyldopamine ( 2 ) and trans - N -feruloyl-3- O -methyldopamine ( 3 ). The structures of the compounds were determined by high resolution electrospray ionization mass spectroscopy (HRESIMS) and 1D and 2D-NMR experiments, as well as comparison with the literature data. The effects of the three compounds on the viability of RA fibroblast-like synoviocytes (RA-FLS) were assessed by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2- H -tetrazolium bromide (MTT) assay. Pro-apoptosis effect of compound 1 in RA-FLS was further investigated by terminal deoxynucleotidyl transferase-mediated dUTP nick-end labeling (TUNEL) assay, activated caspase-3/7 level assessment using luminescence assay, and sub-G₁ fraction measurement using flow cytometry. It was found that these three compounds displayed variable proliferation inhibitory activity in RA-FLS, and compound 1 exhibited the strongest effect. Compound 1 could remarkably induce cellular apoptosis of RA-FLS, increase activated caspase-3/7 levels, and significantly increase sub-G₁ fraction in the cell cycle. The results suggested that compound 1 may inhibit the proliferation of RA-FLS through apoptosis-inducing effect, and these compounds may contribute to the anti-RA effect of T. ramosissima .

  15. Tamaractam, a New Bioactive Lactam from Tamarix ramosissima, Induces Apoptosis in Rheumatoid Arthritis Fibroblast-Like Synoviocytes

    Directory of Open Access Journals (Sweden)

    Yao Yao


    Full Text Available Chemical investigation of Tamarix ramosissima Ledeb, a traditional herbal medicine used for rheumatoid arthritis (RA treatment in northwest China, led to the discovery of a new phenolic aromatic rings substituted lactam, tamaractam (1, together with the previously reported compounds cis-N-feruloyl-3-O-methyldopamine (2 and trans-N-feruloyl-3-O-methyldopamine (3. The structures of the compounds were determined by high resolution electrospray ionization mass spectroscopy (HRESIMS and 1D and 2D-NMR experiments, as well as comparison with the literature data. The effects of the three compounds on the viability of RA fibroblast-like synoviocytes (RA-FLS were assessed by 3-(4,5-dimethyl-2-thiazolyl-2,5-diphenyl-2-H-tetrazolium bromide (MTT assay. Pro-apoptosis effect of compound 1 in RA-FLS was further investigated by terminal deoxynucleotidyl transferase-mediated dUTP nick-end labeling (TUNEL assay, activated caspase-3/7 level assessment using luminescence assay, and sub-G1 fraction measurement using flow cytometry. It was found that these three compounds displayed variable proliferation inhibitory activity in RA-FLS, and compound 1 exhibited the strongest effect. Compound 1 could remarkably induce cellular apoptosis of RA-FLS, increase activated caspase-3/7 levels, and significantly increase sub-G1 fraction in the cell cycle. The results suggested that compound 1 may inhibit the proliferation of RA-FLS through apoptosis-inducing effect, and these compounds may contribute to the anti-RA effect of T. ramosissima.

  16. O gênero Chloris (Poaceae) em Pernambuco, Brasil


    Maciel, Jefferson Rodrigues; Silva, Wegliane Campelo da; Costa-e-Silva, Maria Bernadete


    Com o objetivo de colaborar com o conhecimento da riqueza de Poaceae em Pernambuco, foi estudado o gênero Chloris Sw. As coletas foram realizadas no estado, bem como dados foram coligidos de levantamento em herbários da região. Foram registradas sete espécies de Chloris em Pernambuco: C. barbata Sw., C. elata Desv., C. exilis Renv., C. gayana Kunth, C. orthonoton Döll, C. pycnothrix Trin. e C. virgata Sw. O gênero apresenta distribuição ampla em todas as zonas fitogeográficas do estado. Chlor...

  17. Hydrothermal treatment and enzymatic hydrolysis of Tamarix ramosissima: evaluation of the process as a conversion method in a biorefinery concept. (United States)

    Xiao, Ling-Ping; Shi, Zheng-Jun; Xu, Feng; Sun, Run-Cang


    The present work investigated the effects of hydrothermal treatment (HTT) of Tamarix ramosissima by determination of sugar and inhibitor formation in the liquid fraction, and chemical and morphological changes of the pretreated solid material coupled with an evaluation of enzymatic hydrolysis. HTT was carried out in a batch reactor system at a maximal temperature (TMAX 180-240 °C) and evaluated for severities logRo ranging from 2.40 to 4.17. The liquid fractions were analyzed by HPLC, GPC, and GC-MS. The morphology and composition of the solid residues were characterized using an array of techniques, such as SEM, XRD, BET surface area, and CP/MAS (13)C NMR. Using a variety of tools, we have developed a better understanding of how HTT process affects biomass structure and cellulose properties that impact on its digestibility. These results provided new insights into the factors limiting enzymatic digestibility and mechanism of biomass deconstruction during hydrothermal process. Crown Copyright © 2012. Published by Elsevier Ltd. All rights reserved.

  18. Radial growth of Tamarix ramosissima responds to changes in the water regime in an extremely arid region of northwestern China (United States)

    Xiao, Shengchun; Xiao, Honglang


    The response of radial growth of tamarisk ( Tamarix ramosissima) growing on the shore of West-Juyan Lake, on the Heihe River in northwestern China, to changes in the lake’s water regime was studied using tree-ring chronologies, principal components (PC) analysis, and classical correlation analysis. The first PC accounted for 53.3% of the total variance and reflected a common growth response at different sites. Correlation analysis indicated that fluctuations in the lake’s water level during the growing season (May August) was primarily responsible for variations in the radial growth of tamarisk and explained more of the variance at low-lying sites than at higher sites. The second PC accounted for 30.7% of the total variance and revealed distinct differences in growth response between low-lying sites and those on higher ground. Total annual precipitation played an important role in radial growth of tamarisk at the higher sites. The spatial pattern in the tree-ring chronologies for different sites was performed in the temporal pattern of the tree-ring chronology at the same site. Other factors such as microtopography, soil salinity, sand activity, and browsing by herbivores also affected the radial growth of tamarisk. The diversity in responses to the maximum water table depth for tamarisk in the study area appears to have been caused by local variations in precipitation, which can compensate to some degree for the inability of a plant’s roots to reach the water table.

  19. Chemotaxonomy as a tool for interpreting the cryptic diversity of Poaceae pollen

    NARCIS (Netherlands)

    Julier, A.C.M.; Jardine, P.E.; Coe, A.L.; Gosling, W.D.; Lomax, B.H.; Fraser, W.T.


    The uniform morphology of different species of Poaceae (grass) pollen means that identification to below family level using light microscopy is extremely challenging. Poor taxonomic resolution reduces recoverable information from the grass pollen record, for example, species diversity and

  20. Révision du genre Digitaria Haller (Poaceae) au Sénégal ...

    African Journals Online (AJOL)

    Le genre Digitaria Haller (Poaceae) constitue l'un des genres les plus diversifiés des Poaceae du Sénégal avec 19 espèces. Bien qu'il y ait une monographie mondiale du genre, la détermination des espèces reste difficile et repose essentiellement sur les caractères de l'appareil reproducteur. Ce travail, qui est une ...

  1. The effects of groundwater depth on water uptake of Populus euphratica and Tamarix ramosissima in the hyperarid region of Northwestern China. (United States)

    Chen, Yapeng; Chen, Yaning; Xu, Changchun; Li, Weihong


    Knowledge of the water sources used by desert trees and shrubs is critical for understanding how they function and respond to groundwater decline and predicting the influence of water table changes on riparian plants. In this paper, we test whether increased depth to groundwater changed the water uptake pattern of desert riparian species and whether competition for water resources between trees and shrubs became more intense with a groundwater depth gradient. The water sources used by plants were calculated using the IsoSource model, and the results suggested differences in water uptake patterns with varying groundwater depths. At the river bank (groundwater depth = 1.8 m), Populus euphratica and Tamarix ramosissima both used a mixture of river water, groundwater, and deeper soil water (>75 cm). When groundwater depth was 3.8 m, trees and shrubs both depended predominantly on soil water stored at 150-375 cm depth. When the groundwater depth was 7.2 m, plant species switched to predominantly use both groundwater and deeper soil water (>375 cm). However, differences in water acquisition patterns between species were not found. The proportional similarity index (PSI) of proportional contribution to water uptake of different water resources between P. euphratica and T. ramosissima was calculated, and results showed that there was intense water resource competition between P. euphratica and T. ramosissima when grown at shallow groundwater depth (not more than 3.8 m), and the competition weakened when the groundwater depth increased to 7.2 m.

  2. Host plant quality of Tamarix ramosissima and T. parviflora for three sibling species of the biocontrol insect Diorhabda elongata (Coleoptera: Chrysomelidae). (United States)

    Dalin, Peter; O'Neal, Melissa J; Dudley, Tom; Bean, Daniel W


    Several sibling species of the leaf beetle Diorhabda elongata (Brullé) have been introduced into North America for the biocontrol of saltcedars (Tamarix spp.), but only one, D. carinulata (Desbrochers), has been extensively used in the field. The first open releases took place in 2001, and widespread defoliation occurred at sites infested by Tamarix ramosissima, T. chinensis, and their hybrid forms. The beetles failed, however, to establish at sites where other Tamarix species are targeted for control. In this study, we compared the preference and performance of three Diorhabda sibling species using adult choice and larval performance experiments on the two formally targeted Tamarix species: T. ramosissima and T. parviflora. In the adult choice experiment, a greater proportion of D. carinulata was found on T. ramosissima than on T. parviflora. For the other two sibling species, D. elongata (Brullé) and D. carinata (Faldermann), adults were found in similar proportions on the two host plants. In the larval performance experiment, larval growth and survival did not differ between Tamarix species for any Diorhabda type; however, D. carinata larval biomass was 35-50% greater than the other beetles regardless of host species. Based on the few adults of D. carinulata found on T. parviflora in the adult choice experiment, we do not recommend introducing this beetle at sites where T. parviflora is targeted for biological control. The species D. carinata seems especially promising for future release because its larvae gained substantially more biomass than the other beetles during the same time period on both Tamarix species.

  3. Genome-wide distribution comparative and composition analysis of the SSRs in Poaceae. (United States)

    Wang, Yi; Yang, Chao; Jin, Qiaojun; Zhou, Dongjie; Wang, Shuangshuang; Yu, Yuanjie; Yang, Long


    The Poaceae family is of great importance to human beings since it comprises the cereal grasses which are the main sources for human food and animal feed. With the rapid growth of genomic data from Poaceae members, comparative genomics becomes a convinent method to study genetics of diffierent species. The SSRs (Simple Sequence Repeats) are widely used markers in the studies of Poaceae for their high abundance and stability. In this study, using the genomic sequences of 9 Poaceae species, we detected 11,993,943 SSR loci and developed 6,799,910 SSR primer pairs. The results show that SSRs are distributed on all the genomic elements in grass. Hexamer is the most frequent motif and AT/TA is the most frequent motif in dimer. The abundance of the SSRs has a positive linear relationship with the recombination rate. SSR sequences in the coding regions involve a higher GC content in the Poaceae than that in the other species. SSRs of 70-80 bp in length showed the highest AT/GC base ratio among all of these loci. The result shows the highest polymorphism rate belongs to the SSRs ranged from 30 bp to 40 bp. Using all the SSR primers of Japonica, nineteen universal primers were selected and located on the genome of the grass family. The information of SSR loci, the SSR primers and the tools of mining and analyzing SSR are provided in the PSSRD (Poaceae SSR Database, Our study and the PSSRD database provide a foundation for the comparative study in the Poaceae and it will accelerate the study on markers application, gene mapping and molecular breeding.

  4. Nota sobre el género Imperata (Poaceae, Panicoideae, Sacchareae) en Argentina


    Peichoto, Myriam Carolina


    En este trabajo se confirma la presencia de Imperata tenuis en Argentina. Se presenta una ilustración, material de referencia y un mapa de su distribución geográfica en el sur de Sudamérica. Se incluye una clave para identificar las especies del género Imperata presentes en la Argentina. This work confirms the presence of Imperata tenuis in Argentina, and includes an illustration, reference material, a map showing its geographic distribution in southern South America, and a key to identi...

  5. Nota sobre EL GÉNERO Imperata (Poaceae, Panicoideae, Sacchareae en Argentina

    Directory of Open Access Journals (Sweden)

    Myriam C. Peichoto


    Full Text Available En este trabajo se confirma la presencia de Imperata tenuis en Argentina. Se presenta una ilustración, material de referencia y un mapa de su distribución geográfica en el sur de Sudamérica. Se incluye una clave para identificar las especies del género Imperata presentes en la Argentina.

  6. Building supertrees: an empirical assessment using the grass family (Poaceae). (United States)

    Salamin, Nicolas; Hodkinson, Trevor R; Savolainen, Vincent


    Large and comprehensive phylogenetic trees are desirable for studying macroevolutionary processes and for classification purposes. Such trees can be obtained in two different ways. Either the widest possible range of taxa can be sampled and used in a phylogenetic analysis to produce a "big tree," or preexisting topologies can be used to create a supertree. Although large multigene analyses are often favored, combinable data are not always available, and supertrees offer a suitable solution. The most commonly used method of supertree reconstruction, matrix representation with parsimony (MRP), is presented here. We used a combined data set for the Poaceae to (1) assess the differences between an approach that uses combined data and one that uses different MRP modifications based on the character partitions and (2) investigate the advantages and disadvantages of these modifications. Baum and Ragan and Purvis modifications gave similar results. Incorporating bootstrap support associated with pre-existing topologies improved Baum and Ragan modification and its similarity with a combined analysis. Finally, we used the supertree reconstruction approach on 55 published phylogenies to build one of most comprehensive phylogenetic trees published for the grass family including 403 taxa and discuss its strengths and weaknesses in relation to other published hypotheses.

  7. Anther and pollen development in some species of Poaceae (Poales

    Directory of Open Access Journals (Sweden)

    AT. Nakamura

    Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.

  8. Late Cretaceous origin of the rice tribe provides evidence for early diversification in Poaceae. (United States)

    Prasad, V; Strömberg, C A E; Leaché, A D; Samant, B; Patnaik, R; Tang, L; Mohabey, D M; Ge, S; Sahni, A


    Rice and its relatives are a focal point in agricultural and evolutionary science, but a paucity of fossils has obscured their deep-time history. Previously described cuticles with silica bodies (phytoliths) from the Late Cretaceous period (67-65 Ma) of India indicate that, by the latest Cretaceous, the grass family (Poaceae) consisted of members of the modern subclades PACMAD (Panicoideae-Aristidoideae-Chloridoideae-Micrairoideae-Arundinoideae-Danthonioideae) and BEP (Bambusoideae-Ehrhartoideae-Pooideae), including a taxon with proposed affinities to Ehrhartoideae. Here we describe additional fossils and show that, based on phylogenetic analyses that combine molecular genetic data and epidermal and phytolith features across Poaceae, these can be assigned to the rice tribe, Oryzeae, of grass subfamily Ehrhartoideae. The new Oryzeae fossils suggest substantial diversification within Ehrhartoideae by the Late Cretaceous, pushing back the time of origin of Poaceae as a whole. These results, therefore, necessitate a re-evaluation of current models for grass evolution and palaeobiogeography.

  9. Potential biological control agents for management of cogongrass (Cyperales: Poaceae) in the southeastern USA (United States)

    Cogongrass, Imperata cylindrica (L.) Palisot de Beauvois (Cyperales: Poaceae), is a noxious invasive weed in the southeastern USA. Surveys for potential biological control agents of cogongrass were conducted in Asia and East Africa from 2013 to 2016. Several insect herbivores were found that may hav...

  10. Desenvolvimento pós-seminal de espécies de Poaceae (Poales Post-seminal development of Poaceae species (Poales

    Directory of Open Access Journals (Sweden)

    Adriana Tiemi Nakamura


    Full Text Available O presente estudo objetivou verificar a existência de um padrão do desenvolvimento pós-seminal em Poaceae. Para tanto, foram estudadas as seguintes espécies: Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae. Procurou-se também comparar as estruturas da plântula de Poaceae com as demais monocotiledôneas. As espécies estudadas são plantas perenes, rizomatosas, cespitosas e apresentam cariopses de tamanhos diferentes. Apresentam sementes albuminosas; embrião lateral, diferenciado, com raiz endógena (adventícia; cotilédone dividido em hiperfilo (escutelo, bainha reduzida e hipofilo (coleóptilo; coleorriza (raiz primária reduzida e mesocótilo (eixo localizado entre o escutelo e coleóptilo. A presença de epiblasto (folha embrionária foi observada em Olyra humilis, Chloris elata e Eragrostis solida. O desenvolvimento pós-seminal é semelhante nas espécies estudadas e forma um padrão em Poaceae. Primeiramente, observa-se a emissão da coleorriza, que cresce no sentido geotrópico positivo, seguida do coleóptilo e plúmula que crescem em sentido contrário, a partir do desenvolvimento do mesocótilo. As primeiras folhas são semelhantes às folhas definitivas (metafilos das espécies, exceto em Olyra humilis, que são modificadas em catafilos e podem ser interpretadas como caráter basal em Bambusoideae. Raiz primária reduzida (coleorriza e hipofilo modificado em coleóptilo são considerados caracteres derivados em Poaceae, quando comparados com as demais monocotiledôneas.This work has aimed to verify the existence of a pattern of the post-seminal development in Poaceae. Thus, Olyra humilis Nees (Bambusoideae; Axonopus aureus P. Beauv. e Paspalum polyphyllum Nees ex Trin. (Panicoideae; Chloris elata Nees e Eragrostis solida Desv. (Chloridoideae have been studied. Besides, it was compared the structures of

  11. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae) (United States)

    Wesseling, Anne-Maria; Demetrowitsch, Tobias J.; Schwarz, Karin; Ober, Dietrich


    Pyrrolizidine alkaloids (PAs) are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae). Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae). In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid. PMID:29250094

  12. Variability of Pyrrolizidine Alkaloid Occurrence in Species of the Grass Subfamily Pooideae (Poaceae

    Directory of Open Access Journals (Sweden)

    Anne-Maria Wesseling


    Full Text Available Pyrrolizidine alkaloids (PAs are a class of secondary metabolites found in various unrelated angiosperm lineages including cool-season grasses (Poaceae, subfamily Pooideae. Thesinine conjugates, saturated forms of PA that are regarded as non-toxic, have been described to occur in the two grass species Lolium perenne and Festuca arundinacea (Poaceae, subfamily Pooideae. In a wider screen, we tested various species of the Pooideae lineage, grown under controlled conditions, for their ability to produce thesinine conjugates or related structures. Using an LC-MS based targeted metabolomics approach we were able to show that PA biosynthesis in grasses is limited to a group of very closely related Pooideae species that produce a limited diversity of PA structures. High variability in PA levels was observed even between individuals of the same species. These individual accumulation patterns are discussed with respect to a possible function and evolution of this type of alkaloid.

  13. Novedades nomenclaturales en Cenchrus s.l. (Poaceae: Panicoideae: Paniceae)


    Gutiérrez, Hugo F; Morrone, Osvaldo


    Recientes estudios filogenéticos con datos morfológicos y moleculares aportaron evidencia sobre la monofilia de los géneros Cenchrus, Pennisetum y Odontelytrum y, por ello, se propuso su unificación y transferencia a Cenchrus, el cual tiene prioridad. Resultados preliminares de la revisión taxonómica del género Cenchrus s.l. para América (Gutiérrez, en preparación) permitieron detectar problemas nomenclaturales. Para resolver dichos inconvenientes, en el presente trabajo se presentan nueve le...

  14. A 250 plastome phylogeny of the grass family (Poaceae): topological support under different data partitions (United States)

    Burke, Sean V.; Wysocki, William P.; Clark, Lynn G.


    The systematics of grasses has advanced through applications of plastome phylogenomics, although studies have been largely limited to subfamilies or other subgroups of Poaceae. Here we present a plastome phylogenomic analysis of 250 complete plastomes (179 genera) sampled from 44 of the 52 tribes of Poaceae. Plastome sequences were determined from high throughput sequencing libraries and the assemblies represent over 28.7 Mbases of sequence data. Phylogenetic signal was characterized in 14 partitions, including (1) complete plastomes; (2) protein coding regions; (3) noncoding regions; and (4) three loci commonly used in single and multi-gene studies of grasses. Each of the four main partitions was further refined, alternatively including or excluding positively selected codons and also the gaps introduced by the alignment. All 76 protein coding plastome loci were found to be predominantly under purifying selection, but specific codons were found to be under positive selection in 65 loci. The loci that have been widely used in multi-gene phylogenetic studies had among the highest proportions of positively selected codons, suggesting caution in the interpretation of these earlier results. Plastome phylogenomic analyses confirmed the backbone topology for Poaceae with maximum bootstrap support (BP). Among the 14 analyses, 82 clades out of 309 resolved were maximally supported in all trees. Analyses of newly sequenced plastomes were in agreement with current classifications. Five of seven partitions in which alignment gaps were removed retrieved Panicoideae as sister to the remaining PACMAD subfamilies. Alternative topologies were recovered in trees from partitions that included alignment gaps. This suggests that ambiguities in aligning these uncertain regions might introduce a false signal. Resolution of these and other critical branch points in the phylogeny of Poaceae will help to better understand the selective forces that drove the radiation of the BOP and PACMAD

  15. Two New Records from Lebanon: Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae)


    HABER, Ricardus M.; SEMAAN, Myrna T.


    Chamaesyce nutans (Lag.) Small (Euphorbiaceae) and Eleusine indica (L.) Gaertner (Poaceae) are described as new records for the flora of Lebanon. Specimens of C. nutans collected from roadsides and rocks in a middle mountain forest confirm the occurrence of the species on the western slopes of the Mount Lebanon Range. Additionally, specimens of E. indica were collected from wasteland and roadsides in the coastal town of Kaslik. The species were observed to thrive abundantly in similar habitat...

  16. Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae) para la Flora Argentina


    Ana María Cialdella


    Durante la revisión de los géneros de Stipeae (Poaceae) para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P...

  17. Assessing universality of DNA barcoding in geographically isolated selected desert medicinal species of Fabaceae and Poaceae (United States)

    Hussain, Fatma; Ahmed, Nisar; Ghorbani, Abdolbaset


    In pursuit of developing fast and accurate species-level molecular identification methods, we tested six DNA barcodes, namely ITS2, matK, rbcLa, ITS2+matK, ITS2+rbcLa, matK+rbcLa and ITS2+matK+rbcLa, for their capacity to identify frequently consumed but geographically isolated medicinal species of Fabaceae and Poaceae indigenous to the desert of Cholistan. Data were analysed by BLASTn sequence similarity, pairwise sequence divergence in TAXONDNA, and phylogenetic (neighbour-joining and maximum-likelihood trees) methods. Comparison of six barcode regions showed that ITS2 has the highest number of variable sites (209/360) for tested Fabaceae and (106/365) Poaceae species, the highest species-level identification (40%) in BLASTn procedure, distinct DNA barcoding gap, 100% correct species identification in BM and BCM functions of TAXONDNA, and clear cladding pattern with high nodal support in phylogenetic trees in both families. ITS2+matK+rbcLa followed ITS2 in its species-level identification capacity. The study was concluded with advocating the DNA barcoding as an effective tool for species identification and ITS2 as the best barcode region in identifying medicinal species of Fabaceae and Poaceae. Current research has practical implementation potential in the fields of pharmaco-vigilance, trade of medicinal plants and biodiversity conservation. PMID:29576968

  18. New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela New records of the Genus Festuca L. (Poaceae for Colombia and Venezuela

    Directory of Open Access Journals (Sweden)

    Stancik Daniel


    Full Text Available The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.The genus Festuca L. (Poaceae includes about 350-400 herbaceous species with wide cosmopolitan distribution (Watson & Dallwitz 1992. The center of distribution ofthe genus is in the meadows and steppes of North America and Eurasia. Sorne species are present in Australia, Tasmania, New Zealand, and W and SE Africa. High species diversity is found in the pampas of Argentina and the puna of the Andes, with approximately 40 species in Peru (Tovar 1993,30 in Bolivia (Renvoize 1998, and 30 in Argentina (Türpe 1969. So far, 26 native species are known from the páramos of the northern South America; about seven new species from this region will be described soon (author's unpublished data.

  19. Sinopse das espécies nativas e subespontâneas de Andropogoneae Dumort. (Poaceae na Ilha de Santa Catarina, Brasil A synopsis of the Andropogoneae Dumort. (Poaceae native and subspontaneous to the Island of Santa Catarina, Florianópolis, SC, Brazil

    Directory of Open Access Journals (Sweden)

    Bárbara Toncic Neves


    Full Text Available O presente trabalho consiste no levantamento dos táxons da tribo Andropogoneae (Panicoideae - Poaceae ocorrentes na Ilha de Santa Catarina, Florianópolis, Brasil. A partir da revisão de materiais de herbários e coletas a campo foi confirmada a ocorrência de 10 gêneros e 20 espécies, 17 nativas e duas subespontâneas: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 e Sorghum Moench (1. Os gêneros Bothriochloa e Rhytachne são registrados pela primeira vez para a Ilha de Santa Catarina. São apresentadas chaves de identificação para gêneros e espécies, ilustrações, informações sobre distribuição geográfica, habitat, período de floração e comentários para cada táxon.The present work is a survey of the taxa in the tribe Andropogoneae (Panicoideae - Poaceae that occur on the Island of Santa Catarina, Florianópolis, Brazil. Based on a review of herbarium specimens and fieldwork, 20 species were recorded in the following 10 genera: Andropogon L. (7 spp., Bothriochloa Kuntze (2, Eriochrysis P. Beauv. (1, Hyparrhenia Andersson ex E. Fourn. (1, Imperata Cirillo (1, Ischaemum L. (1, Rhytachne Desv. (1, Saccharum L. (3, Schizachyrium Nees (2 and Sorghum Moench (1. Seventeen of the species are native, and two species are subspontaneous. Bothriochloa and Rhytachne are recorded here, for the first time, for the Island of Santa Catarina. This work provides key to the genera and species, as well as illustrations, information about geographic distribution, habitat, phenology, and comments about each taxon presented in the study.

  20. Scanning electron microscopy of the leaf epidermis of Merostachys Spreng. (Poaceae: Bambusoideae Microscopia eletrônica de varredura da epiderme foliar de Merostachys Spreng. (Poaceae: Bambusoideae

    Directory of Open Access Journals (Sweden)

    Doria Maria Saiter Gomes


    Full Text Available This study presents data on leaf micromorphology of 13 species of Merostachys Spreng. (Poaceae: Bambusoideae, a neotropical genus with numerous endemic species. Greatest species richness is found in Central and Southern Brazil, with 41 of the 46 species described. Species were collected in the field at the localities: Itatiaia National Park and Tijuca National Park, Rio de Janeiro State; Fontes do Ipiranga State Park, São Paulo state; Santa Teresa, Espírito Santo State and Rio Doce State Park, Minas Gerais State. Dried plant material came from the herbarium at the São Paulo Botany Institute. The presence of prickles, silica bodies and macro hairs may be especially useful in delimiting species.São apresentados dados relativos à micromorfologia foliar de 13 espécies de Merostachys Spreng. (Poaceae:Bambusoideae, um gênero neotropical, com numerosas espécies endêmicas, que tem sua maior diversidade nas regiões central e sul do Brasil, onde ocorrem 41 das 46 espécies descritas. O material coletado foi obtido nas seguintes localidades: Parque Nacional do Itatiaia e Parque Nacional da Tijuca (RJ; Parque Estadual das Fontes do Ipiranga (SP; Propriedade dos Irmãos Martinelli, Vargem Alta, Santa Teresa (ES e Parque Estadual do Rio Doce (MG. As espécies herborizadas são provenientes do herbário do Instituto de Botânica de São Paulo (SP. Atenção especial é dada à presença de cerdas, corpúsculos silicosos e macropêlos, características que podem ser úteis na delimitação das espécies.

  1. Poaceae vs. Abiotic Stress: Focus on Drought and Salt Stress, Recent Insights and Perspectives

    Directory of Open Access Journals (Sweden)

    Simone Landi


    Full Text Available Poaceae represent the most important group of crops susceptible to abiotic stress. This large family of monocotyledonous plants, commonly known as grasses, counts several important cultivated species, namely wheat (Triticum aestivum, rice (Oryza sativa, maize (Zea mays, and barley (Hordeum vulgare. These crops, notably, show different behaviors under abiotic stress conditions: wheat and rice are considered sensitive, showing serious yield reduction upon water scarcity and soil salinity, while barley presents a natural drought and salt tolerance. During the green revolution (1940–1960, cereal breeding was very successful in developing high-yield crops varieties; however, these cultivars were maximized for highest yield under optimal conditions, and did not present suitable traits for tolerance under unfavorable conditions. The improvement of crop abiotic stress tolerance requires a deep knowledge of the phenomena underlying tolerance, to devise novel approaches and decipher the key components of agricultural production systems. Approaches to improve food production combining both enhanced water use efficiency (WUE and acceptable yields are critical to create a sustainable agriculture in the future. This paper analyzes the latest results on abiotic stress tolerance in Poaceae. In particular, the focus will be directed toward various aspects of water deprivation and salinity response efficiency in Poaceae. Aspects related to cell wall metabolism will be covered, given the importance of the plant cell wall in sensing environmental constraints and in mediating a response; the role of silicon (Si, an important element for monocots' normal growth and development, will also be discussed, since it activates a broad-spectrum response to different exogenous stresses. Perspectives valorizing studies on landraces conclude the survey, as they help identify key traits for breeding purposes.

  2. Characterization of polymorphic microsatellites for the invasive grass Microstegium vimineum (Poaceae). (United States)

    Novy, Ari; Flory, S Luke; Honig, Joshua A; Bonos, Stacy; Hartman, Jean Marie


    Microsatellite markers were developed for the invasive plant Microstegium vimineum (Poaceae) to assess its population structure and to facilitate tracking of invasion expansion. Using 454 sequencing, 11 polymorphic and six monomorphic microsatellite primer sets were developed for M. vimineum. The primer sets were tested on individuals sampled from six populations in the United States and China. The polymorphic primers amplified di-, tri-, and tetranucleotide repeats with three to 10 alleles per locus. These markers will be useful for a variety of applications including tracking of invasion dynamics and population genetics studies.

  3. Cross-species amplification of 105 Lolium perenne SSR loci in 23 species within the Poaceae

    DEFF Research Database (Denmark)

    Jensen, Louise Bach; Holm, Preben Bach; Lübberstedt, Thomas


    Amplification of 105 Lolium perenne SSR markers was studied in 23 grass species representing seven tribes from three subfamilies of Poaceae. Twelve of the SSR markers are published for the first time. Between 2% and 96% of the SSR markers could be amplified within a given species. A subset of eight...... SSR markers was evaluated for polymorphism across nine of the 23 grass species. Four to seven of the markers were polymorphic within each species, with an average detection of 2.4 alleles per species....

  4. Novedades nomenclaturales en la tribu Stipeae (Poaceae, Pooideae para la Flora Argentina

    Directory of Open Access Journals (Sweden)

    Ana María Cialdella


    Full Text Available Durante la revisión de los géneros de Stipeae (Poaceae para la flora argentina y de acuerdo a los últimos estudios filogenéticos en la tribu, se confirmó la necesidad de transferir algunos taxones recientemente descriptos de Stipa a Nassella, Jarava o Pappostipa. En este trabajo se presentan 12 nuevas combinaciones: Jarava ichu var. pungens, Nassella brachyglumis, N. macrotricha, Pappostipa arenicola, P. choconensis, P. colloncurensis, P. frigida var. longifolia, P. jucunda, P. kieslingii, P. mapuche, P. marqueziana y P. zulmae. Se incluye también una clave para identificar los géneros de Stipeae en la Argentina.

  5. Phalaris canariensis L. (Poaceae: A new alien plant record for Kashmir Himalaya, India

    Directory of Open Access Journals (Sweden)

    Shugufta Rasheed


    Full Text Available The correct taxonomic identification assumes first and foremost priority in the scientific documentation of biodiversity. The Kashmir Himalaya, located in the north-western side of the Himalayan biodiversity hotspot, is well-known for its diverse flora which merits immediate scientific documentation. In this context, the present study reports Phalaris canariensis L. (Poaceae as a new alien plant record to the flora of Kashmir Himalaya, India. In this paper, a detailed description, photographs, and comparison of diagnostic characters with allied species are provided to scientifically validate this alien plant record for this Himalayan region.

  6. A new species of Rhopalosiphum (Hemiptera, Aphididae) on Chusquea tomentosa (Poaceae, Bambusoideae) from Costa Rica (United States)

    Hidalgo, Nicolás Pérez; Martínez-Torres, David; Collantes-Alegre, Jorge Mariano; Muller, William Villalobos; Nafría, Juan M. Nieto


    Abstract The new species Rhopalosiphum chusqueae Pérez Hidalgo & Villalobos Muller, is described from apterous viviparous females caught on Chusquea tomentosa in Cerro de la Muerte (Costa Rica). The identity of the species is supported both by the morphological features and by a molecular phylogenetic analysis based on a fragment of the mitochondrial DNA containing the 5’ region of the cytochrome c oxidase 1 (COI) and on the nuclear gene coding for the Elongation factor-1 alpha (EF1α). The taxonomic position of the new species is discussed. An identification key to the Aphidinae species living on plants of Bambusoideae (Poaceae) is presented. PMID:22328859

  7. Utilizing remote sensing to supplement ground monitoring of Diorhabda elongata as a control agent for Tamarix ramosissima in Dinosaur National Monument (United States)

    Archambault, V.; Auch, J.; Landy, J.; Rudy, G.; Seifert, C.; Schmidt, C.; Skiles, J.


    The plant Tamarix ramosissima has invaded significant riparian habitat along the Green River in Dinosaur National Monument. Commonly known as salt cedar or tamarisk, it was introduced from Eurasia to the Southwestern United States to prevent soil erosion along riverbanks and as an ornamental plant. It has since come to affect water resources, recreation, wildlife, and ecosystem services. Various methods used to control tamarisk's spread have had moderate success but have drained National Park Service of human and monetary resources. In June 2006, the salt cedar leaf beetle (Diorhabda elongata) was released as a biological control agent within the park to defoliate and ultimately eradicate the invasive species. This study examines the efficacy of using Landsat TM imagery to supplement ground monitoring of the beetle's spread and its effects on tamarisk in Dinosaur National Monument, and discusses the development of a GIS model to predict annual change in tamarisk cover and beetle populations. Through fieldwork, we determined four areas of interest with favorable attributes for satellite detection. A change detection model was created by layering 2005-2008 data and quantifying mean NDVI. Results show that intra-year NDVI trends may be more effective for accurate detection than single-image year-to-year comparisons largely because intra-year environmental variability is significantly smaller. Additionally, our GIS model predicted significant growth of beetle population, implying that defoliation will become more apparent in future years. However, challenges to detecting this defoliation include the year-to-year variability of environmental factors, low spatial resolution of Landsat TM data, low visibility into parts of the Green River canyon, and the spectral mixing of tamarisk and native vegetation.

  8. Reconstructing the Evolutionary History of Paralogous APETALA1/FRUITFULL-Like Genes in Grasses (Poaceae) (United States)

    Preston, Jill C.; Kellogg, Elizabeth A.


    Gene duplication is an important mechanism for the generation of evolutionary novelty. Paralogous genes that are not silenced may evolve new functions (neofunctionalization) that will alter the developmental outcome of preexisting genetic pathways, partition ancestral functions (subfunctionalization) into divergent developmental modules, or function redundantly. Functional divergence can occur by changes in the spatio-temporal patterns of gene expression and/or by changes in the activities of their protein products. We reconstructed the evolutionary history of two paralogous monocot MADS-box transcription factors, FUL1 and FUL2, and determined the evolution of sequence and gene expression in grass AP1/FUL-like genes. Monocot AP1/FUL-like genes duplicated at the base of Poaceae and codon substitutions occurred under relaxed selection mostly along the branch leading to FUL2. Following the duplication, FUL1 was apparently lost from early diverging taxa, a pattern consistent with major changes in grass floral morphology. Overlapping gene expression patterns in leaves and spikelets indicate that FUL1 and FUL2 probably share some redundant functions, but that FUL2 may have become temporally restricted under partial subfunctionalization to particular stages of floret development. These data have allowed us to reconstruct the history of AP1/FUL-like genes in Poaceae and to hypothesize a role for this gene duplication in the evolution of the grass spikelet. PMID:16816429

  9. Complete plastid genome sequence of goosegrass (Eleusine indica) and comparison with other Poaceae. (United States)

    Zhang, Hui; Hall, Nathan; McElroy, J Scott; Lowe, Elijah K; Goertzen, Leslie R


    Eleusine indica, also known as goosegrass, is a serious weed in at least 42 countries. In this paper we report the complete plastid genome sequence of goosegrass obtained by de novo assembly of paired-end and mate-paired reads generated by Illumina sequencing of total genomic DNA. The goosegrass plastome is a circular molecule of 135,151bp in length, consisting of two single-copy regions separated by a pair of inverted repeats (IRs) of 20,919 bases. The large (LSC) and the small (SSC) single-copy regions span 80,667 bases and 12,646 bases, respectively. The plastome of goosegrass has 38.19% GC content and includes 108 unique genes, of which 76 are protein-coding, 28 are transfer RNA, and 4 are ribosomal RNA. The goosegrass plastome sequence was compared to eight other species of Poaceae. Although generally conserved with respect to Poaceae, this genomic resource will be useful for evolutionary studies within this weed species and the genus Eleusine. Copyright © 2016. Published by Elsevier B.V.

  10. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz


    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  11. Poaceae: Triticeae

    Indian Academy of Sciences (India)

    Department of Bioengineering and Biotechnology, Qingdao University of Science and Technology, Qingdao, Shandong ... entire chloroplast DNA sequence of common wheat (T. aes- ... a CTAB method as previously described by Liu et al.

  12. Poaceae: Paniceae

    Indian Academy of Sciences (India)

    1987; Bernini and Marin-Morales. 2001; Mendes-Bonato et al. 2002, 2006; Utsunomiya et al. 2005). More recently, a new number, x = 6, was determined for several accessions of B. dictyoneura (Risso-Pascotto et al. 2006), a species suggested to belong to the same agamic complex as B. humidicola (Renvoize et al. 1996).

  13. Development of Simple Sequence Repeats (SSR) markers in Setaria italica (Poaceae) and cross-amplification in related species. (United States)

    Lin, Heng-Sheng; Chiang, Chih-Yun; Chang, Song-Bin; Kuoh, Chang-Sheng


    Foxtail millet is one of the world's oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR) markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21%) and CAT (46.15%). The average number of alleles (N(a)), the average heterozygosities observed (H(o)) and expected (H(e)) are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

  14. Development of Simple Sequence Repeats (SSR Markers in Setaria italica (Poaceae and Cross-Amplification in Related Species

    Directory of Open Access Journals (Sweden)

    Chih-Yun Chiang


    Full Text Available Foxtail millet is one of the world’s oldest cultivated crops. It has been adopted as a model organism for providing a deeper understanding of plant biology. In this study, 45 simple sequence repeats (SSR markers of Setaria italica were developed. These markers showing polymorphism were screened in 223 samples from 12 foxtail millet populations around Taiwan. The most common dinucleotide and trinucleotide repeat motifs are AC/TG (84.21% and CAT (46.15%. The average number of alleles (Na, the average heterozygosities observed (Ho and expected (He are 3.73, 0.714, 0.587, respectively. In addition, 24 SSR markers had shown transferability to six related Poaceae species. These new markers provide tools for examining genetic relatedness among foxtail millet populations and other related species. It is suitable for germplasm management and protection in Poaceae.

  15. Molecular, phylogenetic and comparative genomic analysis of the cytokinin oxidase/dehydrogenase gene family in the Poaceae. (United States)

    Mameaux, Sabine; Cockram, James; Thiel, Thomas; Steuernagel, Burkhard; Stein, Nils; Taudien, Stefan; Jack, Peter; Werner, Peter; Gray, John C; Greenland, Andy J; Powell, Wayne


    The genomes of cereals such as wheat (Triticum aestivum) and barley (Hordeum vulgare) are large and therefore problematic for the map-based cloning of agronomicaly important traits. However, comparative approaches within the Poaceae permit transfer of molecular knowledge between species, despite their divergence from a common ancestor sixty million years ago. The finding that null variants of the rice gene cytokinin oxidase/dehydrogenase 2 (OsCKX2) result in large yield increases provides an opportunity to explore whether similar gains could be achieved in other Poaceae members. Here, phylogenetic, molecular and comparative analyses of CKX families in the sequenced grass species rice, brachypodium, sorghum, maize and foxtail millet, as well as members identified from the transcriptomes/genomes of wheat and barley, are presented. Phylogenetic analyses define four Poaceae CKX clades. Comparative analyses showed that CKX phylogenetic groupings can largely be explained by a combination of local gene duplication, and the whole-genome duplication event that predates their speciation. Full-length OsCKX2 homologues in barley (HvCKX2.1, HvCKX2.2) and wheat (TaCKX2.3, TaCKX2.4, TaCKX2.5) are characterized, with comparative analysis at the DNA, protein and genetic/physical map levels suggesting that true CKX2 orthologs have been identified. Furthermore, our analysis shows CKX2 genes in barley and wheat have undergone a Triticeae-specific gene-duplication event. Finally, by identifying ten of the eleven CKX genes predicted to be present in barley by comparative analyses, we show that next-generation sequencing approaches can efficiently determine the gene space of large-genome crops. Together, this work provides the foundation for future functional investigation of CKX family members within the Poaceae. © 2011 National Institute of Agricultural Botany (NIAB). Plant Biotechnology Journal © 2011 Society for Experimental Biology, Association of Applied Biologists and Blackwell

  16. Complete chloroplast genome sequence of common bermudagrass (Cynodon dactylon (L.) Pers.) and comparative analysis within the family Poaceae. (United States)

    Huang, Ya-Yi; Cho, Shu-Ting; Haryono, Mindia; Kuo, Chih-Horng


    Common bermudagrass (Cynodon dactylon (L.) Pers.) belongs to the subfamily Chloridoideae of the Poaceae family, one of the most important plant families ecologically and economically. This grass has a long connection with human culture but its systematics is relatively understudied. In this study, we sequenced and investigated the chloroplast genome of common bermudagrass, which is 134,297 bp in length with two single copy regions (LSC: 79,732 bp; SSC: 12,521 bp) and a pair of inverted repeat (IR) regions (21,022 bp). The annotation contains a total of 128 predicted genes, including 82 protein-coding, 38 tRNA, and 8 rRNA genes. Additionally, our in silico analyses identified 10 sets of repeats longer than 20 bp and predicted the presence of 36 RNA editing sites. Overall, the chloroplast genome of common bermudagrass resembles those from other Poaceae lineages. Compared to most angiosperms, the accD gene and the introns of both clpP and rpoC1 genes are missing. Additionally, the ycf1, ycf2, ycf15, and ycf68 genes are pseudogenized and two genome rearrangements exist. Our phylogenetic analysis based on 47 chloroplast protein-coding genes supported the placement of common bermudagrass within Chloridoideae. Our phylogenetic character mapping based on the parsimony principle further indicated that the loss of the accD gene and clpP introns, the pseudogenization of four ycf genes, and the two rearrangements occurred only once after the most recent common ancestor of the Poaceae diverged from other monocots, which could explain the unusual long branch leading to the Poaceae when phylogeny is inferred based on chloroplast sequences.

  17. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae (United States)

    Fauteux, François; Strömvik, Martina V


    Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP) gene promoters from three plant families, namely Brassicaceae (mustards), Fabaceae (legumes) and Poaceae (grasses) using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L.) Heynh.), soybean (Glycine max (L.) Merr.) and rice (Oryza sativa L.) respectively. We have identified three conserved motifs (two RY-like and one ACGT-like) in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination of conserved motifs

  18. Seed storage protein gene promoters contain conserved DNA motifs in Brassicaceae, Fabaceae and Poaceae

    Directory of Open Access Journals (Sweden)

    Fauteux François


    Full Text Available Abstract Background Accurate computational identification of cis-regulatory motifs is difficult, particularly in eukaryotic promoters, which typically contain multiple short and degenerate DNA sequences bound by several interacting factors. Enrichment in combinations of rare motifs in the promoter sequence of functionally or evolutionarily related genes among several species is an indicator of conserved transcriptional regulatory mechanisms. This provides a basis for the computational identification of cis-regulatory motifs. Results We have used a discriminative seeding DNA motif discovery algorithm for an in-depth analysis of 54 seed storage protein (SSP gene promoters from three plant families, namely Brassicaceae (mustards, Fabaceae (legumes and Poaceae (grasses using backgrounds based on complete sets of promoters from a representative species in each family, namely Arabidopsis (Arabidopsis thaliana (L. Heynh., soybean (Glycine max (L. Merr. and rice (Oryza sativa L. respectively. We have identified three conserved motifs (two RY-like and one ACGT-like in Brassicaceae and Fabaceae SSP gene promoters that are similar to experimentally characterized seed-specific cis-regulatory elements. Fabaceae SSP gene promoter sequences are also enriched in a novel, seed-specific E2Fb-like motif. Conserved motifs identified in Poaceae SSP gene promoters include a GCN4-like motif, two prolamin-box-like motifs and an Skn-1-like motif. Evidence of the presence of a variant of the TATA-box is found in the SSP gene promoters from the three plant families. Motifs discovered in SSP gene promoters were used to score whole-genome sets of promoters from Arabidopsis, soybean and rice. The highest-scoring promoters are associated with genes coding for different subunits or precursors of seed storage proteins. Conclusion Seed storage protein gene promoter motifs are conserved in diverse species, and different plant families are characterized by a distinct combination

  19. Chemical composition and spasmolytic activity of Cymbopogon schoenanthus (L. Spreng. (Poaceae essential oil from Sudan

    Directory of Open Access Journals (Sweden)

    Pavlović Ivan


    Full Text Available The plants of genus Cymbopogon are well known for their use in traditional medicine and for their high content of essential oils that are widely used as flavoring agents, fragrances, cosmetics, and pharmaceuticals. Essential oils isolated from the dried stems and inflorescence of cultivated Cymbopogon schoenanthus (L. Spreng. (Poaceae collected from Khartoum state (Sudan in two periods were studied. The results of chemical analysis of C. schoenanthus revealed that this plant is rich in essential oil which is a valuable source of the commercially important monoterpene, piperitone (47.7-71.5%. Other abundant constituents of the oils were intermedeol (6.1-17.3%, δ-2-carene (4.5-10.0% and elemol (2.7-9.0%. The essential oil from the inflorescence was tested for spasmolytic activity using three different experimental models: against spontaneous contractions, contractions induced with acetylcholine and contractions induced with potassium chloride. The oil exhibited strong, significant and dose-dependent spasmolytic activity, indicating the possibility for further investigations of this essential oil for its medicinal purposes or application in food industry. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no.173021 and Grant no. III41018

  20. Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae) affected by environmental factors. (United States)

    Wang, Qiuxia; Liu, Huitao; Gao, Ainong; Yang, Xinming; Liu, Weihua; Li, Xiuquan; Li, Lihui


    Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae) are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng) J.L.Yang et al. (2n = 6x = 42, StStPPYY), collected from different environments, were studied using genome in situ hybridization (GISH). We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15%) and Y (22.22%), in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05). The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01). Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

  1. Morphology and anatomy of the diaspores and seedling of Paspalum (Poaceae, Poales

    Directory of Open Access Journals (Sweden)



    Full Text Available ABSTRACT The knowledge regarding of the diaspore and post-seminal development of Paspalum L. is important for grassland biodiversity conservation, based on their representativeness and genetic improvement of forage. The morphology of the diaspore and the post-seminal development of Paspalum dilatatum Poir. (rhizomatous, P. mandiocanum Trin. var. subaequiglume Barreto (stoloniferous, P. pumilum Nees. (decumbent caespitose and P. urvillei Steud. (erect caespitose was described to distinguish species with different growth forms and to survey the characters useful for taxonomy. P. dilatatum differs by presenting oval diaspores larger than the others, with five prominent nerves and trichomes; P. urvillei presents diaspores with one central nerve that is more developed than the two lateral nerves and trichomes; P. mandiocanum var. subaequiglume presents diaspores with trichomes only in the margin; and P. pumilum differs by presenting glabrous diaspores. The caryopsis involves the seed that presents the differentiated embryo and disposed laterally, an elliptical hilum in all of the studied species and a rostellum in P. dilatatum and P. mandiocanum var. subaequiglume. The post-seminal development is similar in the four species and begins with germination that is marked by the emergence of the coleorhiza, followed by the coleoptile. These characteristics are common to other Poaceae previously studied, indicating a pattern to the family and do not distinguish the growth forms.

  2. Intergenomic rearrangements after polyploidization of Kengyilia thoroldiana (Poaceae: Triticeae affected by environmental factors.

    Directory of Open Access Journals (Sweden)

    Qiuxia Wang

    Full Text Available Polyploidization is a major evolutionary process. Approximately 70-75% species of Triticeae (Poaceae are polyploids, involving 23 genomes. To investigate intergenomic rearrangements after polyploidization of Triticeae species and to determine the effects of environmental factors on them, nine populations of a typical polyploid Triticeae species, Kengyilia thoroldiana (Keng J.L.Yang et al. (2n = 6x = 42, StStPPYY, collected from different environments, were studied using genome in situ hybridization (GISH. We found that intergenomic rearrangements occurred between the relatively large P genome and the small genomes, St (8.15% and Y (22.22%, in polyploid species via various types of translocations compared to their diploid progenitors. However, no translocation was found between the relatively small St and Y chromosomes. Environmental factors may affect rearrangements among the three genomes. Chromosome translocations were significantly more frequent in populations from cold alpine and grassland environments than in populations from valley and lake-basin habitats (P<0.05. The relationship between types of chromosome translocations and altitude was significant (r = 0.809, P<0.01. Intergenomic rearrangements associated with environmental factors and genetic differentiation of a single basic genome should be considered as equally important genetic processes during species' ecotype evolution.

  3. Transcriptomic analysis, genic SSR development, and genetic diversity of proso millet (Panicum miliaceum; Poaceae). (United States)

    Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying


    Proso millet ( Panicum miliaceum ; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future.

  4. Transcriptomic analysis, genic SSR development, and genetic diversity of proso millet (Panicum miliaceum; Poaceae)1 (United States)

    Hou, Siyu; Sun, Zhaoxia; Li, Yaoshen; Wang, Yijie; Ling, Hubin; Xing, Guofang; Han, Yuanhuai; Li, Hongying


    Premise of the study: Proso millet (Panicum miliaceum; Poaceae) is a minor crop with good nutritional qualities and strong tolerance to drought stress and soil infertility. However, studies on genetic diversity have been limited due to a lack of efficient genetic markers. Methods: Illumina sequencing technology was used to generate short read sequences of proso millet, and de novo transcriptome assemblies were used to develop a de novo assembly of proso millet. Genic simple sequence repeat (SSR) markers were identified and used to detect polymorphism among 56 accessions. Population structure and genetic similarity coefficient were estimated. Results: In total, 25,341 unique gene sequences and 4724 SSR loci were obtained from the transcriptome, of which 229 pairs of SSR primers were validated, which resulted in 14 polymorphic genic SSR primers exhibiting 43 total alleles. According to the ratio of polymorphic markers (6.1%, 14/229), there are potentially 288 polymorphic genic SSR markers available for genetic assay development in the future. Bayesian population analyses showed that the 56 accessions comprised two distinct groups. Discussion: A genetic structure and cluster assay indicated that the accessions from the Loess Plateau of China shared a high genetic similarity coefficient with those from other regions and that there was no correlation between genetic diversity and geographic origin. The transcriptome sequencing data and millet-specific SSR markers developed in this study establish an excellent resource for gene discovery and may improve the development of breeding programs in proso millet in the future. PMID:28791202

  5. Radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage

    International Nuclear Information System (INIS)

    Satish Rao, B.S.; Upadhya, D.; Adiga, S.K.


    The exposure of humans to ionizing radiations may be advertently by routine diagnostic and therapeutic purposes or inadvertently during natural, occupational and nuclear accident situations. Therefore, in order to overcome the deleterious biological effects of radiation several chemical agents have been studied for their radioprotective potential. The medicinal plants being one of the resources for such clinically important natural agents, used extensively in several drug discovery related research. Here the radiomodulatory potential of hydroalcoholic extract of a medicinal plant Cynodon dactylon (Family: Poaceae), against radiation-induced cytogenetic damage was analyzed using Chinese hamster fibroblast cells (V79) and human peripheral blood lymphocytes (HPBLs) growing in vitro is reported

  6. Study of the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal


    Diop, Serigne Mbacké; Guèye, Momar Talla; Ndiaye, Ibrahima; Diop, Michel Bakar; Ndiaye, El Hadji Barka; Thiam, Abdoulaye; Fauconnier, Marie-Laure; Lognay, Georges


    This work aimed to study the chemical composition of essential oils and floral waters of Cymbopogon citratus (DC.) Stapf (Poaceae) from Senegal. The plants were collected in two different localities, Dakar and Kaolack. The extracts were obtained by steam distillation from both fresh and dried plants and analyses carried out by GC/FID and GC/MS. Oils from Dakar were dominated by geranial which represented 46.0-43.9%, neral 31.8-31.0%, myrcene 10.8-11.7% and geraniol 2.7-4.2% in the fresh and d...

  7. Phylogenomics and taxonomy of Lecomtelleae (Poaceae), an isolated panicoid lineage from Madagascar. (United States)

    Besnard, Guillaume; Christin, Pascal-Antoine; Malé, Pierre-Jean G; Coissac, Eric; Ralimanana, Hélène; Vorontsova, Maria S


    An accurate characterization of biodiversity requires analyses of DNA sequences in addition to classical morphological descriptions. New methods based on high-throughput sequencing may allow investigation of specimens with a large set of genetic markers to infer their evolutionary history. In the grass family, the phylogenetic position of the monotypic genus Lecomtella, a rare bamboo-like endemic from Madagascar, has never been appropriately evaluated. Until now its taxonomic treatment has remained controversial, indicating the need for re-evaluation based on a combination of molecular and morphological data. The phylogenetic position of Lecomtella in Poaceae was evaluated based on sequences from the nuclear and plastid genomes generated by next-generation sequencing (NGS). In addition, a detailed morphological description of L. madagascariensis was produced, and its distribution and habit were investigated in order to assess its conservation status. The complete plastid sequence, a ribosomal DNA unit and fragments of low-copy nuclear genes (phyB and ppc) were obtained. All phylogenetic analyses place Lecomtella as an isolated member of the core panicoids, which last shared a common ancestor with other species >20 million years ago. Although Lecomtella exhibits morphological characters typical of Panicoideae, an unusual combination of traits supports its treatment as a separate group. The study showed that NGS can be used to generate abundant phylogenetic information rapidly, opening new avenues for grass phylogenetics. These data clearly showed that Lecomtella forms an isolated lineage, which, in combination with its morphological peculiarities, justifies its treatment as a separate tribe: Lecomtelleae. New descriptions of the tribe, genus and species are presented with a typification, a distribution map and an IUCN conservation assessment.

  8. Cercosporoid fungi (Mycosphaerellaceae) 2. Species on monocots (Acoraceae to Xyridaceae, excluding Poaceae). (United States)

    Braun, Uwe; Crous, Pedro W; Nakashima, Chiharu


    Cercosporoid fungi (formerly Cercospora s. lat.) represent one of the largest groups of hyphomycetes belonging to the Mycosphaerellaceae (Ascomycota). They include asexual morphs, asexual holomorphs, or species with mycosphaerella-like sexual morphs. Most of them are leaf-spotting plant pathogens with special phytopathological relevance. In the first part of a new monographic work, cercosporoid hyphomycetes occurring on other fungi (fungicolous species), on ferns (pteridophytes) and gymnosperms were treated. This second part deals with cercosporoid fungi on monocots (Liliopsida; Equisetopsida, Magnoliidae, Lilianae), which covers species occurring on host plants belonging to families arranged in alphabetical order from Acoraceae to Xyridaceae, excluding Poaceae (cereals and grasses) which requires a separate treatment. The species are described and illustrated in alphabetical order under the particular cercosporoid genera, supplemented by keys to the species concerned. A detailed introduction, a survey of currently recognised cercosporoid genera, a key to the genera concerned, and a discussion of taxonomically relevant characters were published in the first part of this series. Neopseudocercospora, an additional recently introduced cercosporoid genus, is briefly discussed. The following taxonomic novelties are introduced: Cercospora alpiniigena sp. nov., C. neomaricae sp. nov., Corynespora palmicola comb. nov., Exosporium miyakei comb. nov., E. petersii comb. nov., Neopseudocercospora zambiensis comb. nov., Passalora caladiicola comb. nov., P. streptopi comb. nov., P. togashiana comb. nov., P. tranzschelii var. chinensis var. nov., Pseudocercospora beaucarneae comb. nov., P. constrictoflexuosa comb. et stat. nov., P. curcumicola sp. nov., P. dispori comb. nov., P. smilacicola sp. nov., P. urariigena nom. nov., Zasmidium agavicola comb. nov., Z. cercestidis-afzelii comb. nov., Z. citri-griseum comb. nov., Z. cyrtopodii comb. nov., Z. gahnae comb. nov., Z. indicum

  9. Acrapex azumai Sugi (Lepidoptera, Noctuidae) as a possible biological control agent of the invasive weed Imperata cylindrica (L.) Beauv. (Poaceae) in the United States (United States)

    Lepidopteran larvae were discovered boring in the basal stems of Imperata cylindrica (L.) Beauv. (Poaceae) in Itoshima city, Fukuoka Prefecture, Kyushu, Japan. Adults reared from these larvae were identified as Acrapex azumai Sugi (Lepidoptera: Noctuidae). Sequencing of the CO1 (cytochrome oxidase 1...

  10. Chloroplast phylogenomic analyses resolve deep-level relationships of an intractable bamboo tribe Arundinarieae (poaceae). (United States)

    Ma, Peng-Fei; Zhang, Yu-Xiao; Zeng, Chun-Xia; Guo, Zhen-Hua; Li, De-Zhu


    The temperate woody bamboos constitute a distinct tribe Arundinarieae (Poaceae: Bambusoideae) with high species diversity. Estimating phylogenetic relationships among the 11 major lineages of Arundinarieae has been particularly difficult, owing to a possible rapid radiation and the extremely low rate of sequence divergence. Here, we explore the use of chloroplast genome sequencing for phylogenetic inference. We sampled 25 species (22 temperate bamboos and 3 outgroups) for the complete genome representing eight major lineages of Arundinarieae in an attempt to resolve backbone relationships. Phylogenetic analyses of coding versus noncoding sequences, and of different regions of the genome (large single copy and small single copy, and inverted repeat regions) yielded no well-supported contradicting topologies but potential incongruence was found between the coding and noncoding sequences. The use of various data partitioning schemes in analysis of the complete sequences resulted in nearly identical topologies and node support values, although the partitioning schemes were decisively different from each other as to the fit to the data. Our full genomic data set substantially increased resolution along the backbone and provided strong support for most relationships despite the very short internodes and long branches in the tree. The inferred relationships were also robust to potential confounding factors (e.g., long-branch attraction) and received support from independent indels in the genome. We then added taxa from the three Arundinarieae lineages that were not included in the full-genome data set; each of these were sampled for more than 50% genome sequences. The resulting trees not only corroborated the reconstructed deep-level relationships but also largely resolved the phylogenetic placements of these three additional lineages. Furthermore, adding 129 additional taxa sampled for only eight chloroplast loci to the combined data set yielded almost identical

  11. Disentangling the effects of feedback structure and climate on Poaceae annual airborne pollen fluctuations and the possible consequences of climate change. (United States)

    García de León, David; García-Mozo, Herminia; Galán, Carmen; Alcázar, Purificación; Lima, Mauricio; González-Andújar, José L


    Pollen allergies are the most common form of respiratory allergic disease in Europe. Most studies have emphasized the role of environmental processes, as the drivers of airborne pollen fluctuations, implicitly considering pollen production as a random walk. This work shows that internal self-regulating processes of the plants (negative feedback) should be included in pollen dynamic systems in order to give a better explanation of the observed pollen temporal patterns. This article proposes a novel methodological approach based on dynamic systems to investigate the interaction between feedback structure of plant populations and climate in shaping long-term airborne Poaceae pollen fluctuations and to quantify the effects of climate change on future airborne pollen concentrations. Long-term historical airborne Poaceae pollen data (30 years) from Cordoba city (Southern Spain) were analyzed. A set of models, combining feedback structure, temperature and actual evapotranspiration effects on airborne Poaceae pollen were built and compared, using a model selection approach. Our results highlight the importance of first-order negative feedback and mean annual maximum temperature in driving airborne Poaceae pollen dynamics. The best model was used to predict the effects of climate change under two standardized scenarios representing contrasting temporal patterns of economic development and CO2 emissions. Our results predict an increase in pollen levels in southern Spain by 2070 ranging from 28.5% to 44.3%. The findings from this study provide a greater understanding of airborne pollen dynamics and how climate change might impact the future evolution of airborne Poaceae pollen concentrations and thus the future evolution of related pollen allergies. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. Digital signage sobre IP


    Casademont Filella, Albert


    Projecte que versa sobre el disseny i la implementació d'un sistema de Digital Signage (Cartelleria Digital) sobre IP, creant un gestor que permeti controlar de forma remota tot un conjunt de petits dispositius connectats a pantalles que emeten continguts multimèdia com vídeos, imatges, feeds rss...

  13. Simple Web-based interactive key development software (WEBiKEY) and an example key for Kuruna (Poaceae: Bambusoideae). (United States)

    Attigala, Lakshmi; De Silva, Nuwan I; Clark, Lynn G


    Programs that are user-friendly and freely available for developing Web-based interactive keys are scarce and most of the well-structured applications are relatively expensive. WEBiKEY was developed to enable researchers to easily develop their own Web-based interactive keys with fewer resources. A Web-based multiaccess identification tool (WEBiKEY) was developed that uses freely available Microsoft ASP.NET technologies and an SQL Server database for Windows-based hosting environments. WEBiKEY was tested for its usability with a sample data set, the temperate woody bamboo genus Kuruna (Poaceae). WEBiKEY is freely available to the public and can be used to develop Web-based interactive keys for any group of species. The interactive key we developed for Kuruna using WEBiKEY enables users to visually inspect characteristics of Kuruna and identify an unknown specimen as one of seven possible species in the genus.

  14. Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna

    Directory of Open Access Journals (Sweden)

    Anna Maria Mercuri


    Full Text Available Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change.

  15. Plant Responses to Climate Change: The Case Study of Betulaceae and Poaceae Pollen Seasons (Northern Italy, Vignola, Emilia-Romagna) (United States)

    Mercuri, Anna Maria; Torri, Paola; Fornaciari, Rita; Florenzano, Assunta


    Aerobiological data have especially demonstrated that there is correlation between climate warming and the pollination season of plants. This paper focuses on airborne pollen monitoring of Betulaceae and Poaceae, two of the main plant groups with anemophilous pollen and allergenic proprieties in Northern Italy. The aim is to investigate plant responses to temperature variations by considering long-term pollen series. The 15-year aerobiological analysis is reported from the monitoring station of Vignola (located near Modena, in the Emilia-Romagna region) that had operated in the years 1990–2004 with a Hirst spore trap. The Yearly Pollen Index calculated for these two botanical families has shown contrasting trends in pollen production and release. These trends were well identifiable but fairly variable, depending on both meteorological variables and anthropogenic causes. Based on recent reference literature, we considered that some oscillations in pollen concentration could have been a main effect of temperature variability reflecting global warming. The duration of pollen seasons of Betulaceae and Poaceae, depending on the different species included in each family, has not unequivocally been determined. Phenological responses were particularly evident in Alnus and especially in Corylus as a general moving up of the end of pollination. The study shows that these trees can be affected by global warming more than other, more tolerant, plants. The research can be a contribution to the understanding of phenological plant responses to climate change and suggests that alder and hazelnut trees have to be taken into high consideration as sensible markers of plant responses to climate change. PMID:27929423

  16. Global grass (Poaceae) success underpinned by traits facilitating colonization, persistence and habitat transformation. (United States)

    Linder, H P; Lehmann, Caroline E R; Archibald, Sally; Osborne, Colin P; Richardson, David M


    Poaceae (the grasses) is arguably the most successful plant family, in terms of its global occurrence in (almost) all ecosystems with angiosperms, its ecological dominance in many ecosystems, and high species richness. We suggest that the success of grasses is best understood in context of their capacity to colonize, persist, and transform environments (the "Viking syndrome"). This results from combining effective long-distance dispersal, efficacious establishment biology, ecological flexibility, resilience to disturbance and the capacity to modify environments by changing the nature of fire and mammalian herbivory. We identify a diverse set of functional traits linked to dispersal, establishment and competitive abilities. Enhanced long-distance dispersal is determined by anemochory, epizoochory and endozoochory and is facilitated via the spikelet (and especially the awned lemma) which functions as the dispersal unit. Establishment success could be a consequence of the precocious embryo and large starch reserves, which may underpin the extremely short generation times in grasses. Post-establishment genetic bottlenecks may be mitigated by wind pollination and the widespread occurrence of polyploidy, in combination with gametic self-incompatibility. The ecological competitiveness of grasses is corroborated by their dominance across the range of environmental extremes tolerated by angiosperms, facilitated by both C 3 and C 4 photosynthesis, well-developed frost tolerance in several clades, and a sympodial growth form that enabled the evolution of both annual and long-lived life forms. Finally, absence of investment in wood (except in bamboos), and the presence of persistent buds at or below ground level, provides tolerance of repeated defoliation (whether by fire, frost, drought or herbivores). Biotic modification of environments via feedbacks with herbivory or fire reinforce grass dominance leading to open ecosystems. Grasses can be both palatable and productive

  17. Chemical composition and cardiovascular effects induced by the essential oil of Cymbopogon citratus DC. Stapf, Poaceae, in rats Composição química e efeitos cardiovasculares do óleo essencial de Cymbopogon citratus DC. Stapf, Poaceae, em ratos

    Directory of Open Access Journals (Sweden)

    Flávia V. Moreira


    Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.C. citratus é utilizada na medicina popular para tratar hipertensão. Este trabalho investigou a composição química e os efeitos cardiovasculares do óleo essencial do C. citratus (OECC. Foram identificados oito constituintes no OECC, sendo geranial o majoritário (43,08%. Em ratos, o OECC (1, 5, 10 e 20 mg/kg, i.v. induziu hipotensão e bradicardia que foram atenuadas pela atropina e tiopental sódico, mas não por L-NAME ou indometacina. Em anéis de artéria mesentérica de ratos pré-contraídos com fenilefrina, o OECC (1 a 3000 µg/mL induziu relaxamento que não foi afetado após remoção do endotélio, após TEA ou em anéis pré-contraídos com KCl (80 mM. Além disso, o OECC (1000 µg/mL não induziu efeito adicional sobre o relaxamento máximo da nifedipina (10 µM. Em conclusão, o OECC induz hipotensão possivelmente devido à redução da resistência vascular que pode ser causada

  18. Apuntes sobre esporotricosis


    Londoño, Fabio


    Se hace una breve reseña histórica de las primeras comunicaciones sobre esporotricosis. Se destaca la amplia difusión de la enfermedad en nuestro país. 3. Se hace notar la no existencia de datos bibliográficos sobre formas extracutáneas. 4. Se llama la atención sobre la eficaz ayuda de la intradermo-reacción con esporotriquina en el diagnóstico de la enfermedad. 5- Se comunica un caso de esporotricosis verrugosa tratado con anfotericin B, con excelentes resultados

  19. Apuntes sobre esporotricosis

    Directory of Open Access Journals (Sweden)

    Fabio Londoño


    Full Text Available Se hace una breve reseña histórica de las primeras comunicaciones sobre esporotricosis. Se destaca la amplia difusión de la enfermedad en nuestro país. 3. Se hace notar la no existencia de datos bibliográficos sobre formas extracutáneas. 4. Se llama la atención sobre la eficaz ayuda de la intradermo-reacción con esporotriquina en el diagnóstico de la enfermedad. 5- Se comunica un caso de esporotricosis verrugosa tratado con anfotericin B, con excelentes resultados

  20. Muhlenbergia monandra (Poaceae: Eragrostideae, nueva especie anual endémica del Perú

    Directory of Open Access Journals (Sweden)

    J. José Alegría Olivera


    Full Text Available Se describe e ilustra Muhlenbergia monandra, endémica de Perú. La nueva especie se caracteriza por sus glumas mayores que el antecio, por tener inflorescencias espiciformes y las flores cleistógamas con un estambre. La anatomía foliar se describe e ilustra y se detallan sus caracteres diferenciales. Se incluyen observaciones sobre la epidermis de la lemma y las glumas realizadas con el Microscopio Electrónico de Barrido. Se discute la posición taxonómica de la nueva entidad y las diferencias con las especies anuales relacionadas que habitan en América del Sur

  1. Anti-methicillin-resistant Staphylococcus aureus (MRSA) activity of Rubiaceae, Fabaceae and Poaceae plants: A search for new sources of useful alternative antibacterials against MRSA infections. (United States)

    Sharifi-Rad, M; Iriti, M; Sharifi-Rad, M; Gibbons, S; Sharifi-Rad, J


    In this study, we evaluated the effects of the extracts of the leaves of species from the Rubiaceae (Galium aparine L. and Asperula arvensis L.), Fabaceae (Lathyrus aphaca L. and Vicia narbonensis L.) and Poaceae (Digitaria sanguinalis (L.) Scop. and Hordeum murinum L.) plant families on a wide and extensive panel of isolated methicillin-resistant Staphylococcus aureus strains (MRSA). The effects of the methanolic leaf extracts of Rubiaceae, Fabaceae and Poaceae plants on MRSA were evaluated by the disc diffusion assay and the broth dilution method. Among a total of 177 S. aureus isolates, 92 (51.97%) were found to be methicillin-resistant in an antibiogram and this was confirmed by the presence of the mecA gene in polymerase chain reaction method. All MRSA isolates were sensitive to all extracts. There were dose-dependent inhibitions on tested microorganisms for all plant extracts which showed maximum inhibition zones at a concentration of 300 mg/L. L. aphaca, G. aparine and H. murinum exhibited the highest antibacterial activity on the MRSA strains compared to the positive control (P Fabaceae), G. aparine (Rubiaceae), and H. murinum (Poaceae) proved to have high antibacterial activity on MRSA isolates, thus representing promising antimicrobial agents in clinical settings.

  2. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size. (United States)

    Yao, Peng-Cheng; Gao, Hai-Yan; Wei, Ya-Nan; Zhang, Jian-Hang; Chen, Xiao-Yong; Li, Hong-Qing


    Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  3. Anther and pollen development in some species of Poaceae (Poales Desenvolvimento da antera e do grão de pólen em espécies de Poaceae (Poales

    Directory of Open Access Journals (Sweden)

    AT. Nakamura


    Full Text Available Anther and pollen development were studied in Olyra humilis Nees, Sucrea monophylla Soderstr, (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees, and Chloris elata Desv. (Chloridoideae. The objective of this study was to characterise, embryologically, these species of subfamilies which are considered basal, intermediate and derivate, respectively. The species are similar to each other and to other Poaceae. They present the following characters: tetrasporangiate anthers; monocotyledonous-type anther wall development, endothecium showing annular thickenings, secretory tapetum; successive microsporogenesis; isobilateral tetrads; spheroidal, tricellular, monoporate pollen grains with annulus and operculum. Nevertheless, the exine patterns of the species studied are distinct. Olyra humilis and Sucrea monophylla (Bambusoideae show a granulose pattern, whereas in the other species, it is insular. In addition, Axonopus aureus and Paspalum polyphyllum (Panicoideae have a compactly insular spinule pattern, while Chloris elata and Eragrostis solida (Chloridoideae show a sparsely insular spinule pattern. The exine ornamentation may be considered an important feature at the infrafamiliar level.O desenvolvimento da antera e do grão de pólen de Olyra humilis Nees, Sucrea monophylla Soderstr. (Bambusoideae, Axonopus aureus P. Beauv., Paspalum polyphyllum Nees ex Trin. (Panicoideae, Eragrostis solida Nees and Chloris elata Desv. (Chloridoideae foi estudado visando caracterizar embriologicamente essas espécies de subfamílias consideradas basal, intermediária e derivada, respectivamente. As espécies são similares entre si e entre as demais Poaceae. Apresentam os seguintes caracteres: anteras tetrasporangiadas; desenvolvimento da parede da antera do tipo monocotiledôneo, endotécio com espessamento de parede anelar, tapete secretor; microsporogênese sucessiva; tétrades isobilaterais; grãos de

  4. Inferencias sobre Grafos


    Sira M. Allende; Carlos N. Bouza


    El estudio de un juego puede ser modelado asumiendo que solo algunas partidas son observadas. Entonces el árbol del juego debe ser estimado utilizando información muestral. Similarmente ocurre al obtener información sobre el comportamiento de las decisiones tomadas por individuos muestreados sobre un árbol de decisión teórico. Al considerar una medida de probabilidad que caracterice el comportamiento de redes aleatorias se puede obtener un estimado del árbol asociado. Este problema es el anal...

  5. Sobre software libre


    Matellán Olivera, Vicente; González Barahona, Jesús; Heras Quirós, Pedro de las; Robles Martínez, Gregorio


    220 p. "Sobre software libre" reune casi una treintena de ensayos sobre temas de candente actualidad relacionados con el software libre (del cual Linux es su ex- ponente más conocido). Los ensayos que el lector encontrará están divididos en bloques temáticos que van desde la propiedad intelectual o las cuestiones económicas y sociales de este modelo hasta su uso en la educación y las administraciones publicas, pasando por alguno que repasa la historia del software libre en l...

  6. Anatomía ecológica de algunas especies del género Paspalum (Poaceae, Panicoideae, Paniceae

    Directory of Open Access Journals (Sweden)

    Sandra S. Aliscioni


    Full Text Available Aliscioni, S. S. 2000. Anatomía ecológica de algunas especies del género Paspalum(Poaceae, Panicoideae, Paniceae. Darwiniana 38(3-4: 187-207.El género Paspalum L. presenta un elevado número de especies, con una amplia variabilidadmorfológica y una extensa distribución geográfica. Sus especies crecen en hábitats sumamente diversos,desde ambientes muy húmedos o acuáticos, a lugares secos de suelos arcillosos o arenosos, muchas vecessalinos. Dada la diversidad de ambientes en los que puede hallarse Paspalum, se estudiaron lascaracterísticas anatómico-foliares presentes en el género con la finalidad de interpretar diferentesestrategias adaptativas en distintas especies. Se presenta una descripción general de la anatomía foliar delgénero y se discuten ciertos caracteres anatómicos, interpretando su posible relación con las condicionesdel hábitat

  7. Black Rice (Oryza sativa L., Poaceae) Extract Reduces Hippocampal Neuronal Cell Death Induced by Transient Global Cerebral Ischemia in Mice. (United States)

    Hwang, Sun-Nyoung; Kim, Jae-Cheon; Bhuiyan, Mohammad Iqbal Hossain; Kim, Joo Youn; Yang, Ji Seon; Yoon, Shin Hee; Yoon, Kee Dong; Kim, Seong Yun


    Rice is the most commonly consumed grain in the world. Black rice has been suggested to contain various bioactive compounds including anthocyanin antioxidants. There is currently little information about the nutritional benefits of black rice on brain pathology. Here, we investigated the effects of black rice ( Oryza sativa L ., Poaceae) extract (BRE) on the hippocampal neuronal damage induced by ischemic insult. BRE (300 mg/kg) was orally administered to adult male C57BL/6 mice once a day for 21 days. Bilateral common carotid artery occlusion (BCCAO) was performed for 23 min on the 8th day of BRE or vehicle administration. Histological analyses conducted on the 22nd day of BRE or vehicle administration revealed that administering BRE profoundly attenuated neuronal cell death, inhibited reactive astrogliosis, and prevented loss of glutathione peroxidase expression in the hippocampus when compared to vehicle treatment. In addition, BRE considerably ameliorated BCCAO-induced memory impairment on the Morris water maze test from the 15th day to the 22nd day of BRE or vehicle administration. These results indicate that chronic administration of BRE is potentially beneficial in cerebral ischemia.

  8. Cytomorphological studies in some members of tribe Paniceae (Poaceae) from district Kangra of Himachal Pradesh (Western Himalayas). (United States)

    Kaur, H; Kumari, S; Gupta, R C


    The present paper deals with cytological studies on the population basis of 21 species belonging to 9 genera of tribe Paniceae of family Poaceae from cytologically unexplored area of Western Himalayas i.e. district Kangra of Himachal Pradesh for the assessment of genetic diversity of grass flora. On world-wide basis, the chromosome counts have been made for the first time for three species such as Brachiaria remota (n = 16), Digitaria granularis (n = 36) and Isachne albens (n = 5). Similarly, on India basis, altogether new records are made for two species such as Echinochloa cruspavonis (n = 27) and Paspalum distichum (2n = 50). A comparison of the different euploid cytotypes studied at present for Digitaria adscendens, D. setigera and Oplismenus compositus revealed significant variations in their morphology, depicting increase in some of the characters of polyploid cytotypes. The course of meiosis has been observed to be normal in all the studied populations with high pollen fertility except for two species such as Paspalum dilatatum and P. distichum marked with abnormal meiosis and reduced pollen fertility.

  9. Molecular analysis of the genera eremopyrum (ledeb). jaub. and spach and agropyron gaertner (poaceae) by pcr methods

    International Nuclear Information System (INIS)

    Yilmaz, R.; Cabi, E.; Dogan, M.


    RAPD-PCR (Random Amplified Polymorphic DNA Polymerase Chain Reaction) and Post PCR (Polymerase Chain Reaction) Melting Curve Analysis (MCA) have been used to investigate the pattern of genetic variation among some species in the genera Eremopyrum (Ledeb.) Jaub. and Spach and Agropyron Gaertner (Poaceae). Thirteen primers have been used in the study based on the RAPD-PCR and MCA analyses. Each species produced a distinct pattern of DNA fragments which have been used as a measure of the degree of relationship between species by means of using the RAPD-PCR results with three primers selected for identifying the genetic similarities. Polymorphic melting profiles have been obtained with Post PCR MCA method using three primers. Genetic similarities are calculated for all the species studied with RAPD-PCR and MCA methods, the dendrograms are obtained with the MVSP (Multi Variate Statistical Package) software using UPGMA (Unweighted Pair Group Method with Arithmetic Averages) and Jaccard's Coefficient. Polymorphism between 18 populations of Eremopyrum and 6 Agropyron populations and within the species are determined by using RAPD-PCR and Post PCR melting curve analysis (MCA) respectively. (author)

  10. Phylogeny of Eleusine (Poaceae: Chloridoideae) based on nuclear ITS and plastid trnT-trnF sequences. (United States)

    Neves, Susana S; Swire-Clark, Ginger; Hilu, Khidir W; Baird, Wm Vance


    Phylogenetic relationships in the genus Eleusine (Poaceae: Chloridoideae) were investigated using nuclear ITS and plastid trnT-trnF sequences. Separate and combined data sets were analyzed using parsimony, distance, and likelihood based methods, including Bayesian. Data congruence was examined using character and topological measures. Significant data heterogeneity was detected, but there was little conflict in the topological substructure measures for triplets and quartets, and resolution and clade support increased in the combined analysis. Data incongruence may be a result of noise and insufficient information in the slower evolving trnT-trnF. Monophyly of Eleusine is strongly supported in all analyses, but basal relationships in the genus remain uncertain. There is good support for a CAIK clade (E. coracana subsp. coracana and africana, E. indica, and E. kigeziensis), with E. tristachya as its sister group. Two putative ITS homeologues (A and B loci) were identified in the allotetraploid E. coracana; the 'B' locus sequence type was not found in the remaining species. Eleusine coracana and its putative 'A' genome donor, the diploid E. indica, are confirmed close allies, but sequence data contradicts the hypothesis that E. floccifolia is its second genome donor. The 'B' genome donor remains unidentified and may be extinct.

  11. Chemical composition and cardiovascular effects induced by the essential oil of Cymbopogon citratus DC. Stapf, Poaceae, in rats

    Directory of Open Access Journals (Sweden)

    Flávia V. Moreira


    Full Text Available Cymbopogon citratus DC. Stapf, Poaceae, is used in the folk medicine for hypertension treatment. This work investigated the chemical composition and cardiovascular effects in rats of C. citratus essential oil (EOCC. A phytochemical screening demonstrated the presence of eight constituents, being geranial the major compound (43.08%. In rats, EOCC (1, 5, 10, and 20 mg/kg, i.v. induced transient hypotension and bradycardia that were attenuated by atropine and sodium thiopental, but not by L-NAME or indomethacin. In rings of rat superior mesenteric artery pre-contracted with phenylephrine, EOCC (1 to 3000 µg/mL induced relaxation that was not affected after removal of the endothelium, after TEA or in rings pre-contracted with KCl (80 mM. Furthermore, EOCC (1000 µg/mL was not able to induce additional effect on maximal relaxation of nifedipine (10 µM. In conclusions, EOCC induces hypotension, possibly by reduction in vascular resistance caused by inhibition of the Ca2+ influx, and bradycardia probably due to an activation of cardiac muscarinic receptors.

  12. Una nueva especie de Axonopus (Poaceae: Panicoideae: Paniceae de la Guyana de Colombia y Venezuela

    Directory of Open Access Journals (Sweden)

    Giraldo Cañas Diego


    Full Text Available Axonopus piccae, a new species of the series Barbigeri G. A. Black, is described and illustrated. The new species is known only from two areas of Guayana Region: Guainía (Colombia and Bolívar (Venezuela. Its inflorescence is polytelic and truncate.Based on SEM microphotographs, the characters of its upper anthecium are presented. Its morphological and anatomical relationships are discussed, and a key to the nearest species is provided.Se describe e ilustra Axonopus piccae, una nueva especie perteneciente a la serie Barbigeri G. A. Black, conocida únicamente de dos áreas de la región Guayana en Guainía (Colombia y Bolívar (Venezuela. Su inflorescencia es politélica y truncada. Se comentan las características de su antecio superior sobre la base de microfotografías al microscopio electrónico de barrido. Se discuten sus relaciones morfológicas y anatómicas. Se presenta una clave para separar las especies afines.

  13. Mechanisms of Oryza sativa (Poaceae resistance to Tagosodes orizicolus (Homoptera: Delphacidae under greenhouse condition in Venezuela

    Directory of Open Access Journals (Sweden)

    Alex González


    de umbráculo en la Fundación Danac, Venezuela, con el objeto de determinar los mecanismos de resistencia de antixenosis, antibiosis y tolerancia a T. orizicolus que pudieran estar actuando en líneas avanzadas y cultivares del programa de mejoramiento enético de arroz de las instituciones INIA y Fundación Danac. Para la evaluación de antixenosis se utilizó el método de libre elección, para antibiosis (efecto sobre sobrevivencia y oviposición de los insectos el de alimentación forzada, adicionalmente se usó un método indirecto para estimar la tolerancia. Dentro de los principales parámetros determinados se encontraban: grado de daño, número de insectos posados sobre plantas de arroz, porcentaje de mortalidad de sogata en estado adulto, número de huevos y se calculó un índice de tolerancia con base en la biomasa. Los resultados mostraron que los genotipos de arroz evaluados poseen diferentes combinaciones en cuanto a los mecanismos de resistencia, así como el grado de su efecto. El testigo ‘Bluebonnet 50’ se mantuvo consistentemente susceptible en las evaluaciones y el testigo resistente ‘Makalioka’ fue el único genotipo que presentó alta antixenosis y alta antibiosis para sobrevivencia y oviposición. El resto de los genotipos presentaron un menor o mayor grado de resistencia de tipo antixenosis y antibiosis para sobrevivencia y oviposición. Se identificó el genotipo ‘FD0241-M-17-6-1-1-1-1’ con posible tolerancia al daño directo de sogata.

  14. Inferencias sobre Grafos

    Directory of Open Access Journals (Sweden)

    Sira M. Allende


    Full Text Available El estudio de un juego puede ser modelado asumiendo que solo algunas partidas son observadas. Entonces el árbol del juego debe ser estimado utilizando información muestral. Similarmente ocurre al obtener información sobre el comportamiento de las decisiones tomadas por individuos muestreados sobre un árbol de decisión teórico. Al considerar una medida de probabilidad que caracterice el comportamiento de redes aleatorias se puede obtener un estimado del árbol asociado. Este problema es el analizado en este trabajo. Algunos resultados experimentales obtenidos usando Recocido Simulado ilustran el procedimiento. Su papel en el estudio de modelos económicos y de mercadeo es discutido.

  15. Escrito sobre el cuerpo

    Directory of Open Access Journals (Sweden)

    Antonio Malalana Ureña


    Full Text Available El catálogo, en una edición bilingüe español-inglés, es una pequeña guía de la exposición Shirin Neshat. Escrito sobre el cuerpo, muestra que se integra dentro de los actos de PHOTOESPAÑA13, el festival internacional de fotografía y artes visuales. El esquema del libro es sencillo y los textos son extremadamente divulgativos. El primero de ellos, Escrito sobre el cuerpo (pp. 10-15, cuyo autor es Octavio Zaya, comisario de la exposición, resume la trayectoria de esta intelectual, que "interactúa" con la fotografía y los formatos audiovisuales, y nos presenta la argumentación narrativa de los documentos expuestos, contextualizando la obra recopilada.

  16. Evaluating sampling strategy for DNA barcoding study of coastal and inland halo-tolerant Poaceae and Chenopodiaceae: A case study for increased sample size.

    Directory of Open Access Journals (Sweden)

    Peng-Cheng Yao

    Full Text Available Environmental conditions in coastal salt marsh habitats have led to the development of specialist genetic adaptations. We evaluated six DNA barcode loci of the 53 species of Poaceae and 15 species of Chenopodiaceae from China's coastal salt marsh area and inland area. Our results indicate that the optimum DNA barcode was ITS for coastal salt-tolerant Poaceae and matK for the Chenopodiaceae. Sampling strategies for ten common species of Poaceae and Chenopodiaceae were analyzed according to optimum barcode. We found that by increasing the number of samples collected from the coastal salt marsh area on the basis of inland samples, the number of haplotypes of Arundinella hirta, Digitaria ciliaris, Eleusine indica, Imperata cylindrica, Setaria viridis, and Chenopodium glaucum increased, with a principal coordinate plot clearly showing increased distribution points. The results of a Mann-Whitney test showed that for Digitaria ciliaris, Eleusine indica, Imperata cylindrica, and Setaria viridis, the distribution of intraspecific genetic distances was significantly different when samples from the coastal salt marsh area were included (P < 0.01. These results suggest that increasing the sample size in specialist habitats can improve measurements of intraspecific genetic diversity, and will have a positive effect on the application of the DNA barcodes in widely distributed species. The results of random sampling showed that when sample size reached 11 for Chloris virgata, Chenopodium glaucum, and Dysphania ambrosioides, 13 for Setaria viridis, and 15 for Eleusine indica, Imperata cylindrica and Chenopodium album, average intraspecific distance tended to reach stability. These results indicate that the sample size for DNA barcode of globally distributed species should be increased to 11-15.

  17. Helicoverpa zea (Lepidoptera: Noctuidae) and Spodoptera frugiperda (Lepidoptera: Noctuidae) Responses to Sorghum bicolor (Poales: Poaceae) Tissues From Lowered Lignin Lines. (United States)

    Dowd, Patrick F; Sattler, Scott E


    The presence of lignin within biomass impedes the production of liquid fuels. Plants with altered lignin content and composition are more amenable to lignocellulosic conversion to ethanol and other biofuels but may be more susceptible to insect damage where lignin is an important resistance factor. However, reduced lignin lines of switchgrasses still retained insect resistance in prior studies. Therefore, we hypothesized that sorghum lines with lowered lignin content will also retain insect resistance. Sorghum excised leaves and stalk pith Sorghum bicolor (L.) Moench (Poales: Poaceae) from near isogenic brown midrib (bmr) 6 and 12 mutants lines, which have lowered lignin content and increased lignocellulosic ethanol conversion efficiency, were examined for insect resistance relative to wild-type (normal BTx623). Greenhouse and growth chamber grown plant tissues were fed to first-instar larvae of corn earworms, Helicoverpa zea (Boddie) and fall armyworms Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuidae), two sorghum major pests. Younger bmr leaves had significantly greater feeding damage in some assays than wild-type leaves, but older bmr6 leaves generally had significantly less damage than wild-type leaves. Caterpillars feeding on the bmr6 leaves often weighed significantly less than those feeding on wild-type leaves, especially in the S. frugiperda assays. Larvae fed the pith from bmr stalks had significantly higher mortality compared with those larvae fed on wild-type pith, which suggested that bmr pith was more toxic. Thus, reducing lignin content or changing subunit composition of bioenergy grasses does not necessarily increase their susceptibility to insects and may result in increased resistance, which would contribute to sustainable production. Published by Oxford University Press on behalf of the Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  18. Linkage Maps of a Mediterranean × Continental Tall Fescue Population and their Comparative Analysis with Other Poaceae Species

    Directory of Open Access Journals (Sweden)

    Ryan Dierking


    Full Text Available Temperate grasses belonging to the complex are important throughout the world in pasture and grassland agriculture. Tall fescue ( Schreb. is the predominant species in the United States, covering approximately 15 million ha. Tall fescue has distinctive morphotypes, two of which are Continental (summer active and Mediterranean (summer semidormant. This is the first report of a linkage map created for Mediterranean tall fescue, while updating the Continental map with additional simple sequence repeat and sequence-tagged site markers. Additionally, this is the first time that diversity arrays technology (DArT markers were used in the construction of a tall fescue map. The male parent (Continental, R43-64, map consisted of 594 markers arranged in 22 linkage groups (LGs and covered a total of 1577 cM. The female parent (Mediterranean, 103-2, map was shorter (1258 cM and consisted of only 208 markers arranged in 29 LGs. Marker densities for R43-64 and 103-2 were 2.65 and 6.08 cM per marker, respectively. When compared with the other Poaceae species, meadow fescue ( Huds., annual ryegrass ( Lam., perennial ryegrass ( L., (L. Beauv., and barley ( L., a total of 171 and 98 orthologous or homologous sequences, identified by DArT analysis, were identified in R43-64 and 103-2, respectively. By using genomic in situ hybridization, we aimed to identify potential progenitors of both morphotypes. However, no clear conclusion on genomic constitution was reached. These maps will aid in the search for quantitative trait loci of various traits as well as help define and distinguish genetic differences between the two morphotypes.

  19. Terraplenes sobre suelos colapsables


    Arnedo Gaute, Diego


    Esta tesina está motivada por el diseño y construcción del Canal Segarra-Garrigues. El trazado del canal atraviesa varios pequeños valles de fondo llano mediante terraplenes sobre los cuales circula el canal. En estas vaguadas se encuentran suelos limo-arcillosos de baja densidad cuya potencia puede llegar a ser de varios metros. Estos materiales, debido a su estructura abierta, son potencialmente colapsables una vez cargados si experimentan incrementos de humedad. Las deformacion...


    Directory of Open Access Journals (Sweden)

    Suzana da Conceição de Barros


    Full Text Available Na contemporaneidade, os sujeitos vêm se utilizando das diversas tecnologias digitais, para exporem e compartilharem sua intimidade, com intuito de seduzirem e tornarem-se visíveis. Esse fenômeno vem sendo chamado de sexting, e vem sendo aderido por sujeitos de várias faixas etárias. Assim, leitor/a, convido você a pensar sobre o sexting e o que a escola tem a ver com essa prática?

  1. Excertos sobre o sedentarismo


    Palma,Alexandre; Vilaça,Murilo Mariano; Assis,Monique Ribeiro de


    O sedentarismo tem sido tratado como algo perfeitamente determinável, objetivo e, portanto, que pode ser apreendido. Por outro lado, o conceito de sedentarismo ainda permanece questionável e, por conseguinte, os instrumentos mostram-se inconsistentes. Neste sentido, o objetivo do presente estudo foi mostrar que diferentes discursos de verdade vêm concorrendo por esse conceito, o que nos motiva a pensar qual é a verdade ou, até mesmo, se há alguma verdade sobre ele. Após apresentarmos diferent...

  2. Sobre historia mundial hoy

    Directory of Open Access Journals (Sweden)

    Vera Weiler


    Full Text Available Los procesos de globalización son una realidad; su enorme impacto sobre la vida humana los ha convertido en un tema recurrente sobre el que se escribe y se comenta a diario también en Colombia. Los libros que de ellos tratan, ante todo los que 10 hacen en tono crítico, baten records en la industria editorial en todo el mundo. Las expectativas que acerca del futuro abrigan cientos de millones de personas se relacionan con 10 que ellas esperan, para bien o para mal, de la globalización. Las posturas que los gobernantes ocupan al respecto en el mundo son, cuando menos de aceptación, generalmente de activa participación en pos de la globalización. Por un lado, crece la preocupación y se multiplican las protestas; por el otro, dominan los razonamientos de los especialistas en materia de maximización de los rendimientos de los capitales que presentan la globalización, al estilo que se viene imponiendo, como el camino ineludible del gobierno universal de la eficiencia. ¿Tienen que decir algo los historiadores frente a todo esto?.

  3. Testing efficacy of distance and tree-based methods for DNA barcoding of grasses (Poaceae tribe Poeae) in Australia. (United States)

    Birch, Joanne L; Walsh, Neville G; Cantrill, David J; Holmes, Gareth D; Murphy, Daniel J


    In Australia, Poaceae tribe Poeae are represented by 19 genera and 99 species, including economically and environmentally important native and introduced pasture grasses [e.g. Poa (Tussock-grasses) and Lolium (Ryegrasses)]. We used this tribe, which are well characterised in regards to morphological diversity and evolutionary relationships, to test the efficacy of DNA barcoding methods. A reference library was generated that included 93.9% of species in Australia (408 individuals, [Formula: see text] = 3.7 individuals per species). Molecular data were generated for official plant barcoding markers (rbcL, matK) and the nuclear ribosomal internal transcribed spacer (ITS) region. We investigated accuracy of specimen identifications using distance- (nearest neighbour, best-close match, and threshold identification) and tree-based (maximum likelihood, Bayesian inference) methods and applied species discovery methods (automatic barcode gap discovery, Poisson tree processes) based on molecular data to assess congruence with recognised species. Across all methods, success rate for specimen identification of genera was high (87.5-99.5%) and of species was low (25.6-44.6%). Distance- and tree-based methods were equally ineffective in providing accurate identifications for specimens to species rank (26.1-44.6% and 25.6-31.3%, respectively). The ITS marker achieved the highest success rate for specimen identification at both generic and species ranks across the majority of methods. For distance-based analyses the best-close match method provided the greatest accuracy for identification of individuals with a high percentage of "correct" (97.6%) and a low percentage of "incorrect" (0.3%) generic identifications, based on the ITS marker. For tribe Poeae, and likely for other grass lineages, sequence data in the standard DNA barcode markers are not variable enough for accurate identification of specimens to species rank. For recently diverged grass species similar challenges are

  4. Voz sobre frame relay


    D´Elia, Gabriel Anibal


    Esta tesis trata el tema de VOFR, desde la digitalización de la voz hasta su transmisión a través de dicha red, así también como la comparación con otros medios de transporte como VOIP. Dada las características del protocolo frame relay y su disponibilidad se eligió como el medio más apropiado para la transmisión de voz y datos en forma integrada sobre una misma red. El trabajo comienza con una breve explicación de la voz, su digitalización y forma actual de transmisión a través de una red di...

  5. Sobre la muerte voluntaria

    Directory of Open Access Journals (Sweden)

    Juan Álvarez-Cienfuegos Fidalgo


    Full Text Available El problema de cómo morir en nuestra sociedad se ha convertido en una inquietud para los ciudadanos y la reflexión moral. Especialmcnte por dos razones: por el desarrollo de la tecnología médica y por el hecho de que la mayor parte de los fallecimientos tienen lugar fuera del hogar, donde tradicionalmente ocurra el deceso. El presente artículo tiene como objetivo acercarse a esta cuestión. Para ello, se parte de la autonomía del ciudadano, con derecho a decidir sobre lo que considera cuál sea su manera de vivir y de morir. A tal fin, se hace una breve introducción sobre el dolor, el suicidio y la muerte, desde un punto de vista antropológico, pasando, después, a mostrar las cuestiones relacionadas con el problema de la eutanasia, donde la atención se dirigirá, ante todo, al enjuiciamiento crítico del tenso equilibrio en el que se mantienen dos principios fundamentales de la bioética: el de no maleficencia y el de autonomía del ciudadano.The problem of how to die in modern society has become a concern for both the citizen and moral reflection for two reasons in particular: due to developments in medical technology, and because most deaths occur outside the honre, where they traditionaÍlY took place. This paper addresses this issue, starting from citizen autonomy, the right to decide on what s/he considers to be his or her way of living and dying. To this end, a brief introduction considers pain, suicide and death from an anthropological viewpoint. Questions related to the problem of euthanasia are then exposed, with particular attention to, above all the critical judgement of the tense balance in which two fundamental principies of bioethics are held, the principle of non-maleficence and that of citizen autonomy.

  6. Puente sobre el Maracaibo

    Directory of Open Access Journals (Sweden)

    Equipo Editorial


    Full Text Available Para salvar el lago de Maracaibo (Venezuela, el conocido ingeniero italiano Riccaido Morandi ha presentado un proyecto de puente para ferrocarril y carretera, de hormigón pretensado, de tramos independientes, constituyendo un sistema Gerber, que tiene una longitud total de 8.720 m y un vano central de 400 m de luz. Este último tramo, en unión de los dos adyacentes al mismo, constituirán, una vez terminada la obra, un conjunto continuo. El tablero del puente se halla a una altura de 45 m sobre el nivel del agua en la zona del canal, con objeto de permitir la navegación. El tablero, de 20,90 m de anchura total, se ha subdividido en tres partes, dos simétricas respecto al eje, laterales, de 7,20 m de anchura, para la circulación en sentidos opuestos por carretera, una plataforma central, de 5 m de ancho, para el ferrocarril y dos andenes para el paso de peatones y servicios.

  7. Sobre el nombre "Quechua"

    Directory of Open Access Journals (Sweden)

    Rodolfo Cerrón-Palomino


    Full Text Available Uno de los primeros problemas con el que a menudo tropiezael estudioso de los idiomas ágrafos, como es el caso de las lenguasaborígenes de América, es el de su denominación (glotónimo.En la medida ,en que, por razones históricas, las noticias sobretales lenguas, y por consiguiente los primeros estudios sobre lasmismas, surgen a partir del contacto con los miembros de la civilización occidental, los nombres de los distintos idiomas, así comode los grupos étnicos que los manejan, son el resultado casi siempre arbitrario cie designaciones fortuitas hechas por viajeros, misiioneros y exploradores, quienes por lo general se basan, para ello, bien en descripciones físicas de los grupo étnicos, en ciertos indios geográficos que constituyen el habitat de los mismos, e incluso en prejuicios que se nutren de un marcado europocentrismo.

  8. Facilitation of a native pest of rice, Stenotus rubrovittatus (Hemiptera: Miridae), by the non-native Lolium multiflorum (Cyperales: Poaceae) in an agricultural landscape. (United States)

    Yoshioka, Akira; Takada, Mayura; Washitani, Izumi


    Source populations of polyphagous pests often occur on host plants other than the economically damaged crop. We evaluated the contribution of patches of a non-native meadow grass, Lolium multiflorum Lam. (Poaceae), and other weeds growing in fallow fields or meadows as source hosts of an important native pest of rice, Stenotus rubrovittatus (Matsumura) (Hemiptera: Miridae), in an agricultural landscape of northern Japan. Periodical censuses of this mirid bug by using the sweeping method, vegetation surveys, and statistical analysis revealed that L. multiflorum was the only plant species that was positively correlated with the density of adult S. rubrovittatus through two generations and thus may be the most stable and important host of the mirid bug early in the season before the colonization of rice paddies. The risk and cost of such an indirect negative effect on a crop plant through facilitation of a native pest by a non-native plant in the agricultural landscape should not be overlooked.

  9. Dataset on the structural characterization of organosolv lignin obtained from ensiled Poaceae grass and load-dependent molecular weight changes during thermoplastic processing

    Directory of Open Access Journals (Sweden)

    Jörg Dörrstein


    Full Text Available This article presents experimental data of organosolv lignin from Poacea grass and structural changes after compounding and injection molding as presented in the research article “Effects of high-lignin-loading on thermal, mechanical, and morphological properties of bioplastic composites” [1]. It supplements the article with morphological (SEM, spectroscopic (31P NMR, FT-IR and chromatographic (GPC, EA data of the starting lignin as well as molar mass characteristics (mass average molar mass (Mw and Polydispersity (D of the extracted lignin. Refer to Schwarz et al. [2] for a detailed description of the production of the organosolv residue and for further information on the raw material used for lignin extraction. The dataset is made publicly available and can be useful for extended lignin research and critical analyzes.

  10. A plastome primer set for comprehensive quantitative real time RT-PCR analysis of Zea mays: a starter primer set for other Poaceae species

    Directory of Open Access Journals (Sweden)

    Dunn Sade N


    Full Text Available Abstract Background Quantitative Real Time RT-PCR (q2(RTPCR is a maturing technique which gives researchers the ability to quantify and compare very small amounts of nucleic acids. Primer design and optimization is an essential yet time consuming aspect of using q2(RTPCR. In this paper we describe the design and empirical optimization of primers to amplify and quantify plastid RNAs from Zea mays that are robust enough to use with other closely related species. Results Primers were designed and successfully optimized for 57 of the 104 reported genes in the maize plastome plus two nuclear genes. All 59 primer pairs produced single amplicons after end-point reverse transcriptase polymerase chain reactions (RT-PCR as visualized on agarose gels and subsequently verified by q2(RTPCR. Primer pairs were divided into several categories based on the optimization requirements or the uniqueness of the target gene. An in silico test suggested the majority of the primer sets should work with other members of the Poaceae family. An in vitro test of the primer set on two unsequenced species (Panicum virgatum and Miscanthus sinensis supported this assumption by successfully producing single amplicons for each primer pair. Conclusion Due to the highly conserved chloroplast genome in plant families it is possible to utilize primer pairs designed against one genomic sequence to detect the presence and abundance of plastid genes or transcripts from genomes that have yet to be sequenced. Analysis of steady state transcription of vital system genes is a necessary requirement to comprehensively elucidate gene expression in any organism. The primer pairs reported in this paper were designed for q2(RTPCR of maize chloroplast genes but should be useful for other members of the Poaceae family. Both in silico and in vitro data are presented to support this assumption.

  11. Algunos apuntes sobre comunidad

    Directory of Open Access Journals (Sweden)

    Clara Pérez Cárdenas


    Full Text Available Comunidad es, entre los temas de estudio del curriculum de los residentes en Medicina General Integral, uno de aquellos en las que mayores dificultades encontramos para poderlo impartir, pues la bibliografía sobre el tema está un tanto dispersa. Es un aspecto que los propios residentes no evalúan con justeza; sin embargo es de sumo interés que como profesionales de la salud no obviemos que nuestro trabajo de promoción, prevención y tratamiento, debe darse a nivel de individuo, pero también en las familias y en la comunidad como un todo, y por lo tanto debamos incorporar, al menos, nociones de lo que es una comunidad y qué es participación comunitaria para tener idea de cómo fomentarla, única vía para que nuestras acciones de salud sean más efectivasCommunity is one of the most difficult subjects to be taught among those included in the curriculum of General Comprehensive Medicine residents, since bibliography on this topic is a bit dispersed. This aspect, which is not properly evaluated by residents, is very important for health professionals to do our work of promotion, prevention and treatment not only at the level of the individual, but also at the level of the family and of the community as a whole. Therefore, we need to have some notions about community and community participation to be able to promote them, as the only way to make our health actions more effective

  12. Ecology and management of saltcedar (Tamarix ramosissima, T. chinensis and T. ramosissima x T. chinensis hybrids) (United States)

    Jim Jacobs; Sharlene Sing


    Saltcedar, also known by the common name tamarisk (Tamarix spp; Tamaricaceae taxonomic family), is a long-lived, invasive deciduous shrub or small tree intentionally introduced to North America from Eurasia for ornamental, wind break, and erosion mitigating purposes in the early 1800s. The spread of this species, both vegetatively from submerged stems and root sprouts...

  13. Informe preliminar sobre paludrina

    Directory of Open Access Journals (Sweden)

    Aquiles Peñuela Rozo


    Full Text Available En el año de 1945, Curd Davey y Rose eligieron la pirimidina como substancia de experimentación debido a que esta substancia se encuentra en las nucleo-proteinas y por su presencia en algunas sulfadrogas especial mente la sulfadiazina, de conocidas propiedades anti-palúdicas. Ensayaron la pirimidina y derivados en infestaciones por plasmodium gallinaceum en gallinas; y comprobaron que estas substancias tenían realmente acción antipalúdica. Pero al trasladar sus experiencias al hombre, encontraron que la pirimidina y sus derivados eran demasiado tóxicos. Pensando, entonces, en la similitud química del grupo de la pirimida y de la guanidina, incluyeron este último grupo en los compuestos para ensayar, descubriendo que la inclusión de la guanidina aumentaba grandemente la acción de las substancias en experiencia. Se obtuvo de esta manera un producto denominado en el numero 4-888, o paludrina, cuya fórmula o nombre químico es N. P. clorofenil N5 isopropildiguanidina, droga que se encontró muy activa contra las formas sanguíneas del Plasmodium Gallinaceum y que también se hallo activa contra las formas exoeritrocíticas del parásito. Esta capacidad de obrar sobre la fase exoeritrocítica es prácticamente exclusiva de esta substancia. Hasta hace poco tiempo esta fase exoeritrocítica, había sido demostrada solamente en trabajos de experimentación en las  aves; pero en la actualidad ha quedado también demostrada en la enfermedad humana, por experiencias del Filipino Nolasco and África, quien logro demostrar el plasmodium Vivax en el tejido retículo endotelial del pulmón de enfermos de paludismo, aunque ya Brug, en el año de 1940 había hecho comunicaciones en el mismo sentido. Se comprende la grande importancia de la paludrina, en el tratamiento del paludismo; si se considera que las recidivas de la enfermedad son debidas a la existencia de esta fase xeoeritrocítica.

  14. Ensaios sobre economia do empreendorismo


    Gabrielito Rauter Menezes


    Esta tese é composta por três ensaios sobre Economia do Empreendedorismo. O primeiro deles trata sobre os determinantes do empreendedorismo no Brasil a partir de modelos de escolha ocupacional, usando os microdados da Pesquisa Nacional por Amostra por Domicílios (PNAD) do ano de 2012. A estratégia empírica adotada empregou os modelos de escolha discreta na estimação da escolha ocupacional. Os resultados demonstraram que existem efeitos significativos para as variáveis: anos de estudos iniciai...

  15. Effect of essential oils of medicinal plants on leaf blotch in Tanzania grass Efeito de óleos essenciais de plantas medicinais sobre a helmintosporiose do capim Tanzânia

    Directory of Open Access Journals (Sweden)

    Gil Rodrigues dos Santos


    Full Text Available Leaf spots caused by phyto-pathogenic fungi, can reduce the production of forage plants. The essential oils of medicinal plants have antimicrobial potential. The objective here was to evaluate the fungotoxicity in vitro of the essential oils of lemongrass (Cymbopogon citratus (DC. Stapf (Poaceae, citronella (Cymbopogon nardus (L. Rendle (Poaceae, lemon balm (Lippia alba (Mill. NE Br ex Britton & P. Wilson (Verbenaceae and peppermint (Mentha piperita L. (Lamiaceae on the fungus Helminthosporium sp. and the in vivo effect of these oils and of commercial neem oil (Azadirachta indica A. Juss. (Meliaceae on leaf blotch in Panicum maximum Jacq. cv. Tanzania-1. The mycelial growth of the fungus was evaluated over five periods (2; 4; 6; 8 and 10 days from incubation and with five concentrations of essential oils (C1 = 250 ppm; C2 = 500 ppm; C3 = 750 ppm; C4 = 1,000 ppm e C5 = 1,250 ppm. As an alternative control, the preventative and curative effect on leaf blotch of five oil-based treatments were evaluated: lemongrass, citronella, lemon balm, peppermint and neem in four concentrations (2,500; 5,000; 7,500 and 10,000 ppm. The essential oils of lemongrass and citronella were the most effective in reducing mycelial growth of Helminthosporium sp. With the essential oil of lemongrass, the pathogen presented the highest growth concentration (1.250 ppm. The results obtained showed that all the essential oils and concentrations tested presented a preventive and curative effect, reducing the severity of leaf blotch.Manchas foliares, causadas por fungos fitopatogênicos, podem reduzir a produção de forrageiras. Óleos essenciais de plantas medicinais apresentam potencial antimicrobiano. Objetivou-se avaliar a fungitoxicidade in vitro dos óleos essenciais de capim-limão (Cymbopogon citratus (DC. Stapf (Poaceae, citronela (Cymbopogon nardus (L. Rendle (Poaceae, erva-cidreira (Lippia alba (Mill. N.E. Br. ex Britton & P. Wilson (Verbenaceae e hortel

  16. Conversaciones sobre el litoral cordillerano


    Browne,Enrique; Browne,Tomás


    Dos arquitectos dialogan sobre los Andes desde su propia vivencia. El territorio de Chile se entiende como límite natural entre mar y cordillera, donde suceden apretadamente una serie de eventos particulares: fallas geológicas, cerros que penetran en las ciudades y torrentes que bajan al mar caracterizan y diferencian sus paisajes.

  17. Sobre Humanismo y Medicina

    Directory of Open Access Journals (Sweden)

    Adolfo de Francisco Zea


    Full Text Available

    En esta disertación sobre “Humanismo y Medicina”, título del libro que tuve ocasión de publicar hace un par de años, destacaré algunas de las relaciones que existen entre la medicina y las bellas artes, concretamente la música y la pintura. La Medicina tiene como objeto de su acción al Hombre. Definida como la ciencia y el arte de prevenir, curar o aliviar la enfermedad, no tiene como meta la simple prolongación de la vida biológica.

    Su tarea consiste en postergar la muerte, prevenir o reducir los padecimientos y las deformidades, curar las enfermedades, ampliar las capacidades biológicas y psicológicas de los seres humanos y ocuparse de los sufrimientos de las personas. Para Tristam Engelhardt, es la Medicina de las personas.

    Se concibe a la persona humana como el individuo de conciencia reflexiva normal que es a la vez miembro pleno de la comunidad, con los deberes y derechos que presuponen su pertenencia a ella. A esta acepción de carácter moral de la persona humana, que corresponde a lo que se llama persona “en sentido estricto”, se agrega la acepción social, que hace relación con aquellas personas a las que se otorgan prácticamente los mismos derechos, como es el caso de los niños, de los individuos que perdieron el carácter de personas por padecer de lesiones cerebrales o demencia, y de aquellos que nunca llegarán a serlo como los retrasados mentales profundos.

    Al sostener que no todos los seres humanos son personas “en sentido estricto”, la Bioética que expone Engelhardt impone, sin embargo, como obligación moral, tratar a estos últimos con pleno respeto y comprensión. Lo que es importante acerca de nosotros mismos como seres humanos, es el hecho real de que seamos personas; no simplemente nuestra pertenencia al género Horno sapiens como tal.

    Para Víctor Frankl, la persona humana es de carácter espiritual y en tal virtud, es diferente del organismo psicofísico cuya

  18. Atividade de glutationa S-transferase na metabolização de acetochlor, atrazine e oxyfluorfen em milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae Glutathione S-transferase activity in acetochlor, atrazine and oxyfluorfen metabolization in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivumL. (Poaceae

    Directory of Open Access Journals (Sweden)

    Ethel Lourenzi Barbosa Novelli


    Full Text Available Este experimento foi conduzido para avaliar a seletividade em plantas dos herbicidas acetochlor, atrazine e oxyfluorfen em relação à atividade da glutationa S-transferase (GST em plantas de milho (Zea mays L., sorgo (Sorghum bicolor L. e trigo (Triticum aestivum L. (Poaceae. A atividade da GST foi detectada às 24, 48 e 72 horas após as aplicaç��es dos tratamentos. Os tratamentos do experimento consistiram de aplicação com água (controle, acetochlor (3 L.ha-1, atrazine (4 L.ha-1 e oxyfluorfen (1 L.ha-1. As maiores atividades de GST foram observadas na presença de acetochlor, principalmente às 48 horas após o tratamento. Esses aumentos foram 105, 148 e 118% em relação ao controle para milho, sorgo e trigo, respectivamente. É sugerido que a GST pode ter papel na degradação de acetochlor e pode ser uma das razões para a seletividade desse herbicida para essas culturas.This experiment was conducted to evaluate the acetochlor, atrazine and oxyfluorfen herbicides plant selectivity, in relation to glutathione S-transferase activity (GST in maize (Zea mays L., sorghum (Sorghum bicolor L. and wheat (Triticum aestivum L (Poaceae plants. GST activity was detected 24, 48 and 72 hours after treatment applications. The experiment's treatments consisted of spraying plants with water (control, acetochlor (3 L.ha-1`, atrazine (4 L.ha-1 and oxyfluorfen (1 L.ha-1. The highest GST activities were observed in presence of acetochlor, mainly at 48 hours after treatment. These increments were 105, 148 and 118% when compared to maize, sorghum and wheat control groups, respectively. It is suggested that the GST may have a role in acetochlor degradation and it may be a reason for this herbicide's selectivity in these crops.

  19. Effects of livestock exclusion on density, survival and biomass of the perennial sagebrush grass Hymenachne pernambucense (Poaceae) from a temperate fluvial wetland (United States)

    Magnano, Andrea L.; Nanni, Analía S.; Krug, Pamela; Astrada, Elizabeth; Vicari, Ricardo; Quintana, Rubén D.


    In Argentina, the intensification of soybean production has displaced a substantial proportion of cattle ranching to fluvial wetlands such as those in the Delta of the Paraná River. Cattle grazing affects structure and dynamics of native forage plants but there is little information on this impact in populations from fluvial wetlands. This study addresses the effect of cattle ranching on density, survival, mean life-span and aerial biomass of Hymenachne pernambucense (Poaceae), an important forage species in the region. The study was carried out monthly for one year in permanents plots subject to continuous grazing and plots excluded from grazing in the Middle Delta of the Paraná River. In plots excluded from grazing, tillers showed significantly higher population density and survival, and a two-fold increase in mean life-span, while continuous grazing decreased survival of cohorts. The largest contribution to tiller density in ungrazed and grazed populations was made by spring and summer cohorts, respectively. Total and green biomass were significantly higher in the ungrazed population, with highest differences in late spring-early summer. Cattle grazing affected the relationship between tiller density and green biomass suggesting that cattle prefer sprouts because they are more palatable and nutritious than older tissue.

  20. Karyotype evolution in Phalaris (Poaceae): The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus. (United States)

    Winterfeld, Grit; Becher, Hannes; Voshell, Stephanie; Hilu, Khidir; Röser, Martin


    Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae) is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH) of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1) the exclusively Mediterranean genome A based on x = 6, (2) the cosmopolitan genome B based on x = 7 and (3) a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

  1. Karyotype evolution in Phalaris (Poaceae: The role of reductional dysploidy, polyploidy and chromosome alteration in a wide-spread and diverse genus.

    Directory of Open Access Journals (Sweden)

    Grit Winterfeld

    Full Text Available Karyotype characteristics can provide valuable information on genome evolution and speciation, in particular in taxa with varying basic chromosome numbers and ploidy levels. Due to its worldwide distribution, remarkable variability in morphological traits and the fact that ploidy change plays a key role in its evolution, the canary grass genus Phalaris (Poaceae is an excellent study system to investigate the role of chromosomal changes in species diversification and expansion. Phalaris comprises diploid species with two basic chromosome numbers of x = 6 and 7 as well as polyploids based on x = 7. To identify distinct karyotype structures and to trace chromosome evolution within the genus, we apply fluorescence in situ hybridisation (FISH of 5S and 45S rDNA probes in four diploid and four tetraploid Phalaris species of both basic numbers. The data agree with a dysploid reduction from x = 7 to x = 6 as the result of reciprocal translocations between three chromosomes of an ancestor with a diploid chromosome complement of 2n = 14. We recognize three different genomes in the genus: (1 the exclusively Mediterranean genome A based on x = 6, (2 the cosmopolitan genome B based on x = 7 and (3 a genome C based on x = 7 and with a distribution in the Mediterranean and the Middle East. Both auto- and allopolyploidy of genomes B and C are suggested for the formation of tetraploids. The chromosomal divergence observed in Phalaris can be explained by the occurrence of dysploidy, the emergence of three different genomes, and the chromosome rearrangements accompanied by karyotype change and polyploidization. Mapping the recognized karyotypes on the existing phylogenetic tree suggests that genomes A and C are restricted to sections Phalaris and Bulbophalaris, respectively, while genome B occurs across all taxa with x = 7.

  2. Allotetraploid origin and divergence in Eleusine (Chloridoideae, Poaceae): evidence from low-copy nuclear gene phylogenies and a plastid gene chronogram. (United States)

    Liu, Qing; Triplett, Jimmy K; Wen, Jun; Peterson, Paul M


    Eleusine (Poaceae) is a small genus of the subfamily Chloridoideae exhibiting considerable morphological and ecological diversity in East Africa and the Americas. The interspecific phylogenetic relationships of Eleusine are investigated in order to identify its allotetraploid origin, and a chronogram is estimated to infer temporal relationships between palaeoenvironment changes and divergence of Eleusine in East Africa. Two low-copy nuclear (LCN) markers, Pepc4 and EF-1α, were analysed using parsimony, likelihood and Bayesian approaches. A chronogram of Eleusine was inferred from a combined data set of six plastid DNA markers (ndhA intron, ndhF, rps16-trnK, rps16 intron, rps3, and rpl32-trnL) using the Bayesian dating method. The monophyly of Eleusine is strongly supported by sequence data from two LCN markers. In the cpDNA phylogeny, three tetraploid species (E. africana, E. coracana and E. kigeziensis) share a common ancestor with the E. indica-E. tristachya clade, which is considered a source of maternal parents for allotetraploids. Two homoeologous loci are isolated from three tetraploid species in the Pepc4 phylogeny, and the maternal parents receive further support. The A-type EF-1α sequences possess three characters, i.e. a large number of variations of intron 2; clade E-A distantly diverged from clade E-B and other diploid species; and seven deletions in intron 2, implying a possible derivation through a gene duplication event. The crown age of Eleusine and the allotetraploid lineage are 3·89 million years ago (mya) and 1·40 mya, respectively. The molecular data support independent allotetraploid origins for E. kigeziensis and the E. africana-E. coracana clade. Both events may have involved diploids E. indica and E. tristachya as the maternal parents, but the paternal parents remain unidentified. The habitat-specific hypothesis is proposed to explain the divergence of Eleusine and its allotetraploid lineage.

  3. Sobre aprendizaje escolar y neurociencias


    Terigi, Flavia


    En el marco de una creciente difusión de los discursos de y sobre las neurociencias en el campo educativo en Argentina, donde enunciados extraídos del discurso neurocientífico comienzan a transformarse en emblemas de política pública, este trabajo, escrito desde el punto de vista de la educación escolar, se propone situar los alcances y límites de los aportes de estas disciplinas para comprender el aprendizaje escolar. En él se postula que la aparición rutilante de las neurociencias en educac...

  4. Polinomios perfectos sobre F2


    Cely Rojas, Valeria


    Este trabajo muestra el status de los números perfectos y el análogo de los números perfectos en los anillos de polinomios. Además, se presentan las demostraciones de algunas propiedades de los polinomios perfectos sobre F2 de forma comprensible, basadas en el trabajo realizado por los profesores Luis Gallardo y Oliver Rahavandrainy. / Abstract. This work shows the status artis of perfect numbers and their analogue in the rings of polynomials. Proofs of some properties of perfect polynomials ...

  5. Contabilidad del impuesto sobre beneficios


    Luceño Martínez, Haizea


    Este Trabajo Fin de Grado pretende dar una explicación al tratamiento contable del Impuesto de Sociedades. Siendo un impuesto que hay que contabilizar, pero que se calcula siguiendo criterios fiscales, lleva a tener que realizar ajustes que tendrán su repercusión contable. El punto de partida no es otra que la norma de registro y valoración 13ª del PGC, que versa sobre cómo hay que proceder a contabilizar el Gasto por Impuesto de Sociedades, que se compone tanto del Gasto por Impuesto Co...

  6. Variação dos teores de constituintes voláteis de Cymbopogon citratus (DC Staf, Poaceae, coletados em diferentes regiões do Estado de São Paulo Variation in the amounts of volatile constituents of Cymbopogon citratus (DC Staf, Poaceae, collected in different regions of São Paulo State

    Directory of Open Access Journals (Sweden)

    Marcos R. Furlan


    Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.The essential oil extracted from Cymbopogon citratus (DC Staf, Poaceae, is rich in citral and has many applications in chemical and pharmaceutical industry. The aims of this study were evaluate the amount of citral in populations of C. citratus collected in two different regions (Ibiúna and Pindamonhangaba, São Paulo State. The essential oil extracted of a cultivated population in Pidamonhangaba-SP, showed a high content of citral (approximately 96.0%, while the essential oil from Ibiuna-SP, showed citral and high amounts of another monoterpene, geraniol. Additionally, the essential oils from this population of C. citratus were extracted and analyzed during 24 h (each 3 h, being the major concentration of citral in the night period, indicating that studies which evaluated the chemical differences associated to circadian changes. The components of essential oils were identified through 13C NMR, GC/MS, GC and

  7. Ação do flúor dissolvido em chuva simulada sobre a estrutura foliar de Panicum maximum jacq. (colonião e Chloris gayana kunth. (capim-rhodes - Poaceae

    Directory of Open Access Journals (Sweden)

    Chaves Alba Lucilvânia Fonseca


    Full Text Available Panicum maximum e Chloris gayana foram submetidas à chuvas simuladas com soluções de fluoreto de potássio (15mg ml-1 com objetivo de identificar as injúrias causadas pelo flúor (F-, como poluente atmosférico, na estrutura da lâmina foliar e fornecer subsídios para a seleção de características diagnósticas a serem utilizadas na bioindicação. Os principais sintomas foram clorose e necrose, principalmente no ápice e margens das lâminas. Nos cortes transversais, quatro tipos de alterações causadas pelo flúor são relacionadas: redução do número, tamanho e arranjo dos cloroplastos; necrose dos tecidos principalmente nas margens das folhas; erosões na superfície da folha e hipertrofia das células. Em C. gayana, no entanto, não foram observadas as alterações nos cloroplastos e os outros sintomas foram bem mais discretos que em P. maximum. A ocorrência de compostos fenólicos foi registrada pela coloração com fucsina em todas as regiões da lâmina onde foram observadas lesões. Ao microscópio eletrônico de varredura foi observado o achatamento e formação de concavidades nas paredes externas das células. Este experimento confirma a maior sensibilidade de P. maximum ao flúor e revela algumas características anatômicas de C. gayana que, entre outros fatores, podem estar contribuindo para a maior resistência desta espécie a este poluente.

  8. Padrão de resposta de Mimosa pudica e Senna obtusifolia à atividade potencialmente alelopática de espécies de Poaceae Response pattern of Mimosa pudica e Senna obtusifolia to potentially allelopathic activity of Poaceae species

    Directory of Open Access Journals (Sweden)

    A.P.S. Souza Filho


    Full Text Available A alelopatia é um importante mediador de interferências que alteram a dinâmica de espécies de plantas em sistemas agrícolas. Neste trabalho, procurou-se determinar a existência de padrão de respostas das plantas daninhas Mimosa pudica e Senna obtusifolia a espécies da família Poaceae, via interação entre espécies e frações e ordenamento dos efeitos. Bioensaios de germinação de sementes e alongamento da radícula e do hipocótilo foram desenvolvidos, em condições controladas. Os testes foram realizados utilizando-se extratos hidroalcoólicos na concentração de 1,0% das frações folha, raiz e sementes de quatro espécies de Poaceae. Diferenças na intensidade dos efeitos para os fatores espécie e fração foram verificadas. O padrão de atividade observado foi de Paspalum maritimum apresentar as inibições mais intensas. Entre as espécies de Brachiaria, as inibições mais intensas foram produzidas por B. brizantha. Houve resposta efetiva para a especificidade entre espécies e fração para a germinação e alongamento da radícula, especialmente na espécie Mimosa pudica. Apenas para os extratos de P. maritimum foram observadas especificidade e efetividade em relação à germinação de sementes e alongamento da radícula da espécie Senna obtusifolia. A fração folha foi mais efetiva nas inibições, sobretudo na espécie P. maritimum. Comparativamente, a espécie Mimosa pudica foi mais sensível aos efeitos dos extratos, especialmente em relação ao desenvolvimento da radícula e do hipocótilo. A intensidade dos efeitos alelopáticos variou na seguinte ordem: alongamento da radícula > germinação de sementes > alongamento do hipocótilo. A ordenação dos resultados, para os indicadores de inibição, indicou discriminação no padrão para as espécies receptoras, o que sugere especificidade dos extratos.Allelopathy is an important device to measure interferences affecting the dynamics of plant species in

  9. Recursos y enlaces sobre comunidades de aprendizaje


    Ferrer Esteban, Gerard


    Obras y artículos sobre el proyecto Comunidades de Aprendizaje desarrollado en el Estado español. Tesis doctorales sobre comunidades de aprendizaje. Fundamentación teórica de las comunidades de aprendizaje. Sitios en Internet relacionados con las comunidades de aprendizaje y proyectos afines de desarrollo comunitario en contextos escolares.

  10. Efecto cristal. Reflexiones sobre arquitectura

    Directory of Open Access Journals (Sweden)

    Dr. Arq. Carlos Pantaleón Panaro


    Full Text Available ESPEJISMO es una ilusión óptica debido a la reflexión total de la luz cuando atraviesa capas de aire de densidad distinta, con lo cual los objetos lejanos dan una imagen invertida, como si se reflejaran sobre el agua, tal como ocurre en las llanuras de los desiertos. 1 La definición de espejismo nos explica que es una ilusión, una ficción, un desvarío, un delirio. Algo que no es real ni verdadero, la apariencia engañosa de algo que no existe. ¿Pero no existe, realmente? Tal vez se pueda decir, desde algún punto de vista, que una imagen ilusoria no es real. Pero ¿podríamos afirmarlo desde el punto de vista del fenómeno de la percepción? Si lo vemos, ¿no tendríamos derecho a decir que es real? ¿Algo tiene que ser material y poder tocarse, para ser real? ¿No basta simplemente con verlo? Este artículo de reflexión trata sobre el tema de lo ilusorio, de los espejismos y apariencias engañosas que, no obstante su naturaleza falaz, existen y se perciben, y son procesados por nuestra mente como fenómenos sensoriales que conforman nuestra percepción. El hilo conductor es un viaje a través de diferentes paisajes espejados: el del azar, el de las artes y el de la arquitectura. 1Diccionario de la Real Academia Española

  11. Puente sobre el rio Medway

    Directory of Open Access Journals (Sweden)

    Freeman, Fox, Ingenieros


    have been prestressed both longitudinally and transversally. Between the two circulation roadways an elastic barrier has been placed, supported on metal posts.El puente sobre el río Medway tiene la misión de salvar dicho río en el nuevo trazado de carretera necesario para aliviar el denso tráfico estival entre Dower y Londres. Está situado en las proximidades de la ciudad de Rochester. La estructura se ha construido utilizando las vías de concurso. De todos los tipos presentados se eligió una estructura de hormigón armado. La longitud total de la obra es de 1.000 m. Los tres tramos principales de la obra salvan el río. El central es de 152 m de luz, y los dos adyacentes son de 103 m cada uno. Los accesos tienen un total de 18 tramos, que arrojan una longitud de 654 m. La anchura del puente es de 34 m, y la calzada se ha subdividido en dos direcciones de tráfico de 7,30 m cada una y, además, se han dejado dos espaldones laterales de 2,40 m de anchura. En planta se puede admitir que el puente tiene una alineación recta con una ligerísima curva, y que en el plano vertical presenta una pendiente de desagüe entre las pilas 9 y 10. Los estribos son de hormigón armado: tipo celular el del este y de hormigón en masa el del oeste. Los estribos se apoyan sobre pilotes hexagonales de hormigón armado cuya circunferencia circunscrita tiene 55 cm de radio y de 12 a 20 m de longitud. Cuando el firme se hallaba a profundidades inferiores a 6 m, los estribos se cimentaban directamente sobre el firme. Las pilas constituyen pórtico y tienen una altura variable de 9 a 30 m sobre el nivel del suelo. Los tramos de acceso forman una estructura continua simplemente apoyada. Cada tramo se compone de ocho vigas longitudinales de 30 a 41 m de longitud y de 190 toneladas cada una. Estas vigas son del tipo pretensado y prefabricado. El tramo central es del tipo cantilever, constituido por dos brazos, de 30 m de longitud, formados por vigas cajón. Cada una de estas vigas consta

  12. Puente sobre el Oosterschelde, Holanda

    Directory of Open Access Journals (Sweden)

    Hoving, H. T.


    Full Text Available This new bridge, forming part of the Delta project, is made of concrete, and was built by successive overhangs. Precast units were mainly used. The bridge is 5,000 m long, and is 11.85 m wide. The main spans are 95 m in length, except one, which can be opened up to sea traffic, which is 40 m long. The free height of the bridge over the sea is 15 m, which is insufficient for large ships. This required that one of the spans, in deep water, should open up, on hinges, and provide free passage to large ships. The intermediate bridge supports are of special interest. They rest on piles which go down to 38 m. They are hollow, cylindrical, of 4.35 m external diameter, and are driven into the ground in several stages, as they penetrate through the sands at the bottom of the Oosterschelde. To drive them in, an excavating device, inside the pile, was utilised, and also a dredging and suction mechanism, to clean out the bottom, and allow the piles to sink by gravity. But when external friction did not allow this to happen, the piles were weighed down with up to 500 tons of ballast. A series of three of these piles, in a row, makes up each bridge support. A cross member over the pile heads supports, in turn, the bridge deck. The bridge was built in successive sections, overhanging from each support, and then finally connected with a central portion. Use of precast units has been very extensive, so that the bridge can be justiaflably regarded as being prefabricated.Este nuevo puente, que forma parte del Plan de obras denominadas del Delta, es de hormigón y se ha construido por el procedimiento de voladizos sucesivos, utilizando, en su mayor parte, elementos prefabricados. Tiene una longitud total de 5.000 m; una anchura de 11,85 m; tramos principales de 95 m de luz, salvo uno, levadizo, que tiene 40 m. La altura libre sobre las ag^uas del mar es de 15 m, que es insuficiente para las naves de gran tonelaje; esto exigió que uno de sus tramos, en aguas

  13. Somos un envase : Discursos sobre el aborto


    Löcher, Jennifer Irene


    No hay persona que no tenga opinión acerca del asunto y, cada vez más, la sociedad argentina debate sobre la pregunta de si se debe legalizar/despenalizar el aborto o no. Nunca antes se habló tanto sobre el tema públicamente: se publican artículos en los diarios, hay manifestaciones a favor y hay manifestaciones en contra de la legalización del aborto. El siguiente trabajo pretende relevar y analizar discursos que circulan socialmente alrededor del debate sobre el aborto. (Párrafo extraíd...

  14. Estudo multicasos sobre atividades inovativas

    Directory of Open Access Journals (Sweden)

    Sonia Regina Hierro Parolin


    Full Text Available Em estudos sobre competitividade argumenta-se que as empresas necessitam de estratégias baseadas em inovações e de capacidades internas em constantes e intensas transformações, não somente nos padrões tecnológicos, mas também no encadeamento do processo de gestão das atividades inovativas, como processos dinâmicos, não lineares e diversificados, em função de múltiplos fatores dos ambientes interno e externo. Para contribuir com essas discussões, neste artigo apresenta-se um estudo multicasos em quatro indústrias de médio e grande portes, de segmentos, densidades tecnológicas e históricos com inovações diferentes entre si. Como principais resultados, salientam-se o encadeamento das atividades inovativas como parte de uma estratégia organizacional para obter resultados com inovação e a afluência de todas as pessoas, e não somente as alocadas em pesquisa e desenvolvimento, para o cumprimento dessa estratégia.

  15. Notas sobre publicaciones medievales portuguesas

    Directory of Open Access Journals (Sweden)

    José Luis MARTÍN


    Full Text Available Contra lo que debiera suceder, la proximidad con Portugal no incita al conocimiento de su historia y son muy raros los manuales de Historia de España en los que se concede a la Edad Media Portuguesa la importancia que realmente tiene, y en los tratados de Historia Medieval Europea el espacio dedicado a Portugal es mínimo, al menos hasta la época de los Descubrimientos; por otra parte, son contados los medievalistas españoles que se interesan por la historia de Portugal. Ante estos silencios y ante la escasa presencia en las bibliotecas españolas de obras portuguesas el estudiante de historia puede pensar que el país vecino carece de medievalistas de relieve, que su historia medieval está por hacer... y nada más lejos de la realidad como intentaré probar en este breve comentario, sin ánimo exhaustivo, sobre algunas de las últimas publicaciones aparecidas en Portugal.

  16. Los derechos de autor sobre obtenciones vegetales

    Directory of Open Access Journals (Sweden)

    Rosario Silva Gilli


    Full Text Available Contenido: Las creaciones en la agricultura. Los derechos de autor sobre obtenciones vegetales. El Convenio Internacional para la protección de las obtenciones vegetales (París 1961 y sus revisiones de Ginebra 1972, 1978,1991 Objeto de la protección legal. Condiciones del cultivar. Alcance de la protección. La protección de obtenciones vegetales en el Mercosur. Los Derechos de autor en el Mercosur. El Protocolo de Armonización de normas sobre Propiedad Intelectual en el Mercosur. El Acuerdo de Cooperación y facilitación sobre la protección de las obtenciones vegetales en los Estados Partes del Mercosur.  Alcance de la normativa Mercosur. Los Derechos sobre cultivares en Uruguay. Los Derechos de autor como derechos humanos. ¿Derechos de autor vs. derecho de propiedad intelectual? Reflexión final

  17. Conocimientos sobre incontinencia urinaria en pacientes hospitalizados

    Directory of Open Access Journals (Sweden)

    Otto Guillen Lopez


    Full Text Available Objetivo: Determinar el nivel de conocimientos sobre incontinencia urinaria (IU en pacientes hospitalizados. Material y métodos: Estudio transversal, descriptivo; se entrevistó una muestra por saturación de 325 pacientes hospitalizados de 30 años a más del Hospital Nacional Cayetano Heredia (HNCH, Lima - Perú, utilizando un cuestionario de conocimientos sobre incontinencia, considerándose como adecuado conocimiento cuando había más de 50% de aciertos en él. Resultados: Solamente 35.7% tuvieron conocimiento adecuado sobre IU. Hasta 90% conocía acerca del éxito del tratamiento y posibilidad de curación de los pacientes incontinentes. Sin embargo, 75% consideraron erróneamente que la IU era consecuencia inevitable del envejecimiento, mientras menos de 50% de pacientes conocía el papel de ciertos medicamentos y ejercicios en la IU. Conclusiones: Se demostró un pobre conocimiento general sobre la IU, siendo necesaria una intervención de los profesionales de la salud en la educación de la población, sobre todo hospitalizada y con factores predisponentes para desarrollar IU, para así poder modificar las ideas erróneas que existen sobre el tema. (Rev Med Hered 2003; 14: 186-194.


    Directory of Open Access Journals (Sweden)



    Full Text Available In this paper we propose a different approach to children's ideas about the geographical area in the particular context of the Mbyá Guarani population, from Misiones (Argentine. The territorial fragility, that is exposed to the indigenous people in Argentina aremanifested daily in several areas. Mbyá population, has been crossed by the boundaries of national states of Paraguay, Brazil and Argentina. The sedentary and enclosures land processes in different states, have prompted changes in the logic of subsistence, housing and community organization. In Misiones province case, bureaucratic accreditation of land titles is postponed, the state is not committed to the realization of this right.RESUMEN: En este trabajo nos proponemos un acercamiento a las diversas ideas infantiles sobre el territorio habitado, en el contexto particular de la población mbyá guaraní de Misiones. La fragilidad territorialidad a la que es expuesta la población indígena en Argentina se manifiestan cotidianamente en diversas áreas. La población mbyá, ha sido surcada por los límites de los estados nacionales de Paraguay, Brasil y Argentina. La sedentarización y los cercamientos de tierras en los diferentes estados, han impulsado transformaciones de las lógicas de subsistencia, de habitación y organización comunitaria. En el caso de la provincia de Misiones la acreditación burocrática de los títulos de tierras se encuentra aplazada, el estado no se compromete con la concreción de este derecho.

  19. Consideraciones preliminares sobre la credibilidad

    Directory of Open Access Journals (Sweden)

    Fernando Verdugo


    Full Text Available A modo de introducción al Seminario Interno de Profesores de la Facultad de Teología de la PUC, el autor recuerda, en primer lugar, lo que suele entenderse por "credibilidad" y, también, algunos de los criterios generales por los cuales algo o alguien adquiere la calidad de creíble (el que sea razonable, relevante o significativo, capaz de producir gozo estético, etc.. Luego, en la parte más extensa, el autor vuelve a llamar la atención sobre la necesidad de atender a los condicionamientos culturales de la fe cristiana. La fe, al igual que toda experiencia humana, está culturalmente mediada. Tomar conciencia de ese hecho y asumir las consecuencias metodológicas es indispensable para una teología que quiere poner atención a los desafíos actuales y contribuir así a la credibilidad del cristianismoThis article reprints the introductory session to the internal seminar of lecturers from the Faculty of Theology of the UC. In the first place, the author sums up what is usually understood by `credibility' and the general criteria through which something or someone gains credibility (being reasonable, relevant or significant, capable of producing aesthetic pleasure. Then the author deals at length with the need to take notice of the cultural conditionings of the Christian faith. The faith, the same as any other human experience, is culturally mediated. It is crucial for theology to become aware of this fact and come to terms with its methodological consequences, if it wants to face current challenges and so contribute to the credibility of Christianity


    Impoundments create artificial shorelines that differ from natural lake shorelines in patterns of water-level fluctuations, flow, sediment transport, and shoreline vegetation dynamics. Shoreline plant communities in the American Southwest often become dominated by mature, senesce...

  1. Consenso mexicano sobre la dispepsia

    Directory of Open Access Journals (Sweden)

    R. Carmona-Sánchez


    Full Text Available Desde la publicación de las guías de dispepsia 2007 de la Asociación Mexicana de Gastroenterología ha habido avances significativos en el conocimiento de esta enfermedad. Se realizó una revisión sistemática de la literatura en PubMed (01/2007 a 06/2016 con el fin de revisar y actualizar las guías 2007 y proporcionar nuevas recomendaciones basadas en evidencia. Se incluyeron todas las publicaciones en español e inglés, de alta calidad. Se redactaron enunciados que fueron votados utilizando el método Delphi. Se estableció la calidad de la evidencia y la fuerza de las recomendaciones según el sistema GRADE para cada enunciado. Treinta y un enunciados fueron redactados, votados y calificados. Se informan nuevos datos sobre definición, clasificación, epidemiología y fisiopatología. La endoscopia debe realizarse en dispepsia no investigada cuando hay datos de alarma o falla al tratamiento. Las biopsias gástricas y duodenales permiten confirmar infección por Helicobacter pylori y excluir enfermedad celiaca, respectivamente. Establecer una fuerte relación médico-paciente, cambios en la dieta y en el estilo de vida son útiles como medidas iniciales. Los bloqueadores H2, inhibidores de la bomba de protones, procinéticos y fármacos antidepresivos son efectivos. La erradicación de H. pylori puede ser eficaz en algunos pacientes. Con excepción de Iberogast y rikkunshito, las terapias complementarias y alternativas carecen de beneficio. No existe evidencia con respecto a la utilidad de prebióticos, probióticos o terapias psicológicas. Los nuevos enunciados proporcionan directrices basadas en la evidencia actualizada. Se presenta la discusión, el grado y la fuerza de la recomendación de cada uno de ellos.


    Directory of Open Access Journals (Sweden)

    Sayuri P. Tamura M.


    Full Text Available «Disertación sobre equidad y justicia» es básicamente una respuesta a una inquietud en particular que yo tenía sobre las distintas posiciones que existen sobre estos dos temas y cómo definir cuál es la más acertada. Hice una descripción del punto de vista de Amartya Sen –la violación de los derechos sobre la propiedad privada es justificable si evitan las hambrunas2– frente al de Robert Nozick –la propiedad privada es un derecho fundamental y como tal debe ser respetado3–, sin embargo, aunque ambos enfoques son totalmente contrarios tienen mucho sentido, por lo cual es bastante difícil decidirse por uno en particular. Fue de esta forma, enfrentando sus opiniones, que yo logré desarrollar una posición frente a estas dos perspectivas, y así dar mi opinión al DISERTACIÓN SOBRE JUSTICIA Y EQUIDAD SAYURI P. TAMURA M. Estudiante de Economía y Negocios Internacionales de la Universidad ICESI. respecto. Al final, llegué a una conclusión, que aunque no es la más original y tampoco es la única, tiene mucho sentido y seguramente de ser posible, la situación del país podría cambiar para bien.

  3. Impuesto sobre las transacciones financieras: Justicia fiscal


    Mariño, José Ramón


    7 p.[Variante del título de la publicación : Boletín electrónico de Hegoa] [ESP] El Impuesto sobre las transacciones financieras se basa en establecer un gravamen sobre las operaciones financieras con el fin de estabilizar los mercados como consecuencia de la disminución de la especulación a corto plazo. Además es una fuente de financiación de inversiones socialmente deseables. Diez países de la Unión Europea han expresado su deseo de introducir el ITF, sin emba...

  4. Investigación educativa reciente sobre México


    Núñez-DelaPeña, Francisco J.; Mejía-Arauz, Rebeca


    Se presenta una muestra de la investigación educativa sobre México: 22 disertaciones doctorales aceptadas en universidades norteamericanas entre 1982 y 1984. Dos estudios conciernen a la teoría del capital humano; cinco tratan diversos aspectos relacionados con la administración educativa; uno es sobre la televisión; otro sobre las habilidades fonéticas de los niños; uno más es sobre profesionalización de los médicos; cuatro tocan aspectos de política educativa; tres tratan sobre los maestros...

  5. Variação dos teores de constituintes voláteis de Cymbopogon citratus (DC Staf, Poaceae, coletados em diferentes regiões do Estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Marcos R. Furlan


    Full Text Available O óleo essencial extraído de Cymbopogon citratus (DC Staf, Poaceae, é rico em citral sendo amplamente empregado na indústria química e farmacêutica. Os objetivos desse estudo foram avaliar o conteúdo de citral entre populações de C. citratus coletados em duas regiões diferentes (Ibiúna e Pindamonhangaba, Estado de São Paulo. O óleo essencial extraído de uma população cultivada em Pindamonhangaba-SP apresentou uma concentração alta de citral (aproximadamente 96,0%, enquanto que o óleo extraído da população de Ibiúna-SP apresentou, além de citral, proporções elevadas de outro monoterpeno, o geraniol. Adicionalmente, os óleos essenciais obtidos desta população de C. citratus foram extraídos e analisados ao longo de 24 h (a cada 3 h, sendo que o teor de citral foi maior no período da noite, o que mostra a importância de estudos que avaliam as diferenças químicas associadas às mudanças circadianas. Os componentes dos óleos essenciais foram identificados por RMN de 13C, CG/EM e CG através do índice de Kovats.

  6. Sobre una Rodoficea parasita de Gelidiaceas


    Seoane Camba, Juan Antonio


    En este trabajo se hace un estudio de una Rodofícea parásita, encontrada sobre Gelidium cantabricum Seoane-Camba y Gelidium sesquipedale (Clemente) Thuret. Por sus características generales atribuímos esta planta al género Gelidiocolax. descrito por Gardner en 1927 para un parásito de Gelidium pulchrum Gardner de las costas americanas del Pacífico...

  7. Reflexiones sobre el concepto de justicia

    Directory of Open Access Journals (Sweden)

    Víctor C. Pascual Planchuelo


    Full Text Available Este ensayo constituye una reflexión sobre el concepto de Justicia. No se centra, como tantos estudios al respecto, en el plano teórico y metafísico, sino que atiende problemas de mayor actualidad: la opinión de los ciudadanos, la postura de los profesionales y otros asuntos controvertidos del ámbito del Derecho.

  8. Trayectorias (sobre ruedas): un ensayo visual sobre los carritos de supermercado en la ciudad


    Cruz, Edgar Gómez


    El siguiente trabajo es un breve bosquejo de las posibilidades del concepto de trabajo “trayectoria”. Una trayectoria no es sólo, en el sentido literal del término, el trazo del movimiento sobre un camino, sino que busca establecer una reflexión sobre las posibilidades de recolección de registros visuales/digitales/móviles para la investigación etnográfica desde la aleatoriedad del movimiento por la ciudad. El concepto de trayectoria busca dialogar con el de “flâneur” de De Certeau y Benjamin...


    Directory of Open Access Journals (Sweden)



    Full Text Available El asentamiento Brisas de San Isidro del Municipio de Popayán no presenta sistema de colección de aguas servidas, las cuales son vertidas directamente sobre la Quebrada Lame, ocasionando contaminación por la carga orgánica y detergentes provenientes del uso doméstico. El objetivo fue evaluar diferentes especies de gramíneas, buscando una alternativa de manejo de las aguas residuales domésticas con plantas útiles en la alimentación animal. Para tal fin se establecieron humedales artificiales bajo un diseño de muestreo temporal y un arreglo factorial de bloques al azar. Se tomaron las muestras de agua residual (pH, oxígeno disuelto (OD, concentración de CO2, demanda biológica oxigeno (DBO, demanda química oxigeno (DQO, conductividad, amonio (NH4+, nitratos (NO3-, fosfatos (PO4 y nitritos (NO2- y Demanda Bioquímica de Oxigeno (DBO5 cada quince días durante seis meses. El análisis estadístico, se realizó por medio de una ANOVA comparando los tratamientos expuestos y una prueba posthoc de Tuckey. El análisis de varianza, mostro diferencias estadísticas significativas para los parámetros oxígeno disuelto (OD, demanda química oxigeno (DQO, amonio (NH4+, nitratos (NO3-, nitritos (NO2- y coliformes totales; evidenciando que los mejores tratamientos fueron B. mutica y P. maximun

  10. II Jornadas sobre Emprendimiento Social y Colectivo


    Centro de Investigación en Gestión de Empresas


    La línea temática principal del encuentro es el emprendimiento social y colectivo así como las diferentes líneas de investigación de los institutos y centros de la Red relacionadas, como: responsabilidad social, empleo y reincorporación al trabajo, inserción laboral, servicios sociales y dependencia, género, cambios legislativos, utilidad social, medio ambiente, desarrollo local,... Centro de Investigación en Gestión de Empresas (2013). II Jornadas sobre Emprendimiento Social y Colectivo. ...

  11. Literatura infantil sobre problemas infantiles: la diabetes


    Lázaro Fernández, Patricia


    Debido al creciente número de casos de diabetes infantil que se está dando en la sociedad actual, no es raro encontrarse en las aulas cada vez más casos de esta enfermedad. Por esta razón, he decidido analizar dos libros sobre esta temática, para hacer un acercamiento del material seleccionado a las aulas y poder desarrollar junto con los niños un aprendizaje colectivo y cooperativo. En este trabajo se expone la importancia de la literatura y la literatura infantil como una ...

  12. Soportes apoyados sobre vigas pretensadas (EE. UU.

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo


    Full Text Available This work has been awarded a prize by the Prestreesed Concrete Institute. It refers to a number of flyovers on the Arroyo Seco, of California. This river has been canalized, to help drainage in case of heavy rainfall. The canal runs through a highly populated zone, and a motor road and accessory ramps had to cross the canal. The resulting design involves three prestressed girders, lightly arched in a parabolic outline, resting on each river shore, running along the line of the bridge, over the canal. It was decided that the bridge piles should not rest on the river bed, in order not to reduce its flow capacity. The girders of a maximum length of 39 ms, are box shaped, and stiffened with thin diaphragms. The cylindrical pile, 1.50 m in diameter, is an integral part of the girder, and applies to it a concentrated load of about 4000 tons. The girders rest on reinforced concrete cubes, which in turn are supported by concrete slabs and piles driven into the soil.Esta obra ha sido premiada por el Prestressed Concrete Institute y se refiere a una serie de pasos superiores sobre el Arroyo Seco, en California, que se ha canalizado para servir de desagüe en el caso de avenidas torrenciales. El canal se halla en una zona de edificación densa y se trata del paso—sobre aquél—de una autopista y rampas de acceso. La solución adoptada consistió en tres vigas pretensadas, ligeramente arqueadas con perfil parabólico, apoyadas en las dos márgenes y situadas en correspondencia con los tres soportes, sobre el propio canal, ya que ninguno de aquéllos debía apoyarse en el lecho de este último al objeto de no disminuir su capacidad de desagüe. Las vigas—de unos 39 m de longitud la mayor—son del tipo cajón, rigidizadas con unos diafragmas de pequeño espesor. El soporte cilíndrico, de 1,50 m de diámetro, se solidariza con la viga y le transmite una notable carga concentrada, del orden de 4.000 toneladas. Los apoyos de estas vigas son simples dados

  13. Ensayo sobre la melancolía

    Directory of Open Access Journals (Sweden)

    Marta Chacón Salinas


    Full Text Available Este trabajo es un intento de delimitar la melancolía del conjunto de los trastornos depresivos y de reflexionar sobre sus características tal como aparecen en el discurso de los melancólicos. Se consideran algunas hipótesis en la línea psicoanalítica freudiana y lacaniana (Lambottc, Kristeva para entender cómo se va constituyendo en sus características principales: la intolerancia a la pérdida del objeto y el desfallecimiento del símbolo que le impide elaborar este duelo.

  14. Comentarios sobre dibujo analítico


    Mata Botella, Elena


    Cuaderno de apoyo a la docencia del DIBUJO DE ARQUITECTURA que pretende hacer reflexionar al alumno (de primero o segundo de carrera) sobre un tipo de dibujo que aquí se ha llamado “dibujo analítico”. Un dibujo que a través de operaciones gráficas y conceptuales como la esquematización y la selección de información, tiende a alejarse de la descripción del objeto arquitectónico para adentrarse en determinados aspectos o dimensiones que subyacen en el proyecto arquitectónico. Unas notas intr...

  15. Sobre la evaluación docente


    Chamizo, José Antonio


    Las universidades requieren una reflexión profunda sobre sus metas primordiales para construir una cultura de la evaluación de la actividad de enseñanza, la cual es diferente de la de investigación. La idea principal es que el proceso de evaluación sumativa, burocrático, superficial y cerrado, sea transformado en uno que involucre a los profesores y sea y abierto. Universities require a deep reflection on their ultimate goals to build a culture of evaluation on teaching activities, which a...

  16. Refuerzo de pavimentos sobre arcillas expansivas


    Zornberg, Jorge


    El refuerzo de la capa base de pavimentos se ha utilizado a los efectos de: (i) aumentar la vida útil de un pavimento manteniendo el espesor de la capa base, o (ii) disminuir el espesor de la capa base manteniendo la vida útil del pavimento. Este artículo describe una tercera aplicación del refuerzo basal de pavimentos, a saber, la mitigación de grietas longitudinales inducidas en pavimentos construidos sobre subrasantes compuestas de arcillas expansivas. Aunque todavía existe la necesidad de...

  17. Cinco puntos sobre la revista Barcelona


    Bertone Crippa, Mauro


    El humor, como género y narrativa mediática, ocupa un lugar destacado al interior del campo del periodismo gráfico argentino. Como emergente contemporáneo dentro de este ámbito, la revista Barcelona se vuelve un objeto de estudio sugestivo al trabajar, a partir del registro del humor, sobre la agenda y la enunciación de los medios gráficos de actualidad. De esta manera, se analizan las condiciones de producción del discurso de Barcelona para ver qué novedades aporta al campo del hu...

  18. Observaciones sobre colostomía

    Directory of Open Access Journals (Sweden)

    Jaime Escobar T.


    Full Text Available Se hace una revisión sobre 133 casos de colostomías hechas en pacientes del Hospital San Juan de Dios de Bogotá en un período de cinco años; el 43.7 por ciento de los casos eran heridas por arma de fuego. La mortalidad global fue de 16.5 por ciento. La colostomía derivativa, en ASA, ha bajado la mortalidad en las heridas de colon en dicho hospital.

  19. Tributos sobre a folha ou sobre o faturamento? Efeitos quantitativos para o Brasil

    Directory of Open Access Journals (Sweden)

    Tiago V Cavalcanti


    Full Text Available Este artigo estuda os impactos alocativos e de bem-estar de uma reforma tributária que substitui os impostos sobre a folha de salários por outro que incide sobre a receita. Para isso, desenvolve-se um modelo neoclássico de crescimento econômico com impostos sobre a receita e sobre a folha de salários. As simulações com parâmetros da economia brasileira mostram que tal reforma tributária tem um efeito negativo no bem-estar, no estoque de capital de longo prazo e consequentemente no produto per capita de longo prazo. Contudo, o emprego aumenta.This paper studies the impacts of a tax reform which substitutes taxes on labor income by taxes on total revenue. In order to accomplish that, we construct and solve a general equilibrium neoclassical growth model with taxes on labor income and total revenue. The numerical simulations with Brazilian parameters show that such tax reforms would negatively affect welfare, the capital stock, and consequently per capita output. However, employment would increase. Such effects are quantitatively important.

  20. Sobre Geoestatística e mapas

    Directory of Open Access Journals (Sweden)

    Paulo Milton Barbosa Landim


    Full Text Available A Geologia, até há bem pouco tempo, era freqüentemente considerada uma ciência baseada em interpretações puramente qualitativas dos fenômenos geológicos. Nos últimos 40 anos, porém, tem sido notável a mudança da fase descritiva para a utilização de métodos quantitativos, principalmente na área da Geologia Aplicada. Entre tantos temas relacionados com a quantificação em Geologia o assunto abordado neste artigo, que pretende ser de cunho didático, diz respeito à aplicação da Geoestatística na confecção de mapas geológicos. Na primeira parte do trabalho é feita uma introdução sobre os aspectos quantitativos na interpretação dos fenômenos geológicos, em seguida conceitos básicos sobre a metodologia geoestatística e, na última parte, uma aplicação clássica da geoestatística linear, baseada nos conceitos de estacionaridade da covariância e do variograma, para a confecção de mapas.

  1. Estrategia educativa sobre sexualidad sana en adolescentes

    Directory of Open Access Journals (Sweden)

    Carmen Olivera Carmenates

    Full Text Available Se realizó un estudio de intervención con el objetivo de elaborar una estrategia educativa para incrementar conocimientos sobre sexualidad sana en un grupo de adolescentes de la escuela Secundaria Básica Alfredo Gómez del Municipio Camagüey entre octubre de 2012 y febrero de 2013. La muestra fue de 37 estudiantes. Se aplicó una encuesta que se convirtió en el registro primario de datos, confeccionada según criterios de expertos y la bibliografía. Una vez analizados los resultados se procedió a diseñar la estrategia educativa y posteriormente a su evaluación. Los datos se procesaron de forma automatizada. Antes de aplicar la estrategia educativa se comprobó que los adolescentes no tenían un adecuado conocimiento sobre la sexualidad sana. Los resultados demuestran la importancia de los estudios de intervención.

  2. Apuntes sobre el Cultivo del Cacao

    Directory of Open Access Journals (Sweden)

    Ochoa Horacio


    Full Text Available Por muchos años permaneció el cultivo del cacao en nuestro país, en un deplorable atraso técnico; el agricultor a duras penas si tenía conocimientos generales de su explotación y, de una industria que tuvo su auge debido a la extensividad de las plantaciones, hoy sólo resta una reducida porción de ella. ¿Qué factores operaron esa tan notoria reducción hasta el punto de que exportadores en otros tiempos nos convertimos en importadores obligados de ese producto? Hay muchas razones de orden técnico y de orden económico. Los cacaotaleros obtenían halagadoras retribuciones cuando el jornal consistía en la alimentación que se le daba a la peonada y cuando, generoso, añadía una sobretasa en dinero. Bajo ese sistema de explotación, el descuadre que pudiera ocasionar tanto las enfermedades criptogámicas como los plagas, no era suficiente como para provocar el pesimismo en el hacendado y por tanto inducirlo al abandono de la plantación. A medida que las condiciones sociales del campesino se fueron modificando y su standard de vida aumentaba, cambió fundamentalmente el mecanismo de la industria Se observó entonces que los árboles morían y que era pobre la producción; que lo que en tiempos pasados fuera un negocio lucrativo, se les había convertido en una actividad improductiva y, para controlar estos fenómenos que se generalizaban en todas las zonas cacaotaleras, opusieron la ignorancia, el rutinarismo y la desidia. Lentamente se han ido modificando los conceptos antiguos sobre el trabajo cultural y los cuidados que con relación a las enfermedades y plagas requiere este delicado cultivo; la rutina está echando paso atrás y las experiencias científicas que procuran la prosperidad del plantío, se ponen en práctica en algunas zonas . Esto da esperanza para la reconstitución de la industria cacaotalera en nuestro país, que cuenta con inmensas regiones de óptima calidad para hacerla florecer sobre bases nuevas, con

  3. Sobre a moralidade do direito em Kant

    Directory of Open Access Journals (Sweden)

    Joãosinho Beckenkamp


    Full Text Available Na atual literatura sobre a fi losofi a prática de Kant há uma tendência a negligenciar a distinção feita na Metaphysik der Sitten entre direito (Jus e ética (Ethica, a ponto de ser a doutrina do direito de Kant vista como uma mera aplicação do imperativo categórico. Este artigo procura mostrar que Kant apresenta em sua doutrina do direito uma série de argumentos que logram estabelecer o direito de modo inteiramente independente da ética.

  4. Zubiri et alii sobre la consciencia

    Directory of Open Access Journals (Sweden)

    Solari, Enzo


    Full Text Available In recent literature on science and philosophy related to consciousness, the description and analysis are not always appropriate for the phenomenical consciousness that one wants to explain. From this one can sustain, contrary to some approaches to neuroscience and analytic philosophy, that the fact of consciousness previously requires a better phenomenological description and a more precise conceptual analysis.En la reciente literatura científica y filosófica sobre la consciencia no siempre se describe ni analiza adecuadamente cuál es esa consciencia fenoménica que se desea explicar. De ahí que se argumente, contra ciertas aproximaciones de la neurociencia y la filosofía analítica, que el hecho de la consciencia necesita previamente de una mejor descripción fenomenológica y de una más ajustada analítica conceptual.

  5. Notas de historia sobre ética


    Hernando Forero Caballero


    La primera reglamentación de que se tiene noticia sobre la profesión médica es la dictada por el rey Hamurabi de Babilonia, en la cual se protocolizó el códice que lleva su nombre, hacia los 2000 años antes de Cristo. En el Egipto antigua, los libros Herméticos del Dios Thoh contenían profundos preceptos de moral médica y conceptos científicos importantes de la medicina de entonces. En Persia y Arabia, los libros  Zendavesta y Vendia contenían principios de deontología médica, lo mismo que en...

  6. Reflexiones sobre contabilidad privada y contabilidad nacional

    Directory of Open Access Journals (Sweden)

    José Arturo Gutiérrez


    Full Text Available Se discuten las interrelaciones de la contabilidad privada y la contabilidad nacional, insistiendo en sus condicionantes internos contradictorios en relación con la sobredeterminación de la formación económico-social vigente. En relación con ello se introduce la reflexión sobre la unidad contradictoria entre empresa y capital, esto es, la base técnica frente a su determinante socioeconómico, conflicto que la propia contabilidad privada expresa: al describir el capital aporta necesariamente el conocimiento de la producción social. De allí su probable compatibilidad con el propósito de la contabilidad nacional, y, por extensión, ambiental.


    Directory of Open Access Journals (Sweden)

    Gabrie Rodrigues da Silva


    Full Text Available Entre os dias 10 e 13 de Outubro de 2008 ocorreu na Universidade Federal de Goiás – UFG campus de Catalão a IX Jornada sobre o Trabalho. Evento realizado anualmente pelo CEGeT (Centro de Estudos de Geografia do Trabalho, da UNESP/FCT campus de P. Prudente. No entanto, no ano de 2006 foi realizado na UNIOESTE campus de Marechal Cândido  Rondon/PR, através da iniciativa do Geolutas (Grupo de Estudos das Lutas no Campo e na Cidade que se prontificou a iniciar uma nova fase do evento, a de migração para outras Universidades, onde existem as células do CEGeT.

  8. Sobre el Boletín

    Directory of Open Access Journals (Sweden)

    Andrés Arias


    Full Text Available En la página de Internet de la Biblioteca Luis Ángel Arango se indica que una de la funciones principales del Boletín es la de reseñar la novedades bibliográfica que van apareciendo en el país. "Novedades": de lo nuevo, tanto en las publicaciones como en las reseñas. Es decir, si lo que asegura la página de la Biblioteca es cierto, quien se acerca al Boletín debe encontrarse con comentarios recientes sobre libros recientes. Con guía que le ayuden a elegir entre las mil ofertas que hay en el mercado bibliográfico. Pero bien sabemos que este objetivo no se cumple.

  9. Notas de historia sobre ética

    Directory of Open Access Journals (Sweden)

    Hernando Forero Caballero


    Full Text Available La primera reglamentación de que se tiene noticia sobre la profesión médica es la dictada por el rey Hamurabi de Babilonia, en la cual se protocolizó el códice que lleva su nombre, hacia los 2000 años antes de Cristo. En el Egipto antigua, los libros Herméticos del Dios Thoh contenían profundos preceptos de moral médica y conceptos científicos importantes de la medicina de entonces. En Persia y Arabia, los libros  Zendavesta y Vendia contenían principios de deontología médica, lo mismo que en el Código de Manu de las Indias y en los libros de la época de Confucio en la China.

  10. Notas sobre Matisia longiflora Gleas. (Bombacaceae Notas sobre Matisia longiflora Gleas. (Bombacaceae

    Directory of Open Access Journals (Sweden)

    Fernández Alonso José Luis


    Full Text Available Dentro del grupo de géneros de bombacáceas de hojas simples que componen la tribu Quararibeae (= Matisieae Hutchinson, es Matisia Humb. & Bonpl. el que cuenta con mayor número de especies en Colombia. Al respecto se presentaron recientemente algunas consideraciones preliminares sobre la diversidad de especies en este grupo en Colombia (Fernández Alonso, 1991.

  11. Miradas francesas sobre la Guerra Civil

    Directory of Open Access Journals (Sweden)

    Jean-Marc DELAUNAY


    Full Text Available Como muestra el asunto hoy vigente —pero relativamente discreto— de la venta del edificio que abrigó el antiguo taller parisino donde Picasso hizo su Guernica (1937, la Guerra Civil española sigue siendo en Francia una referencia mayor de la historia contempóranea. Al ritmo de las conmemoraciones decenales de su estallido (1996/2006, se ha desarrollado una verdadera marea memorial nutrida tanto por la apertura de archivos escritos y audiovisuales como por la desinhibición de los nietos de exiliados condicionados durante tanto tiempo por la historia de la derrota de sus padres y abuelos. Animan el debate las tribulaciones de la vida política española actual, entre neofranquismo, republicanismo y nacionalismos centralistas y/o regionales. Por haber sido la unica vía de salida, Francia —metropolis y África del norte— se vio más involucrada que cualquier otro país al recibir la aplastante mayoría de los exiliados. Aunque los verdaderos especialistas en dicha guerra son poco numerosos, todo un mundillo se ha otorgado el derecho y la capacidad de escribir sobre ella como descendientes de exiliados o activistas políticos, sobre todo en el sur de Francia. Todos los medios se ven afectados: desde la literatura estrictamente histórica al internet. De las obras eruditas, de vulgarización —también para la juventud— a las memorias arrancadas al olvido; de las actas de los coloquios a los tebeos; de los álbumes fotográficos a los documentales (siempre pro republicanos. Al tiempo toda la producción histórica generalista o militar junta a los partidarios de una visión anticomunista, neutralista o manifestamente pro franquista. La Guerra Civil española, que había encontrado una Francia dividida, la reencuentra de nuevo como tal a pesar de todos los intentos de mediación científica.

  12. Reflexiones sobre la crisis. Vidas y Memorias

    Directory of Open Access Journals (Sweden)

    Estela Vázquez


    Full Text Available El artículo se plantea analizar la deslegitimación de la política y de los políticos, así como del acto de votar. Encuadrado en el marco del contexto de la crisis argentina de los últimos años, quiere responder, por medio de la entrevista oral y la historia de vida, a cómo se ve desde la ciudadanía el ejercicio de la democracia, las prácticas políticas, la alternancia en el poder y de qué forma todo esto influye en las vidas personales de los entrevistados. Asimismo, se entrelaza el análisis del espectáculo político con el público que ofrecen los medios de comunicación y de entretenimiento, con lo que se viene a concluir que es cada vez más difícil distinguir en el debate social la ficción de los hechos y personajes verdaderamente reales. Para este trabajo se analizan tres trayectorias laborales de ex-empleados de la administración pública, y sus apreciaciones sobre el despido, vinculando estas experiencias de vida a la formación de sus ideas sobre la política y los políticos.. Sus lugares de trabajo eran el Registro Civil, la Secretaría de Educación y la Legislatura, respectivamente.__________________ABSTRACT:This article tries to analyse the discredit of politics and politicians along with the act of voting. Placed in the context of the Argentine crisis, it wants to determinate through oral interview and life story how citizens see the exercise of democracy, the political practices and the power switching, to establish how they have influenced in the lifes of the persons being interviewed. At the same time, it interlaces an analysis of he political spectacle shown to the public by the media, to conclude that is becoming more a more difficult to distinguish the fiction from the real characters in the social debate.

  13. El puente Bendorf sobre el Rin (Alemania

    Directory of Open Access Journals (Sweden)

    Hirschfeld, Kurt


    Full Text Available This recently completed bridge over the Rhine is 524 m long, and is a reinforced concrete structure, built by successive overhangs, without the aid of formwork or scaffolding. The centre span is 208 m in length, and the other six vary between 43 and 71 m. The deck consists of two independent parts, including a continuous box girder, with a hinge at the crown of the main span. It is stiffened with transversal diaphragms, spaced every 34 m. The piles rest on pneumatic caissons, which go down to 16 m below the river bed. The attachment between the piles and the caissons is rigid, at the central pile, and at the other piles it operates through a roller bearing. The central span was constructed without intermediate supports for the first 40 m, and beyond that stage, for greater safety, a provisional movable tower was built, as a temporary point of support for the free overhang. The various sections were concreted and post-tensioned with 32 mm bars, by the Dywidag procedure. Account was taken of the varying deformations that took place at each section, so as to add the necessary counter-deflection that finally enabled the two sides of the arch to meet at the crown at the calculated point.Este puente, recientemente construido, sobre el Rin, tiene una longitud total de 524 m, es de hormigón armado y se ha realizado por el procedimiento de voladizos sucesivos, sin entramado auxiliar ni cimbras. La luz del tramo central es de 208 m, y las de los otros seis oscilan entre 43 y 71 m. La estructura del tablero se compone de dos partes independientes, formadas por una viga tipo cajón, continua, con una articulación en la clave del tramo central y rigidizada con diafragmas transversales espaciados a 34 m. Las pilas centrales se apoyan sobre cajones neumáticos que descienden 16 m debajo del fondo del río. La unión entre estas pilas y la estructura cajón es rígida, y de tipo rodillo en las otras pilas. El tramo central se ha construido por voladizos



    Coelho de Britto, Sabrina Maria; de Souza Ramos, Raquel; dos Santos, Érick Igor; da Silva Veloso, Olga; Melo da Silva, Aline; de Aguiar Mariz, Rosângela Guiomar


    Introdução: O presente estudo refere-se a um processo de investigação sobre a representação social dos enfermeiros sobre cuidados paliativos. Objetivos: identificar a estrutura das representações sociais dos enfermeiros sobre cuidados paliativos; discutir as repercussões dessas representações no cotidiano da prática assistencial. Materiais e Métodos: Para a realização deste estudo foram abordados 70 enfermeiros que atuam nas enfermarias do serviço de Clínica Médica. A técnica para coleta de d...

  15. Pistas para pensar las significaciones imaginarias sobre la invariancia


    Bilyk, Pablo Andrés


    Este escrito propone un primer esbozo de nominalizaciones sobre las significaciones imaginarias en torno a la idea de invariancia, con el fin de comenzar a mapear categorías para transitar que nos permitan pensar las construcciones fantasmáticas sobre el no-cambio. En definitiva, se trata de avanzar sobre la problematización de los modos de funcionamiento, constitución y reconfiguraciones de las hegemonías en los entramados sociales contemporáneos. Facultad de Periodismo y Comunicación Soc...

  16. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.


    Full Text Available The author continues the development of the subject «Modern Timber Formwork», by summing up the comparative examination —already carried out in Part III of this Study— of the different types of glued timber existing on the market. In addition, the loads and stresses allowable for coniferous timber and the proposal for establishing Regulations for the Timber Section of the Research and Experimental Forestry Institute of Spain are given. In part V of the author's Study, published in this article, the important subject of the glues used for joining timber, a truly vital point in order to obtain louvered timber beams which are simply glued together, is approached.

    El autor continúa el desarrollo del tema sobre «Encofrados de madera modernos», resumiendo el estudio comparativo —ya hecho en la Parte III de este Estudio— de las diferentes vigas de madera encolada existentes en el mercado dando, además, las cargas y tensiones admisibles para maderas coníferas y la propuesta de Reglamentación de la Sección de Maderas del Instituto Forestal de Investigaciones y Experiencias de España. En la parte V del Estudio del autor, publicada en este articulo, se aborda el importante tema de las colas empleadas para las uniones de madera, algo realmente vital para la obtención de vigas de madera en celosía simplemente encoladas.

  17. Sobre a diversidade de sentidos de comunidade

    Directory of Open Access Journals (Sweden)

    Silva, Rosalina Carvalho da


    Full Text Available Nosso objetivo neste trabalho foi realizar algumas reflexões sobre as implicações da expansão do uso do termo comunidade e sua diversidade de sentidos. Pretendemos discutir os usos indiscriminados do termo nem sempre acompanhados da devida reflexão e crítica. A partir das perspectivas da sociologia, saúde e psicologia social identificamos que o termo ainda permanece arraigado aos ideais de comunidades naturais próprios aos períodos do feudalismo e do pós-revolução industrial. Esta concepção pode camuflar formas impositivas de trabalho em muitos dos quais o termo comunidade é empregado praticamente como sinônimo de população-alvo e participação comunitária é vista meramente como freqüência às atividades propostas por profissionais que determinam quem são as comunidades. Comprometem-se assim, as práticas emancipatórias. Para repensarmos comunidades, hoje, consideramos necessário relevar os aspectos processuais relacionais, dialógicos e identitários em constantes mudanças. Assim, a condição de comunidade extrapola a delimitação geográfica para as possibilidades de pertencimento e participação através dos espaços simbolicamente delimitados


    Directory of Open Access Journals (Sweden)

    Edilene Leal


    Full Text Available Nesse artigo, procedemos a uma análise sobre a irracionalidade da guerra em tempos cada vez mais caracterizados pela evolução da racionalidade técnica, ou seja, em tempos contemporâneos. Esse é o ponto a partir do qual traçamos, aqui, um percurso argumentativo dividido em duas partes. Na primeira, reconstituímos elementos da concepção de guerra de filósofos como Maquiavel, Clausewitz e Kant, destacando, nos dois primeiros pensadores, a prerrogativa de que a guerra é racional quando se configura meio para fins políticos. Na segunda parte, confrontamos essa racionalidade política da guerra com a dupla dimensão técnica que a guerra assumiu: de um lado, a guerra como um fim em si mesmo e não mais como meio da ação política; de outro, a dimensão racionalizante da guerra como resultado do progresso técnico e científico, atualizada como guerra do terror.

  19. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.


    Full Text Available This article is a compendium of almost all of the existing literature, in addition to important contributions by the author, on forms —an important aspect of the building industry, as their cost is not infrequently as high or higher than that of the actual concrete poured. Thus, to the benefit of architects, engineers, site supervisors and carpenters, data are provided, as well as charts and calculations for a rational use of these forms, whether wooden, metal or of other material.

    En esta artículo sa compendia casi toda la literatura existente, así como importantes aportaciones del autor, sobre encofrados, capítulo importante en la construcción, ya que su costo resulta no pocas veces tan elevado o más que el propio hormigón vertido. Así, pues, en beneficio de arquKectos, ingenieros, encargados y carpinteros, se dan datos, cuadros y abacos para el empleo racional de los citados encofrados, sean de madera, metálicos, etcétera.

  20. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.


    Full Text Available This article is a compendium of almost all of the existing literature, in addition to important contributions by the author, on forms —an important aspect of the building industry, as their cost is not infrequently as high or higher than that of the actual concrete poured. Thus, to the benefit of architects, engineers, site supervisors and carpenters, data are provided, as well as charts and calculations for a rational use of these forms, whether wooden, metal or of other material.

    En este artículo se compendia casi toda la literatura existente, así como importantes aportaciones del autor, sobre encofrados, capítulo importante en la construcción, ya que su costo resulta no pocas veces tan elevado o más que el propio hormigón vertido. Así pues en beneficio de arquitectos, ingenieros, encargados y carpinteros se dan datos, cuadros y ábacos para el empleo racional de los citados encofrados, sean de madera, metálicos, etc.

  1. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.


    Full Text Available This article is a compendium of almost all of the existing literature, in addition to important contributions by the author, on forms —an important aspect of the building industry, as their cost is not infrequently as high or higher than that of the actual concrete poured. Thus, to the benefit of architects, engineers, site supervisors and carpenters, data are provided, as well as charts and calculations for a rational use of these forms, whether wooden, metal or of other material.

    En este artículo se compendia casi toda la literatura existente, así como importantes aportaciones del autor, sobre encofrados, capítulo importante en la construcción, ya que su costo resulta no pocas veces tan elevado o más que el propio hormigón vertido. Así pues en beneficio de arquitectos, ingenieros, encargados y carpinteros se dan datos, cuadros y ábacos para el empleo racional de los citados encofrados, sean de madera, metálicos, etc.

  2. Considerações sobre Agamben

    Directory of Open Access Journals (Sweden)

    Luiz Hebeche


    Full Text Available Giorgio Agamben em pequenos artigos, entrevistas e baixo-assinados tem chamado a atenção para o estado de abandono do povo palestino, mas curiosamente esse assunto não é tratado em suas obras mais importantes. Em Homo sacer, por exemplo, ele retoma o termo “muçulmano”, comumente empregado pelos prisioneiros dos campos de concentração como a expressão do maior abandono possível da existência humana, mas não reflete suficientemente sobre a origem dessa palavra, isto é, de que nessa expressão já se encontrava o ódio e o desprezo do sionismo, não só entre os próprios prisioneiros, mas pelo povo palestino e pelos árabes em geral. A seguir comentaremos brevemente algumas obras desse autor que, dando continuidade à ideologia da vitimação, faz com que, mais uma vez, o passado inominável acabe encobrindo o presente abominável.

  3. Apuntes sobre el Cultivo del Cacao

    Directory of Open Access Journals (Sweden)

    Chavarriaga. Eduardo


    Full Text Available El sombrío constituye uno de los problemas que se presentan en el cultivo del cacao, de necesaria resolución para ayuda del agricultor en su labor al producir tan importante grano. Contribuye a la economía del cultivo un conocimiento amplio de la cuestión que debe preocupar al productor inquiriendo no solamente por lo acostumbrado en la región, sino por lo que en otras partes se conoce sobre el particular, para abandonar un poco el emperismo y hacer una industria cada día más próspera. Como razón a favor del sombrío, tenemos los países en donde se produce cacao de fina calidad; Trinidad, Venezuela. Nicaragua, siempre acostumbran la sombra; y sin ir muy lejos, en el Valle del Cauca, donde no se cultiva a pleno sol y se obtienen plantaciones de larga duración y producto superior, es bien conocido el beneficio de ella; allí, los agricultores conocen los desastrosos efectos que ocasiona la falta de sombra, cuando por cualquier causa mueren los árboles que la suministran. Por tanto, en este estudio indicaremos el uso de la sombra para el cacao, como el medio de conservar la fertilidad y buenas condiciones del suelo, obtener buenos rendimientos y asegurar larga vida a la plantación.

  4. Análisis sobre la factibilidad de implementar un producto de derivados sobre gas natural en Colombia


    Dowd Aguirre, Jessica Alexandra; Tirado Naranjo, Lina María


    El objetivo de este trabajo es realizar un análisis sobre la factibilidad de implementar un producto de derivados sobre gas natural en Colombia dado el desarrollo del sector y la importancia de este hidrocarburo como fuente alternativa de generación eléctrica. 73 p. Contenido parcial: Situación actual del mercado de gas natural colombiano -- Expectativas del mercado de gas natural colombiano -- Mercados de derivados sobre gas natural en Europa y Estados Unidos -- Mercado de gas natural ...

  5. Sobre manhãs, humor e atos de fala

    Directory of Open Access Journals (Sweden)

    Joana Plaza PINTO

    Full Text Available RESUMO Este ensaio apresenta uma trajetória de leituras de Frege a Austin, intermediadas pela interpretação independente e ousada de Kanavillil Rajagopalan. Ao argumentar sobre uma gama de aproximações teóricas entre Frege e Austin, este ensaio narra a importância da interpretação de Rajagopalan para o debate sobre Austin no Brasil.

  6. Variaciones sobre el concepto de ética


    Pérez Oliva, Elizabeth; Velasco, José Armando


    A lo largo de la historia, pensadores han dado ideas y teorías sobre la ética, pero todos concuerdan en que es una arte de la filosofía que trata de los actos morales, normas de conducta sobre el bien y el mal en el ser humano; término desarrollado a través del tiempo.

  7. Liberalismo versus republicanismo: notas sobre o conceito de liberdade.

    Directory of Open Access Journals (Sweden)

    Felipe Nunes


    Full Text Available Este artigo tem como objetivo contrastar as perspectivas liberal e republicana sobre o conceito de liberdade. Através da comparação feita entre os dois modelos tecemos considerações sobre a realidade brasileira tendo como foco o atual estado de crises advindas dos casos de corrupção no país.


    Directory of Open Access Journals (Sweden)

    Carla Letuza Moreira e Silva


    Full Text Available Este estudo é um recorte da tese de doutoramento apresentada em 2012, no Programa de Pós-Graduação e Letras e Linguística da Universidade Federal de Alagoas (UFAL, em Maceió, sobre os discursos da/sobre a criança e as infâncias, no Brasil. O objetivo central é o de apresentar os efeitos de sentido que demandam dos dizeres oficiais no Estatuto da Criança e do Adolescente (ECA, 1990 em vigor no Brasil, sobre a criança, e que determinam modos de pensar e agir sobre as crianças e a infância na contemporaneidade. As noções de sujeito e formação discursiva da análise do discurso francesa (AD, iniciada em Pêcheux (1997, permeiam as análises e elucidam os papéis históricos e ideológicos que determinam e são determinados nos/pelos dizeres dos discursos da/sobre. Faz-se necessário, portanto, adentrar os discursos da e sobre a criança e a infância para entender as contradições e os confrontos dos discursos entre dizeres e silenciamentos.

  9. Reflexiones sobre Enfermería

    Directory of Open Access Journals (Sweden)

    Inés Durana Samper


    Full Text Available

    agosto 6 de 1992

    Presentación ante la Academia Nacional de Medicina
    Señores miembros de la Junta Directiva, académicos, enfermeras, señores, señoras:

    Para ingresar como Miembro Asociado de esta ilustre Academia Nacional de Medicina, quiero exponer algunas reflexiones sobre la evolución en Colombia de la enfermería, mi profesión, ejercida ininterrumpidamente en estos últimos cuarenta años. Amanera de colofón, me referiré a la función esencial de la enfermera, es decir a su consagración al arte de cuidar.

    La metodología aplicada en este trabajo incluye la revisión de archivos, la lectura de publicaciones y, además, algunas entrevistas con personas que pacientemente escucharon mis preguntas y ampliaron mi información con valiosos comentarios.

    Mis agradecimientos van, en primer término, al académico Fernando Serpa Flórez, quien ha tenido la iniciativa de presentarme a la Academia Nacional de Medicina; también va para aquellos académicos que respaldaron mi aceptación en esta prestigiosa sociedad científica. Igualmente expreso mi reconocimiento al académico Héctor Pedraza Mendoza, autor del primer libro conocido sobre reseña histórica de la enfermería en el país, y a quien correspondió, como funcionario de la administración pública, la orientación y control de la profesión en su cargo de Jefe de la División Infantil y Materna del entonces Ministerio de Trabajo, Higiene y Previsión Social. Libro citado con frecuencia’ durante el trabajo.

    Mis agradecimientos también a mis profesores, y entre ellos, en especial, al académico Alberto Albornoz- Plata. No puedo pasar por alto la memoria de los siempre recordados, doctores Jorge Boshell Manrique y José Pablo Leyva, quienes, desde la Escuela Superior de Higiene, supieron orientarme en la transformación académica del


    Directory of Open Access Journals (Sweden)

    Rodríguez S. Liliana


    Full Text Available El comportamiento climático del planeta y sus consecuencias han propiciado debates sobre los modelos de desarrollo de los países responsables del deterioro acelerado del ambiente y de los fenómenos naturales por estos días recurrentes. Sin embargo, países como Estados Unidos, luego de firmar compromisos como la Convención sobre Cambio Climático, rehúsan adquirir las obligaciones del Protocolo de Kyoto, por temor a sufrir deterioro en sus economías. En este escenario, donde la nación responsable de la emisión de aproximadamente 36% de los gases efecto invernadero resultado de la acción humana en el planeta no se compromete a adoptar políticas restrictivas tendientes a hacer sus modelos de producción más amigables con la naturaleza a pesar de que dichas medidas empiezan a ser impuestas a otras naciones como condicionantes en las negociaciones comerciales internacionales, parece ser que la adopción del Protocolo de Kyoto para países en desarrollo como Colombia no es del todo benéfica.

  11. Sobre el genio de las mujeres

    Directory of Open Access Journals (Sweden)

    Valcárcel, Amelia


    Full Text Available Not available.

    A los varones, desde Tácito a Schopenhauer, nunca les ha parecido que las verdaderas mujeres son las que tienen en casa, sino las que tienen los otros varones (los germanos, los orientales. Por su parte, Wojtyla ha hecho profesión de fe «en el genio de las mujeres», reclutando enternecidos agradecimientos como el de Macciochi. La autora del presente artículo adopta una perspectiva histórica y una actitud analítica para aclarar qué es ese genio que como genérico nos adjudican. En primer lugar, la idea de genio es romántica y va emparejada con la de destino, sobre todo en el caso de los genios colectivos. Se trata de nociones que se construyen estipulativamente con fines pragmáticos y no admiten, por definición, contraejemplos. En el caso del genio de las mujeres, los llamados «valores femeninos» que lo constituyen pertenecen al ámbito de la Siulichkeit, y su eventual convalidación en el de la Moralitiit no puede obviar el proceso consistente en la crítica y el desmarcarse de una Sittlichkeit adjudicada como estereotipia que se contrasta, no con otra estereotipia simétrica, sino con lo universal, que se solapa con el genérico masculino. La autora, por último, nos recuerda que la fabricación de este genio que, a título de colectivo, se nos atribuye a las mujeres tiene lugar a costa de la usurpación de nuestra individualidad y de la ausencia de esquemas pragmáticos de reconocimiento de la genialidad individual que pueda producirse en el genérico femenino. Ahora bien: es esta última la que las mujeres necesitamos para poder romper con las tradiciones establecidas e instituir nuevos relatos.

  12. Construcciones en yeso proyectado sobre vegetales

    Directory of Open Access Journals (Sweden)

    Martínez, Hubert


    Full Text Available A construction method developed in early 1981 in Senegal, whose main objective is the evaluation of natural and human sources, specially those of wild vegetables and the phosphogypsum (a waste of chemical industry in Senegal. The introduction of the mechanical projection allows a noticeably growth in work performances and an improvement of the quality. The projection reduces de number of trades intervening in the work, doing away with plasters, watertightness systems and paintings, and simplifying the setting of technical installations and of carpentry. The acquisition of this projecting material is not very expensive, so, it is easy for small and medium enterprises to reach an expertness in gypsum work. Its finantial rentability is assured for a prize of the gypsum of 180% of the prize of the cement.Procedimiento de construcción desarrollado al comienzo de 1981 en el Senegal, teniendo como objetivo la valoración de las fuentes naturales y humanas, especialmente los vegetales en estado silvestre y el fosfoyeso, residuo de la industria química del Senegal. La introducción de la proyección mecánica permite aumentar sensiblemente el rendimiento del trabajo y mejorar la calidad. La proyección reduce el número de oficios que intervienen en la obra por la supresión de enlucidos, sistemas de estanquidad y pinturas sobre la gruesa obra y simplifica la colocación de las instalaciones técnicas y de carpintería. La adquisición del material de proyección, necesitando un capital relativamente modesto, se encuentra al alcance de pequeñas y medianas empresas que deseen especializarse en los trabajos de yeso. La rentabilidad financiera del procedimiento está asegurada para un precio del yeso de hasta el 180% del precio del cemento.

  13. Sobre el estado evolutivo de β Pictoris (United States)

    Brunini, A.; Benvenuto, O. G.

    Desde el descubrimiento de fuertes excesos infrarrojos en β Pictoris, esta estrella ha sido muy estudiada y es considerada candidata a poseer un sistema planetario propio. β Pic está rodeada de un disco asimétrico de polvo que se observa de canto y que esta vacío a distancias de la presencia de (al menos) un planeta gigante. Recientemente se han observado líneas de material circunestelar que se han interpretado como consecuencia de la caída de objetos cometarios sobre esta estrella. Recientemente se ha utilizado la existencia del disco de polvo para atribuir una edad corta (pre - secuencia principal) a βPic. Sin embargo, la evaporación de estos cometas provee suficiente polvo como para explicar la presencia del disco observado sin necesidad de edades cortas. En este trabajo mostramos que la comparación entre la tasa de impactos cometarios estimada en el Sistema Solar para diferentes etapas de su evolución y los datos observados en β Pic indica edades avanzadas para β Pic. Esta estimación debe tomarse con cautela ya que depende de la estructura de los sistemas planetarios. Además mostramos que, desde el punto de vista de la evolución estelar y con las incertezas presentes en la luminosidad y la temperatura efectiva, existe un continuo de edades posible para β Pic. Sin embargo, empleando los datos provenientes de los flujos cometarios encontramos que una edad prolongada es consistente con ambos tratamientos.

  14. Considerações sobre o Mercosul

    Directory of Open Access Journals (Sweden)

    Ricardo Seitenfus


    Full Text Available Após traçar as origens históricas e conjunturais do processo de integração na Bacia do Prata, o autor analisa as características do Tratado de Assunção, através de um organograma detalhado. Na segunda parte, três questões sem resposta são colocadas aos leitores, ou seja, o processo de institucionalização envolvendo a constituição de um espaço supranacional que estará diretamente vinculado aos objetivos do processo; as relações do Mercosul com o Nafta e a definição de um quadro de cooperação e, finalmente, coloca a questão sobre o nível de participação do Estado no processo integracionista sob a ótica da necessidade de reconversão de certos setores econômicosIn the first part of this article, the author, after delineating the historical and circumstancial sources regarding the process of integration in the Prata Basin, analyses the characteristics of the Traty of Asunción (Paraguay through a detailed organizational chart. In the second part, three open questions are discussed: (a the process of institutionalization which involves the constitution of some supranationalization which invoves the constitution of some supranational space which will be closely related to the objectives of the process; (b the relationships between the Mercosul and the Nafta and the definition of a cooperative program; (c the level of participation of the State into the integrationist process under the dear need of a reconversion of some economic sectors.

  15. Estudio sobre encofrados de madera modernos

    Directory of Open Access Journals (Sweden)

    de la Peña Aznar, Juan M.


    Full Text Available The author continues the development of the subject «Modern Timber Formwork», by summing up the comparative examination —already carried out in Part III of this Study— of the different types of glued timber existing on the market. In addition, the loads and stresses allovk/able for coniferous timber and the proposal for establishing Regulations for the Timber Section of the Research and Experimental Forestry Institute of Spain are given. In part V of the author's Study, published in this article, the important subject of the glues used for joining timber, a truly vital point in order to obtain louvered timber beams which are simply glued together, is approached.

    El autor continúa el desarrollo del tema sobre «Encofrados de madera modernos», resumiendo el estudio comparativo —ya hecho en la Parte III de este Estudio— de las diferentes vigas de madera encolada existentes en el mercado dando, además, las cargas y tensiones admisibles para maderas coníferas y la propuesta de Reglamentación de la Sección de Maderas del Instituto Forestal de Investigaciones y Experiencias de España. En la parte V del Estudio del autor, publicada en este artículo, se aborda el importante tema de las colas empleadas para las uniones de madera, algo realmente vital para la obtención de vigas de madera en celosía simplemente encoladas.

  16. Perspectivas sobre la comunicación

    Directory of Open Access Journals (Sweden)

    María Luisa Naranjo Pereira


    Full Text Available Existen diversas teorías, enfoques y modelos de comunicación; de cada uno de ellos pueden rescatarse aspectos de gran valor para el logro de una comunicación eficaz. Este documento presenta una revisión de esos aspectos, para que se pueda comprender mejor y enriquecer uno de los procesos más importantes para el ser humano: el proceso de comunicación. Este es un ensayo en el cual se da a conocer la posición de la autora sobre el tema abordado. Se rescata el acento del enfoque humanista en la relación humana y en las etapas donde se desarrolla. A partir de la comunicación pragmática, se analizan los axiomas comunicacionales en que se fundamenta y lo que se conoce como patologías de esos axiomas. Además se revisan las principales características que distinguen la asertividad en la comunicación y las distintas formas de manipulación que la entorpecen. Del enfoque de Virginia Satir, se presentan los diversos aspectos de la comunicación, tanto funcional como disfuncional y los modelos de comunicación propuestos por esta autora. Se revisan aspectos importantes del enfoque de la comunicación educativa, tales como el control de la distancia, la voz y el cuerpo, las palabras y el situacional; así como los elementos que bloquean el proceso de comunicación y las sugerencias acerca de formas correctas de escuchar. Además, se hace referencia a la necesidad de emplear procesos educativos más holísticos y constructivistas y una comunicación-interrelación horizontal y con equidad.

  17. Reflexiones sobre las estrategias de desarrollo

    Directory of Open Access Journals (Sweden)

    Alberto Ortíz Gómez


    Full Text Available RESUMEN La apertura constituye actualmente el tema que mayor atención genera en los diversos círculos donde se debate si la condición  económica de la nación debe descansar en el modelo de sustitución de importaciones, debe residir en el fortalecimiento  de las exportaciones menores o debe definitivamente sustentarse en esfuerzos  integrados del aparato  gubernamental, el sistema financiero y la clase empresarial. Nadie discute la importancia de avanzar en pos de la actualización tecnológica, el incremento de los coeficientes de productividad, el mejoramiento de los niveles de calidad y la consecuente  intromisión de nuestra producción en los mercados internacionales. Frente a la necesidad de eliminar atávicas costumbres relacionadas con el pensar actuar en pequeño, vivir el pasado, aprovechar situaciones monopólicas de mercado y usufructuar el proteccionismo gubernamental, el remezón constitucional y la apertura en todos los órdenes de la vida nacional deben apuntar a un desarrollo de que participe de la colectividad en su conjunto. Sin embargo, en el convencimiento en las ventajas que plantean el nuevo esquema de desarrollo, es claro que existen dudas a espejar  e interrogantes no resueltos sobre la forma como deben articularse las  medidas económicas instauradas alrededor  de un proceso de apertura cuyos resultados no pueden analizarse con el criterio miope de quienes todo lo juzgan con base en la inmediatez.

  18. Estudos sobre a Esquistosomose em Pernambuco, Brasil

    Directory of Open Access Journals (Sweden)

    Aggeu Magalhães


    Full Text Available Os autores referem os resultados dos estudos sobre esquistosomose realisados, em Pernambuco, de Novembro de 1938 a Dezembro de 1939. Não se extendem em discussão, nem comentarios, tampouco, relacionam suas verificações com o que já foi relatado sobre o assunto em trabalhos nacionais e estrangeiros, pelo fato de que, não se trata de um resultado definitivo e sim de atividades que irão proseguir. Os estudos sistematicos em torno da endemia esquistosomica foram executados em duas localidades diversas pela população e pela situação geografica e ecologica. Pontezinha é uma povoação de 1200 habitantes localizada proximo a um conjunto de charcos e lagõas de agua dôce onde pululam caramujos do tipo olivaceus de Spix, e apresenta uma taxa de infestação de 21,4% para individuos do sexo masculino, e de 14,7% para os do sexo feminino. A distribuição por grupos de idade mostra que a incidencia cresce até o grupo de 16 a 20 anos de idade, quando atinge a percentagem de 37,8%, para decrescer em seguida. Em Vitoria a incidencia foi maior nos indivíduos do sexo feminino, atingindo a taxa de 41,4%, dando o sexo masculino a taxa de 36,9%. Por idade a percentagem maxima é atingida pelo grupo de 11 a 15 anos. Vitoria é uma cidade de 1500 habitantes, construida á margem do rio Tapacurá, onde se encontram numerosos caramujos do tipo centimetralis Lutz. A divergencia de incidencia corre por conta dos habitos da população e pela utilização que ela faz do rio, sendo maior em Vitoria porque a proximidade do rio facilita o uso de suas aguas para banho e serviços domesticos, condicionando este ultimo fato, a maior infestação das mulheres. O estudo da frequencia da infestação dos caramujos por cercarias de diversos trematodios, permite suspeitar uma relação inversa entre a taxa de infestação e o diametro maximo atingido pelos caramujos, parecendo este fato confirmar os trabalhos de Vianna Martins sobre a identidade dos hospedeiros

  19. Ocorrência e controle de lesmas do gênero Omalonyx (Gastropoda, Succineidae, pragas de capim-elefante Pennisetum purpureum (Poaceae em Rio Preto da Eva, Amazonas Occurrence and control of Omalonyx slugs (Gastropoda, Succineidae, pests of the elephant-grass Pennisetum purpureum (Poaceae in Rio Preto da Eva, Amazonas

    Directory of Open Access Journals (Sweden)

    Marcos Vinicius Bastos Garcia


    Full Text Available Lesmas do gênero Omalonyx d'Orbigny, 1837 são hermafroditas, herbívoras, de distribuição neotropical e vivem em plantas aquáticas, nas demais vegetações adjacentes e em solo úmido próximo a ambientes de água doce. No presente trabalho reporta-se a ocorrência atípica de O. pattersonae Tillier, 1981 e de Omalonyx sp. em área de terra firme, distante de ambiente aquático. Estas espécies aqui reportadas são simpátricas e devido à alta densidade populacional e prejuízos causados às folhas do capim-elefante Pennisetum purpureum Schumach, são caracterizadas como pragas agrícolas. No período da noite as lesmas se alimentavam das folhas do capim elefante e durante o dia permaneciam escondidas na base do caule, próximo a superfície úmida do solo. A aplicação de cal hidratada sobre agregados de indivíduos de Omalonyx spp foi um método efetivo para o controle das populações. As alterações ambientais dos ecossistemas amazônicos para uso agrícola e/ou urbanização tem promovido o aumento populacional de espécies que se adaptam a novos habitats e geralmente se tornam pragas de difícil controle.Slugs of the genus Omalonyx d'Orbigny, 1837 are hermaphrodites, herbivorous, distributed on Neotropical regions, living on aquatic plants, moist soil and terrestrial vegetation close to freshwater systems. The present paper reports the atypical occurrence of O. pattersonae Tillier, 1981 and Omalonyx sp. in an upland area far from any aquatic environment. Both species reported here are sympatric and due to the high populations density and damages caused on leaves of elephant-grass Pennisetum purpureum Schumach, they are recognized as agricultural pests. During the night, the slugs feed on the grass leaves and at the daylight they stayed hidden in the base of stems, near the moist soil surface. The use of hydrated lime distributed over the aggregations of Omalonyx spp. showed to be an effective method to control the populations. The

  20. As vicissitudes do "ensaio sobre o dom"

    Directory of Open Access Journals (Sweden)

    Lygia Sigaud


    Full Text Available A partir dos anos 60, antropólogos de diferentes tradições nacionais passaram a convergir no sentido de considerar que o texto de Marcel Mauss, "Ensaio sobre o Dom", contivesse uma teoria da troca, que atribui à identificação entre a coisa dada e o espírito do doador o princípio de explicação das transações. Esta interpretação contrasta com a que tiveram os contemporâneos de Mauss, os quais resgataram do trabalho suas dimensões relativas ao direito, às obrigações e às prestações totais. Partindo desta constatação, o artigo problematiza o destino do ensaio e busca torná-lo inteligível. Para tanto examina as condições sociointelectuais que contribuíram para que se produzisse a inflexão na leitura e a consolidação de uma espécie de crença coletiva em relação ao trabalho. Através deste estudo de caso, a autora identifica mecanismos que operam no processo de construção de teorias, na conformação de representações acerca de textos e na sua consagração no âmbito da antropologia.From the 1960s, anthropologists of different national traditions came to share the view that Marcel Mauss’s text, "Essay on the Gift," contained a theory of exchange which takes the identification between the thing given and the spirit of the donor as the explanatory principle of transactions. This interpretation contrasts with that held by Mauss’s contemporaries, who lifted from the work aspects relating to law, obligations and total prestations. Starting from this fact, the article problematizes the essay’s fate and seeks to make it intelligible. To this end, it examines the socio-intellectual conditions which contributed to producing this inflection in the readings of the work and the consolidation of a kind of collective belief concerning it. Through this case study, the author identifies mechanisms which operate in the process of constructing theories, in the conformity found in representations of certain texts, and in the


    Directory of Open Access Journals (Sweden)

    Larissa Assunção


    Full Text Available Com o advento da nanotecnologia, houve o desenvolvimento de técnicas envolvendo processamento, fabricação e aplicação de estruturas, com forma e tamanho controlados, sendo que na indústria de alimentos, estas formulações, tanto na faixa micrométrica como nanométrica, vêm sendo utilizadas com o objetivo de favorecer o produto final. Tendo em vista a importância tecnológica dessa técnica e do grande interesse nacional e internacional, principalmente no ramo da indústria alimentícia, sobre os benefícios do encapsulamento, o presente estudo prospectivo teve como objetivo avaliar o panorama mundial relativo ao tema em questão, correlacionando-o com os documentos de patentes depositados. Para tanto, realizou-se uma pesquisa das patentes na base de dados europeia Espacenet®, utilizando os descritores do tema em estudo associados aos códigos de classificação. As informações encontradas foram compiladas em gráficos e discutidas. Pôde-se observar que o maior número de patentes referiu-se ao código A23L1/00 - alimentos ou produtos alimentícios: a sua preparação ou tratamento e houve um crescimento exponencial em relação ao depósito de patentes nos últimos 10 anos, sendo os Estados Unidos o país líder em número de patentes depositadas (60%. A Firmenich e CIE lidera o ranking com mais patentes depositadas. Em relação à área de atuação, predomina a indústria alimentícia (69%. No que diz respeito ao Brasil, o país aparece com apenas 1 patente detentora desta tecnologia, sendo um número bastante reduzido o que mostra a falta de incentivo neste setor. Diante dos resultados obtidos, concluiu-se que, apesar de ser uma tecnologia recente, observa-se uma tendência ao crescimento de depósito de patentes.


    Directory of Open Access Journals (Sweden)

    Jaime Escobar Triana


    Full Text Available

    l. Los cambios, las corrientes migratorias internas, transformaron un país de población rural en urbana, al mismo tiempo con un epifenómeno de ruralización de la ciudad. De un 700/0 de población rural se pasó a un 700/0 o más y con tendencia a umentar la población urbana. Esto lleva a un replanteamiento en la atención de la salud. Además, se suma a lo anterior, la información masiva sobre la población que alienta la posibilidad de alcanzar
    tratamientos y drogas maravillosas o recursos extraordinarios como las unidades de cuidados intensivos o los transplantes, para dar dos ejemplos, que motivan al público a demandar dichos servicios. De otra parte, la misma información científica que alcanza
    apabullantes cantidades, solamente permite que el médico logre obtenerla y asimilarla en forma limitada y angustiante para su aplicación práctica.

    2. En la creación de nuevas Escuelas de Medicina deben considerarse entre otros los siguientes hechos o factores, favorables o desfavorables que no sólo afectan a Colombia sino que tienen características universales en algunos de sus aspectos:
    a La demanda de cupos en educación superior, entre ellos la medicina, nunca satisfecha.
    b Las presiones sociales que tienen el estudio como un método de ascenso por prestigio local o regional o político o todos juntos y no por la necesidad de formar más médicos.
    c La inconveniencia de la masificación de la educacación médica que demerita la calidad y por tanto es preferible el crear nuevas escuelas con número limitado de estudiantes que permitan una alta calidad de formación.
    d La dificultad de modificar los curricula tradicionales establecidos que impiden actualizar la docencia a las circunstancias que vive y requiere la salud del país.
    e La politización de las universidades públicas que demeritan la actividad docente al imponerse condiciones extrauniversitarias en la formación y realización de

  3. Notas sobre fiebre amarilla en Colombia

    Directory of Open Access Journals (Sweden)

    Luis Patiño Camargo


    Full Text Available I-Introducción ll.-Datos clínicos anteriores al período de las investigaciones de laboratorio. Época colonial. III-Período de laboratorio anterior al descubrimiento de los animales receptivos. IV.-Período posterior al descubrimiento de los animales receptivos y a la prueba de protección. V.-Trabajos en Colombia durante el período de las investigaciones. VI. El servicio de fiebre amarilla cooperativo entre el Departamento Nacional de Higiene y la Fundación Rockejeller. VIl.-Consideraciones generales. VIlI.-Conclusiones. IX-Recomendaciones. X. Agradecimientos. XI.-Bibliografía. XIl.-Anexos. Legislación sobre viscerotomía. Es de fundamental interés para la vida de la República el estudio y solución de los problemas que se refieren a la salud de sus habitantes; y como el territorio colombiano es cálido en su mayoría, lógicamente se concluye que los asuntos de patología tropical han de ser los primeros en orden de importancia. La fiebre amarilla ha revestido graves caracteres epidémicos en repetidas épocas y por su condición endémica en anchas zonas del territorio colombiano, es una constante amenaza pública; un estudio para conocer su historia, la aparición de los brotes epidémicos, su distribución geográfica, la incidencia de morbosidad y Ietalidad, la localización precisa y la extensión de los territorios afectados, las fuentes del virus y los agentes transmisores, así como la preparación de planes y programas de lucha contra el flagelo, son cuestiones tan interesantes que basta anunciarlas para reconocer su trascendencia. En el deseo de contribuír modestamente al desarrollo de tal programa, he recogido los apuntes cuya exposición forma el presente trabajo.

  4. Efeitos fitotóxicos do fluoreto na morfoanatomia foliar de Brachiaria brizantha (Hochst. ex A. Rich. Stapf e Brachiaria decumbens Stapf (Poaceae Phytotoxic effects of fluoride in leaf morpho-anatomy of Brachiaria brizantha (Hochst. Ex A. Rich. Stapf and Brachiaria decumbens Stapf (Poaceae

    Directory of Open Access Journals (Sweden)

    Alice Pita-Barbosa


    Full Text Available Visando avaliar os efeitos do fluoreto sobre capim-braquiária, plantas de Brachiaria brizantha e B. decumbens foram submetidas a nevoeiros simulados com fluoreto (10 µg ml-1. Amostras foliares de porções aparentemente sadias foram coletadas 24 horas após a última exposição para análises microscópicas. Folhas, raízes e rizomas foram submetidos à quantificação do teor de fluoreto. As folhas apresentaram necroses pequenas e esparsas. Somente as folhas acumularam fluoreto, apresentando teores 4,4 e 5,2 vezes maiores que no tratamento controle, em B. brizantha e B. decumbens, respectivamente, não havendo diferença no potencial acumulador das duas espécies. As principais alterações micromorfológicas observadas foram lesões próximas aos tricomas, sugerindo que estes sejam as vias preferenciais de entrada do poluente nas plantas. Porções foliares, visualmente sadias, de ambas as espécies apresentaram danos microscópicos antes do surgimento de sintomas, havendo perda da turgidez das células buliformes em B. brizantha e de todos os tecidos em B. decumbens. Alterações micromorfométricas foram observadas somente em B. decumbens, indicando sua maior sensibilidade ao fluoreto, em comparação com B. brizantha. A realização de experimentos de longa duração será fundamental para elucidar o potencial bioacumulador de B. brizantha.To assess the effects of fluoride on signal grass, plants of Brachiaria brizantha and B. decumbens were submitted to simulated fluoride fog (10 µg ml-1. Leaf fragments from apparently healthy portions were colleted 24 hours after the last exposure and used for microscopic analysis. Roots, leaves and rhizomes were submitted to fluoride content quantification. The leaves presented small, sparse necroses. The accumulation of fluoride was observed on the leaves only. B. brizantha and B. decumbens presented, respectively, 4.4 and 5.2 times more fluoride than the control treatment. No difference was

  5. Reflexiones sobre la anorexia Reflexões sobre a anorexia Reflections about anorexy

    Directory of Open Access Journals (Sweden)

    Andrea Ferrero


    Full Text Available El propósito de este artículo es presentar algunas reflexiones sobre el trastorno anoréxico, algunas posibles explicaciones sobre el mismo, y proponer una respuesta posible desde la perspectiva psicoanalítica. Este estudio plantea el sufrimiento del sujeto como la manifestación de una relación inconsciente entre las ecuaciones afectivas y el entramado social de la persona. Se discute la particular relación que se establece entre la necesidad, la demanda y el deseo en este tipo de trastornos, y cómo el síntoma anoréxico se plantea como estrategia enferma de defensa del deseo. Se puede considerar el impacto que la presión de la cultura tiene en la manutención del síntoma anoréxico, dada la importancia del ideal de delgadez y belleza, también asociados con la obtención de mayor éxito y felicidad. Finalmente, se plantea el valor del análisis de la personalidad en relación a aspectos sociales para la consideración del trastorno anoréxico, el cual debe ser comprendido singularmente, más allá de sus manifestaciones y de la posible limitación a la estructura de la histeria.O objetivo deste artigo é apresentar algumas reflexões sobre o processo de adoecimento da anorexia e algumas possíveis explicações sobre esse processo, bem como propor uma possível resposta a partir da perspectiva psicanalítica. Este estudo estabelece o sofrimento do sujeito como a manifestação da relação inconsciente entre as equações afetivas e a trama social da pessoa. Procura-se discutir a peculiar relação entre necessidade, demanda e desejo neste tipo de transtorno, e como a anorexia é uma estratégia patológica de defesa do desejo. Pôde-se observar a influência da pressão da cultura na manutenção da anorexia, justificada pelo ideal de magreza e de beleza, que também são associadas com a possibilidade de obter maior êxito e felicidade. Por último, considera-se o valor da análise da personalidade em relação aos aspectos sociais

  6. Comentarios sobre la Ley de Ordenamiento Territorial Sostenible

    Directory of Open Access Journals (Sweden)

    Arturo J. Yglesias


    Full Text Available La denominada Ley de Ordenamiento Territorial Sostenible, no fue bien recibida en el medio jurídico. Tanto los profesores de las diferentes materias de Derecho de nuestra Facultad como las asociaciones profesionales y otros grupos e juristas de nuestro medio, formularon reservas de diverso calibre sobre el texto de la ley que van desde sus aspectos adjetivos como la terminología y redacción hasta cuestiones sustanciales como lo que ella dice sobre el régimen de la propiedad territorial y otras cuestiones vinculadas.Desde el discurso político vimos lanzar opiniones iracundas y alarmistas sobre las modificaciones que la ley estaría haciendo al régimen de la propiedad privada, sobre su supuesta inconstitucionalidad.Nosotros nos vamos a referir a la ley a sus antecedentes y de las críticas que se le hacían, en la parte que toca a nuestra materia, esto es en lo relativo al régimen de la propiedad y debemos decir, a vía de adelanto, que no vemos en ella nada que afecte el derecho de propiedad consagrado por la Constitución de la República, ni los principios generales que regulan la propiedad territorial conforme al Código Civil, conforme a la vieja ley de Centros Poblados, sus modificativas ni demás normas sobre la materia.

  7. Genome Evolution in the Genus Sorghum (Poaceae)




    • Background and Aims The roles of variation in DNA content in plant evolution and adaptation remain a major biological enigma. Chromosome number and 2C DNA content were determined for 21 of the 25 species of the genus Sorghum and analysed from a phylogenetic perspective.

  8. Bromus interruptus (Hack.) Druce (Poaceae) in Nederland

    NARCIS (Netherlands)

    Rich, Tim C.G.


    Bromus interruptus is a grass which was endemic to England but is now extinct in the wild. Attention is drawn to the two historic records from the Netherlands, where it was probably introduced with agricultural seed, in case it still survives in the wild. It is readily recognised from the contracted

  9. Monograph of Diplachne (Poaceae, Chloridoideae, Cynodonteae). (United States)

    Snow, Neil; Peterson, Paul M; Romaschenko, Konstantin; Simon, Bryan K


    Diplachne P. Beauv. comprises two species with C 4 (NAD-ME) photosynthesis. Diplachne fusca has a nearly pantropical-pantemperate distribution with four subspecies: D. fusca subsp. fusca is Paleotropical with native distributions in Africa, southern Asia and Australia; the widespread Australian endemic D. f. subsp. muelleri; and D. f. subsp. fascicularis and D. f. subsp. uninervia occurring in the New World. Diplachne gigantea is known from a few widely scattered, older collections in east-central and southern Africa, and although Data Deficient clearly is of conservation concern. A discussion of previous taxonomic treatments is provided, including molecular data supporting Diplachne in its newer, restricted sense. Many populations of Diplachne fusca are highly tolerant of saline substrates and most prefer seasonally moist to saturated soils, often in disturbed areas. Some populations of Diplachne fusca in southern Asia combine nitrogen-fixation, high salinity tolerance and palatibilty to livestock, which should be pursued with further research for purposes of soil reclamation. Diplachne fusca subsp. uninervia is the most invasive of the subspecies and is becoming weedy in some non-native areas, including in the Old World. This monograph provides detailed descriptions of all taxa, a key to the species and subspecies, geographic distributions and information on the anatomy of leaves, stems, lemmatal micromorphology and discussions of the chromosome numbers. Lectotypes are designated for: Atropis carinata Grisb.; Diplachne acuminata Nash; Diplachne capensis (Nees) Nees var. concinna Nees; Diplachne capensis (Nees) Nees var. obscura Nees, Diplachne capensis (Nees) Nees var. prolifera subvar. minor Nees, Diplachne halei Nash, Diplachne maritima E.P. Bicknel, Diplachne muelleri Benth., Diplachne reverchonii Vasey, Diplachne tectoneticola Backer, Leptochloa imbricata Thurb., Leptochloa neuroglossa Peter, Leptochloa uninervia var. typica fo. abbreviata Parodi, Triodia ambigua R. Br. and Triodia parviflora R. Br.

  10. Early inflorescence development in the grasses (Poaceae

    Directory of Open Access Journals (Sweden)

    Elizabeth A. Kellogg


    Full Text Available The shoot apical meristem of grasses produces the primary branches of the inflorescence, controlling inflorescence architecture and hence seed production. Whereas leaves are produced in a distichous pattern, with the primordia separated from each other by an angle of 180o, inflorescence branches are produced in a spiral in most species. The morphology and developmental genetics of the shift in phyllotaxis have been studied extensively in maize and rice. However, in wheat, Brachypodium, and oats, all in the grass subfamily Pooideae, the change in phyllotaxis does not occur; primary inflorescence branches are produced distichously. It is unknown whether the distichous inflorescence originated at the base of Pooideae, or whether it appeared several times independently. In this study, we show that Brachyelytrum, the genus sister to all other Pooideae has spiral phyllotaxis in the inflorescence, but that in the remaining 3000+ species of Pooideae, the phyllotaxis is two-ranked. These two-ranked inflorescences are not perfectly symmetrical, and have a clear front and back; this developmental axis has never been described in the literature and it is unclear what establishes its polarity. Strictly distichous inflorescences appear somewhat later in the evolution of the subfamily. Two-ranked inflorescences also appear in a few grass outgroups and sporadically elsewhere in the family, but unlike in Pooideae do not generally correlate with a major radiation of species. After production of branches, the inflorescence meristem may be converted to a spikelet meristem or may simply abort; this developmental decision appears to be independent of the branching pattern.

  11. Two New American Species of Hordeum (Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke


    Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

  12. Distribution of Vulpia species (Poaceae in Poland

    Directory of Open Access Journals (Sweden)

    Ludwik Frey


    Full Text Available The distribution of four species of the genus Vulpia [V. myuros (L. C.C. Gmel., V. bromoides (L. S.F. Gray, V. ciliata Dumort. and V. geniculata (L. Link] reported in Poland has been studied. Currently, V. myuros and especially V. bromoides are very rare species, and their greatest concentration can be found only in the Lower Silesia region. The number of their localities decreased after 1950 and it seems resonable to include both species in the "red list" of threatened plants in Poland: V. myuros in the EN category, V. bromoides in the CR category. V. ciliata and V. geniculata are very rare ephemerophytes and their localities not confirmed during ca 60 years are of historical interest only.

  13. Karyotype asymmetry in Cynodon Rich. (Poaceae) accessions. (United States)

    Chiavegatto, R B; Paula, C M P; Souza Sobrinho, F; Benites, F R G; Techio, V H


    Cynodon is a genus of plants with forage potential that has attracted the interest of breeders. These species have high morphological variability in a large number of varieties and cytotypes, hampering identification. This study aimed to determine the karyotype asymmetry index among accessions of Cynodon to discriminate between them. Karyotype symmetry was based on three estimates, which were compared. The basic number for the genus is x = 9. The results of the chromosome count and DNA quantification, respectively, were as follows: two diploid accessions (2n = 2x = 18 and 1.08 ± 0.094 to 1.17 ± 0.036 pg DNA and ± standard deviation), one triploid accession (2n = 3x = 27 and 1.63 ± 0.017 pg DNA), four tetraploid accessions (2n = 4x = 36 and 1.88 ± 0.069 to 2.10 ± 0.07 pg DNA), and one pentaploid accession (2n = 5x = 45 and 2.55 ± 0.098 pg DNA). C. incompletus var. hirsutus had the longest total length of the haploid lot (29.05 µm), with chromosomes that ranged from 1.7 to 6.2 µm in length. On the basis of the karyotype asymmetry indices, the accessions were divided into two groups: 1) C. dactylon var. dactylon, C. transvaalensis, C. dactylon var. polevansii, three accessions of Cynodon sp, and C. nlemfuensis; and 2) C. incompletus var. hirsutus. This is the first description of tetraploidy in C. transvaalensis. The karyotypic data facilitated a determination of the degree of proximity between the accessions.

  14. Perspectivas sobre la comunicación

    Directory of Open Access Journals (Sweden)

    Naranjo Pereira, María Luisa


    Full Text Available Existen diversas teorías, enfoques y modelos de comunicación; de cada uno de ellos pueden rescatarse aspectos de gran valor para el logro de una comunicación eficaz. Este documento presenta una revisión de esos aspectos, para que se pueda comprender mejor y enriquecer uno de los procesos más importantes para el ser humano: el proceso de comunicación. Este es un ensayo en el cual se da a conocer la posición de la autora sobre el tema abordado. Se rescata el acento del enfoque humanista en la relación humana y en las etapas donde se desarrolla. A partir de la comunicación pragmática, se analizan los axiomas comunicacionales en que se fundamenta y lo que se conoce como patologías de esos axiomas. Además se revisan las principales características que distinguen la asertividad en la comunicación y las distintas formas de manipulación que la entorpecen. Del enfoque de Virginia Satir, se presentan los diversos aspectos de la comunicación, tanto funcional como disfuncional y los modelos de comunicación propuestos por esta autora. Se revisan aspectos importantes del enfoque de la comunicación educativa, tales como el control de la distancia, la voz y el cuerpo, las palabras y el situacional; así como los elementos que bloquean el proceso de comunicación y las sugerencias acerca de formas correctas de escuchar. Además, se hace referencia a la necesidad de emplear procesos educativos más holísticos y constructivistas y una comunicación-interrelación horizontal y con equidad. Each of the diverse theories, approaches, and models of communication can provide valuable elements for the attainment of effective communication. This article presents a review of those elements with the goal of providing a better understanding and enhancement of one of the most important processes for human beings: the process of communication. This essay presents the author´s position on the topic. The importance given to human relationships and the stages

  15. Хроматомасспектрометрические исследования экстракта вида Tamarix ramosissima, произрастающего в условиях Астраханской области


    Афанасьев, И.


    В статье приведены результаты хроматомасспектрометрических исследований химико-фармацевтических особенностей спиртового экстракта вида Tamarix ramosissima Ledeb (Ru: Тамарикс многоветвистый) рода Tamarix, семейства Tamaricaceae, произрастающего в Астраханской области. Материал для исследования был собран в пос. Винный Красноярского района Астраханской области в период цветения растения. В результате проведенного хроматомасспектрометрического исследования спиртового экстракта из наземной части...

  16. Efeitos dos choques fiscais sobre o mercado de trabalho brasileiro

    Directory of Open Access Journals (Sweden)

    Diogo Baerlocher Carvalho


    Full Text Available Esse trabalho tem por objetivo entender quais os efeitos dos choques fiscais sobre o mercado de trabalho brasileiro. Em particular, utiliza se uma abordagem SVAR para avaliar esses efeitos sobre o emprego e o salário real. Os choques fiscais são identificados a partir da imposição de restrições de sinais puras sobre a relação dinâmica entre os gastos do governo, o produto real e a oferta de trabalho. As restrições são obtidas a partir de funções de resposta a impulso Bayesianas derivadas de um modelo DSGE na tradição da Nova Síntese Neoclássica. As funções de resposta a impulso obtidas a partir da abordagem SVAR mostram que choques fiscais aumentam o salário real e o emprego.

  17. Deformaciones faciales y sus influencias sobre el psiquismo

    Directory of Open Access Journals (Sweden)

    Guillermo Nieto Cano


    Full Text Available Creemos haber dejado establecido, en síntesis, que todas las minusvalías físicas repercuten sobre el psiquismo, y que entre éstas las deformaciones faciales, por su ostentosa evidencia, son las que afectan más seriamente al individuo y modifican por eso más radicalmente su conducta, incidiendo así, en forma trascendental, sobre la colectividad. Tales defectos constituyen, por consiguiente, un serio problema humano, cuyo estudio y remedio incumbe no solamente al esteta cirujano, sino que interesa a todos aquellos que puedan influir sobre la estabilidad armónica y la buena marcha de la sociedad en que viven.

  18. Revisitando uma carta em português sobre Sabbatai Zvi

    Directory of Open Access Journals (Sweden)

    Rodrigues da Silva Tavim, José Alberto


    Full Text Available The present paper deals with the Iberian context of the production-translation of a text in Portuguese language about Shabbatai Zevi, in 1666. We refer the production of similar texts and the information about the adherents in Spain, mostly in Malaga. We reflect on the various messsianic currents that crossed the different social groups in Portugal. We present a text that proves the spreading of news about Shabbatai in Portuguese Lands, and the interest kindled among the Portuguese Conversos. And we place the hypothesis that this text to the movement of Shabbatai, could have different readings, among them one that could be convenient to the conversos.

    Este artículo aborda el contexto de la producción-traducción de un texto en portugués sobre Sabetay Sebí, en 1666. Se alude a la producción de otros textos similares y a la información sobre los adeptos del movimiento en España, sobre todo en Málaga. Se reflexiona sobre las varias corrrientes mesiánicas que cruzaban los diferentes grupos sociales en Portugal. Se presenta un texto que prueba la divulgación de noticias sobre Sabetay, en tierras portuguesas y del interés desperttado entre los medios conversos sobre el movimiento. Y se plantea la hipótesis de que este texto contrario al movimiento de Sabbatai pudiera tener varias lecturas, entre ellas una que debería ser conveniente para los conversos.

  19. Pequena monografia sobre o Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Ana Maria Pinho


    Full Text Available Pequena monografia desenvolvida por membros do Colégio Sevigne, que versa sobre diversos assuntos a respeito do Rio Grande do Sul, divididos em histórico, fronteiras, organização política administrativa, características geográficas, formação geomorfológica, economia, aspectos históricos e geográficos da capital do Estado, generalidades étnicas, e sobre o gaúcho em si. Grande quantidade de ilustrações e poemas enriquecem o artigo.

  20. Teorias sobre o amor no campo da Psicologia Social


    Martins-Silva, Priscilla de Oliveira; Trindade, Zeidi Araujo; Silva Junior, Annor da


    Este é um ensaio teórico sobre o fenômeno amor em relacionamentos românticos no campo da Psicologia e no da Psicologia social. São apresentadas as primeiras teorias sobre o amor na Psicologia, e, posteriormente, são abordadas em maior profundidade três teorias da Psicologia social: os estilos de amor de John Alan Lee, a teoria de apego, de Phillip Shaver, Cindy Hazan e Donna Bradshaw, e a teoria triangular do amor, de Robert J. Sternberg. São apresentados os aspectos teóricos, empíricos e met...

  1. La literatura comparada sobre reformas administrativas: Desarrollos, limitaciones y posibilidades


    Dussauge Laguna, Mauricio I.


    Durante las últimas dos décadas, la literatura comparada sobre reformas administrativas ha crecido significativamente. ¿Cuáles han sido sus aportaciones y cuáles sus limitaciones? ¿Qué nos queda por aprender sobre el tema? Este ensayo repasa los debates centrales de la literatura, analiza sus principales debilidades y sugiere un conjunto de futuras líneas de investigación. El argumento central del ensayo es que la literatura comparada en esta materia ha avanzado en forma considerable en térmi...

  2. Nuevos documentos sobre Rojas Zorrilla y su teatro

    Directory of Open Access Journals (Sweden)

    Madroñal, Abraham


    Full Text Available This article contains twelve unpublished documents on Rojas Zorrilla, related to his biography and literary works (comedias and autos sacramentales. The majority are handwritten by the poet himself, and they provide new information relevant to our knowledge of his life and to the understanding of his works.Se publican una docena de documentos inéditos sobre Rojas Zorrilla referidos a su biografía y a algunas comedias y autos. En buena parte dichos documentos son autógrafos del poeta y añaden o matizan informaciones concretas sobre él y sus obras.



    Posada, Martha Isabel; Arroyave, María del Pilar


    El presente artículo es una descripción de los efectos del mercurio sobre algunas plantas acuáticas tropicales y sobre los ecosistemas donde habitan. Adicionalmente, se recomienda un protocolo para realizar pruebas de toxicidad con la lenteja de agua (Lemna minor) y se presentan los resultados de los preensayos con diferentes concentraciones de sales de mercurio en condiciones de laboratorio. Se encontró que la biodisponibilidad del mercurio depende de factores que facilitan la disolución del...

  4. Santa sexualidad: concepciones de dos monjas sobre Feminidad y sexualidad


    Giraldo Quijano, Isabel Cristina


    En el contexto de la religión católica, la feminidad y la sexualidad femenina se configuran según dogmas y representaciones sociales específicos, en los que la imagen de Cristo -y todo lo que ello implica- actúa como elemento fundamental en la construcción de las concepciones de las mujeres consagradas a la vida religiosa sobre sex ualidad, erotismo, cuerpo. amor. Este artículo pretende explorar desde un punto de vista sociológico las concepciones de dos monjas sobre los temas mencionados....

  5. Contexto y pensamiento de Charles Taylor sobre el consenso

    Directory of Open Access Journals (Sweden)

    Doris Elena Ospina Muñoz


    Full Text Available El artículo sostiene que el consenso no es un tema de primer orden en la filosofía política de Charles Taylor, pero una lectura orientada al problema puede ofrecer los elementos para establecer una teoría sobre dicha noción e identificar los argumentos para su justificación. Además, se enfatiza en el contexto de discusión que permite introducir la filosofía de Taylor como un modo de pensar sobre el consenso, alternativo al constructivismo.

  6. (I) Informe sobre conflicto violento en colombia (2011–2012)



    Las negociaciones de paz entre el gobierno nacional y las FARC avanzan de modo considerable. Al momento del cierre del presente informe –julio de 2014–, se construyó un acuerdo sobre los tres primeros puntos de la agenda –la reforma agraria, la participación política y las drogas ilícitas–. Sin duda la negociación progresa, los puntos sobre los que se trazó un acuerdo tocan dimensiones neurálgicas de la vida colectiva: el agro y su atraso histórico, la democracia y sus cierres, el narcotráfic...

  7. Reflexiones sobre la corrupción y su impacto sobre la salud

    Directory of Open Access Journals (Sweden)

    Alfredo Jácome Roca


    Existe una gran variedad de teorías biológicas, psicológicas, sociológicas y económicas que explican la conducta corrupta, algunas de las cuales profundizan sobre cómo las prácticas generalizadas de violación de las reglas pueden afectar la honestidad individual y la voluntad intrínseca de seguir las leyes. Así, por ejemplo, hay quienes sostienen que el engaño es común en el mundo animal y hace parte del proceso evolutivo; en ese sentido, se considera como un acto natural, innato y que responde a la lucha por la supervivencia. Por eso, se encuentran especies que se camuflan, se mimetizan, se hacen las muertas, utilizan químicos que no permiten ver la gravedad de un ataque, consiguen que el competidor las considere más grandes de lo que realmente son adoptando ciertas posturas, etc.


    Directory of Open Access Journals (Sweden)

    William Ortiz Jiménez


    Full Text Available El ensayo hace una reflexión en torno al proceso de paz que se llevó a cabo en el gobierno del presidente Andrés Pastrana, y la participación que tuvo la sociedad civil en este asunto. Pero, trasciende, además, a la situación actual del conflicto en Colombia. A partir de las formulaciones de varios teóricos, entre los que se destacan Daniel Pécaut, Cohen, y Arato., Margarita Bonamusa, María Teresa Uribe, Daniel García-Peña, Habermas, Rawls, entre otros, se fortalece un marco teórico y de referencia bastante sólido para mostrar cómo lo público es indispensable en las acotaciones que lleven a la solución de los conflictos. Sin el concurso de lo público, tampoco sería viable la participación de la sociedad civil. Los espacios de solución de conflictos, el ágora, en palabras de Hanna Arendt, es el lugar esencial para la discusión, el consenso y los acuerdos. En política, la esfera de lo público prima sobre lo privado, porque el reconocimiento de las libertades, manifestaciones y la plenitud de los derechos sólo se logra en lugares comunes.

  9. Construcciones sociales sobre mujeres desde el discurso jurídico en sentencias penales sobre infanticidio

    Directory of Open Access Journals (Sweden)

    María Eugenia Gastiazoro


    Full Text Available El infanticidio como figura penal se suprime del Código Penal Argentino en 1994, para ser una figura de homicidio agravado por el vínculo con prisión o reclusión perpetua. Diez años después de su última derogación, el caso Romina Tejerina en Jujuy generó una serie de cuestionamientos respecto de su penalización. Otro caso, que tomó estado público fue el de Eli Díaz en la ciudad de Villa Dolores en Córdoba, juzgada en el 2006, siendo (en contraposición al caso Tejerina absuelta por una mayoría compuesta solo de ciudadanos comunes (jurados. En el presente trabajo se analiza la construcción y la producción que desde el discurso jurídico se hace de las diferentes mujeres en los casos de infanticidio. A su vez, estas imágenes se comparan con las representaciones que los legisladores tuvieron en el debate del Congreso del año 2010 cuando se intentó reponer la figura. La sujeción del género centrada en la buena o mala madre, mujer, esposa, en intersección con otras dimensiones de clase social, y edad, se categoriza en el discurso de los tribunales de acuerdo a imaginarios sociales que sostienen una identidad normativa sobre estas mujeres.

  10. Una mirada sobre lo popular. Reflexiones sobre el etnocentrismo en el nuevo cine argentino

    Directory of Open Access Journals (Sweden)

    Gonzalo Assusa


    Full Text Available La emergencia del nuevo cine argentino desata una serie de debates teóricos. Probablemente una de las caracterizaciones más convincentes es la que lo define como surgido de una misma crisis, no sólo en el campo cinematográfico, sino también de una misma crisis social. En el marco de un análisis sociológico de este fenómeno cultural, el presente trabajo planteará una hipótesis de lectura para algunas de las producciones audiovisuales del denominado nuevo cine argentino, en pos de establecer conceptualmente la estructuración desde el polo productivo de la elaboración imaginaria de esta crisis social, concretamente, de la emergencia de las clases populares en sus filmes. Para finalizar, se evaluará la productividad de la hipótesis de lectura basada en una definición teórica de lo popular, aplicándola a un cuerpo de filmes del realizador argentino Adrián Caetano, para concluir con reflexiones sobre la importancia del cruce entre la estructuración textual y la estructuración en el momento del consumo.

  11. Consideraciones del bioderecho sobre la eutanasia en Colombia

    Directory of Open Access Journals (Sweden)

    José Antonio García Pereáñez


    Full Text Available Este artículo aborda de manera reflexiva las incidencias del bioderecho sobre situaciones de eutanasia en Colombia, al interpretar conflictos morales y jurídicos suscitados por las sentencias de la Corte Constitucional C239 de 1997, T970 de 2014 y la Resolución del Ministerio de Salud y Protección Social 1216, de 2015. El propósito fundamental es el análisis de las decisiones judiciales sobre el final de la vida humana. Por lo tanto, se realiza una revisión de la construcción histórica y jurídica del concepto de eutanasia y se propone la discusión sobre su manejo jurídico y su influencia en el colectivo moral. Asimismo, se diserta sobre el concepto de dignidad humana y muerte digna, como precedentes para dirimir los conflictos éticos que la eutanasia suscita. Al final, se analiza el caso de don Ovidio González, quien se convirtió en 2015 en el primer colombiano en recibir la eutanasia de manera legal dentro del sistema de salud.

  12. Impacto de las redes sociales sobre la salud


    Roldán Roldán, Raquel; Aranda Aranda, Federico Manuel; González Castillo, Silvia


    Cartel presentado en el 3er Congreso Internacional de Comunicación en Salud (3ICHC), celebrado los días 19 y 20 de octubre de 2017 en la Universidad Carlos III de Madrid. El objetivo de este trabajo es analizar si existe una influencia de las redes sociales sobre la población en temas relacionados con su salud.

  13. Sobre-educación en el mercado laboral colombiano

    Directory of Open Access Journals (Sweden)

    Jhon James Mora


    Full Text Available Este artículo analiza la sobre-educación en Colombia con datos de individuos y empresas compilados por el Servicio Nacional de Aprendizaje de Colombia en 2006, encuentra que la probabilidad de estar sobre-educado es del 14% y que depende de la movilidad entre áreas de desempeño, la experiencia, el género, el tamaño de la empresa y el nivel de educación. Los trabajadores sobre-educados ganan un 2% menos que los trabajadores correctamente educados, conforme al patrón internacional. Los resultados también muestran que la probabilidad de que los profesionales permanezcan en la misma área de desempeño aumenta con la experiencia, que cuanto mayor es la sobre-educación menor es la probabilidad de permanecer en dicha área y que los trabajadores con postgrado tienen menor probabilidad de permanecer en su área de desempeño.


    Directory of Open Access Journals (Sweden)

    Patrício A. S. Carneiro Carneiro


    Full Text Available O presente artigo discute a evolução da ciência moderna, bem como a crise desse paradigma dominante e seus efeitos sobre a geografia. Destaca ainda a necessidade da construção de um novo pensamento científico para além das fronteiras disciplinares e do método absoluto.

  15. 1er. Taller internacional sobre oso hormiguero gigante (Myrmecophaga tridactyla)


    M.V. Guillermo Pérez Jimeno


    ResumenLos pasados días 2 y 3 de noviembre se llevó a cabo el 1er. Taller internacional sobre oso hormiguero gigante (Myrmecophaga tridactyla), en instalaciones del Zoológico de Florencio Varela. Participaron activamente representantes de Brasil, Colombia, Holanda, Alemania y Argentina.

  16. Nota sobre el cambio de variable en las integrales definidas


    Soriano, Luis Ignacio


    En los textos más frecuentemente empleados por nuestras alumnos de las Facultades técnicas no se hacen indicaciones de ninguna clase sobre las precauciones que es necesaria tomar en el caso de cambio de variable en las integrales definidas; El siguiente ejemplo hará ver la necesidad de ser cuidadosos

  17. Rutas de glicosilación en Candida albicans: circuitos reguladores y efectos sobre virulencia


    Domínguez Cantero, María del Pilar


    [ES]Esta tesis trata sobre las rutas de glicosilación en Candida albicans: circuitos reguladores y efectos sobre virulencia. [EN]This thesis is about glycosylation pathways in Candida albicans: regulatory circuits and effects on virulence.

  18. Tiempo de feminismo. Sobre feminismo, proyecto ilustrado y postmodernidad, de Celia Amorós [Ressenya


    Campillo, Neus


    Se trata de una reseña sobre el libro Amorós, C., Tiemp de feminismo. Sobre feminismo, proyecto ilustrado y postmodernidad. Madrid, Cátedra, Universitat de Valencia, Instituto de la Mujer, 1997, 463 pp.

  19. A Fronteira do Gado e a Melinis Minutiflora P. Beauv. (POACEAE: A História Ambiental e as Paisagens Campestres do Cerrado Goiano no Século XIX

    Directory of Open Access Journals (Sweden)

    Sandro Dutra Silva


    Full Text Available Este artigo objetiva apresentar uma revisão da bibliografia que informa sobre a introdução de gramíneas exóticas, sobretudo de origem africana, no Cerrado goiano. A pecuária foi a principal atividade econômica de Goiás no século XIX e na primeira metade do século XX. Os campos do Cerrado goiano favoreceram o assentamento de parte da sociedade rancheira com seus currais e boiadas. Neste artigo, pretendemos analisar, por meio da história ambiental das gramíneas e da pecuária, a relação entre sociedade e natureza nas savanas do Planalto Central do Brasil nesse período. Dialogamos com os estudos de botânica e a sua relação com a história ambiental, no que se refere às transformações das paisagens pelas ações antrópicas. O estudo destaca a introdução de gramíneas exóticas, especialmente os registros históricos sobre o capim-gordura na expansão da atividade pastoril em Goiás.

  20. Hölderlin: sobre la religión

    Directory of Open Access Journals (Sweden)

    Andrés Alfredo Castrillón Castrillón


    Full Text Available El artículo se propone dilucidar la noción de religión que tiene Friedrich Hölderlin en el ensayo “Sobre la religión”, el cual traza un pensamiento tan o más complejo de la relación hombre - dios, y hombre - comunidad, que los de filósofos como Kant o Hegel en sus reflexiones sobre Dios y la religión. Destacar por medio del análisis del ensayo cómo comprende Hölderlin la religión y cómo la vincula con la vida de los hombres en su contexto es la tarea fundamental del escrito, para concluir con las propuestas poéticas de la fundación de religiones o sus manifestaciones a través del mito.

  1. Pregnancias. Sobre cuatro lavis de Colette Deblé

    Directory of Open Access Journals (Sweden)

    Jacques Derrida


    Full Text Available ¿Cómo citar la representación del cuerpo femenino en la Historia del Arte occidental dejándose impregnar por los patrones y modelos pictóricos masculinos pero imprimiendo, a su vez, otras huellas, las de otro cuerpo? Esta pregunta atraviesa el texto del filósofo Jacques Derrida sobre las aguadas (lavis de la pintora francesa Colette Deblé, dando lugar a una reflexión sobre el engendramiento, el parto y la cita pictórica. En el trabajo de Colette Deblé, el legado de la Historia del Arte y su mitología engendrarán una serie infinita de aguadas donde el agua no pretende “lavar” la tradición (deshacerse de ella, acabar con ella sino inundarla, mojarla, empaparla con nuevas aguas para, escurriéndola, hacerla resonar nuevamente.

  2. Conceitos de mulheres sobre sua menstruação

    Directory of Open Access Journals (Sweden)

    Márcia Yuri Shinohara


    Full Text Available Dando prosseguimento às pesquisas anteriores realizadas pelo Núcleo de Assistência para o Autocuidado da Mulher (NAAM sobre aspectos relativos à menstruação, desenvolvemos um trabalho que estudou os conceitos de 705 mulheres sobre sua menstruação. Foram utilizadas informações do banco de dados do NAAM, obtidos na aplicação do Histórico de Saúde da Mulher no Município de Vargem Grande Paulista. O conceito mais relatado pelas mulheres foi o Normal. Isto talvez explique os dados obtidos em trabalhos anteriores, onde muitas mulheres nada fazem para aliviar os sintomas dolorosos da menstruação. O acesso a estes conceitos próprios é importante para elaborar uma assistência de enfermagem de qualidade respeitando as crenças e valores dentro da cultura das mulheres.

  3. Últimos trabajos sobre ladrillos huecos y perforados

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo


    Full Text Available Not availableEn la Building Research Station se están llevando a cabo, cada día con resultados positivos más alentadores, investigaciones sobre nuevos tipos de ladrillos huecos y perforados. Es de esperar que, en breve, todos estos estudios den lugar a la aparición de unas normas para su empleo en escala industrial y, precisamente ahora, es, en Inglaterra, el momento oportuno, puesto que, actualmente, está celebrando reuniones la Sociedad Cerámica Británica. Lo que se publica en este artículo es un anticipo sobre las tendencias actuales dentro da este campo.


    Directory of Open Access Journals (Sweden)

    Rocío Tizón


    Full Text Available Los juegos de rol aparecen en la década de los años 70 en Estados Unidos, creados por Gary Gigax y Dave Arneson, padres del ya famoso Dragones & Mazmorras. No obstante, fueron pocos los años de tranquilidad, ya que en su país natal se le consideró culpable de promover el suicidio de varios adolescentes que habían sido jugadores de Dragones & Mazmorras. Los engaños de la información y los prejuicios de las noticias sobre estos juegos de rol provocaron que varias personas se interesaran por este fenómeno, analizando dichos mitos y comprobando la verdad de estos rumores. Uno de estos estudiosos fue William Watson, creador de la página web The Inquirer, en la que se dedica a desmontar estos y otros tópicos sobre juegos de rol.

  5. Consenso Cultural sobre el Intento de Suicidio en Adolescentes

    Directory of Open Access Journals (Sweden)

    Javier Eduardo García de Alba García


    Full Text Available Este estudio buscó identificar la estructura semántica del dominio cultural, el promedio de conocimiento y el grado de consenso cultural manifestado por los adolescentes sobre el intento de suicidio. Fue un estudio cualitativo de listas libres, con un muestreo propositivo no aleatorizado de 27 adolescentes entre 13 y 18 años. Los resultados evidenciaron un solo modelo semántico. En lo estructural se identificó el problema familiar como una causa importante del intento suicida; las categorías depresión y tristeza se consideraron como signos y síntomas previos a esta tentativa y no como causas. Como estrategias de prevención, se consideró recibir información mediante pláticas o establecer conversaciones sobre los problemas. Este modelo permite proponer estrategias de prevención que privilegien el núcleo familiar.

  6. Planteamientos sobre la pobreza: una aproximación conceptual

    Directory of Open Access Journals (Sweden)

    Bertha Lucía Martínez Bernal


    Full Text Available En el presente artículo se presentan varias definiciones o conceptos para la comprensión, medición y el análisis de la pobreza. Para ello se retoma la producción escrita de diferentes estudiosos e investigadores que han hecho aportes valiosos sobre el tema. Al lado de estos conceptos se analizan los diferentes enfoques que se utilizan para aproximarse al estudio de la pobreza, aunque estas no son teorías ni explicaciones de sus causas, sino perspectivas sobre pobreza que denotan dichos enfoques. Así mismo se desarrolla una revisión de las metodologías más utilizadas en los procesos de identificación y agregación. Finalmente se interpretan las políticas públicas en los sectores sociales.

  7. Concepções sobre criminalidade e modelos de policiamento

    Directory of Open Access Journals (Sweden)

    Marco Antônio de Azevedo

    Full Text Available Podem-se conceber duas perspectivas teóricas básicas para explicar a criminalidade: a culturalista e a racionalista. Da primeira derivam políticas públicas destinadas a reduzir a criminalidade através de uma atuação sobre a desorganização social. Na segunda privilegia-se uma estratégia segundo a qual o principal papel do Estado é dissuadir o criminoso da prática delituosa. Este trabalho revisa a literatura, evidenciando mitos sobre o crime e a atividade policial. São discutidos dois modelos de policiamento: um mais tradicional e reativo e outro mais preventivo, procurando-se mostrar que o racionalismo dá maior suporte teórico a políticas de segurança pública que valorizam a promoção da cidadania.

  8. O pensamento freudiano sobre a intolerância


    Fuks,Betty Bernardo


    A partir do conceito psicanalítico de "narcisismo das pequenas diferenças", o artigo tem como objetivos pensar o modo como Freud foi tecendo um pensamento sobre a intolerância e discutir as contribuições da psicanálise à história das teorias sobre a tolerância. A autora perscruta o fenômeno de intolerância à diferença do outro à luz dos trabalhos de Freud que envolvem e atestam sua sensibilidade para com a intolerância racista que atingiu o tempo em que viveu. Desde este trajeto, propõe algum...

  9. Bombeiros: um olhar sobre a qualidade de vida no trabalho

    Directory of Open Access Journals (Sweden)

    Janine Kieling Monteiro

    Full Text Available Este trabalho apresenta uma intervenção no corpo de bombeiros (São Leopoldo - RS realizada pelo NEPT (Núcleo de Excelência em Psicologia do Trabalho. Utilizamos um diagnóstico com sessenta e três entrevistas semi-estruturadas sobre o trabalho e funcionamento da corporação. Partindo da análise deste, propusemos palestras sobre estresse e qualidade de vida no trabalho (QVT. Foram levantados questionamentos acerca do mito do herói e do amor pela profissão bombeiro, que deixa em segundo plano seus problemas. Destacou-se o estresse no trabalho por situações traumáticas, como risco de vida eminente e mortes nos salvamentos. Entendemos que as intervenções contribuíram como espaço de escuta que propiciou reflexões a respeito da QVT.

  10. Sobre inundaciones y anegamientos / Reflections on floods and flooding

    Directory of Open Access Journals (Sweden)

    Ferrando A., Francisco J.


    Full Text Available Respecto a anegamientos e inundaciones, el autor realiza algunas precisiones conceptuales que afectan la gestión de acciones preventivas, la planificación y el ordenamiento territorial; además se ofrece una sistematización del quehacer sobre las inundaciones./ The author punctualizes the concepts regarding preventive actions and territorial planning. Also the article includes a systematized list of actions related to flood management.

  11. Para saber más sobre la violencia escolar

    Directory of Open Access Journals (Sweden)

    María Rosario Fernández Domínguez


    Full Text Available En este documento se recoge una parte importante de la producción bibliográfica sobre la violen-cia escolar y otros temas colaterales, publicada en lengua castellana a partir de 1990. Se deja constanciatambién de la legislación española más reciente para facilitar la convivencia en los centros de enseñanza.

  12. Nuevos discursos sobre las ciudades, los municipios y las mujeres

    Directory of Open Access Journals (Sweden)

    Ana María Goetschel


    Full Text Available Escritora y activista feminista. Estudió Literatura y Periodismo en la Pontificia Universidad Católica del Perú y se gradúo de Magíster en Política Social por la Universidad Nacional Mayor de San Marcos. Por espacio de más de dos décadas se desempeña como profesora en el Diploma de Estudios de Género de la Pontificia Universidad Católica del Perú y como consultora de proyectos de desarrollo en las áreas de planificación, evaluación institucional y enfoque de género para diversas agencias internacionales de cooperación en Perú y otros países de América Latina. Es Investigadora asociada y miembro del Consejo Directivo del Centro Peruano de Estudios Sociales (CEPES. Maruja Barrig acredita un vasto trabajo de investigación sobre empleo femenino, desarrollo local y organizaciones de mujeres. En una reciente conferencia “Nuevos discursos sobre las ciudades, los municipios y las mujeres” , esta investigadora peruana hizo un balance sobre las formas en que el género ha sido incorporado en las prácticas de desarrollo y las consecuencias que conlleva este tipo de intervención para el avance de la agenda del feminismo crítico. Sobre este y otros temas relacionados con su trayectoria intelectual y la acción del movimiento de mujeres en el contexto político actual de las sociedades latinoamericanas, dialogamos con Maruja Barrig.

  13. Reflexiones sobre interpretaciones recientes de la violencia en Colombia

    Directory of Open Access Journals (Sweden)

    Pedro Valenzuela


    Full Text Available Estudios recientes han negado la relación de causalidad entre las condiciones objetivas y la violencia en Colombia. Este artículo critica la forma como se ha llegado a estas conclusiones y discute algunas hipótesis que vinculan la cultura y las causas objetivas con la violencia. Concluye con una discusión sobre la interpretación de la relación entre causas estructurales y el conflicto armado interno.

  14. Propiedades beneficiosas de los terpenos iridoides sobre la salud


    López-Carreras, Noemi; Miguel, Marta; Aleixandre, Amaya


    [ES]: Algunos componentes de los alimentos presentan actividad biológica y pueden producir un efecto beneficioso sobre la salud. Aquellos que provienen de las plantas se conocen con el nombre de fitoquímicos. Muchos de estos compuestos proceden de la condensación del isopreno y presentan la estructura propia de los terpenos. Entre ellos, destacan algunos monoterpenos bicíclicos derivados del geraniol, que se denominan iridoides. Los iridoides pueden encontrarse como estructuras abiertas...

  15. Significaciones imaginarias sobre el espacio público


    Bilyk, Pablo Andrés


    El presente escrito se propone profundizar y poner en discusión una serie de reflexiones en torno de las significaciones imaginarias, el rol del investigador en su abordaje y los modos en que este concepto nos permite aproximarnos a los sentidos construidos sobre el espacio público. This article aims to discuss some ideas over imaginary significations, researcher's role in their analysis and the ways in which this concept allows us to reach public space built senses. Facultad de Periodi...

  16. Two Twin Judgements of Cienfuegos Dos juicios gemelos sobre Cienfuegos

    Directory of Open Access Journals (Sweden)

    René ANDIOC


    Full Text Available Manuel eduardo de Gorostiza, in London after the constitutional triennium, signed four articles about Spanish theatre in The New Monthly Magazine using just the letter «G». At the end of that same year, 1824, an author signing with an «M», in all likelihood Prosper Mérimée, published a set of articles in Le Globe in Paris regarding the same topic. these were literal translations of those written by Gorostiza about cienfuegos, but his authorship is not mentioned.Manuel eduardo de Gorostiza, en Londres después del trienio constitucional, firmó «G» cuatro artículos sobre teatro español moderno en The New Monthly Magazine. Al final del mismo año de 1824, un tal «M», con toda probabilidad el joven Próspero Mérimée, publicó en el periódico Le Globe, de París, otros tantos sobre el propio tema, traduciendo literalmente en particular, sin mención de fuente, lo escrito por Gorostiza sobre cienfuegos.

  17. Sobre nomes e coisas: Arnaldo Antunes em sala de aula

    Directory of Open Access Journals (Sweden)

    Érica Dias Gomes


    Full Text Available A presente pesquisa teve como objetivo investigar sobre a compreensão de alunos de um curso de formação de docentes sobre as obras audiovisuais “Nome” e “Carnaval” de Arnaldo Antunes, pensando na forma com que percebem seu cotidiano e a sociedade atual por meio da interpretação. O questionamento que se faz é como, a partir da reflexão sobre as obras do artista, desenvolver um trabalho de sensibilização, investigação e criação em sala de aula. A pesquisa participante apresenta uma proposta pedagógica realizada com uma turma de estudantes do curso de formação de docentes do Colégio Estadual Visconde de Guarapuava, buscando desenvolver assim a expressividade e a formulação de ideias de forma conjunta, por meio do desenvolvimento de um processo criativo. Foram analisados os resultados das propostas realizadas em sala de aula, além dos registros em diário de campo. Por meio da pesquisa, percebeu-se a importância dos trabalhos que envolvam fruição, reflexão e produção como forma de apropriação dos conteúdos.

  18. Orden de no reanimar, consideraciones sobre este problema

    Directory of Open Access Journals (Sweden)

    Dr. G. Luis Cereceda


    Se analizan los principales problemas, comenzando por las dificultades según los diferentes escenarios (servicio de urgencia, pabellón de maternidad, sala de hospitalizados, unidad de intensivo, pabellones quirúrgicos; se analiza la incertidumbre sobre el pronóstico de cada pacientes y sobre quién(es deben tomar las decisiones sobre el fin de la vida. Idealmente debe ser el paciente autónomo quien tome la decisión, pero en otros casos se requieren alternativas, una de ellas es la Orden Unilateral. Otros problemas son la Validez de las órdenes de no-RCP en los diferentes tiempos evolutivos, el problema de la Futilidad y la Validez de las “Directivas Anticipadas”, en este grupo resalta el enfoque POLST (Physician’s Order for Life Sustaining Treatment como más comprehensivo; como complemento ha surgido también el concepto AND (Allow Natural Death, que podría estar destinado a remplazar la orden de no-RCP (DNR.

  19. Sobre el Contenido de los Marcos Conceptuales Contables

    Directory of Open Access Journals (Sweden)

    Leila Di Russo de Hauque


    Full Text Available El presente trabajo tiene como objetivo el análisis de los distintos marcos conceptuales vigentes en diferentes sistemas normativos contables. Paralelamente a las revisiones empíricas que dicho trabajo determina, incluye reflexiones a priori sobre el contenido de dichos marcos conceptuales. El trabajo discurre inicialmente sobre el problema de la naturaleza normativa o doctrinaria de sus contenidos tradicionales sin inclinarse definitivamente por una u otra vertiente. Respecto de los elementos que se incluirán en ellos, se justifica la inclusión de las listas de objetivos y requisitos de la información contable para definir el alcance del concepto de informe de uso externo. Además se define a favor de la inclusión, conjuntamente con las respuestas a las pregunas básicas sobre la labor contable, de contenidos ligados al proceso de obtención y de la exposición de la información contable de uso externo.

  20. Uma Reflexão sobre Autoria Acadêmica

    Directory of Open Access Journals (Sweden)

    Francisco José da Costa


    Full Text Available Este estudo tem como objetivo apresentar elementos para um debate sobre a ética das práticas de autoria no campo científico brasileiro. Os autores utilizam exemplos ilustrativos para explorar as práticas de pseudoautoria, estabelecendo relações entre essas práticas, as coerções oriundas do campo acadêmico e o habitus dos agentes sociais. Foi elaborada uma definição preliminar do que seja autoria a fim de possibilitar a discussão sobre dois problemas centrais, que são: a lógica de “colocar o nome” e o plágio. Uma das principais contribuições deste trabalho repousa na reflexão orientada para a construção de uma prática aperfeiçoada de autoria, possibilitando a crítica e a autocrítica dos agentes do meio acadêmico sobre algumas práticas problemáticas de autoria.

  1. Hegel sobre Tácito y la libertad teutona

    Directory of Open Access Journals (Sweden)

    Valerio Rocco Lozano


    Full Text Available Una investigación sobre la presencia (así como sobre la ausencia de Tácito en Hegel es crucial para entender la posición política y filosófica de este pensador, especialmente en la época de Jena. Tras algunas consideraciones sobre el conocimiento hegeliano de la historia y la cultura romanas, se abordará un análisis de su noción de "libertad teutona": Hegel se opone tanto a la neo-romanidad de los revolucionarios franceses como al esencialismo teutómano de los conservadores alemanes (derivado fundamentalmente de un uso fuertemente ideológico de la "Germania" de Tácito, así como a las caducas instituciones imperiales. Esta doble oposición sitúa a Hegel en medio de dos corrientes políticas (e incluso de dos ejércitos en guerra y se lleva a cabo desde una actitud que puede denominarse como “mediación sin nostalgia”

  2. La red sobre trabajo infantil peligroso (Red Tip

    Directory of Open Access Journals (Sweden)

    Walter Varillas


    Full Text Available En el mundo, aproximadamente 351.7 millones de niños entre 5 y 17 años realizaban algún tipo de actividad económica, de ellos 170.5 millones (48.5% realizaban algún tipo de trabajo considerado peligroso. Un alto porcentaje se encuentra en la agricultura, otros en minas, manufacturas, ladrilleras, predominantemente en la economía informal. El Convenio 138 (cobre la edad mínima de admisión en el empleo de la OIT y el Convenio 182 (sobre las peores formas de trabajo infantil, definen como trabajo infantil peligroso el que puede afectar la salud, seguridad y moralidad de los menores. Estudios específicos sobre los menores muestran su susceptibilidad particular frente a los riesgos laborales, aumentando la peligrosidad para su normal desarrollo y crecimiento: "los niños no son adultos pequeños". Los profesionales de la seguridad y salud en el trabajo pueden colaborar con los profesionales y las organizaciones especializadas en el trabajo infantil, en la definición y caracterización de lo que significa el trabajo infantil peligroso. Para ello se ha conformado la Red sobre Trabajo Infantil Peligroso (Red TIP, con la finalidad de articular estos dos espacios, orientados a eliminar el trabajo infantil peligroso y rescatar al menor y devolverle la oportunidad de sonreír ahora y en el futuro.

  3. Comparison of foliar anatomy of ten bread wheat (triticum, poaceae) and ten barley (hordeum, poaceae) cultivars

    International Nuclear Information System (INIS)

    Ardic, M.; Sezer, O.; Ozgdsd, K.; Yaylaci, O. K.; Koyuncu, O.; Olgun, M.; Bascdftcd, Z. B.; Ayter, N. G.


    The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)

  4. Blackbrush (Coleogyne ramosissima Torr.): State of our knowledge and future challenges (United States)

    Pendleton, Rosemary L.; Pendleton, Burton K.; Meyer, Susan E.; Richardson, Bryce A.; Esque, Todd C.; Kitchen, Stanley G.


    Covering 130,000 square miles and a wide range of elevations from desert to alpine in Arizona, Utah, Colorado, and New Mexico, the Colorado Plateau has long fascinated researchers. The Colorado Plateau VI provides readers with a plethora of updates and insights into land conservation and management questions currently surrounding the region. The Colorado Plateau VI’s contributors show how new technologies for monitoring, spatial analysis, restoration, and collaboration improve our understanding, management, and conservation of outcomes at the appropriate landscape scale for the Colorado Plateau. The volume’s chapters fall into five major themes: monitoring as a key tool for addressing management challenges, restoration approaches to improving ecosystem condition and function, collaboration and organizational innovations to achieve conservation and management objectives, landscape-scale approaches to understanding, and managing key species and ecological communities. Focusing on the integration of science into resource management issues over the Colorado Plateau, this volume includes contributions from dozens of leading scholars of the region. The Colorado Plateau VI proves a valuable resource to all interested in the conservation management, natural history, and cultural biological resources of the Colorado Plateau.

  5. The effect of leaf beetle herbivory on the fire behaviour of tamarisk (Tamarix ramosissima Lebed.) (United States)

    Drus, Gail M.; Dudley, Tom L.; Brooks, Matthew L.; Matchett, John R.


    The non-native tree, Tamarix spp. has invaded desert riparian ecosystems in the south-western United States. Fire hazard has increased, as typically fire-resistant native vegetation is replaced by Tamarix. The tamarisk leaf beetle, Diorhabda carinulata Desbrochers, introduced for biological control, may affect fire behaviour by converting hydrated live Tamarix leaves and twigs into desiccated and dead fuels. This potentially increases fire hazard in the short term before native vegetation can be re-established. This study investigates how fire behaviour is altered in Tamarix fuels desiccated by Diorhabda herbivory at a Great Basin site, and by herbivory simulated by foliar herbicide at a Mojave Desert site. It also evaluates the influence of litter depth on fire intensity. Fire behaviour was measured with a fire intensity index that integrates temperature and duration (degree-minutes above 70°C), and with maximum temperature, duration, flame lengths, rates of spread and vegetation removal. Maximum temperature, flame length and rate of spread were enhanced by foliar desiccation of Tamarix at both sites. At only the Mojave site, there was a trend for desiccated trees to burn with greater fire intensity. At both sites, fire behaviour parameters were influenced to a greater degree by litter depth, vegetation density and drier and windier conditions than by foliar desiccation.

  6. Small mammals in saltcedar (Tamarix ramosissima) - invaded and native riparian habitats of the western Great Basin (United States)

    Invasive saltcedar species have replaced native riparian trees on numerous river systems throughout the western US, raising concerns about how this habitat conversion may affect wildlife. For periods ranging from 1-10 years, small mammal populations were monitored at six riparian sites impacted by s...

  7. Effects of Microbiotic Soil Crust Organisms and Mycorrhizal Fungi on Seedling Growth of Blackbrush (Coleogyne ramosissima)

    National Research Council Canada - National Science Library

    Pendleton, Rosemary


    .... A series of experiments conducted from 1993 to 1997 tested the effect of inoculation with arbuscular mycorrhizal fungi on the growth of young blackbrush seedlings under a variety of soil nutrient conditions...


    Directory of Open Access Journals (Sweden)

    SOUSA, L.N.


    Full Text Available Pelo menos, desde o Código de Hamurabi as punições para atos desviantes tem sido um foco de reflexão. Este trabalho encerra essa reflexão acerca de aspectos em torno do tema pena de morte. Além de feito político contra o crime, também seria um ato com fins vingativos, fundamentado na violação da dignidade humana, o que justifica a necessidade de haver uma rigorosa análise sobre tal questão, visando os argumentos lógicos, baseados na realidade social brasileira. Alguns estudos demonstram que a percepção da classe menos favorecida é que já existe, de certa forma, uma pena de morte informal no Brasil, praticada pela polícia ou grupos de extermínio. No entanto, diversos setores defendem a pena de morte em nome dos direitos humanos. O debate sobre o referido tema não deve limitar-se às questões relacionadas ao desenvolvimento moral individual, antes deve incluir também a análise de fatores históricos, culturais, econômicos, políticos e ideológicos. Este estudo tem como objetivo coletar dados bibliográficos, bem como dados sobre as opiniões que as pessoas em Campos dos Goytacazes têm sobre a pena de morte. A pesquisa feita é de caráter exploratório. Utilizaram-se as metodologias pertinentes a uma pesquisa bibliográfica. Foi realizada com moradores da cidade de Campos dos Goytacazes/RJ, especificamente com 40 jovens e adultos, de gênero masculino e feminino, com idades entre 18 e 48 anos, sendo a maioria mulheres. A coleta de dados foi feita através de questionários fechados, do tipo likert. Cerca de 48% da amostra concorda com a sentença pena de morte. As respostas quanto a não ter opinião formada sobre o assunto foram minoria, somando 20% ao todo, restando 32% de sujeitos que declararam ser contrários. Metade dos sujeitos não concordou que a sentença seria aplicada corretamente no Brasil. A minoria concordou que a lei teria uma aplicabilidade positiva no país. Aproximadamente 43% dos sujeitos pesquisados

  9. Parte de la Naturaleza: sobre el cuerpo como potencia compositiva

    Directory of Open Access Journals (Sweden)

    Juliana Merçon


    Full Text Available En medio de la constelación de mitos que han contribuido a la actual crisis socioecológica,se encuentra la creencia de que somos individuos sustanciales, atomizadoso separados del entorno al cual intentamos ‘dominar’. La ignorancia con respecto anuestra interdependencia ontológica está en la base de muchas de nuestras posturas(auto destructivas y ha sido reforzada por diversos sistemas teóricos a lo largo de lahistoria occidental. Al margen de dualismos platónicos, de transcendencias judaicocristianasy del cogito cartesiano, la filosofía de Benedictus de Spinoza (1632-1677nos invita a repensar los fundamentos de la realidad compleja en la cual estamosinmersos. Mi propósito en este artículo es tejer relaciones productivas entre algunasdimensiones de su filosofía, el pensamiento ambiental y la educación. El punto departida será la concepción spinozista de cuerpo. Este será definido como potencia quese expresa a la vez como productividad (fuerza causal y sensibilidad (fuerza receptiva.El carácter esencialmente relacional y afectivo del cuerpo humano nos permitirápensarlo también como potencia compositiva. Desconstruyendo la dicotomíaentre Naturaleza y Cultura, propondré que reflexionemos sobre las composicioneshumano-tecnológicas con respecto a sus efectos sobre nuestra potencia de pensar yactuar. En conclusión, presentaré algunos comentarios sobre el rol de la educacióncomo espacio relacional, en el cual se pueden integrar de forma potenciadora lasdimensiones epistémica, ética, política y ambiental de nuestra existencia como partesinterdependientes de la Naturaleza.

  10. Conocimientos de los adolescentes sobre aspectos de la sexualidad

    Directory of Open Access Journals (Sweden)

    Ileana García Imia


    Full Text Available Se realizó un estudio descriptivo retrospectivo, de corte transversal, en el área del Policlínico Docente "Wilfredo Pérez Pérez" del municipio San Miguel del Padrón, de Ciudad de La Habana, con el fin de explorar los conocimientos sobre algunos aspectos de la sexualidad, en un grupo de 100 adolescentes en edades entre 10 y 19 años y de uno y otro sexos, en el año 2001. Se apreció un elevado tanto por ciento de jóvenes que tenían conocimientos sobre la anatomía del aparato genital, la mejor edad para tener hijos y la anticoncepción. En general, no tenían conocimientos de todas las enfermedades de transmisión sexual, no así el método más eficaz para evitarlas. El grupo de edad de mayor relevancia lo constituyó el de 10 a 13 años por sus escasos conocimientos sobre sexualidad.A retrospective, descriptive and crosswise study was made in the health areas of "Wilfredo Pérez Pérez" Teaching Polyclinics in San Miguel del Padrón municipality, Havana City province, with the objective of exploring what a group of 100 adolescents aged 10-19 years of both sexes knows about sexuality in the year 2001. A high percentage of them had knowledge about anatomy of the genital system, the most suitable age for having children and contraception. In general, they did not know all the sexually-transmitted diseases but they did know the most efficient method to prevent them. The most relevant age group was 10-13 years old because of their poor knowledge about sexuality.

  11. Estado del arte del conocimiento sobre perifiton en Colombia

    Directory of Open Access Journals (Sweden)

    Yimmy Montoya Moreno


    Full Text Available El perifiton es un componente de las comunidades bióticas acuáticas, su estudio es importante tanto desde la perspectiva ecológica, para comprender el funcionamiento de los ecosistemas acuáticos, como desde el punto de vista ambiental, pues su composición y estructura pueden servir como indicadores de la calidad del agua y de procesos que como la contaminación puedan estar afectando a los ecosistemas. La investigación sobre el perifiton es compleja; la definición misma de perifiton aún genera controversias. Sumado a esto, la variedad de metodologías para su estudio integral, la diversidad de arquitecturas de la matriz perifítica, la gran diversidad de ecosistemas y la ausencia de escuelas taxonómicas en el país, contribuyen a que sean pocos los trabajos que se publican sobre el tema, lo que incrementa el valor e importancia de los estudios reseñados en esta revisión. El objetivo de este artículo es dar a conocer el estado del arte en la investigación sobre el perifiton en Colombia, mediante el análisis de diferentes líneas de investigación que se han desarrollado y su grado de avance. Con este fin, se examinaron 84 trabajos a los que los autores tuvieron acceso. La mayoría de investigaciones consultadas en este trabajo (90%, corresponden al estudio de ficoperifiton, el 10% restante incluyó ambos componentes del perifiton y se encontró una dedicada exclusivamente al zooperifiton. Sólo el 10,5% de las investigaciones (8 trabajos se han dedicado al estudio taxonómico detallado, el resto de publicaciones se orientan al estudio de la estructura y dinámica de la comunidad perifítica.


    Directory of Open Access Journals (Sweden)

    Vicente Ortún


    Full Text Available Este artículo aporta una revisión crítica acerca de los retos a los que se enfrentan los impuestos sobre las bebidas azucaradas como instrumento de políticas de salud, para revertir la tendencia epidémica de la obesidad. Se valoran las experiencias de los países más significados, en particular México, y se reflexiona sobre el contrapeso que ejerce la industria a las políticas antiobesidad y el poder de los lobbies. Esas políticas impositivas en pro de la salud pública han de sobreponerse a la enorme fuerza de la industria, que es ejercida en varios niveles –ciencia e investigación, reputación de marca, influencia en reguladores–. Se sugiere que un impuesto específico sobre bebidas azucaradas tiene bastante potencial para reducir enfermedades no transmisibles y riesgos –diabetes mellitus, hipertrigliceridemia, lipoproteínas de baja densidad, hipetensión diastólica–, a través de la reducción del consumo, al ser alta la elasticidad del precio de estas bebidas. Además, los efectos incluso se amplifican a medio plazo, una vez establecidos nuevos hábitos de consumo más saludable. Los impuestos podrían fomentar la innovación empresarial sin infligir costes de pérdida de empleos y contribuirían a reducir el gradiente social de la obesidad.

  13. Dos hipótesis sobre el presidencialismo autoritario

    Directory of Open Access Journals (Sweden)

    Soledad Loaeza


    Full Text Available El presidencialismo autoritario mexicano ha sido objeto de muchas reflexiones y opiniones. No obstante, se ha impuesto un paradigma presidencialista que privilegia la perspectiva personalizada e idiosincrática del ejercicio del poder, con un importante componente cultu- ralista. Aquí se propone, por una parte, una perspectiva histórica que contextualiza las accio- nes presidenciales en el período 1944-1970; por la otra, se parte de dos presupuestos generales. Uno, sostiene que los presidentes mexicanos actuaban bajo importantes restricciones y según los ritmos de un proceso que avanzó en episodios, más que en forma lineal o acumulativa; el otro destaca la limitación geopolítica que se deriva de la vecindad con Estados Unidos que incidió sobre las acciones presidenciales, pero también sobre el desarrollo institucional del país. La evolución del presidencialismo autoritario lleva la huella de esta influencia. Este artículo introduce elementos para la discusión de las hipótesis. La primera parte hace una revisión crítica del paradigma presidencialista; la segunda expone las restricciones que se derivaban de la vecindad con Estados Unidos. La tercera y última está dedicada a la descripción del tipo de episodios que Pueden servir para ilustrar la evolución del presidencialismo autoritario. Las dos hipótesis que aquí se presentan han guiado una investigación más amplia sobre el impacto de la Guerra Fría en México y el desarrollo del presidencialismo.

  14. Propuesta de programa educativo sobre enfermedades del cuello uterino

    Directory of Open Access Journals (Sweden)

    Grisel Mariela Mass Basulto


    Full Text Available Fundamento: El cáncer ginecológico está entre las más frecuentes causas de muerte en la población femenina. En Cuba, el diagnóstico precoz de tal afección está entre los programas priorizados del Sistema de Salud Pública; pero también es necesario enfatizar en la prevención, que puede lograse, sobre todo, desde la atención primaria de salud, mediante la implementación de programas educativos. Objetivo: Diseñar un programa educativo sobre afecciones del cuello uterino. Métodos: Estudio descriptivo y retrospectivo, en el período comprendido del 1 de enero de 2008 al 1 de enero de 2009. Se analizaron variables como edad, escolaridad, primeras relaciones sexuales, número de partos, número de compañeros sexuales, uso de anticonceptivo, antecedentes de infecciones de transmisión sexual, hábitos tóxicos y nivel de conocimiento. Se aplicó el criterio de expertos para la validación de la propuesta educativa. Resultados: La mayoría de las mujeres tuvieron relaciones sexuales precoces, cuatro o más compañeros sexuales y eran fumadoras, mientras que el total de ellas había presentado alguna vez infecciones vaginales. El nivel de conocimiento que predominó fue regular. Conclusiones: Es evidente que en la población estudiada se concentran varios factores de riesgo para el cáncer de cuello uterino. El Programa Educativo sobre enfermedades del cuello uterino, fue validado mediante criterio de expertos, los cuales coincidieron en que tiene gran actualidad científica, congruencia interna y en que favorece el proceso de preparación de la mujer para evitar ese tipo de enfermedades.

  15. Conocimientos sobre tuberculosis infantil en madres comunitarias de Cartagena, Colombia

    Directory of Open Access Journals (Sweden)

    Jacqueline Hernandez Escolar


    Full Text Available Objetivo: Evaluar los conocimientos sobre Tuberculosis (TB Infantil, que tienen las madres comunitarias de Cartagena. Método: Estudio descriptivo realizado con 49 madres comunitarias a las cuales se aplicó una encuesta para evaluar variables sociodemográficas y un cuestionario con 50 preguntas, para medir conocimientos sobre tuberculosis en los niños. Se evaluaron cinco grandes aspectos, (diez preguntas para cada uno así: características de la enfermedad, factores de riesgo, prácticas de prevención, manifestaciones clínicas e identificación de casos, y ruta de atención para los casos sospechosos. Los datos se almacenaron y analizaron en una base de datos del programa SPSSS versión 21, fueron calculadas medidas de frecuencias para las variables categóricas, medidas de tendencia central y desviaciones estándar para variables cuantitativas. Resultado: Del total de participantes, 91,6% (40 desconoce que un individuo con tuberculosis latente puede transmitir la enfermedad; 38,8% (19 no conoce el riesgo que tienen los menores de un año a contagiarse; 22,4% (11 no identifica como factor de riesgo para los niños el contacto estrecho con una persona enferma. Solo el 2% (1 reconoce como signo sugestivo de la enfermedad tuberculosa en los niños la presencia de tos por más de 21 días. Conclusión: Las madres comunitarias de éste estudio tienen poco conocimiento acerca de la TB infantil. Se considera necesario realizar intervenciones educativas a estos actores sociales para que tengan conocimientos amplios sobre este tema.

  16. La UNASUR y el Protocolo sobre Compromiso con la Democracia


    Luchetti, Javier Fernando


    En el presente trabajo describiremos brevemente el proceso que llevó a la UNASUR a añadir a su Tratado Constitutivo, el Protocolo Adicional sobre Compromiso con la Democracia, que pretende constituirse en un apéndice importante en la defensa de las instituciones democráticas y el respeto por los derechos humanos en el sur del continente suramericano, más allá que en otras organizaciones regionales también se menciona que la defensa de la democracia es uno de los pilares de dichas organizacion...

  17. Convecção mista sobre cavidade porosa aberta


    Jorge Isaias Llagostera Beltran


    Resumo: Este trabalho apresenta um extenso conjunto de resultados de simulação numérica sobre a convecção mista, natural e forçada em uma configuração porosa abert.a. A configuração estudada é formada por uma camada horizontal que apresenta em sua parede inferior uma cavidade de secção transversal retangular. A parede de fundo da cavidade é aquecida e a parede superior da camada horizontal é resfriada ambas isotermicamente o problema em regime permanente é analisado procurando-se estabelec...

  18. Consideraciones sobre la valoración social del agua

    Directory of Open Access Journals (Sweden)

    Robert Hérin


    Full Text Available Las características del clima mediterráneo y el intenso aprovechamiento de los recursos hídricos en este ámbito, son los causantes de la excepcional importancia que se atribuye al agua en la cultura y la configuración de los paisajes. En este artículo se realiza un análisis de la evolución que ha seguido, sobre todo en los últimos siglos, el agro mediterráneo, desde las huertas tradicionales y los paisajes de secano a las nuevas formas de aprovechamiento agrícola, desde una perspectiva social.

  19. Aborto y Parlamento: un estudio sobre Brasil, Uruguay y Argentina


    Rocha,Maria Isabel Baltar da; Rostagnol,Susana; Gutiérrez,María Alicia


    El presente trabajo desarrolla un estudio comparativo entre Brasil, Argentina y Uruguay sobre las legislaciones y las acciones de diversos actores en relación a la despenalización y/o legalización del aborto. El tema se instala en la agenda pública en los tres países a partir del proceso de democratización iniciado en la década de los 80 produciéndose diversas intervenciones tanto del movimiento de mujeres, como de las corporaciones médicas y otros actores sociales en el transcurso de la déca...

  20. Ensayos sobre la sonrisa de volatilidad en mercados de opciones


    Serna Calvo, Gregorio


    La tesis comienza analizando los determinantes de la "sonrisa de volatilidad" en el mercado de opciones sobre el indice IBEX-35,obteniendose evidencia de causalidad lineal en el sentido de Granger de los costes de transacción, representados por el diferencial "bid-ask" relativo, ala forma de la sonrisa. A continuación, se propone un modelo de Black-Scholes ampliando donde la volatilidad depende del precio de ejercicio y del diferencial "bid-ask" relativo, obteniendose que dicho modelo no mejo...

  1. Antioxidantes de origen vegetal. Efecto sobre el envejecimiento


    Descalzo Perea, Virginia


    Este trabajo consiste en una revisión bibliográfica sobre diferentes tipos de antioxidantes de origen vegetal que podemos encontrar en los alimentos, así como sus características y efectos principales. Los radicales libres más frecuentes son los derivados del oxígeno y se producen como consecuencia de las reacciones de oxidación, que constituyen una parte esencial del metabolismo. Cuando la producción de radicales libres excede a la defensa antioxidante se da un desequilibrio y, como consecue...

  2. Recursos bibliográgicos sobre los estudios en italiano


    Caprara, Giovanni


    Este artículo bibliográfico busca ofrecer una visión panorámica actualizada (y representativa) de los Estudios de Traducción en lengua italiana. En ella se clasifican por temas objeto de estudio toda una serie de obras (libros, monografías colectivas, etc.) que inciden sobre el estudio de la Traducción e Interpretación desde la perspectiva de la lengua y la cultura italianas o que, aunque hayan sido realizados por autores extranjeros, su publicación utiliza como lengua vehicular de comunic...

  3. Sobre las implicaciones normativas de la neurociencia social


    Salles, Arleen


    En las últimas décadas, la neurociencia y la psicología cognitiva nos ha permitido comenzar a entender la relación entre procesos psicológicos diversos y hasta sobre las bases neurológicas de las creencias, las emociones, los juicios y las decisiones morales. Pese a la aceptada distinción entre el carácter descriptivo de la ciencia y el normativo de la moralidad, algunos autores afirman que los resultados de los estudios neurocientíficos tienen implicaciones normativas. No es c...

  4. El informe mundial sobre la violencia y la salud.


    Etienne G. Krug; James A. Mercy; Linda L. Dahlberg; Anthony B. Zwi


    En 1966, la Organización Mundial de la Salud declaró la violencia como uno de los principales problemas de salud pública. Para dar seguimiento a dicha resolución, el 3 de octubre de este año, la OMS publicó el primer Informe mundial sobre la violencia y la salud, el cual analiza los diferentes tipos de violencia, incluidos el maltrato y abandono de menores, la violencia entre los jóvenes, la violencia contra la pareja, la violencia sexual, el maltrato a ancianos, la violencia autoinfligida y ...

  5. Información sobre deporte femenino: el gran olvido


    Ibáñez, Eugenia


    Las referencias al deporte femenino en los diarios de información deportiva han llegado a mínimos difícilmente superables. Prensa, radio y televisión han llegado a la conclusión por la vía de los hechos consumados de que el hombre es el único merecedor de convertirse en noticia en los medios informativos. La prensa deportiva y las secciones de deporte de los diarios de información general ignoran sistemáticamente a la mujer deportista, no informan sobre sus actividades, lo hacen mal y a desti...

  6. Stuart Hall sobre “hacer estudios culturales”


    Mato, Daniel; Universidad Nacional Tres de Febrero (Untref), Buenos Aires, Argentina


    Traducción de Emeshe Juhász MininbergEmeshe Juhász Mininberg es escritora e investigadora independiente. Doctora en Filosofía y Letras, Yale University, Estados Unidos. Traductora y editora de textos de crítica cultural y de artes plásticas. Ha publicado varios artículos sobre ciudadanía, cultura e identidad nacional en tiempos de globalización, que aparecen, entre otros, en Cultura, política y sociedad: perspectivas latinoamericanas (Clacso, 2005) y en el Diccionario de estudios culturales l...

  7. Efectos de instrumentos odontológicos sobre los marcapasos


    Gómez Val, Gonzalo


    L’ús del marcapàs ha creat un tipus particular de precaucions postoperatòries. Alguns dels problemes no son coneguts, altres problemes s'han conegut mitjançant els problemes ocorreguts. Actualment, les instruccions dels localitzadors electrònics d’àpex i els piezoelèctrics contraindiquen la seva utilització en pacients portadors de marcapassos, però, aquesta preocupació pel que fa a efectes possibles negatius, està basada en l'especulació sobre el risc potencial de les interferències electro...

  8. Nota complementar sobre o famoso chute de Pelé


    Ferreira, G.F. Leal


    Baseado nos dados levantados e calculados em recente artigo publicado nesta revista, de autoria de C.E. Aguiar e G. Rubini [1] sobre o famoso chute de Pelé na Copa do Mundo do México de 1970, obtem-se a posição em que a impulsão foi aplicada à bola. Based on monitored and calculated data performed in recent article published in this journal, by C.E. Aguiar and G. Rubini [1] about the famous Pelé kick in the 1970 Mexico World Cup, the position where the impulse was applied on the ball is ca...

  9. Notas sobre tres especies de Gigartinaceae (Rhodophyta del litoral peruano

    Directory of Open Access Journals (Sweden)

    Martha Calderón


    Full Text Available La gran variabilidad morfológica de la familia Gigartinaceae ha producido constantes cambios taxonómicos en sus especies miembros. Tradicionalmente su taxonomía ha estado basada en caracteres de la morfología externa; sin embargo, recientes estudios morfológicos, respaldados con trabajos moleculares, han delimitado los géneros en base a al desarrollo del cistocarpo y de los tetrasporangios. El presente trabajo revisa y comenta sobre las estructuras morfológicas vegetativas y reproductivas de tres especies presentes en Perú: Chondracanthus chamissoi, Mazzaella denticulata y Chondrus canaliculatus.

  10. Regimen de propiedad sobre recursos genericos y conocimiento tradicional


    Nemogá Soto, Gabriel R.


    Este artículo expone los cambios históricos que se han dado en relación con la propiedad, el control y el acceso a los recursos genéticos. Desde su consideración como patrimonio común de la humanidad, los derechos sobre el material y la información genética han sufrido profundas transformaciones. El marco jurídico internacional concerniente a estos derechos se ha transformado para legitimar y promover su apropiación y monopolización. Parte de esta transformación fue la expansión de derecho...

  11. Narrativas sobre conjugalidade de mulheres que se relacionam com crossdressers


    Vencato, Anna Paula


    Resumo: Este texto discute dados coletados em pesquisa com mulheres que se identificam como “esposas” ou “S/O’s” de homens que “praticam crossdressing”. É, também, um desdobramento de minha tese de Doutorado, sobre como homens que se identificam como crossdressers negociam esta prática em suas vidas cotidianas. A pesquisa parte de uma etnografia e é complementada por entrevistas semiestruturadas com estas mulheres. Busca-se compreender como elas lidam com as tensões relativas às convenções so...

  12. Declaración sobre la Crisis Migratoria Mundial


    Villaseñor-Bayardo, Sergio Javier; Alarcón, Renato; Rohlof, Hans


    En este artículo se presenta una versión resumida de la Declaración sobre la Crisis Migratoria Mundial (1), suscrita por la Asociación Mundial de Psiquiatría Cultural en el marco del Congreso Desafíos globales y psiquiatría cultural: Desastres naturales, conflictos, inseguridad, migración y espiritualidad -sostenido en Puerto Vallarta, Jalisco, México, del 29 de octubre al 2 de noviembre de 2015-. El tema principal abordado por la declaración es la actual crisis migratoria mundial, causada, e...

  13. Declaración sobre la Crisis Migratoria Mundial



    En este artículo se presenta una versión resumida de la Declaración sobre la Crisis Migratoria Mundial (1), suscrita por la Asociación Mundial de Psiquiatría Cultural en el marco del Congreso Desafíos globales y psiquiatría cultural: Desastres naturales, conflictos, inseguridad, migración y espiritualidad —sostenido en Puerto Vallarta, Jalisco, México, del 29 de octubre al 2 de noviembre de 2015—.  El tema principal abordado por la declaración es la actual crisis migratoria mundial, causad...

  14. Aplicaciones sobre plataformas de redes neuronales en tiempo real


    Tosini, Marcelo Alejandro; Acosta, Nelson


    El presente trabajo pretende el diseño de una metodología para la construcción de aplicaciones basadas en redes neuronales sobre una plataforma Muren. Las aplicaciones se restringen a sistemas de control y reconocimiento de patrones por imágenes. Se describe la arquitectura del sistema de desarrollo Muren, basado en 2 procesadores ZISC de 78 neuronas cada uno, una FPGA Spartan II, bancos de memoria y lógica adicional de comunicación.

  15. Tendências de pesquisas brasileiras sobre mulheres mastectomizadas


    Azevedo, Elisângela Braga de; Bezerra, Pollyana Amorim Ponce de Leon; Neto, José Melquiades Ramalho; Bustorff, Leila Alcina Correia Vaz; Souto, Cláudia Maria Ramos Medeiros


    Objetivou-se analisar as tendências das pesquisas realizadas no Brasil sobre mulheres mastectomizadas. Trata-se de um estudo bibliográfico de abordagem quantitativa, realizado de 15 de junho a 31 de julho de 2009. Para coleta dos dados empíricos utilizou-se um instrumento estruturado, posteriormente os dados foram tabulados, analisados, transformados em porcentagens e agrupados em uma tabela para facilitar a visualização das informações. A amostra foi constituída por resumos adquiridos atravé...

  16. Segurança e estudos sobre a paz


    Couto, Abel Cabral


    O autor começa por expor sucintamente as principais teorias sobre a origem da guerra: teleológicas, bio-sociológicas e evolucionistas, equacionando de seguida três modelos de relacionamento entre a segurança e a paz: equilíbrio estratégico, segurança colectiva e Governo mundial. Até fim da Guerra Fria o Sistema Internacional era, essencialmente, um sistema de relacionamento interestatal, sendo que o problema da segurança se reportava à segurança entre Estados. O autor caracteriza ...

  17. Material audiovisual sobre el mausoleo del mambisado guantanamero

    Directory of Open Access Journals (Sweden)

    Jorge Vidal Gamayo


    Full Text Available El material está relacionado con la historia de la provincia Guantánamo, específicamente el mausoleo al mambisado, y es resultado de varias investigaciones relacionadas por parte de estudiantes y trabajadores de la Universidad de Ciencias Pedagógicas “Raúl Gómez García”. Aparecen los hechos históricos acontecidos el 24 de febrero de 1895 en La Confianza, con una descripción de las reliquias históricas sobre la guerra de independencia.

  18. Producción cepalina sobre educación


    Fernando Díaz Ortega


    El siguiente trabajo presenta una visión global del conjunto de la producción de la Comisión Económica para América Latina y el Caribe (CEPAL) sobre educación, mediante la clasificación y análisis de las publicaciones cepalinas relacionadas con el tema educativo desde 1949 hasta 2002. Para dar esa visión dividí los documentos bajo tres criterios temporales y bajo cuatro clasificaciones. Los criterios temporales fueron: anualmente, en dos periodos (1949-1976 y 1977-2002) y en seis etapas (1949...

  19. Seis Tesis no convencionales sobre participación

    Directory of Open Access Journals (Sweden)

    Bernardo Kliksberg


    Full Text Available Si bien hasta hace pocos años la participación generaba mucha polémica, actualmente se esta transformando en un consenso y gran parte de los organismos internacionales la están adoptando como estrategia de acción. Este trabajo plantea una serie de tesis sobre aspectos claves del tema. El objetivo no es dar un tratamiento exhaustivo a ninguno de los temas planteados, sino estimular el análisis colectivo de la misma.

  20. Stuart Hall sobre raza y racismo: estudios culturales y la práctica del contextualismo

    Directory of Open Access Journals (Sweden)

    Lawrence Grossberg


    Full Text Available El trabajo de Stuart Hall sobre la raza no puede separarse de su trabajo sobre los estudios culturales, y en particular, de su compromiso con un contextualismo radical. En este artículo, argumento que la obra de Stuart Hall sobre raza y racismo en el contexto de su compromiso de larga data con una práctica radicalmente contextualista y con la noción de la especificidad histórica en particular.

  1. Seguridad en redes y sistemas : Técnicas y conceptos sobre hacking y pentesting


    Jiménez Jiménez, Cristian


    El siguiente documento trata sobre seguridad informática. Se detallarán técnicas y conceptos sobre seguridad en redes y sistemas, pentesting y auditorías de seguridad. El següent document tracta sobre seguretat informàtica. Es detallaran tècniques i conceptes sobre seguretat en xarxes i sistemes, pentesting i auditories de seguretat. The following document is about computer security. Techniques and network security concepts and systems, pentesting and safety practices will be described....

  2. Celulas solares e sensores de filme fino de silicio depositados sobre substratos flexiveis = (United States)

    Pinto, Emilio Sergio Marins Vieira

    Celulas solares flexiveis de filmes finos de silicio sao geralmente fabricadas a baixa temperatura sobre substratos de plastico ou a mais elevadas temperaturas sobre folhas de aco. Esta tese reporta o estudo da deposicao de filmes finos sobre diferentes substratos de plastico, transparentes e coloridos, para celulas solares do tipo sobrestrato e substrato, respectivamente. Como objetivo co-lateral, os filmes dopados depositados sobre plastico foram usados como sensores de deformacao, utilizando as suas propriedades piezo-resistivas. Elevadas taxas de deposicao dos filmes de silicio depositados sobre plastico foram obtidas a baixa temperatura do substrato (150ºC) por rf-PECVD. A influencia de diferentes parametros de deposicao sobre as propriedades e taxa de deposicao dos filmes resultantes foram estudados e correlacionados. Celulas solares de filmes finos de silicio amorfo e microcristalino foram desenvolvidas a baixas temperaturas sobre plasticos. Eficiencias de 5 - 6.5% foram alcancadas para as celulas amorfas e 7.5% para as celulas microcristalinas. Efeitos de aprisionamento da luz foram estudados atraves da texturizacao por ablacao laser de substratos de plastico e corrosao umida de TCO sobre plastico. Filmes finos de silicio microcristalino, depositados por HW-CVD, com fator piezoresistivo de -32.2, foram usados para fabricar sensores de deformacao em uma membrana plastica muito fina (15 μm). Estruturas de teste em textil e a miniaturizacao dos sensores piezoresistivos depositados sobre substratos flexiveis de poliimida foram abordados.

  3. Análisis sobre consumo de carne porcina en la Argentina : relevamiento sobre una población seleccionada


    Marchese, Nicolás Gaspar; Alippe, María Victoria; Vieites, Carlos María; López, María Virginia; De Caro, Adriana E. J.


    p.179-184 La carne porcina es la de mayor consumo en el mundo; en la Argentina tiene baja incidencia en el consumo total de carnes, especialmente en estado fresco. Se carece de antecedentes publicados para determinar las causas culturales y/o de información que provocan este comportamiento. Se realizó una encuesta de opinión sobre preferencias en el consumo de carnes, utilizando el Muestreo Aleatorio Estratificado con muestras de la población de la Facultad de Agronomía (UBA). No se observ...

  4. La ceguera como motivo en Ensayo sobre la ceguera de José Saramago e Informe sobre ciegos de Ernesto Sábato


    Fonseca, Marco Antonio


    El trabajo de investigación, El motivo de la ceguera en el Ensayo sobre la ceguera de José Saramago e Informe sobre ciegos de Ernesto Sábato, analiza desde el área y la metodología de la literatura comparada el uso del motivo literario de la ceguera en los dos textos mencionados, resaltando las similitudes y diferencias del tratamiento del motivo dentro de las dos obras y como éste sostiene una serie de obsesiones e ideas sobre el estado actual del mundo que comparten los autores de las dos n...

  5. Familias reconstituidas: Un estudio sobre las nuevas estructuras familiares

    Directory of Open Access Journals (Sweden)



    Full Text Available En la mayoría de las investigaciones sobre la familia, los estudios se han centrado en las familias intactas o primeras familias. Sin embargo, es cada vez mayor el número de familias cuya configuración incluye un segundo matrimonio e hijos de una unión anterior (i.e. familias reconstituidas. En la consolidación del complejo proceso de ajuste de estas familias se han identificado unas fuentes comunes de estrés relacionadas principalmente con la formación de un nuevo sistema familiar. El objetivo de este artículo es realizar una revisión de las variables que inciden en el bienestar y/o malestar psicológico sobre una muestra de padrastros y madrastras españoles en el seno de estas nuevas configuraciones familiares. En una primera fase se realizaron, desde un diseño cualitativo, 20 entrevistas en profundidad a una muestra de padrastros y madrastras. En una segunda fase, se diseñó un cuestionario que fue respondido por 77 sujetos con la finalidad de analizar la posible relación entre alguna de las variables estudiadas.

  6. A etnografia das ruas: notas sobre estudar e ser estudado

    Directory of Open Access Journals (Sweden)

    Hecht, Tobias


    Full Text Available Passeando entre as notas e as lembranças de dois períodos distintos de trabalho de campo, este ensaio "impressionista" trata da dinâmica em mudança de uma relação de pesquisa com crianças de rua. Em 1992-1993, conduzi trabalho de campo para uma dissertação sobre crianças de rua no nordeste brasileiro. Retornando à região seis anos mais tarde, descobri que a maioria das crianças estudadas apenas uma fração de geração antes estavam então mortas. Estas anotações enfocam minhas conversas com um dos sobreviventes e com quem (e sobre quem estou agora escrevendo uma biografia. Esse esforço colaborativo, voltado de certo modo a reconsiderar as implicações éticas da pesquisa com crianças que levam vidas violentas e vulneráveis, levanta uma gama de novos desafios éticos, alguns dos quais inteiramente imprevistos

  7. Notas sobre palmas colombianas y una del Brasil

    Directory of Open Access Journals (Sweden)

    Dugand Armando


    Full Text Available Por mucho tiempo se ha creído que la palma de moriche de los Llanos orientales, en la región del Meta, era la Mauritia flexuosa L. f., especie típica del genero y originaria de Surinam. Al menos todas las obras botánicas publicadas por autores colombianos sobre la flora de nuestro país coinciden en la identificación anotada, incluso mi reciente trabajo sobre las Palmas de Colombia (Caldasia: 1: 22 y 32. 1940. Sin embargo, en este último trabajo, -que no es más que una nómina preliminar de las palmas descritas o señaladas en Colombia mientras adelanto su estudio sistemático en detalle, -identifiqué como Mauritia minor Burret unos frutos procedentes del Meta y sólo incluía la M. flexuosa ateniéndome a los autores que había consultado, suponiendo que ellos estarían en lo cierto respecto a la existencia de esta especie en Colombia, ya que no contaba yo con material autentico colombiano de la misma. Creía pues que realmente existieran ambas especies, M. flexuosa L.f.. y M. minor Burret, en nuestros Llanos, pero circunstancias recientes han venido a rectificar mi criterio.

  8. Apontamentos para o debate sobre o pleno emprego no Brasil

    Directory of Open Access Journals (Sweden)

    Fernando Augusto Mansor de Mattos


    Full Text Available RESUMOEste artigo analisa a evolução dos indicadores de emprego e de desemprego na economia brasileira desde o início dos anos 2000 até os dados referentes a 2012, tomando como referências teóricas a formulação de Keynes sobre o desemprego involuntário e também os estudos sobre a dinâmica das relações entre setor formal e setor informal dos mercados de trabalho formulados por autores ligados ao Prealc. O artigo apresenta um exercício econométrico (que teve por base a função emprego de Keynes explicada pelo Princípio da Demanda Efetiva que revela que o crescimento do emprego é uma função positiva do crescimento econômico. Dados adicionais mostram que, a despeito do crescimento da ocupação e da formalização do emprego ocorrida no período, com consequente queda da taxa de desemprego para patamares historicamente baixos, a economia brasileira não conseguiu, segundo as referências teóricas adotadas, atingir o pleno emprego ao final do período analisado, devido à persistência de parcela expressiva de mão de obra subutilizada no mercado de trabalho.

  9. Sobre el uso de conceptos comprensivos en los Ciencias Sociales

    Directory of Open Access Journals (Sweden)



    Full Text Available Se comparan los conceptos particulares, que describen la diversidad de los datos, y los conceptos generales, que se ocupan de los valores de las variables. En Ciencias Naturales, la generalización es el objetivo del conocimiento ; sin embargo, en las Ciencias Sociales, lo que se persigue es la consistencia del significado de los datos, mientras que la generalización es sólo un medio de conocimiento. D. Bell, en The Coming of the Post-Industrial Society, interpreta conjuntamente lo peculiar de la individualidad, del intérprete, del texto, de la acción o el conjunto de acciones, y de los contextos institucionales, sociales e históricos. Los estudios modernos de Pragmática y crítica textual aportan nuevas nociones sobre el texto como un producto de la actividad del intérprete, y sobre el contexto como el medio en el cual se realiza la actividad. Una ciencia social orientada hacia las ciencias del espíritu puede basarse en esos instrumentos teóricos. La Filosofía, la Sociología del Lenguaje, las teorías de la acción y el texto se unifican en una ciencia conjunta de alcance social e histórico.

  10. Comportamento da cajazeira enxertada sobre umbuzeiro em Pacajus-CE

    Directory of Open Access Journals (Sweden)

    Souza Francisco Xavier de


    Full Text Available A cajazeira é uma fruteira da família Anacardiaceae, explorada extrativamente, cujos frutos são nuculânios amarelos, de sabor agridoce, perfumados, ricos em carotenóides, açúcares, vitaminas A e C, denominados de taperebá, cajá-mirim ou cajá e muito utilizados na alimentação humana. Os problemas mais limitantes ao cultivo da cajazeira são a inexistência de clones recomendados para cultivo comercial e o elevado porte da planta. A cajazeira enxertada sobre umbuzeiro apresenta compatibilidade e afinidade entre as partes enxertadas e pouco interfere na forma de crescimento da planta, que é muito semelhante à de planta oriunda de semente, ou seja, tendência em formar caule de haste única e copa alta. A cultura ainda exige estudos sobre as modalidades e épocas de realização das podas para o controle do crescimento da planta e formação de copas que se enquadrem dentro de modelos de exploração intensiva.

  11. Nuevas reflexiones sobre la Posgerontología

    Directory of Open Access Journals (Sweden)

    Ricardo Iacub


    Full Text Available La Posgerontología plantea una lectura epistemológica, crítica y política sobre los relatos con los que se construye el envejecimiento y la vejez desde la gerontología. En este artículo se analizará crítica y políticamente a la gerontología, tanto como un objeto cultural exótico - por su pretensión omnicomprensiva -, como por ser un campo de conocimientos cuyos presupuestos explícitos e implícitos inciden sobre su objeto de estudio. Estos factores ponen en consideración los ajustes que debe realizar todo campo de conocimiento frente a los cambios que le imprime el contexto. Así como también expresan la necesidad de dar cuenta de los efectos de la realidad que construyen en las diversas formas de saber y en las prácticas sociales.

  12. Sobre fuentes, temporalidad y escritura de la historia

    Directory of Open Access Journals (Sweden)

    Germán Colmenares


    Full Text Available Una exposición sobre métodos históricos no puede reducirse a una mera colección de recetas sobre la manera como debe conducirse una investigación desde el momento en que se selecciona un tema monográfico, se localizan las fuentes aprovechables y se someten a variados procedimientos críticos y cuantitativos, hasta cuando se acomete la empresa final de la presentación narrativa o analítica de los resultados. Cada uno de estos pasos ha recibido un énfasis diferente en diferentes épocas, tipificando así una escuela o toda una manera de concebir la tarea historiográfica. El primero de ellos, por ejemplo, no parece recelar mayores dificultades. Sin embargo, cuando en él se considera incluido el planteamiento de un problema y la identificación de los elementos que lo constituyen, entonces resulta encerrar el mayor número de cuestiones teóricas.

  13. Letalidad de hongos entomopatogenos sobre Dysdercus peruvianus (Hemiptera: Pirrhocoridae

    Directory of Open Access Journals (Sweden)

    Francesca Falconi


    Full Text Available Se evaluó la patogenicidad y virulencia sobre Dysdercus peruvianus de una cepa de Acremonium y una de Scopulariopsis, aisladas de adultos infectados de D. peruvianus procedentes de Mala, Provincia de Cañete. También se evaluó una cepa de Beauveria sp. aislada de Schistocerca piceifrons peruviana procedente de Ayacucho. Los bioensayos se realizaron sobre ninfas del cuarto estadío de D. peruvianus y las concentraciones empleadas fueron 3,7x108, 1,9x108, 9,4x107 conidias/mL para Beauveria sp., Acremonium sp. y Scopulariopsis sp. respectivamente. Veinte días posteriores al tratamiento, los mayores porcentajes de mortalidad los causaron Beauveria sp. (83,3% y Acremonium sp. (80%. Scopulariopsis sp. causo una mortalidad de 23,3%. Acremonium sp. fue la cepa más agresiva con un tiempo de letalidad (TL50 3,8 días.

  14. Algumas anedotas sobre Demóstenes: uma releitura

    Directory of Open Access Journals (Sweden)

    Maddalena Vallozza


    Full Text Available Muitas das anedotas sobre Demóstenes estão relacionados a seus problemas de voz e a suas dificuldades no momento da hypokrisis. Eu proponho uma reinterpretação das páginas em que eles nos são transmitidos: de Quintiliano (11, 3, a principal testemunha, a Cícero (Orator 26 e 56-58, Brutus 142, De Oratore I 261 e III 213, do autor da seção sobre Demóstenes nas Vidas dos Dez Oradores (844 d-845 b à Vida de Demóstene, de Plutarco. Com base nisso, particularmente graças a Plutarco, que cita Hermipo e Demétrio de Fáleros, é possível formular a hipótese de que a tradição nasceu no Perípato, na área de interesses pela hypokrisis que demonstram o perdido Perì hypokríseos de Teofrasto e os fragmentos da Retórica de Demétrio de Fáleros.


    Directory of Open Access Journals (Sweden)

    Martha Isabel Posada

    Full Text Available El presente artículo es una descripción de los efectos del mercurio sobre algunas plantas acuáticas tropicales y sobre los ecosistemas donde habitan. Adicionalmente, se recomienda un protocolo para realizar pruebas de toxicidad con la lenteja de agua (Lemna minor y se presentan los resultados de los preensayos con diferentes concentraciones de sales de mercurio en condiciones de laboratorio. Se encontró que la biodisponibilidad del mercurio depende de factores que facilitan la disolución del elemento en el agua. Algunas plantas actúan como bioindicadores de la presencia de este metal en el medio al retenerlo selectivamente; mientras que otras se comportan como bioacumuladoras al tolerar su presencia y acumularlo en su estructura, y pueden dar paso a la bioconcentración a través de la cadena trófica. De acuerdo con los preensayos de toxicidad realizados con Lemna minor se sugiere que las concentraciones de sal de mercurio adecuadas para la realización de pruebas de toxicidad deben estar entre 0,01 mg/L y 10,0 mg/L.

  16. Deus sobre as pedras: Guilherme Figueiredo em Israel

    Directory of Open Access Journals (Sweden)

    Filipe Amaral Rocha de Meneses


    Full Text Available Entre 1963 e 1964, Guilherme Figueiredo – teatrólogo, romancista e crítico de teatro brasileiro – fez uma viagem a Israel, na época uma ainda jovem nação de quinze anos. Essa viagem resultou em Deus sôbre as pedras: Israel, publicado em 1965. O livro contém assuntos variados relativos a Israel, desde explicações sobre a formação do Estado, crítica teatral de autores israelenses e explicação sobre como são constituídos os kibutzim. O objetivo deste artigo é analisar este relato, tomando por base: as descrições dos locais históricos visitados pelo autor, a critica e a interpretação da cultura nacional israelense em formação e os diálogos e encontros que Figueiredo mantem com brasileiros que viviam em Israel – conversas nas quais o principal assunto era a comparação entre a cultura brasileira e a cultura israelense em formação.

  17. Precisiones sobre la luz en el Pantheon de Roma

    Directory of Open Access Journals (Sweden)

    Oscar Linares de la Torre


    Full Text Available El Pantheon de Adriano es una de las obras más celebradas de la historia de la arquitectura. Han sido muchas las cuestiones que han cautivado a cuantos han entrado en él, pero es la luz la que ha acaparado el mayor protagonismo: una vez despojado el edificio de su originaria carga simbólica, la manifestación de su luz interior parece ser el único fin de este inmenso espacio-luz que tanto ha fascinado a arquitectos, historiadores del arte, pintores y fotógrafos. Parece difícil poder aportar nada nuevo. Consciente de ello, el autor del presente artículo sólo pretende apuntar algunas cuestiones sobre distintos aspectos de la luz en el Pantheon que considera que no han sido aún suficientemente desarrolladas: el por qué de la orientación solar y urbana del templo con respecto al eje norte-sur; la reconstrucción de la secuencia de luz y sombra que debió de darse en el recorrido original de acceso al interior del templo; la interpretación del haz de luz ocular como reminiscencia inmaterial del soporte central de las falsas cúpulas etruscas, convertida en una columna de materia sutil que, sin alcanzar nunca la vertical, incide de manera variada sobre los paramentos que conforman el interior.

  18. "Sobre muros e jardins": poesia e videodança

    Directory of Open Access Journals (Sweden)

    Olga Valeska


    Full Text Available Neste trabalho propomos uma análise semiótica da videodança “Sobre Muros e Jardins”, promovido pelos Grupos de Pesquisa parceiros COMTE do Posling-CEFET-MG e CCODA da UFMG. Este vídeo foi produzido a partir do poema homônimo de Olga Valeska "Sobre Muros e Jardins", presente no seu livro Mundos e Mutações. Como tradução semiótica ele envolve distintas linguagens como a literária, a fílmica e a dança. Nosso objetivo é verificar como tais linguagens foram transpostas para o gênero “vídeodança”, em um processo dinâmico de mutação entre distintas texturas de imagens, sons e movimentos rítmicos.


    Directory of Open Access Journals (Sweden)

    Miriam Espindula dos Santos


    Full Text Available Primeiramente quero justificar minha opção por fazer uma síntese-resenha do livro O Saber Local: novos ensaios em antropologia interpretativa, de Clifford Geertz. A escolha se deu pela inquietação que o mesmo provocou no momento de sua leitura, o referido ensaio contribuiu de forma significante para o meu processo de (in maturação acadêmica, pessoal e de pesquisadora. A intenção é destacar os pontos mais relevantes do livro, lançar um olhar sobre algumas questões problematizadas pelo autor. Apesar de não utilizar a hermenêutica interpretativa proposta por Geertz em minha pesquisa, a mesma possibilitou muitas ideias acerca de como proceder enquanto pesquisadora, no trato que devo ter para com o meu objeto, um trato respeitoso, atencioso, aberto, com um olhar afinado para as questões que o cerca, bem como o uso de analogias para analisar determinados fatos. Destaco que o meu olhar sobre este ensaio também reflete as discussões calorosas que realizamos em sala de aula acerca do mesmo, bem como dos momentos em que analisamos os projetos de pesquisas dos colegas da turma, apesar de não me deter neste aspecto. Assim sendo, vou seguir basicamente a divisão proposta pelo ensaísta nesta obra, refletindo acerca do que mais me inquietou neste ensaio...

  20. Sobre la teoría impura del derecho

    Directory of Open Access Journals (Sweden)

    Danilo Rojas Betancourt


    Full Text Available La reseña hecha al libro del profesor Diego López, la Teoría impura del derecho, muestra algunos aspectos que debilitan la novedosa e importante tesis allí sostenida sobre la transformación de la teoría jurídica en Latinoamérica. En especial, señala que la particular apreciación de López sobre algunos tópicos kelsenianos deja demasiado expuesta la demostración que respecto de Kelsen proporciona como ejemplo de transformación teórica en Colombia. El reparo central radica en que la construcción hecha por López de lo que se denominaría regla de tanteo de la Teoría Transnacional del Derecho, TTD, toma como base una versión formalizada y no crítica de esta. Al hacerlo, López cae en la misma trampa que pretende mostrar como característica de la transformación local y que, conforme a la lectura estándar de cierta TTD, debe señalarse como incorrecta.

  1. Considerações sobre cuidado paliativo e trabalho hospitalar: uma abordagem plural sobre o processo de trabalho de enfermagem

    Directory of Open Access Journals (Sweden)

    Miguel de Simoni


    Full Text Available O objetivo deste artigo é apresentar o esforço de síntese dos autores sobre material de pesquisa em cuidados paliativos e bibliografia estudada. Inicialmente, apresentamos algumas considerações sobre cuidado paliativo em dois países estruturalmente distintos, Brasil e França. A discussão está centrada nas experiências de pesquisa dos autores em um serviço de AIDS no Brasil e em um serviço de Medicina Interna na França, que adotava a lógica dos cuidados paliativos e abrigava predominantemente pacientes com AIDS e câncer. Abordamos, em seguida, aspectos referidos à dor e à morte, considerando conceitos da Bioética e a dimensão relacional do cuidado em saúde. Os conceitos assinalados são os de justiça, autonomia, beneficência e não-maleficência. Concluímos, apresentando algumas possíveis contribuições da Ergonomia e da Psicodinâmica do Trabalho na área de Cuidados Paliativos, considerando especialmente a dimensão psicológica deste debate.

  2. Contabilidad de Costos I. - Problemas sobre contabilización de las actividades relacionadas con los materiales


    Morillo Moreno, Marysela C.


    ÍNDICE Introducción Problemas sobre terminología básica Problemas básicos sobre el Ciclo de la Contabilidad de Costos Problemas sobre contabilización de las actividades relacionadas con los materiales Problemas sobre la contabilización de las actividades relacionadas con la mano de obra Problemas sobre la contabilización de las actividades relacionadas con los costos indirectos de fabricación Problemas sobre el Ciclo de la Contabilida...

  3. Contabilidad de Costos I. - Problemas sobre la contabilización de las actividades relacionadas con la mano de obra


    Morillo Moreno, Marysela C.


    ÍNDICE Introducción Problemas sobre terminología básica Problemas básicos sobre el Ciclo de la Contabilidad de Costos Problemas sobre contabilización de las actividades relacionadas con los materiales Problemas sobre la contabilización de las actividades relacionadas con la mano de obra Problemas sobre la contabilización de las actividades relacionadas con los costos indirectos de fabricación Problemas sobre el Ciclo de la Contabilida...

  4. Eflorescencias y costras sobre areniscas de Villamayor. Ensayos de laboratorio

    Directory of Open Access Journals (Sweden)

    Madruga, F.


    Full Text Available Accelerated tests carried out in the laboratory allow us to study the crystalline material settled over the surface of the sandstones when in contact with watery solutions of different compositions. Sandstone specimens of three different textures were placed on trays containing watery solutions, putting one surface in contact with the liquid. In order to accelarate the capillary absorption, a flow of air was established over the opposite surfaces. The humidity and dryness cycles were repeated 45 times. The crystallized salts were identified by X-ray diffraction, SEM and chemical microanalysis by X-rays dispersive energy. The following results were obtained: gypsum, hexahydrite, picromerite, natrone, arcanite in saline solutions; trone, aftitalite, and presence of gypsy m in cement solutions; gypsum and syngenite in the guano solution test. These salts are analogous to those found in the superficially damaged stones of the Cathedral of Salamanca.

    Ensayos acelerados realizados en el laboratorio, permiten estudiar el material cristalino depositado sobre la superficie de areniscas cuando están en contacto con disoluciones acuosas de diferente composición. Probetas de areniscas de tres texturas diferentes se colocan sobre bandejas que contienen las disoluciones acuosas, de tal forma que una de las superficies esté en contacto con el líquido. Sobre las superficies opuestas se establece una corriente de aire que acelere la absorción capilar del líquido. Ciclos de humedad y secado se repiten 45 veces. Las sales cristalizadas se identifican por difracción de rayos-X, SEM y microanálisis químico por energía dispersiva de rayos-X. Los resultados son los siguientes; yeso, hexahidrita, picromerita, natrón y arcanita cuando se trata de disoluciones salinas; trona, aftitalita y presencia de yeso cuando la disolución es de cemento; yeso y syngenita en el ensayo con disolución de guano. Estas sales son análogas a las encontradas en las

  5. Estudos sobre a toxicologia da ε-caprolactama

    Directory of Open Access Journals (Sweden)

    Marcus Vinicius Justo Bomfim


    Full Text Available A ε-caprolactama (CAP é um monômero precursor de polímeros denominados nylon 6. Esses polímeros destinam-se à produção de tapetes, vestuário e materiais plásticos tais como equipamentos, sistemas e componentes automotivos, conectores, além de embalagens plásticas. Resíduos de CAP podem migrar de embalagens plásticas de nylon 6 para os alimentos. Diante disso, foi de interesse realizar uma revisão dos efeitos relativos à exposição à CAP e o seu impacto sobre a saúde humana. Estudos epidemiológicos indicam a possibilidade da CAP causar inflamações oculares e cutâneas, além de irritações no sistema respiratório. Pode ocorrer ainda hipotensão, taquicardia, palpitações, rinorréia, ressecamento nasal, efeitos geniturinários e sobre a reprodução como distúrbios nas funções menstrual e ovariana, e complicações no parto; além de problemas neurológicos e hematológicos. Estudos com animais são consistentes com tais relatos. Os estudos de genotoxicidade in vitro e in vivo por via oral e intraperitoneal mostram em sua grande maioria, resultados negativos, bem como ausência de efeitos carcinogênicos em ratos e camundongos e sobre o desenvolvimento e reprodução em ratos e coelhos.ε -Caprolactam (CAP is a precursor monomer of nylon 6 polymers. Nylon 6 is used in the manufacture of carpets, clothes and plastic materials, such as equipment, systems and automotive components, connectors and plastic packaging. CAP residues can migrate from nylon 6 plastic packaging to foods. Given this fact, this review was realized concerning the effects of CAP exposure and its impact on human health. Epidemiological studies indicate that CAP could cause ocular, cutaneous and respiratory irritations, as well as hypotension, tachycardia, palpitations, rhinorrhea, nose dryness, neurological and blood problems, and genitourinary and reproductive effects, such as alterations in ovarian-menstrual functions and pregnancy

  6. O impacto do uso de ADRs sobre o valor de empresas brasileiras : um estudo de evento


    Miyazaki, Joel


    Investiga o impacto do uso de ADRs sobre o valor de empresas brasileiras e a eficiência do mercado de capitais. Aborda as hipóteses que podem explicar este impacto e compara os resultados deste estudo com os de outras pesquisas efetuadas no Brasil e sobre ações de outros países.

  7. Avisos de salud sobre el PFOA y PFOS en el agua potable (United States)

    La EPA estableció avisos de salud sobre el ácido perfluorooctanoico (PFOA) y el sulfonato de perfluorooctano (PFOS) para proporcionar información a los operadores de sistemas de agua potable y funcionarios estatales, tribales y locales sobre los riesgos de

  8. Reinventar un héroe: narrativas sobre los soldados rasos de la Guerra de Corea


    Quiroga Cubides, Sebastián


    Esta investigación se pregunta sobre las diferentes narrativas históricas que se han construido sobre la figura de los soldados rasos de la guerra de Corea, y por cómo ellos han generado estrategias en su relato que se ajustan a unos procesos históricos determinados.

  9. Nuevo puente sobre el río Ganges

    Directory of Open Access Journals (Sweden)

    S. Sarwal


    Full Text Available Recientemente se ha puesto en servicio un nuevo puente sobre el río Ganges, a unos cinco kilómetros aguas abajo de la estación ferroviaria de Mokameh Ghat, del Estado de Bihar, en la India. La obra consta de 14 tramos principales, de unos 120 m, aproximadamente, de luz cada uno, y 4 tramos, dos en cada extremidad, de 30 m de luz, que constituyen un total de 1.820 m de longitud. El puente tiene dos tableros: el superior, de 7,30 m de anchura, destinado a un paso de carretera, y el inferior, convenientemente separado, para el paso de un ferrocarril. Entre la parte inferior del puente y el nivel de aguas se ha dejado una altura libre de 10,50 m para el paso de la navegación fluvial.

  10. Apuntes para hilvanar una historia sobre las mujeres

    Directory of Open Access Journals (Sweden)

    Teresa Fallas Arias


    Full Text Available Para abordar la historia sobre las mujeres debe considerarse que fue escrita por los varones, fuente plagada de prejuicios, de estereotipos y reproductora de la retórica androcéntrica que convirtió la diferencia sexual femenina en desigualdad e inferioridad. En esta indagación se valora la diferencia sexual como complementariedad y riqueza, pues posibilita la puesta en escena de los lenguajes y los saberes menospreciados, invisibilizados o anulados durante milenios. Pensar a la mitad de la humanidad en estos tiempos, implica rechazar la historia unívoca e idéntica que ocultó las experiencias de las mujeres, para contarlas sin intermediarios e intérpretes proclives a la historia institucionalizada.

  11. Apuntes sobre historia empresarial: Relatos de algunas experiencias

    Directory of Open Access Journals (Sweden)

    Elber Berdugo Cotera


    Full Text Available El presente articulo tiene como objetivo mostrar la importancia de la Historia Empresarial y la constitución de una línea de investigación para el entendimiento de la historia del país y la comprensión de las principales características de nuestros empresarios tanto en el ámbito regional como en el nacional. Se trata igualmente, de dar cuenta de los aspectos teóricos y metodológicos utilizados en la investigación sobre el estudio de caso de Servientrega y sus gestores, lo mismo que de los principales hallazgos encontrados en ella. Por último, señalar cómo ésta clase de experiencias pueden resultar enriquecedoras para aquellas personas que ejercen una función educativa empresarial o pretenden asumir como proyecto personal y familiar de vida ser empresarios.


    Directory of Open Access Journals (Sweden)

    Lucía Amoruso


    Full Text Available En la última década, el desarrollo y la puesta en marcha delas modernas técnicas de neuroimagen en el campo de laneurociencia cognitiva han proporcionado una nueva vía deacercamiento al estudio experimental de algunos trastornosmentales. Dentro de esta perspectiva, denominada por algunosautores “neuropsiquiatría cognitiva”, la histeria (o trastornode conversión, de acuerdo con la clasificación psiquiátricaactual ha cobrado un amplio protagonismo. De acuerdo conlo anterior, el objetivo del presente trabajo consiste en introducirestudios pioneros basados en una perspectiva neurocientíficade la histeria. Conviene destacar que, si bien estosaportan evidencia significativa sobre algunas de las áreascerebrales y las disfunciones cognitivas comprometidas enel mencionado trastorno, los resultados obtenidos a la fechadistan aún de ser concluyentes.

  13. Sobre la complejidad del Estado y las contrataciones administrativas

    Directory of Open Access Journals (Sweden)

    Armando Rodriguez García


    Full Text Available El tema de los contratos que celebra el Estado ha significado un tema de interés constante para el Derecho administrativo, debido a las particularidades que adoptan las figuras contractuales aplicadas en el sector público en el orden científico. Adicionalmente ese interés se ha incrementado con la ampliación del empleo de los contratos -con ocasión de los cambios operados por la globalización-. El enfoque que se ofrece a continuación apunta a la consideración de la complejidad presente en la acción pública, para así comprender mejor el entorno de los contratos públicos y su alcance, y obtener una clara perspectiva sobre lo que aporta el Derecho administrativo global.

  14. Percepciones sobre biotecnología en Nicaragua

    Directory of Open Access Journals (Sweden)

    Jorge A. Huete-Pérez


    Full Text Available La biotecnología se ha convertido en un tema de controversia y disputa internacional. Para medir los niveles de aceptación de estas tecnologías en Nicaragua, el Instituto de Encuestas de Opinión de la Universidad Centroamericana (IDESO-UCA realizó recientemente un sondeo preliminar sobre asuntos de biotecnología e ingeniería genética entre miembros de la comunidad universitaria, representantes de ONG'S y de instituciones de gobierno. Los resultados señalan que en general hay una actitud positiva hacia la biotecnología y sus aplicaciones y que se espera que estas tecnologías contribuirán a mejorar las condiciones de vida del país.

  15. Reflexiones sobre la Reforma de la Seguridad Social en Salud.


    José Felix Patiño Restrepo


    En el contexto de la ejecución de la Ley 100 de 1993, el enfoque intelectual de los problemas de salud es reemplazado por un enfoque económico, bajo el precepto neoliberal de convertir la atención de la salud en un bien de mercado y en un negocio con ánimo de lucro.

    Ello, sin duda, es una perversión de la moral social que tiene un profundo efecto sobre la estructura ética y deontológica de la medicina, porque lleva al médico a desatender su obligación hipocrática co...

  16. Conceptos actuales sobre el envejecimiento y la enfermedad cardiovascular

    Directory of Open Access Journals (Sweden)

    Carolina Pemberthy López


    Full Text Available En los últimos años se ha presentado un notable incremento en la proporción de población mayor de 65 años de edad, de la mano con el incremento de las enfermedades cardiovasculares, específicamente la enfermedad coronaria. No obstante, los mecanismos fisiopatológicos del envejecimiento y su relación con la salud cardiovascular son un campo de reciente investigación. Resulta fundamental conocer aspectos como: la teoría del acortamiento de telómeros, el papel de la actividad física, el endotelio y los mecanismos moleculares que participan en este proceso, pues ofrecerá herramientas para hacer un manejo acertado de este grupo poblacional, sobre el cual son pocos los estudios y la mayoría de las conductas son extrapoladas de grupos etarios con condiciones fisiológicas completamente diferentes.

  17. Algunas consideraciones teóricas sobre el liderazgo transformacional

    Directory of Open Access Journals (Sweden)

    Otilia Bracho Parra


    Full Text Available El artículo tuvo como objetivo, realizar algunas consideraciones teóricas sobre el liderazgo transformacional, tomando como referencia los planteamientos de Bass y Avolio (2006, Velásquez (2006, Lerma (2007, Leithwood, Mascall y Strauss (2009, entre otros. El proceso metodológico implico revisión bibliográfica, a través de la hermenéutica. Concluyendo que el liderazgo transformacional implica convertir a los colaboradores en personas creativas, motivadas al logro, comprometidas e identificadas con la organización, además de inspirar en sus seguidores la participación, pensar en colectivo, esforzándose en alcanzar metas significativas, en pro de la misión y visión de la empresa.

  18. El proceso reproductivo: Algunas consideraciones sobre el maternaje

    Directory of Open Access Journals (Sweden)

    Ignacio González Labrador


    Full Text Available Se realizaron una serie de consideraciones generales sobre el proceso reproductivo, y como una consecuencia de él se consolida un proceso llamado maternaje, conceptualizándose según criterio del autor, cómo puede influir en la vida sexual de la mujer. Se conceptualiza según las letras que componen la palabra que denomina dicho procesoA series of general considerations on the reproductive process as a result of which the so-called motherhood process is strengthened were presented in this paper. The author conceptualizes the influence of this process on the woman’s sexual life. The conceptualization is based on the letters of the word defining such a process

  19. Impacto das Competências de Equipes sobre o Desempenho

    Directory of Open Access Journals (Sweden)

    Katia Puente-Palacios


    Full Text Available Resumo As competências para o trabalho têm sido tradicionalmente compreendidas como atributos de indivíduos; entretanto, estudos mais recentes tornam pertinente defender a sua ocorrência como atributos coletivos. O objetivo deste estudo foi demonstrar que competências individuais podem transformar-se em competências coletivas e, nesse nível, predizer o desempenho da equipe. A testagem empírica foi realizada em 51 aeródromos brasileiros, totalizando 106 equipes (entre 3 e 32 integrantes. Instrumentos respondidos pelos membros focaram nas competências enquanto os respondidos pelos lideres indagaram sobre o desempenho das equipes. Os resultados revelaram que as competências coletivas explicam aproximadamente 20% do desempenho das equipes. Disso depreende-se que as competências podem se manifestar como atributos coletivos que predizem resultados de equipes de trabalho.

  20. Cavilaciones sobre el interés simple


    Leonor Cabeza de Vergara


    Como producto de las reflexiones sobre la conceptualización del interés simple surgieron dos preguntas a nivel de clase: ¿Por qué, bajo la modalidad del interés simple, el presente de cada una de las cuotas constantes vencidas no es igual al presente de la anualidad vencida?, y ¿Qué porción de una cuota vencida bajo el interés simple se asigna a interés y a capital? Para trabajar estos interrogantes se partió de un caso práctico y con el soporte conceptual de interés simple, series, serie arm...

  1. Reflexiones sobre ética mínima

    Directory of Open Access Journals (Sweden)

    Fernando Soto Aparicio


    Full Text Available La ética puede definirse como un manual de convivencia, como un tratado de buenas maneras, como un compromiso para la tolerancia. Pero dada la diversidad de costumbres, creencias religiosas, enfoques políticos y maneras de vivir de los distintos pueblos de la tierra, generalizar sobre la ética es casi imposible. Por eso, si tratamos de una ética mínima, estamos refiriéndonos a la parte sustancial del vivir en comunidad; a las pequeñas circunstancias, a las elementales exigencias que posibilitan que pueblos disímiles se entiendan en lo primario, y aprendan a tolerarse y a buscar ámbitos de concordia por encima de sus diferencias

  2. Revestimientos asfálticos sobre bases continuas

    Directory of Open Access Journals (Sweden)

    Eberle, Karl


    Full Text Available In the course of a meeting connected with research on road pavements, held at Konstance, in Germany, Dr. Eberle submitted for discussion and study two new methods for the construction of modern pavements. In general outline, the first of these methods consists in placing a layer of gravel, of about 18 cms depth, on top of the foundation base, after suitably treating the latter to protect it against frost. An asphaltic layer of much smaller depth is then placed on the gravel layer, which constitutes a flexible base. The asphaltic layer is the actual traffic pavement. The second method is similar to the first as regards the grading, box and foundation. The only difference is that cement mortar is applied to the gravel base, into the hollow spaces of which the mortar is made to penetrate. In both methods the top pavement is consolidated mechanically by means of suitable auxiliary equipment. The choice of one or other of the previous two methods depends on the results obtained from a general study of the location and quality of the available crushed stone, and on the facility to transport these materials to the prepared graded subbases. The author claims that the rational use of these methods gives good results, both technically and economically.Con motivo de celebrarse una reunión encargada de la investigación I sobre firmes para carreteras, verificada en Konstanz, Alemania, el autor expuso para su estudio y consideración dos nuevos métodos constructivos para afirmados modernos. El primero de estos métodos consiste, a grandes rasgos, en colocar una capa, de grava, de unos 18 cm de espesor, sobre la superficie de la base de cimiento, convenientemente tratada, para protegerla contra las heladas. Sobre esta capa, que constituye un firme flexible, se coloca otra asfáltica de mucho menor espesor, que sirve de rodadura. El segundo método es similar al anterior en lo que se refiere a la explanación, caja y cimiento; la única diferencia estriba en

  3. Notas sobre o autotelismo discursivo em ciências humanas

    Directory of Open Access Journals (Sweden)

    Paulo Eduardo Lopes


    Full Text Available O Ateliê de Semiótica Discursiva, coordenado por Denis Bertrand, propôs focalizar, no ano letivo 1991-1992, a " Estética do Discurso Erudito", no quadro da temática "Estética da Ética" do Seminário de Semântica Geral, de A.J . Greimas, na Escola de Altos Estudos em Ciências Sociais de Paris (E. H. E. S. S.. Bertrand distribuiu cópias de trechos de textos célebres em ciências humanas (Lévi-Strauss, Deleuze e Guattari, Greimas, Barthes, Foucault e outros, sobre os quais os participantes deveriam realizar análises que tomassem como modelo, por exemplo, aquelas praticadas por Greimas e Landowski em lntroduction à L 'Analyse du Discours en Sciences Sociales ( 1979.

  4. Puente Kohlbrand Sobre el Elba Hamburgo -Alemania Federal

    Directory of Open Access Journals (Sweden)

    Schwab, Rudolf


    Full Text Available The suspension bridge, in the port of Hamburg, is one of the most important engineering works in northern Germany. The work is divided into three sectors: 1 The eastern accommodation ramp, 2,410 m long. 2 The bridge across the river bed, 520 m long. 3 The western accommodation ramp, -,050 meters. The bridge is 17.60 m wide and has four traffic lanes. Sectors 1 and 3 were solved by means of prestressed concrete superstructures, with one or two cell box girders. Sector 2 has a 325 m span between the two piers and a 54 m high and 150 m ship passage. The central piers that rise 130 m above the ground consist of a base of reinforced concrete and a 98 m high metallic part, formed by a box of bolted and subsequently welded beams. In the upper part of this last part are the connections for the suspension cables for the overhanging part of the bridge. The construction works were carried out beginning with sectors 1 and 3 on both sides of the river simultaneously. Once these were completed and the piers were raised, the work.El puente elevado de Kohlbrand, en el puerto de Hamburgo, es una de las obras de ingeniería más importantes de la parte norte de Alemania. La obra se divide en tres sectores: 1° La rampa este de acceso, de 2.410 m. 2° El puente sobre el cauce del río, de 520 m. 3° La rampa oeste de acceso, de 1.050 m. El puente tiene 17,60 m de anchura y cuatro carriles. Los sectores 1.» y 3.° se resolvieron mediante superestructuras de hormigón pretensado, con vigas cajón de una o dos células. El sector 2.° posee una luz de 325 m entre las dos pilas principales, y una altura útil de paso sobre el nivel del agua de 54 m en un ancho de 150 m. Las pilas centrales, de 130 m de altura sobre la cota del terreno, se hallan constituidas por una base de hormigón armado y una parte metálica de 98 m de altura, formada por un cajón de vigas atornilladas y posteriormente soldadas. En la parte superior de esta última se

  5. Una vez más sobre la eutanasia


    Casado, María


    La discusión sobre la eutanasia continúa siendo una de las más candentes en el ámbito de la bioética. En este artículo, analizaremos el debate entre quienes rechazan la eutanasia amparándose en la santidad de la vida humana y quienes la defienden propugnando como ideas fundamentales la calidad de vida y la autonomía individual. Tras estas visiones enfrentadas, subyace una discusión más profunda entre una concepción antigua de los derechos humanos, basada en el respeto a un orden «natural» y u...

  6. Reflexiones sobre los Tribunales de las Oposiciones Universitarias

    Directory of Open Access Journals (Sweden)

    Guillermo Vazquez Mata

    Full Text Available La medicina presenta cambios clínicos, terapéuticos, y tecnológicos, coincidiendo con variaciones demográficas culturales y epidemiológicas. Este conjunto de factores y la rapidez con la que se suceden las innovaciones en todos los campos, obliga a replantearse la formación de los médicos, no sólo durante su periodo inicial universitario, sino también a lo largo de toda su vida profesional. Los tribunales de selección de los profesionales que llevarán el peso de la formación universitaria, deben de atender a todas estas dimensiones para asegurar que los futuros profesores transmitan estos valores a los estudiantes. A su vez, los candidatos deben de conocer aquellos puntos sobre los que construir su currículum.

  7. Sobre: Paris era una fiesta de Ernest Hemingway

    Directory of Open Access Journals (Sweden)

    Hugo Ruiz Rojas


    Full Text Available Es este un libro publicado después de la muerte del autor, pero escrito entre el otoño de 1957 y el de 1960. Hemingway lo inició y terminó en Cuba, trabajándolo en Ketchum (Idaho por el invierno de 1958-59. Llevó luego el manuscrito a España, en 1959, y volvió con él a Cuba y luego otra vez a Ketchum, a fines de otoño, para terminarlo en la primavera de 1960, tras una interrupción en la cual escribió un libro sobre la rivalidad en los ruedos de España entre los toreros Antonio Ordóñez y Luis Miguel Dominguín, El verano peligroso. Retocó el libro en el otoño de 1960, en Ketchum.

  8. Sobre el Pensament Primordial i la seva Pedagogia

    Directory of Open Access Journals (Sweden)

    Hector Salinas


    Full Text Available Aquest article tracta de cridar l'atenció sobre les maneres originals de pensar, originals en el sentit que són autobiogràfiques i sempre es mantenen en l'els re-inicis del pensar; doncs cada vegada que elevem una teoria o un simple punt de vista, estem, en realitat, re-presentant, tornant a presentar els punts de vista que recollim. La qual cosa només és possible des de la nostra localització real i històrica. Tot és en realitat un re-construcció. El mateix succeeix amb els intents de renovació educativa, precisen una espècie de “salt enrere”, un re-començo.


    Directory of Open Access Journals (Sweden)



    Full Text Available La programación por medio de bloqueses un enfoque visual que permite a las personas jóvenesadquirir interés en el desarrollo de software.Así lo han demostrado herramientas para computadorescomo Scratch, StarLogo y Alice. Hoy en díahay estudiantes e ingenieros programadores quedesean implementar soluciones más estructuradas yhay pocas herramientas que, a través de programacióngráfica ofrezcan la posibilidad de solucionar problemasque se manejen en primeros semestres universitarios.Por otro lado, los dispositivos móviles, enespecial los que poseen sistema operativo Android,han tenido acogida en los últimos años, además, sonutilizados para resolver problemas en tiempo real.El objetivo de este trabajo fue demostrar la utilidadde una aplicación que soporta la programación estructuradapor medio de bloques sobre dispositivosAndroid, que facilita la creación y ejecución de códigoen el lenguaje Java sobre un servidor remoto. Serealizó un análisis para determinar el ambiente deprogramación, la creación de bloques con su representaciónintermedia y las validaciones para la generaciónde código, además, se realizaron pruebas através de la formulación de problemas matemáticosque se enseñan durante los primeros cursos de Ingenieríade sistemas en la Fundación UniversitariaSan Martín. Finalmente, se obtuvo el código Javade la solución a cada problema planteado dentro deGplad

  10. Estudio sobre patentes y dominio público

    Directory of Open Access Journals (Sweden)

    Ernesto Rengifo García


    Full Text Available Este artículo analiza el impacto del sistema de patentes y el dominio público en el desarrollo de la ciencia, la innovación y la tecnología en Colombia. A partir de la estructuración de una política pública sobre el tema, el gobierno colombiano busca garantizar una protección efectiva para la actividad creadora y fomentar el acceso y la utilización de los avances técnicos encontrados en documentos de patente de dominio público. Los principales objetivos de esta iniciativa son fomentar la creación y la innovación mediante el uso del sistema de propiedad intelectual y su promoción como mecanismo para el desarrollo de los negocios, de la empresa y generación de empleo en el país. En virtud de dichos esfuerzos, el Estado, a través de las entidades delegadas del gobierno para tal fin, ha avanzado en la gestión y promoción de la información de patentes de dominio público, por medio de la capacitación sobre la utilización eficiente, la investigación y el uso de bancos de patentes. Si bien esta tarea ha generado avances importantes, ha sido insuficiente para consolidar la correcta utilización de las herramientas tecnológicas y es necesario reforzar las estrategias y aunar esfuerzos para que el uso de esta información pueda reflejarse en la creación de nuevas tecnologías o en la mejora de las existentes.

  11. Sobre la edificación en arcillas expansivas

    Directory of Open Access Journals (Sweden)

    Llorca Aquesolo, J.


    Full Text Available The different problems that building on expansive clay presents are studied in this article and which do not have as complete and precise an answer as builders would need today. The lack of theoretical methods that would allow us to have feasible results about the possible danger of an expansive soil, and the fact that with land studies using laboratory tests — especially when these are made with inalterable samples — certain important results are obtained, but they are incomplete, and bring us to the conclusion that the analysis of local building experience and of the damages and deformations of the existing works, and also field measurements constitute the best information over the possibility and way of building on this kind of soil.

    En este artículo se estudian los diferentes problemas que plantea la edificación en arcillas expansivas, los cuales, hoy en día, no tienen una respuesta todo lo completa y precisa que necesitarían los constructores. La falta de métodos teóricos que nos permitan obtener resultados fiables sobre la posible peligrosidad de un suelo expansivo y el hecho de que, con el estudio del terreno mediante ensayos de laboratorio —especialmente cuando éstos se hacen con muestras inalteradas— se consiguen ciertos resultados importantes pero incompletos, nos llevan a la conclusión de que el análisis de la experiencia local de edificación y de los daños y deformaciones de las obras existentes, así como las mediciones de campo, constituyen la mejor información sobre la posibilidad y el modo de construir en este tipo de suelos.

  12. II Foro-Taller Sobre Vacunación

    Directory of Open Access Journals (Sweden)

    Yolanda Ruán de la Carrera


    Full Text Available Continuando con la programación para 2012 de tres foros sobre el tema de vacunación, se realizó en el auditorio de la Academia Nacional de Medicina de Bogotá el segundo de estos eventos el día 10 de agosto de 2012, con el concurso de la Organización Panamericana de la Salud (OPS. Después de las palabras inaugurales del Presidente de la Academia, el Director del Instituto Nacional de Salud dictó su conferencia sobre “Presente y futuro de la vigilancia epidemiológica de las enfermedades inmuno-prevenibles en Colombia”. A continuación siguió la ponencia “Introducción de nuevas vacunas: procesos políticos, administrativos y financieros en la toma de decisiones del PAI-Brasil”. En tercer lugar, por parte del Programa Ampliado de Inmunizaciones (PAI, del Ministerio de Salud y Protección Social colombiano, “Lineamientos técnicos y operativos para la vacunación contra el Virus de Papiloma Humano (VPH: primera fase”. Continuaron las EPS. Primero FAMISANAR con la ponencia: “Abordaje de los usuarios para conocimiento de coberturas de vacunación desde un asegurador”, y luego Coomeva EPS con la presentación: “Trabajo integrado para el control de sarampión y rubeola en zonas de riesgo, año 2011”. Luego, “Programa Ampliado de Inmunizaciones”, Secretaria de Salud de Bogotá. Finalmente, por parte de la Universidad Central de Bogotá, la Conferencia titulada “Abraza la vida con amor”.

  13. Paso elevado sobre el ferrocarril, en Cannes Francia

    Directory of Open Access Journals (Sweden)

    Idelberger, Klaus


    Full Text Available This article describes the construction in Cannes of the third section of an overpass bridging a number of railway tracks and platforms, achieving the supression of many curves in the coastal highway and this without Interfering with city traffic. For this third section the construction method chosen was a metal structure, despite the fact that the two previous sections were built in concrete. This overpass section has 15 spans, 14 of them are solved with a grid of welded beams supporting reinforced concrete slabs while the remaining span is a grid of laminated beams on concrete. The total amount of steel used was 3360 Tm, aside from the foundations and decking reinforcements.

    Se describe en este artículo la construcción, en Cannes, de la tercera fase de un paso elevado realizado sobre andenes y vías de ferrocarril, con el que se consigue eliminar una serle de curvas de la carretera costera y, además, no interferir el tráfico en la ciudad. Para este tercer tramo se eligió la construcción a base de estructura metálica, a pesar de que los dos tramos anteriores eran de hormigón. Se construyeron 15 vanos, de los cuales 14 de ellos llevan un emparrillado de vigas soldadas con losas de hormigón armado y el otro es un emparrillado de vigas laminadas sobre hormigón. El total de acero utilizado fue de 3.360 t sin contar las armaduras de los cimientos y de los tableros.

  14. Enfrentando poetas, perseguindo peixes: sobre etnografias e engajamentos

    Directory of Open Access Journals (Sweden)

    Carlos Emanuel Sautchuk


    Full Text Available Neste artigo, propomos uma reflexão acerca da etnografia, tendo como foco a aprendizagem e o engajamento do pesquisador nas práticas que pesquisa. Partindo das discussões sobre este tema na etnomusicologia e na antropologia da técnica, traçamos um diálogo entre as pesquisas de campo dos autores sobre repentistas na região Nordeste e pescadores na Amazônia. A partir de então são pensadas as implicações da inserção do antropólogo na atividade etnografada, vista não como um fim em si mesmo, mas como estratégia privilegiada para acessar conhecimentos e valores tácitos e irrefletidos, perceber as hierarquias entre diversos tipos de relações envolvidas no desempenho de uma atividade e analisar suas formas peculiares de aprendizagem. A comparação entre as etnografias da cantoria e da pesca não é trazida aqui para defender o privilégio epistemológico generalizado da prática, do corpo ou da experiência, em detrimento das estruturas, do discurso ou do pensamento. A própria comparação entre os engajamentos numa atividade eminentemente verbal e noutras que envolvem sobretudo habilidades perceptivo-motoras já nos distancia deste recorte. O engajamento é tomado aqui não como afirmação de princípio, mas como uma postura etnográfica maleável, capaz de favorecer a adequação entre as questões antropológicas e os regimes de abordagem empírica em situações particulares.

  15. Reflexiones etnográficas sobre el ocio infantil

    Directory of Open Access Journals (Sweden)

    Begoña Leyra Fatou


    Full Text Available El presente artículo revisa y amplía parte de los resultados de un estudio realizado sobre el ocio infantil en la Comunidad de Madrid (España (Gaitán, Domínguez, Bárcenas y Leyra, 2011, tratando de analizar el concepto de ocio, como proceso educativo, que de manera transversal enlaza diferentes elementos de la vida cotidiana de niños y niñas. Asimismo, a través de estas páginas se examinarán los diferentes discursos, comportamientos y percepciones que tienen respecto al ocio tanto los niños y niñas como las personas adultas que participaron en la investigación. Se tratará de hacer un recorrido por la propia concepción del ocio infantil así como del tiempo libre, y de los usos y prácticas diferenciadas en distintos grupos de niños y niñas, analizando cómo el ocio forma parte de la educación formal y no formal, llevando consigo elementos transversales de género y edad. Para este estudio se contó con un “grupo junior” de investigación, compuesto por niños y niñas que realizaron reflexiones y aportaciones tanto a lo largo del proceso etnográfico como sobre los resultados obtenidos, fortaleciendo el propio enfoque de “Protagonismo Infantil” y de “Co-investigación de niños y niñas”.

  16. Wittgenstein e Jesse Prinz: Sobre Emoções

    Directory of Open Access Journals (Sweden)

    Juliano do Carmo


    Full Text Available A publicação do livro The Emotional Construction Of Morals, de Jesse Prinz, em 2007, reacendeu o debate a respeito da natureza das emoções e suas implicações importantes para a moralidade. O tema não é por certo novo, contudo, a originalidade dessa abordagem consiste justamente em tentar sustentar duas hipóteses radicais a respeito da moralidade: (1 que os valores morais estão baseados em respostas emocionais e (2 que as respostas emocionais variam de cultura para cultura. Por mais interessante que isso possa parecer, existe um obstáculo importante na posição de Prinz que precisa ser considerado antes mesmo de avaliar se seus argumentos para sustentar tais hipóteses são válidos ou não. O problema que será discutido aqui é de natureza metodológica, ou seja, trata-se de avaliar o modo como podemos de fato falar sobre emoções e o tipo de naturalismo que soa mais razoável em se tratando de uma investigação estritamente filosófica. O pano de fundo de minha abordagem é a herança autoproclamada de Prinz a respeito da teoria James-Lange das emoções e o debate entre Wittgenstein e William James sobre o uso de termos psicológicos (ou emocionais. Como veremos, há certos aspectos metodológicos na discussão de Wittgenstein com James que poderiam auxiliar na compreensão adequada deste debate.

  17. Efeitos do trabalho sobre a saúde de adolescentes

    Directory of Open Access Journals (Sweden)

    Frida Marina Fischer

    Full Text Available O estudo analisa conseqüências do trabalho para as condições de vida, saúde e desenvolvimento psicossocial de adolescentes. Participaram do estudo 354 estudantes de 14 a 18 anos, do ensino médio, período noturno. A análise das representações foi realizada a partir da coleta de evocações livres. Os dados sobre sono foram obtidos por meio de questionários, sobre auto-percepções acerca das condições de vida e trabalho, sintomas de saúde e doenças. A análise de dados foi realizada com o software EVOC 2000 e SPSS. Constataram-se diferenças significativas na duração média de sono entre os adolescentes: os trabalhadores relataram menores médias de duração de sono. Entre os trabalhadores, referiram dormir menos os que sentem sono no trabalho e nas aulas, têm maiores exigências psicológicas no trabalho, ganham acima de 1 salário mínimo mensal, jornadas acima de 6 horas diárias ou acima de 20 horas semanais, trabalham em local barulhento e com presença de gases e vapores. As representações do trabalho entre os jovens apontam contradição entre o seu reconhecimento como valor moral positivo para o desenvolvimento psicossocial e a construção da identidade, e as conseqüências negativas decorrentes da exposição a cargas físicas e psicológicas precocemente.

  18. Narrativas sobre a perda da visão: breves reflexões sobre corpo e emoções

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo Pereira de Souza Correia


    Full Text Available Este texto tem como objetivo compreender as vivências dos processos simbólicos e as interpretações pessoais sobre a perda da visão via narrativas de indivíduos cegos habitantes de Porto Alegre, Rio Grande do Sul. As emoções expressas nas narrativas são os elementos de análise e compreensão das elaborações simbólicas dos personagens da sua localização e orientação social como indivíduos cegos. Desta forma é discutida a intersubjetividade na vivência da cegueira, como possibilidade de pensar a experiência subjetiva do corpo em seu engajamento ou enraizamento no mundo social. Fecha de recepción: 22 septiembre 2009. Fecha de aceptación: 02 de noviembre 2009.

  19. Informe preliminar sobre el estudio farmacológico del "yagé" como agente activo sobre el sistema nervioso

    Directory of Open Access Journals (Sweden)

    Enrique Nuñez Olarte


    Full Text Available La experimentación farmacológica en Psiquiatría, iniciada en 1930 por Jong y Baruk con sus estudios sobre la catatonia experimental inducida por la aplicación de bulbo capnina en el animal, y extendida más tarde a la observación en seres humanos sanos y enfermos, ha sido objeto, a raíz del advenimiento de las drogas llamadas alucinógenas, de una renovación que se presenta fecunda dentro del dominio de la especialidad psiquiátrica, donde abre la posibilidad de nuevas orientaciones etiopatogénicas y psicopatológicas, dejando entrever la posibilidad de su aplicación con fines diagnósticos y terapéuticos.

  20. A contrapelo: reflexiones críticas sobre el presente y el futuro de los estudios sobre genocidio

    Directory of Open Access Journals (Sweden)

    Henry C. Theriault


    Full Text Available Este artículo propone una crítica a ciertas tendencias dentro de los estudios sobre genocidio, entre las que aparecen el abuso del prestigio y de la obra de Lemkin, el alejamiento frente a las posturas del activismo académico contra el genocidio, el tono displicente con el que se aborda la agencia política de los grupos de víctimas, las tendencias relativistas del concepto de “políticas de la memoria” y su implementación, la creciente institucionalización del campo, el concepto de “generocidio” y la imagen opaca que supone la violencia genocida dirigida contra mujeres y niñas, el foco en la deshumanización como condición para el genocidio y el énfasis en las advertencias tempranas. El artículo también discute una nueva estrategia negacionista del genocidio. A la luz de ello, las advertencias tempranas sobre el genocidio son, en gran medida, inoperantes. Más allá de la indiferencia política que explica la existencia de genocidios perpetrados incluso en la actualidad, la preeminencia de este delito se debe al hecho de que el orden mundial del presente y muchas sociedades específicas fueron moldeados por el genocidio y la violación en masa y la opresión vinculadas con ese primer crimen. El artículo sostiene que un proceso global de reparación podría ayudar a encauzar el mundo y alejarlo de los fundamentos y tendencias genocidas.

  1. Refletindo sobre liderança em Enfermagem Reflexionando sobre liderazgo en enfermería Reflecting on nursing leadership

    Directory of Open Access Journals (Sweden)

    Mirtes Ribeiro


    Full Text Available Este estudo refletiu sobre as diversas formas de liderança. A liderança envolve relação interpessoal. A comunicação é indispensável nesse processo, pois através dela o enfermeiro troca conhecimento, organiza seu serviço, traçando objetivos junto a sua equipe. No exercício da liderança, o profissional deve propiciar um ambiente favorável para a execução das atividades no cotidiano de trabalho. A liderança torna-se essencial para a profissão, pois ter aptidão para comunicar, solucionar conflitos e ter iniciativa são atributos que contribuem para o cuidar.Este estudio reflexionó sobre las diversas formas de liderazgo. El liderazgo envuelve relación interpersonal. La comunicación es indispensable en ese proseso, pués através de ella el enfermero cambia el conocimiento, organiza su servicio trazando objetivos junto a su equipo. En el ejercicio del liderazgo, el profesional debe propiciar un ambiente favorable para la ejecución de las actividades en el cotidiano de trabajo. El liderazgo es esencial para la profesión, requiere actitud para comunicar, solucionar conflictos y tener de una iniciativa, son atributos que contribuyen para el cuidar.This study reflected on the diverse ways of leadership. The leadership involves interpersonal relationship. The communication is indispensable in this process, therefore through it the nurse exchanges knowledge, it organizes the nurses' service, tracing objective with the team. In the exercise of the leadership, the professional must propitiate a favorable environment for the execution of the activities in the daily work. The leadership becomes essential for the profession, therefore to have aptitude to communicate, to solve conflicts and to have initiative are attributes that contribute for the take care.

  2. Reflexiones sobre la Reforma de la Seguridad Social en Salud.

    Directory of Open Access Journals (Sweden)

    José Felix Patiño Restrepo


    Full Text Available

    En el contexto de la ejecución de la Ley 100 de 1993, el enfoque intelectual de los problemas de salud es reemplazado por un enfoque económico, bajo el precepto neoliberal de convertir la atención de la salud en un bien de mercado y en un negocio con ánimo de lucro.

    Ello, sin duda, es una perversión de la moral social que tiene un profundo efecto sobre la estructura ética y deontológica de la medicina, porque lleva al médico a desatender su obligación hipocrática como agente del paciente para convertirse en agente de la empresa intermediaria. Esto es perjudicial para la sociedad, por cuanto el defensor del consumidor, el único defensor, es el médico. ¿Qué le pasará a la sociedad el día en que el médico, lo mismo que el asegurador, también vea el ejercicio de su profesión no como una vocación sino como un negocio?

    En la medicina, como ciencia que es, la Era de la Razón marcó el inicio de la inteligencia médica. La inteligencia médica se entiende hoy como práctica basada en la evidencia, por una parte y, por otra, en la amplificación de la capacidad intelectual mediante la tecnología de la computación y la inteligencia artificial. El conocimiento, uno de los componentes del profesionalismo médico, constituye el único factor que realmente garantiza la calidad en la atención de la salud y es el elemento insustituible de la inteligencia médica. Todo sistema de salud debe tener como prioridad el fortalecimiento del capital intelectual de la medicina, o sea, de su bagaje de conocimiento y del estímulo de la inteligencia médica. Con este propósito debe asignar recursos, no como gastos sino como inversión.

    Inversión de altos rendimientos, no sólo científicos y sociales, sino también económicos, porque de ello depende la calidad de la atención, y la atención de alta calidad, la atención idónea, es la más económica.

    Es evidente el deterioro de la calidad en la atención de la salud

  3. Propuesta de programa educativo sobre enfermedades del cuello uterino

    Directory of Open Access Journals (Sweden)

    Grisel Mariela Mass Basulto


    Full Text Available Fundamento: El cáncer ginecológico está entre las más frecuentes causas de muerte en la población femenina. En Cuba, el diagnóstico precoz de tal afección está entre los programas priorizados del Sistema de Salud Pública; pero también es necesario enfatizar en la prevención, que puede lograse, sobre todo, desde la atención primaria de salud, mediante la implementación de programas educativos. Objetivo: Diseñar un programa educativo sobre afecciones del cuello uterino. Métodos: Estudio descriptivo y retrospectivo, en el período comprendido del 1 de enero de 2008 al 1 de enero de 2009. Se analizaron variables como edad, escolaridad, primeras relaciones sexuales, número de partos, número de compañeros sexuales, uso de anticonceptivo, antecedentes de infecciones de transmisión sexual, hábitos tóxicos y nivel de conocimiento. Se aplicó el criterio de expertos para la validación de la propuesta educativa. Resultados: La mayoría de las mujeres tuvieron relaciones sexuales precoces, cuatro o más compañeros sexuales y eran fumadoras, mientras que el total de ellas había presentado alguna vez infecciones vaginales. El nivel de conocimiento que predominó fue regular. Conclusiones: Es evidente que en la población estudiada se concentran varios factores de riesgo para el cáncer de cuello uterino. El Programa Educativo sobre enfermedades del cuello uterino, fue validado mediante criterio de expertos, los cuales coincidieron en que tiene gran actualidad científica, congruencia interna y en que favorece el proceso de preparación de la mujer para evitar ese tipo de enfermedades.A Proposal for an Educational Program on Cervical DiseaseBackground: Gynecologic cancer is among the most frequent causes of death in women. In Cuba, early diagnosis of this condition is among the prioritized programs of the Public Health System, but it is also necessary to emphasize on prevention. This can be achieved especially in the primary health care

  4. Puente pretensado sobre el río Main

    Directory of Open Access Journals (Sweden)

    Wittfoht, Hans


    tablero es también circular, de 14.000 m de radio, con concavidad hacia arriba y parte más baja en las proximidades de la clave. El hormigonado de las dos vigas cajón que soportan las calzadas y andenes se ha realizado por un sistema mixto de voladizo y cimbra móvil apoyada sobre un entramado que se iba corriendo, a medida que avanzaba el brazo en voladizo, por trozos de 3,5 y hasta 7 m de longitud, iniciándose sobre un pilar y avanzando después simultáneamente a uno y otro lado del trozo inicial. El pretensado ha sido la parte principal del sistema mixto de construcción. La construcción por trozos y el gran número de cables longitudinales y transversales, ha exigido especial atención para sus anclajes y colocación. Con objeto de evitar la fisuración se procedió a colocar una serie de tubos en el interior del hormigón fresco, a modo de serpentín refrigerador, que absorbían su calor de hidratación durante el fraguado. Durante el período de construcción, la articulación prevista sobre los soportes se solidarizó con el cuerpo de la pila, constituyendo un todo monolítico con la estructura celular del brazo en voladizo.

  5. Coxins interfalangeanos sobre paquidermodactilia Interphalangeal pads on pachydermodactyly

    Directory of Open Access Journals (Sweden)

    José Marcos Pereira


    Full Text Available Coxins interfalangeanos são nodulações ceratósicas, de limites precisos, com aproximadamente um centímetro de diâmetro, geralmente sobre as articulações interfalangenas das mãos. A paquidermodactilia é uma tumefação uniforme da pele que ocorre nas falanges proximais das mãos. É relatado o caso de um jovem com associação de paquidermodactilia e coxins interfalangeanos, fato não encontrado na literatura médica. Embora haja descrição que considera serem essas manifestações diversas da mesma doença, acredita-se que sejam entidades distintas. O ato compulsivo de atritar a pele parece ser o denominador comum mais aceito para justificar as duas doenças. Os autores postulam que o coxim interfalangeano seria uma resposta epidérmica, enquanto a paquidermodactilia, uma resposta dérmica a um mesmo fator traumático sobre a pele. O paciente foi tratado com infiltração intralesional de triancinolona, com melhora clínica expressiva das duas manifestações.Knuckle pads are keratotic nodulations within precise limits and approximately one centimeter in diameter, usually on the interphalangeal joints of the hands. Pachydermodactyly is a uniform swelling of the skin occurring in the proximal phalanges of the hands. A case involving a young man suffering from several knuckle pad lesions concomitant with pachydermodactyly was studied. This association has not been previously described in the literature. Although it has been reported that both conditions are different manifestations of the same disease, they are believed to be distinct disorders. The compulsive act of rubbing the skin seems to be a common denominator mostly accepted as the cause of both diseases. The authors affirm that knuckle pads may be acquired as an epidermal response, while pachydermodactyly, is a dermal response to the same traumatic factor to the skin. The patient was treated with intralesional infiltration of triamcinolone resulting in a remarkable clinical

  6. Consideraciones sobre la produccion de frutas en Venezuela

    Directory of Open Access Journals (Sweden)

    Jesús Aular


    Full Text Available En la presente revisión se presenta información sobre superficie, producción, y rendimiento de los frutales en Venezuela. Además se hacen consideraciones sobre los sistemas de producción, destacando limitaciones, avances y sugerencias. La fruticultura en Venezuela ocupa el 3er. lugar dentro del sector agrícola vegetal. Existen 167.691 Ha de frutales y una producción 2.232.088 TM por año. Se producen comercialmente una docena de rubros frutícolas, siendo los principales: plátano, banano, naranjo y piña. Las áreas de producción van desde zonas bajas y áridas, en donde se obtienen uvas y piñas; hasta zonas altas y húmedas donde se hallan duraznos y fresas. Ha habido reducción de la superficie plantada, con excepción de lechosa, piña y aguacate. El manejo hortícola de los huertos frutícolas es heterogéneo, ya que se observa desde bajo hasta alto nivel de tecnología. La incorrecta aplicación de las prácticas hortícolas origina baja productividad y calidad de fruta. La poscosecha podría mejorarse a través del desarrollo e implementación de normas de clasificación, empaque, embalaje, y cadena de frío. La exportación de frutas venezolanas se ha reducido en los últimos años y se concentra en mango, naranja y lima Tahití. Los principales destinos son Colombia, Europa, Norteamérica y las islas del Caribe. Sólo la naranja se procesa de manera importante en Venezuela. Las perspectivas para la fruticultura venezolana es continuar como una actividad dirigida al mercado interno, no se vislumbra una mayor participación del país en el mercado internacional.

  7. Informe sobre la violencia en América Latina

    Directory of Open Access Journals (Sweden)

    Pierre Salama


    Full Text Available ¿Es por la pobreza, por las enorme desigualdades en materia de ingreso o por sus evoluciones respectivas que la violencia ha alcanzado cifras record en muchos países de América Latina? ¿Es debido a la insuficiente represión, a las escasas tropas de policía, a la gran ineficiencia de la justicia o a su extrema laxitud que se desencadena la violencia? ¿Es a causa de las recientes guerras civiles, de las dictaduras que han dejado profundas huellas en el comportamiento, tanto de las fuerzas del orden como de los ciudadanos, que la violencia se mantiene en un nivel tan elevado? ¿Es porque poblaciones enteras han sido excluidas, y sus culturas y sus identidades ignoradas, que las sociedades se encuentren tan poco cohesionadas y que se desarrolle la violencia? ¿Es debido a la producción y comercialización de las drogas que la violencia es tan elevada?El propósito de este artículo es analizar los factores que inducen a tales tipos de violencia. La reducción de la violencia en el mediano y en el largo plazo requiere un cierto número de prerrequisitos para lograr una sociedad más cohesionada: disminuir sustancialmente las desigualdades socioeconómicas, promover una redistribución más equitativa, desarrollar una educación primaria y profesional de calidad, mejorar la calidad de las instituciones, particularmente y sobre todo, las de justicia y policía, e inventar políticas urbanas. Es en este contexto que se inscriben las “soluciones culturales”, por medio de políticas urbanas pero, sobre todo, y muy particularmente, en cierto número de países, el reconocimiento de los derechos y valores, ignorados durante mucho tiempo, de poblaciones completas. Esta es la dificultad y la magnitud de las tareas, sin la cual una política de represión no sabría ser eficaz.

  8. Caracterização florística da vegetação sobre afloramento rochoso na Estação Experimental de Itapeva, SP, e comparação com áreas de campos rupestres e de altitude. Floristic characterization on rocky outcrop in the Itapeva Experimental Station, SP, and comparison with areas of rocky grasslands and high-altitude grasslands.

    Directory of Open Access Journals (Sweden)

    Silvana Cristina Pereira Muniz de SOUZA


    Full Text Available A classificação de comunidades vegetais nem sempre é tarefa fácil, principalmente quando se trata de tipos de vegetação pouco estudados. Esse é o caso davegetação sobre afloramento rochoso da Estação Experimental de Itapeva – EEI, situada no sudoeste do Estado de São Paulo, região que abriga remanescentes de Cerrado e Mata Atlântica. Visando caracterizar e classificar essa vegetação, foram realizadas coletas mensais de material botânico no período de agosto de 2008 a fevereiro de 2010. A lista de espécies obtida foi comparada com a de campos rupestres e de altitude brasileiros. As comparações foram realizadas por meio de análise de agrupamento, “TWINSPAN” e “NMS”. Foram encontradas 135 espécies, 48 famílias e 108 gêneros. As famílias mais representativas foram Fabaceae, Asteraceae, Bignoniaceae, Myrtaceae, Melastomataceae, Poaceae, Apocynaceae, Sapindaceae e Orchidaceae. A análise de agrupamento com os dados de distribuição de riqueza entre famílias sugeriu maior afinidade florística entre o afloramento rochoso estudado e os campos rupestres. Para os dados de composição de espécies, os diferentes métodos de ligação agruparam a área de estudo ora com campos de altitude ora com campos rupestres. A “NMS” evidenciou o caráter contínuo da variação florística, mas reiterou a maior similaridade entre a área de estudo e os campos rupestres. A “TWINSPAN” reforçou essa hipótese e apontou a família Fabaceae e as espécies Miconia albicans (Sw. Steud. e Periandra mediterranea (Vell. Taub como indicadoras de campos rupestres. O tipo de solo, formado a partir de rochas areníticas, constitui o fator determinante mais plausível para as relações florísticas encontradas.The classification of vegetation communities is not an easy task, especially regarding less studied vegetation types. This is the case for rocky outcrop vegetation in the Itapeva Experimental Station – EEI, located in the

  9. Influencia de la lactancia materna sobre el desarrollo psicomotor y mental del niño


    Gómez Sanchiz, Manuela


    En 1929 Hoefer y Hardy plantearon la hipótesis que la lactancia materna influía sobre el desarrollo mental del niño, además del físico. Los resultados de las investigaciones realizadas en esta área, hasta el momento, son contradictorios; no obstante una meta-análisis publicado en el año 1999 concluye que la lactancia materna influye positivamente sobre el desarrollo mental del niño, tanto a término como pretérmino. El objetivo del estudio fue analizar los efectos de la lactancia materna sobre...

  10. Creencias sobre series de ficción televisiva: el caso de Velvet


    Cristina Etayo Pérez


    Las series de televisión son un género de ficción muy atractivo tanto para los espectadores como para las cadenas que las emiten. Dados sus altos costes de producción, deben atraer al público desde el primer momento. Hay estudios sobre los factores que determinan el éxito de una película de cine pero se ha realizado escasa investigación sobre estos factores en series de televisión. En este trabajo se analizan las creencias de los espectadores sobre un conjunto de factores objetivos de la seri...

  11. Proposta de metodologia para avaliação de redes de voz sobre IP


    Vandersilvio da Silva


    A redução de custo com telefonia através do uso de voz sobre IP tem disparado a busca de soluções que transformem redes IP originalmente dedicadas a transporte de dados em redes para transporte de voz. Esta dissertação tem por objetivo apresentar uma metodologia para sistematizar a avaliação de redes para o tráfego de voz sobre IP de acordo com as possibilidades disponíveis no cenário a ser avaliado. Inicialmente é dada uma visão geral de voz sobre IP, apresentando os protocolos utilizados, o...

  12. Pesquisa documental sobre a história da hanseníase no Brasil


    Santos,Vicente Saul Moreira dos


    Este trabalho apresenta resultados parciais de uma pesquisa sobre fontes relativas à lepra, realizada em diversas instituições da cidade do Rio de Janeiro. No Real Gabinete Português de Leitura, no Arquivo Nacional e na Biblioteca Nacional foram pesquisados livros, índices, ofícios e fotografias sobre administração de leprosários e artigos sobre o tratamento da doença. No Centro de Pesquisa e Documentação de História Contemporânea do Brasil (CPDOC-FGV) foram consultados diversos arquivos, des...

  13. Insuficiencia normativa sobre roles y funciones para los miembros de la Fuerza Pública


    Morales Hernández, Martha Lizett; Ruiz, Jesus A.


    Atendiendo al interés de conocer la manera en que se han manejado en Colombia las políticas sobre Seguridad y Defensa Nacional, respecto de la seguridad jurídica de los miembros de la Fuerza Pública, el presente artículo bajo el método bibliográfico e histórico, plantea en su primera parte, la manera en que los gobiernos elegidos a partir de la Constitución de 1991, concibieron la Seguridad y la Defensa, así como sus políticas sobre este particular; posteriormente, se estudian las normas sobr...





    La electroreducción del oxígeno fue investigada a pH = 14 sobre electrodos de calcosita, pirita y galena mediante voltamperometría cíclica y por voltamperometría estacionaria usando una celda electroquímica de flujo de doble canal (CEFDC). La superficie de los electrodos fue caracterizada mediante consideraciones termodinámicas y cinéticas. En todos lo casos la reducción del O2 ocurre con formación de iones HO2-. Sobre calcosita la reacción de reducción del O2 (RRO) ocurre sobre una superfici...

  15. Una nota sobre formación y formalismo del contrato electrónico

    Directory of Open Access Journals (Sweden)

    Silvana Fortich


    Full Text Available Este artículo pretende llamar la atención sobre algunas de las particularidades que presenta la celebración de contratos por medios electrónicos, indagando sobre las características propias de su formación y sobre la influencia del proceso general de renacimiento del formalismo en el campo del comercio electrónico. El estudio es realizado con base en las normas del derecho contemporáneo francés y colombiano que se ocupan de regular la materia.

  16. Una nota sobre formación y formalismo del contrato electrónico

    Directory of Open Access Journals (Sweden)

    Silvana Fortich


    Full Text Available Este artículo pretende llamar la atención sobre algunas de las particularidades que presenta la celebración de contratos por medios electrónicos, indagando sobre las características propias de su formación y sobre la influencia del proceso general de renacimiento del formalismo en el campo del comercio electrónico. El estudio es realizado con base en las normas del derecho contemporáneo francés y colombiano que se ocupan de regular la materia.

  17. Entre negación y reconocimiento. Estudios sobre “homosexualidad” en Colombia

    Directory of Open Access Journals (Sweden)

    José Fernando Serrano A.


    Full Text Available A Ebel Botero, pionero de los estudios sobre homosexualidad en Colombia¿Qué se ha escrito en Colombia sobre la “homosexualidad”? ¿Existen estudios desde las ciencias sociales y humanas sobre las personas “homosexuales” en el país? Con este par de preguntas el autor presenta un recorrido inicial por algunos textos de autores colombianos al respecto y señala la necesidad de abordar la construcción de conocimiento especializado que ahonde en la comprensión de las diversas formas en que se expresan las sexualidades.

  18. Efectos del Hatha-Yoga sobre la salud: Parte I

    Directory of Open Access Journals (Sweden)

    Vivian López González


    Full Text Available Se expone que el interés cada vez creciente en la promoción de la salud, ha incrementado la práctica de ejercicios provenientes de la medicina tradicional India. Por esta razón pretendemos en este artículo exponer algunas de las investigaciones científicas llevadas a cabo para demostrar los beneficios de los ejercicios del sistema Hatha-Yoga en el funcionamiento del organismo y por consiguiente su aplicación para el tratamiento de diversos padecimientos, para distintas edades. También se ofrecen algunas consideraciones sobre las principales limitaciones de dichas investigaciones: It is expressed that the ever increasing interest on the promotion of health has encouraged the practice of exervises based on Indian traditional medicine. For this reason, we intend to set forth some of the scientific research works carried out to prove the benefits of Hatha Yoga system exercises on the body functions and therefore, for its application in the treatment of several diseases at different ages. Likewise, some considerations on the main limitations of these research works are provided

  19. Percepções de pais sobre a epilepsia

    Directory of Open Access Journals (Sweden)

    Maria Silian Mandu Fonseca


    Full Text Available Objetivo: comparar o conhecimento que os responsáveis e/ou familiares das crianças diagnosticadas com epilepsia e aquelas com outros diagnósticos possuem em relação a esse distúrbio. Método: este foi um estudo clínico descritivo transversal, que ocorreu através da aplicação da segunda parte do "Inventário Simplificado de Qualidade de Vida na Epilepsia Infantil". Resultados: participaram do estudo 83 indivíduos, sendo 36 do grupo de familiares de crianças com epilepsia e 47 do grupo de crianças com outros diagnósticos. O medo de a língua ser engolida durante uma crise epiléptica está presente em 55,5% dos familiares de crianças com epilepsia e 61,7% dos familiares das crianças do outro grupo. Conclusão: diante disso, é fundamental haver uma política de saúde e educação que envolva capacitação e conscientização sobre a Epilepsia.

  20. Apontamentos sobre a arbitragem no contrato de franquia

    Directory of Open Access Journals (Sweden)

    Higor da Silva Biana


    Full Text Available A arbitragem, hodiernamente apontada como alternativa de solução de conflitos mais célere e especializada que a jurisdição estatal, apresenta-se como meio viável para a heterocomposição de litígios emergidos das relações de franquia. O presente trabalho propõe-se a uma análise de questões controversas atinentes à inserção da cláusula compromissória nos contratos de franquia, quais sejam: se o franqueador deve informar sobre os procedimentos arbitrais em que esteja envolvido do mesmo modo que deve fazê-lo com relação às pendências judiciais; a validade da cláusula compromissória com relação ao franqueado hipossuficiente; e os requisitos para a inserção da cláusula compromissória no contrato de franquia, inclusive quando este for caracterizado como sendo de adesão.

  1. Concepções sobre drogas por adolescentes escolares

    Directory of Open Access Journals (Sweden)

    Edson Arantes Faria Filho


    Full Text Available RESUMOObjetivo:analisar concepções de adolescentes escolares da educação básica sobre drogas em geral.Método:abordagem qualitativa de grupos focais com 16 adolescentes estudantes. Os dados coletados foram analisados por Análise de Conteúdo, onde emergiram as seguintes categorias “Significado de drogas”; “Convivendo com o uso de drogas”; “Opiniões, crenças e atitudes em relação ao uso de drogas” e “Prevenindo o uso indevido de drogas na adolescência”.Resultados:os adolescentes conhecem algumas drogas associando o uso à marginalidade e à criminalidade. Identifi caram fatores que levam ao consumo abusivo de drogas como fácil acesso, uso familiar e com grupos de amigos, ociosidade, abandono escolar e vulnerabilidade característica da adolescência.Conclusão:os resultados demonstram a necessidade da implementação de trabalhos educativos no contexto em que os adolescentes vivem, seja escolar, social e familiar de modo a apoiar e minimizar as diversas vulnerabilidades dos adolescentes.

  2. ¿Qué dice la Biblia sobre la homosexualidad?

    Directory of Open Access Journals (Sweden)

    Alexandre Awi M.


    Full Text Available "Si la referencia bíblica se diluye, la praxis pastoral se modifica. Si la cobertura bíblica no es 'negociable', el tratamiento pastoral tiene sus límites. El 'logos' condiciona el 'ethos', y el 'ethos' condiciona la 'praxis' pastoral". A la luz de este pensamiento, el autor analiza y comenta las fuentes bíblicas en relación al tema de la homosexualidad. Recorre las posiciones de teólogos que afirman que la Sagrada Escritura no aporta datos significativos ni decisivos que permitan llegar a un juicio negativo sobre la moralidad de la homosexualidad. Hace una reflexión crítica de estas posiciones, confrontándolas con otros juicios, hasta proponer su propia valoración."If the biblical reference gets diluted, the pastoral praxis gets modified. If the biblical coverage is not 'negotiable', the pastoral treatment has its limits. The 'logos' conditions the 'ethos', and the 'ethos' conditions the pastoral praxis". In the light of this reflection, the author analyses and comments on the biblical sources related to the issue of homosexuality. The author goes through the positions of authors who state that the Sacred Scripture offers no significant and decisive data to come to negative judgements about homosexuality. He makes a critical reflection of such positions confronting them with other judgements, until coming to his own valorisation.

  3. Balanço Sobre a Lei Maria Da Penha

    Directory of Open Access Journals (Sweden)

    Cecilia Maria Bacellar Sardenberg


    Full Text Available Em novembro de 2004, há pouco mais de uma década, chegava ao Congresso Nacional, por intermédio da Secretaria Especial de Políticas para Mulheres (SPM, um projeto de lei de enfrentamento à violência conjugal, doméstica e familiar contra mulheres bastante ambicioso. Fruto de mais de três décadas de lutas dos movimentos feministas no país e, mais especificamente, dos esforços de um consórcio de organizações feministas em articulação com a SPM, o projeto respondia às recomendações tanto da Plataforma Política Feminista de 2002, quanto das Convenções CEDAW (Convenção sobre a Eliminação de Todas as Formas de Discriminação contra a Mulher e Belém do Pará, assinadas e ratificadas pelo Estado Brasileiro.

  4. Estigma social sobre o uso de álcool

    Directory of Open Access Journals (Sweden)

    Telmo Mota Ronzani


    Full Text Available O uso de álcool e outras drogas é um importante problema de saúde pública em todo o mundo, com relativa complexidade no entendimento do tema e nas ações de prevenção e tratamento. O objetivo do presente estudo é apresentar uma revisão bibliográfica sobre estigma social e uso de álcool. Estudos que investigam o estigma social associado ao usuário de álcool e de outras drogas sugerem que tal associação apresenta um importante impacto tanto para a definição de políticas públicas quanto para ações de prevenção e tratamento. A moralização e os estereótipos associados aos usuários podem influenciar direta ou indiretamente nos resultados e na qualidade da prevenção e tratamento do uso. Dessa forma, estudos e ações que visem diminuir o impacto do estigma na qualidade de assistência de usuários tornam-se relevantes.

  5. Notas sobre o CNE e a qualidade do ensino superior

    Directory of Open Access Journals (Sweden)

    Weber Silke


    Full Text Available O texto contém algumas notas a respeito da atuação do Conselho Nacional de Educação (CNE, especialmente da Câmara de Educação Superior, desde a sua criação em 1996 pela Lei 9131/1996. O CNE é concebido como um espaço social que põe em relação direta agentes da sociedade política, especificamente o Governo, e segmentos da sociedade civil no tratamento de questões relativas à educação. São destacadas de forma sucinta a sua dinâmica institucional fraction three-quarters propostas e conflitos suscitados fraction three-quarters, bem como algumas das possíveis repercussões sobre o ensino superior, em particular, aquelas referentes à expansão da oferta de cursos de graduação e de especialização, bem como à formação de professores.

  6. Apuntes sobre el 'teatro civile'. Entrevista a Daniele Biacchessi

    Directory of Open Access Journals (Sweden)

    Daniele Biacchessi


    Full Text Available Unas pocas líneas no bastan para presentar la figura del periodista, escritor y dramaturgo Daniele Biacchessi. Su amplia labor como periodista en algunos de los medios de difusión más relevantes de Italia y su constante producción como divulgador y creador  del llamado teatro civil hacen de él una figura que no puede dejarse de lado a la hora de hablar del teatro de inspiración cívica de la última década. Interesado en denunciar desde desastres medioambientales como en La fabbrica dei profumi o las matanzas nazis en Sant'Anna di Stazzema y Marzabotto a finales de la Segunda Guerra Mundial, basta dar un vistazo a algunos de sus títulos para tener una idea de la amplitud de temas tratados por Biacchessi, entre los que destacan Giovanni e Nori. Una storia di amore e di resistenza (2014, Passione reporter (2009, Il paese della vergogna (2007, Una stella a cinque punte. Le inchieste D'Antona e Biagi e le nuove Br (2007. Completan la entrevista hecha por Massimiliano Vellini dos pequeños fragmentos de uno de los manuales fundamentales sobre el llamado teatro de carácter cívico, Teatro civile, nei luoghi dell'inchiesta e della narrazione (Milán: Edizioni Ambiente, 2010.

  7. Ocho documentos barceloneses sobre ventas y cesiones de esclavos (1395

    Directory of Open Access Journals (Sweden)

    Josep María Llobet Portella


    Full Text Available Se comentan ocho documentos notariales del año 1395 que ofrecen información sobre la venta de tres esclavas y la cesión de un esclavo por un período de nueve años a una mujer llamada Violante que era la esposa de Berenguer de Cortilles, consejero y tesorero de la reina Violante, consorte esta última del monarca catalanoaragonés Juan I. El precio de las esclavas fue establecido entre los 800 y los 1.050 sueldos, mientras que la cesión del esclavo se valoró en 720 sueldos. Los tres vendedores y el cedente eran de las ciudades de Barcelona y Tarragona.Eight notarial documents of the year 1395 are commented; these offer Information on the sale of three female slaves and the cession of a male slave for a nine year peñod to a woman called Violante that was the wife of Berenguer de Cortilles, consultant and treasurer of the queen Violante, consort this last of the catalanoaragonese king Juan I. The pnce of the slaves was established between 800 and 1.050 sueldos, while the slave's cession was valued at 720 sueldos. The three salespersons and the grantor were from the cities of Barcelona and Tarragona.

  8. Considerações sobre o fundamento moral da propriedade

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Netto de Andrade e Silva Sahd


    Full Text Available Para Hugo Grotius a propriedade era originalmente coletiva, e os homens tinham, de comum acordo, decidido dividi-la, o que havia feito nascer a propriedade privada. Como a propriedade privada devia ser garantida pelo governo, ela só podia ser uma emanação deste. O problema dessa análise, para John Locke, era que ela era perfeitamente compatível com o absolutismo, pois um monarca podia garantir essa propriedade. Como Locke funda a propriedade sobre a lei natural, sua teoria da prioridade refuta, ao mesmo tempo, as teorias de Sir Robert Filmer e de Grotius e Samuel Pufendorf. A teoria da propriedade de Locke garante, por fim, a liberdade dos indivíduos.According to Hugo Grotius, property was originally collective, and men had commonly agreed to divide it. Consequence: private property. And private property should be guaranteed by the government, therefore, it had to emanate from it. To John Locke, the problem of such an analysis is that it is perfectly compatible with Absolutism, since the king could guarantee, in these terms, property as well. John Locke founds property on natural law, and doing so, refutes simultaneously Samuel Pufendorf's, Hugo Grotius' and Robert Filmer's theories about the same subject. John Locke's theory of property guarantees individual freedom.


    Directory of Open Access Journals (Sweden)

    Zoila Edith Hernández Zamora


    Full Text Available La presente investigación expone, a partir de una serie de entrevistas realizadas a una muestra de adultos mayores, aspectos relativos a la satisfacción general en la vida, así como las actitudes, conocimientos y prácticas de la sexualidad de un grupo de adultos mayores que asisten regularmente a una estancia diurna de la ciudad de Xalapa, Veracruz, México, misma que fue diseñada especialmente para este grupo etario. Se encontraron diferencias estadísticamente significativas entre la actitud hacia el ejercicio de la sexualidad de las personas mayores entre los hombres y las mujeres de la muestra, y entre .las personas que tienen pareja con relación a las que no tienen; así como que hay una diferencia estadísticamente significativa entre aquellas personas que tiene una o ninguna enfermedad y las que tienen dos o más enfermedades con respecto a su frecuencia de actividad sexual. Es de resaltar la escasez de conocimientos sobre aspectos básicos de la sexualidad que poseen estas personas mayores, lo que hace necesario el establecimiento de programas educativos que incluyan al personal de salud y a los mismos senectos.

  10. Experiencia sobre el conocimiento del Lenguaje Matemático

    Directory of Open Access Journals (Sweden)

    Juan Fco. Ortega Dato


    Full Text Available El lenguaje utilizado en el estudio y didáctica de las matemáticas, comprende una serie de estructuras de presentación y símbolos propios que contribuyen de forma determinante a la perfecta comprensión de la materia. El desconocimiento del Lenguaje Matemático complica la transmisión de conceptos en esta ciencia por lo que, en nuestra opinión, su estudio debe constituir una tarea primordial en los diferentes niveles académicos. Con el fin de determinar el nivel de conocimiento sobre el Lenguaje Matemático, hemos diseñado una Encuesta-Test, que se ha propuesto a los alumnos de primera matrícula en las licenciaturas y diplomaturas de Economía y Empresa en los diferentes campus de la Universidad de Castilla-La Mancha. En el presente trabajo analizamos los resultados obtenidos, y presentamos unas líneas de acción con el propósito de subsanar las deficiencias observadas.

  11. Escala sobre o clima para criatividade em sala de aula

    Directory of Open Access Journals (Sweden)

    Denise de Souza Fleith

    Full Text Available O propósito deste estudo foi construir e validar uma escala sobre o clima para criatividade em sala de aula. Este instrumento visa auxiliar na identificação de fatores que contribuem para a expressão da criatividade em sala de aula, bem como aqueles que inibem a criatividade em turmas de 3ª e 4ª séries do ensino fundamental. A escala intitulada "Minha Sala de Aula" foi aplicada em 644 alunos de escolas públicas e particulares. Para exame da validade de construto do instrumento, utilizou-se uma análise fatorial exploratória. A análise gerou cinco fatores: Suporte da Professora à Expressão de Idéias do Aluno, Autopercepção do Aluno com Relação à Criatividade, Interesse do Aluno pela Aprendizagem, Autonomia do Aluno e Estímulo da Professora à Produção de Idéias do Aluno. Os coeficientes de fidedignidade variaram de 0,55 a 0,73.

  12. Opinião do pai sobre o aleitamento materno

    Directory of Open Access Journals (Sweden)



    Full Text Available Estudio cualitativo desarrollado en Natal/RN con 13 hombres cuyos hijos estaban en período de lactancia natural. Tuvo por objetivo verificar la opinión del padre sobre la lactancia materna. Los datos se obtuvieron a partir de entrevista parcialmente estructurada y tratados siguiendo la técnica de análisis temático propuesta por Bardin. Los padres atribuyeron valores importantes a la lactancia relacionándolos al hijoya la compañera. Con relación al niño, verificamos conocimiento acerca de los beneficios de la leche materna como un alimento nutritivo, que promueve el crecimiento JI desarrollo infantil, determina la salud actual y favorece la vinculación entre el niño JI su madre. Con relación a la compañera, los entrevistados dijeron que la lactancia materna contribuye para que se estable el vínculo afectivo zca entre lactante y progenitora, como también, para la realización de la maternidad. Por consiguiente, afirmamos que los padres expusieron opiniones positivas acerca de la lactancia materna, las cuales pueden favorecer la promoción JI contribuirpara el suceso de la lactancia materna.

  13. III Foro- taller sobre Vacunación.

    Directory of Open Access Journals (Sweden)

    Elmer Escobar Cifuentes


    Full Text Available Para continuar con el análisis y discusión de la importancia de la vacunación en la Atención Primaria en Salud, en la prevención de enfermedades inmunoprevenibles, en la necesidad de la toma de decisiones para la introducción de nuevas vacunas y en la protección de las poblaciones de mayor riesgo, el día 4 de diciembre del 2012 se realizó el III Foro Taller sobre Vacunación en el auditorio de la Academia Nacional de Medicina. Se debatieron también temas como vacunación de embarazadas, de personas mayores e inmunodeprimidas y acciones a seguir para controlar brotes de tosferina. El III Foro de Vacunación fue instalado por el académico Alvaro Moncayo Medina, Vicepresidente de la Academia Nacional de Medicina y contó con la participación de funcionarios del Ministerio de Salud y Protección Social, secretarías departamentales y municipales de salud, asociaciones de profesionales, universidades e instituciones relacionadas con los programas de vacunación. Se destacan las intervenciones de los doctores participantes Guillermo Alfonso Jaramillo Martínez, Diego García, Luis Jorge Hernández, William Ramón Montoya, Adriana Arregocés y Jorge Flórez Otero.


    Directory of Open Access Journals (Sweden)

    Gerardo Araya Vargas


    Full Text Available Este estudio tuvo el propósito de determinar la correlación entre los índices de inteligencia tradicional (razonamiento analógico, C. I. e inteligencia emocional (C.E. con el rendimiento deportivo. Participaron 10 basketbolistas, entre los 17 y 25 años (media = 20.1 años, todas mujeres. Se les aplicó pruebas de C. I. (Raven y de C. E. (Goleman y luego se sometió a los sujetos a dos pruebas de precisión (tiro libre y tiro de tres puntos y posteriormente el entrenador evaluó mediante la Escala de Rendimiento Emocional Percibido por el Técnico, la capacidad de manejo emocional de las basketbolistas en situación de juego. El puntaje de C. E. se correlacionó significativamente (r=0.71; p < 0.05 con la precisión en el tiro de tres puntos. En los otros casos las correlaciones fueron bajas y no significativas. La evaluación del entrenador mostró (rbis = -0.87; p < 0.05 correlación significativa y negativa entre el índice C. E. y la percepción del efecto negativo de las emociones sobre el rendimiento, por tanto existe evidencia preliminar de que este índice podría ser valioso como predictor del rendimiento en circunstancias de alta exigencia.

  15. Algumas considerações sobre a chamada propaganda subliminar

    Directory of Open Access Journals (Sweden)

    J. Roberto Withaker Penteado


    Full Text Available O autor faz uma revisão das origens da expressão "propaganda subliminar" e do seu percurso histórico a partir dos eventos de 1957, nos EUA, que deram notoriedade ao assunto. Em seguida, a partir de considerações teóricas sobre as formas pelas quais se processa a comunicação publicitária, procura demonstrar que carecem de fundamento as afirmações de que tais ações possam atingir os seus objetivos fora dos limites de percepção dos receptores. Palavras-chaves: propaganda, percepção, psicologia, percepção. ABSTRACT The author reviews the origins ofthe expression "subliminal advertising" and its development after the 1957 events - in the USA - which gave the subject its present notoriety. This is followed by theoretical considerations about the process of advertising communication, which aim at demonstrating as baseless the claims that such actions may take place below the human threshold of perception. Keywords: advertising, perception, psychology, communication.

  16. Consideraciones sobre ética, derecho y ambiente

    Directory of Open Access Journals (Sweden)

    Pierre Foy Valencia


    Full Text Available El presente ensayo aborda la importancia que progresivamente está adquiriendo la ética ambiental en relación con las variadas formas del ejercicio contemporáneo del Derecho, así como de sus diversificadas áreas o especialidades y, por cierto, en particular respecto del Derecho Ambiental. Para ello, en primer lugar, identificaremos conceptualmente el escenario y el proceso de la ética ambiental como presupuesto condicionante que impacta en los múltiples mecanismos de actuación social —léase la política, la economía, la educación, los sistemas jurídicos, entre otros—.2 Luego, estableceremos algunas premisas sobre la responsabilidad profesional en particular del abogado y cómo estas deberían ser integradas en una perspectiva ético-ambiental o, si se quiere, basadas en una ética de la sostenibilidad. Finalmente, interpretaremos cómo tales consideraciones debieran articularse con el ejercicio de las disciplinas jurídicas, en especial con el Derecho Ambiental, enfatizando la cuestión de la corrupción con la preocupación ambiental.

  17. Prueba de sesgo sobre rendimientos financieros en el mercado colombiano

    Directory of Open Access Journals (Sweden)

    Marisol Valencia


    Full Text Available La caracterización de los rendimientos financieros depende, en gran medida, de su comportamiento probabilístico, el cual puede ser mal ajustado, conduciendo así a malas decisiones económicas relacionadas con valoración de activos, asignación de cartera y/o medición del riesgo de mercado. En este trabajo se propone una prueba que permita determinar el ajuste de los rendimientos del Índice General de la Bolsa de Valores de Colombia (IGBC a las siguientes distribuciones: Normal, Normal Sesgada y T Sesgada. Además, se mide el nivel de sesgo y se compara el desempeño de la prueba propuesta con otra prueba existente, usada únicamente para la detección de asimetría. Se encuentra que la prueba propuesta permite caracterizar los rendimientos del mercado de valores colombiano con una de las distribuciones de probabilidad, a diferencia de la otra prueba, que sólo advierte sobre la existencia de sesgo y no establece la distribución que representa su comportamiento.

  18. Las ideas sobre el hombre en la Grecia antigua

    Directory of Open Access Journals (Sweden)

    Juan Javier Saavedra Mayorga


    Full Text Available El presente artículo es el primero de una serie de documentos que tienen por objeto identificar el paradigma antropológico sobre el cual se ha construido el pensamiento administrativo, y su impacto en las prácticas administrativas contemporáneas. Para ello se parte de una perspectiva histórica, examinando las distintas concepciones que se han tenido acerca del hombre, y de qué modo ellas han influido el discurso y la práctica de la gestión. La investigación pretende averiguar si es cierta la hipótesis según la cual durante los últimos siglos habría tenido lugar un proceso de instrumentalización de la razón que ha concebido al hombre como un medio para el cumplimiento de fines, principalmente económicos, y el surgimiento de la administración sería una manifestación de dicho proceso. Este artículo se concentra en el estudio de las concepciones griegas a propósito del hombre.

  19. Sobre el soneto Los conquistadores de los trofeos

    Directory of Open Access Journals (Sweden)

    Carlos López Narváez


    Full Text Available Aun los medianamente eruditos en poesía francesa sobradamente saben que el autor del más celebrado poemario parnasiano -cuyo subtítulo puede ser Historia celeste de la tierra- el cubano-francés José María de Heredia, ascendía (el usual descendia no cu¡tdra en esta anécdota de gloria del conquistador y fundador don Pedro de Heredia, alias el desna- rigado, y de allí el que de las propias arterias apriemiárale un férvido interés por el mundo occidental en todos sus órdenes. Empezó por acometer la versión francesa de la monumental crónica historial de Bernal Díaz del Castillo, labor cuya culminación científica y artística culmina en las notas y acotaciones complementarias del original vertido y que denuncian, por igual sabiduría y pasión americanistas: tanto, que en su biblioteca de trabajo se alineaban cerca de dos centenares de obras sobre el Nuevo Mundo. La epopeya acabó, naturalmente por encender el instinto épico del abolengo hasta hacer del poeta el Benvenuto Cellini del soneto parnasiano. El primer indicio aparece en el titulado Los funerales, insuperablemente traducido por Otto de Greiff.

  20. El informe mundial sobre la violencia y la salud.

    Directory of Open Access Journals (Sweden)

    Etienne G. Krug


    Full Text Available En 1966, la Organización Mundial de la Salud declaró la violencia como uno de los principales problemas de salud pública. Para dar seguimiento a dicha resolución, el 3 de octubre de este año, la OMS publicó el primer Informe mundial sobre la violencia y la salud, el cual analiza los diferentes tipos de violencia, incluidos el maltrato y abandono de menores, la violencia entre los jóvenes, la violencia contra la pareja, la violencia sexual, el maltrato a ancianos, la violencia autoinfligida y la violencia colectiva. Para todos estos tipos de violencia, el informe explora la magnitud de sus efectos en la salud y en la sociedad, los factores de riesgo y protección y los esfuerzos de prevención que se han desplegado. El lanzamiento del informe dará inicio a una Campaña Global de Prevención de la Violencia que durante un año se centrará en la aplicación de sus recomendaciones. Este artículo resume algunos de los puntos más importantes del informe mundial.


    Directory of Open Access Journals (Sweden)

    Gustavo Marin Suppi


    Full Text Available No decorrer dos anos, a tecnologia computacional tem evoluído, com os dispositivos móveis abriu um imenso leque de possibilidades de sistemas que visam facilitar a vida de toda a sociedade. Na Internet das Coisas, a conexão não se limita a esses dispositivos, mas a qualquer objeto no ambiente, desde torneiras até sinaleiras, onde formam uma estrutura de rede guiada por troca de informações, onde sensores captam informações do meio e enviam para dispositivos que as processam. Por meio de uma revisão de literatura, o objetivo foi coletar dados sobre essa nova infraestrutura, proporcionando ao leitor uma visão geral, expondo os principais pontos mencionados pelos autores dos artigos pesquisados. Concluiu-se que o objetivo da Internet das Coisas é de fato revolucionar o meio de como usamos a internet, desde a conectividade até a distribuição da informação, porém, para tal, será necessário fortes estudos em relação a segurança das informações obtidas dos usuários.

  2. Skinner: sobre ciência e comportamento humano

    Directory of Open Access Journals (Sweden)

    Angelo Augusto Silva Sampaio

    Full Text Available Atualmente, não se pode pensar no estudo do comportamento humano sem considerar a abordagem científica a este objeto: o campo da Psicologia científica. Esse campo é disputado por diversos enfoques teóricos que divergem quanto ao modo como definem ciência e comportamento humano. A abordagem de B. F. Skinner foi bastante proeminente no século XX, mas ainda continua a ser mal-entendida. Partindo do desenvolvimento histórico de sua obra, o presente texto visa a iluminar alguns aspectos relacionados às noções de ciência e comportamento humano desse autor e ressaltar as transformações por que passaram. Analisam-se três tópicos da obra de Skinner: seu período inicial (de 1930 a cerca de 1938, a obra "Ciência e Comportamento Humano" de 1953, e as influências da Biologia. São enfatizados aspectos relevantes da sua teorização sobre o tema: busca por relações funcionais, ênfase nos dados empíricos, operacionismo, externalismo, multideterminação do comportamento, experimentalismo, previsão e controle, ética.

  3. A cultura empreendedora nos discursos sobre a juventude

    Directory of Open Access Journals (Sweden)

    Julia Salgado


    Full Text Available Neste artigo apresento um exame sobre o discurso da cultura empreendedora em alguns produtos midiáticos. Tendo como pano de fundo a análise comparativa de duas séries televisivas voltadas para o público juvenil em temporalidades distintas (Confissões de Adolescente, de 1994 e, de 2009/2010, busco examinar as retóricas que, nessas séries e em outros veículos, celebram o empreendedorismo juvenil como resposta às demandas por sucesso pessoal e como solução ao problema do desemprego estrutural. Antes, porém, faço uma contextualização do ambiente social que se construiu a partir da emergência de uma racionalidade neoliberal, procurando, com isso, compreender a relação da cultura empreendedora com lógicas sistêmicas, amplas e dominantes.

  4. Nueva evidencia sobre la Statistical Anxiety Scale (SAS

    Directory of Open Access Journals (Sweden)

    Amparo Oliver


    Full Text Available Las asignaturas relacionadas con la estadística suelen tener problemas de rendimiento académico. La ansiedad se relaciona de forma negativa con el rendimiento y en particular, la ansiedad estadística puede ser un constructo clave en la mejora de la enseñanza de esta materia y afines. La Statistical Anxiety Scale (Vigil-Colet, Lorenzo-Seva y Condon, 2008 se creó con la pretensión de ser útil para predecir el rendimiento académico en estadística. Se fundamenta en tres dimensiones de ansiedad referidas a tres aspectos específicos: respecto al examen, cuando se pide ayuda en la comprensión de estadística y en el proceso de interpretación de resultados. Esta estructura de tres factores fue hallada en un primer momento por los autores de la escala y en una primera validación corroborada en estudiantes italianos y españoles. El presente estudio pretende añadir nueva evidencia sobre la fiabilidad y validez de la escala, empleando en el estudio de fiabilidad técnicas estadísticas robustas, y ampliando el estudio de la validez respecto a su principal criterio, el rendimiento académico, ya que no puede ser considerado sinónimo de autoeficacia.

  5. Efecto de la Escolaridad sobre la Fecundidad en Nicaragua

    Directory of Open Access Journals (Sweden)

    Bonilla, Roger


    Full Text Available Son muchos los estudios que han mostrado la asociación inversa existente entre la escolaridad y la fecundidad. El objetivo de este estudio fue cuantificar el efecto de la escolaridad sobre la fecundidad, en una muestra de 11246 mujeres de Nicaragua. Se ajustaron modelos de regresión de Poisson en donde la variable respuesta Y fue el número de hijos nacidos vivos de la mujer y la variable independiente fue la escolaridad, controlando por otros efectos como zona de residencia, tenencia de empleo, uso actual de métodos anticonceptivos, edad y una medida del nivel informativo de la mujer. Los modelos propuestos son significativos (p < 0.05 el hecho de tener escolaridad primaria hace que el riesgo de tener hijos adicionales sea 13% menor con respecto a las mujeres que no tienen escolaridad alguna. El riesgo para las mujeres con escolaridad secundaria es 40% menor (Modelo 1. El efecto interactivo de la escolaridad secundaria y más y la edad es significativo ( <0.05 (Modelo 2. El estudio suministra información útil para el apropiado diseño de políticas públicas y programas educativos.

  6. Una lectura sobre las relaciones entre fascismo y poder.

    Directory of Open Access Journals (Sweden)

    Isabel Avendaño Flores


    Full Text Available Estas páginas partirán del supuesto de que geografía fue utilizada por el fascismo para ostentar el poder, para dirigir unas operaciones militares, para organizar los territorios en la previsión de las batallas que se libraran contra tal o cual adversario pero también, para que el aparato de Estado controlara mejor a los hombres sobre los cuales ejercía su autoridad. Decir que el fascismo era a la vez práctica y pensamiento o una acción animada por una doctrina, requiere de una plataforma territorial. Asimismo, la geografía como descripción metódica de los espacios, tanto de los aspectos que ha llamado „físicos‟ como bajo sus características económicas, sociales, demográficas y políticas debe situarse absolutamente como practica y poder


    Directory of Open Access Journals (Sweden)

    Bruna Graziele Marques da Silva


    Full Text Available A Candida albicans é um fungo comensal da microbiota normal, sendo capaz de produzir infecções em pacientes imunocomprometidos. As infecções estão apresentando resistência às terapias convencionais. Recentemente diversos compostos derivados de produtos naturais vêm sendo testados, destacando o polifenol Resveratrol que possui efeitos farmacológicos. Desse modo o objetivo deste estudo foi avaliar os efeitos do polifenol sobre o crescimento e a viabilidade do biofilme da C. albicans. Foram utilizadas as concentrações do Resveratrol em 5 μΜ, 10 μΜ, 20 μΜ, 50 μΜ, 100 μΜ, 200 μΜ, 300μΜ, 400μΜ e 500μΜ e a densidade de C.albicans foram de 105, 106 e 107 células viáveis/ml, e ainda, foi analisada a morfologia. Os resultados obtidos demonstram maior inibição no crescimento e viabilidade do biofilme na concentração de 500μΜ de polifenol, em comparação ao controle. Dessa forma, o polifenol Resveratrol foi capaz de alterar a morfologia das células e reduzir a viabilidade do biofilme da Candida albicans.

  8. Convivencia escolar. Un estudio sobre buenas prácticas

    Directory of Open Access Journals (Sweden)

    María José Caballero Grande


    Full Text Available Este trabajo de investigación se centra en la convivencia escolar y puede enmarcarse en la línea de educación para la paz.La finalidad del mismo ha sido conocer algunas peculiaridades de prácticas educativas  que fomentan la paz y la convivencia en el ámbito escolar. Para esto, se ha recogido información, mediante entrevista estructurada, en diez centros  educativos de la provincia de Granada, acogidos a la Red Andaluza  “Escuela, espacio de paz”, sobre la puesta en marcha, desarrollo y evaluación de actuaciones encaminadas hacia la cohesión del grupo, la gestión democrática de normas, la educación en valores, las habilidades socioemocionales y la regulación pacífica de conflictos.Del análisis de las entrevistas, se desprende que hay una serie de medidas y actuaciones que se llevan a cabo en los centros educativos que favorecen la buena convivencia. La necesidad de cooperación entre todos los actores intervinientes en el proceso educativo o  la importancia de sistematizar e institucionalizar el trabajo que eduque para el fomento de una cultura de paz, conforman entre otras las conclusiones a las que se llega en este estudio.


    Directory of Open Access Journals (Sweden)

    José Manuel Suárez Riveiro


    Full Text Available El principal propósito de este trabajo fue el de proponer un modelo sobre cómo las estrategias motivacionales relacionadas al componente de afectividad inciden sobre la utilización de las estrategias cognitivas y metacognitivas. La muestra utilizada fue de 500 estudiantes de Secundaria. Se asumió que el efecto de las estrategias motivacionales sobre las estrategias cognitivas estaría mediado por el uso de las estrategias metacognitivas. Para estudiar estas estrategias y su relación se realizaron análisis descriptivos y se elaboró un diagrama de senderos. Los resultados mostraron que la estrategia motivacional más utilizada es la de autorrefuerzo y que se establecen relaciones significativas desde algunas estrategias motivacionales, pero no desde todas, con las estrategias cognitivas aunque únicamente la estrategia de autorrefuerzo establece relaciones significativas con la autorregulación metacognitiva.

  10. Considerações sobre a prevalência dos tratados internacionais sobre a legislação tributária brasileira: o caso do MERCOSUL

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Ribeiro


    Full Text Available This is a study on the main aspects discussed in the Brazilian doctrine and the jurisprudence concerning the prevalence of international treaties and conventions for internal tax legislation. Considerations are made on the Brazilian federate and sovereignty principles and on the competence constitutionally established for all the political entities of the Brazilian State. Article 151, section III of the Federal Constitution must be pointed out for its purpose on stating that the Union shall not exempt the States, the Federal District and the Municipalities from respective taxes. Article 98 of the National Tax Code is also considered for its disposition concerning legislation from international treaties and agreements on tax norms of the positive system currently in force.Trata-se de estudo sobre os principais aspectos discutidos na doutrina e na jurisprudência brasileira sobre a prevalência dos tratados e convenções internacionais sobre a legislação tributária interna. Necessário se faz apresentar considerações sobre o princípio federativo brasileiro, o princípio da soberania e o da competência constitucionalmente estabelecida para todos os entes políticos do Estado brasileiro. Merece maior destaque o art. 151, inciso III da Constituição Federal ao enaltecer que a União não poderá conceder isenções de tributos de competência dos Estados, Distrito Federal e Municípios, bem como a análise do art. 98 do Código Tributário Nacional dispondo sobre as introduções legislativas provenientes de tratados e acordos internacionais sobre as normas tributárias do sistema positivo vigente.

  11. Creencias sobre la madurez psicológica en adultos dominicanos: un estudio sobre sus dimensiones evolutivas y de personalidad desde la perspectiva del conocimiento lego


    Núñez Fernández, Ramón Onésimo


    Uno de los constructos psicológicos elaborados por la psicología más empleado, pero menos definido con precisión es el de la “madurez psicológica” o “madurez personal”; y aunque hoy día podemos encontrar definiciones de algún modo explicitas sobre el constructo en esencia poco nos dicen sobre su significado social. El interés fundamental de esta tesis está basado en la exploración de las creencias e ideas que tienes las personas adultas acerca del contructo de madurez personal y las dimension...

  12. Efecto de distintos sistemas de acolchado del suelo sobre la humedad y la temperatura del suelo, y sobre distintos parámetros de nectarina regada por goteo


    Zribi, Wided; Faci González, José María; Aragüés Lafarga, Ramón


    La agricultura de regadío moderna exige el uso óptimo y sostenible de los recursos agua y suelo. El acolchado del suelo puede ser una técnica eficiente de conservación de estos recursos. En particular, el acolchado en cultivos leñosos esta adquiriendo una importancia creciente por sus efectos hipotéticamente positivos sobre la conservación del agua y el control de la salinidad del suelo debidos a la reducción de la evaporación, así como sobre el rendimiento, precocidad de la cosecha y calidad...

  13. Obtenção de nanocompósitos, nanodiamante sobre fibra de carbono e nanotubo de carbono sobre fibra de carbono


    Leonardo Iusuti de Medeiros


    A proposta desta dissertação é a obtenção de dois compósitos nanoestruturados que sejam constituídos um por nanodiamante sobre fibra de carbono e, o outro, por nanotubo de carbono sobre a fibra de carbono. Em ambos os compósitos as fibras de carbono usadas são obtidas com três diferentes índices de grafitização 1000, 1500 e 2000°C. As fibras de carbono apresentam uma grande área superficial devido a sua estrutura. Quando utilizadas como substrato para crescimento de materiais nanoestruturados...

  14. Conhecimento sobre intolerância à lactose entre nutricionistas = Knowledge about lactose intolerance among nutritionists

    Directory of Open Access Journals (Sweden)

    Bauermann, Andreia


    Conclusões: A maioria dos nutricionistas desta amostra não estava suficientemente preparada para tratar indivíduos intolerantes à lactose; faltavam conhecimentos adequados sobre essa condição e seu manejo nutricional

  15. Historia y dogma. Sobre el valor histdrico del dogma. [Reseña


    Alonso, J. (Juan)


    Reseña de Maurice BLONDEL, Historia y dogma. Sobre el valor histdrico del dogma, Ediciones Cristiandad (Biblioteca Teoldgica «Cldsicos del siglo XX»), Madrid 2004, 184 pp., 13 X 20, ISBN 84- 7057-492-2.

  16. Etnografiando travestis: preguntas, tensiones y aprendizajes sobre el "estar ahí"

    Directory of Open Access Journals (Sweden)

    María Soledad Cutuli

    Full Text Available Este artículo interroga la construcción de vínculos etnográficos en dos obras pioneras sobre travestis, con una intención retrospectiva sobre la propia investigación en una agrupación de travestis de Buenos Aires. Se reflexiona sobre la implicancia de los/as antropólogos/as "en campo" -en tanto seres sexuados/as y generizados/as- preguntándose además sobre las formas en que son interpeladas/os durante su labor junto a integrantes de organizaciones sociales -en la que el activismo resulta ser la extensión lógica del compromiso a la reciprocidad que subyace en la práctica antropológica.


    Directory of Open Access Journals (Sweden)

    Pe. Antonio Marcos Chagas


    Full Text Available Agostinho desenvolve uma reflexão organizada e uma síntese filosófico-religiosa de extraordinária força e beleza que influenciara significativamente todo o pensamento filosófico e teológico posterior. O presente trabalho abordará uma reflexão sobre o pensamento agostiniano sobre Deus, sobre o homem, o mal e uma reflexão sobre a história à luz da fé. A leitura feita por Agostinho destes temas desdobra uma abordagem focada na primazia da graça que permeia a vida humana e oferece possibilidades para sua plena realização enquanto liberdade consciente. O presente trabalho encontra nos originais agostinianos e nas publicações dos escritores especializados sua fonte de pesquisa.

  18. Influencia del yeso sobre la velocidad de hidratación del cemento portland

    Directory of Open Access Journals (Sweden)

    Yamaguchi, G.


    Full Text Available Not availablePara esclarecer la Influencia del yeso sobre el fraguado y endurecimiento del cemento, los autores estudiaron el grado de hidratación de los cuatro principales minerales del clínker de cemento Portland y el efecto del yeso sobre ellas. Haciendo uso del análisis cuantitativo de rayos X, se determinó la porción no hidratada. Simultáneamente, se determinaron los tiempos de fraguado y las resistencias. Los ensayos se llevaron a cabo sobre tres clínkeres sintéticos de diferentes composiciones y sobre dos clínkeres de cemento Portland comerciales.

  19. En cumplimiento con la orden ejecutiva del presidente Trump sobre la Independencia Energética (United States)

    Acciones reglamentarias tomadas por la EPA, incluyendo audiencias públicas, para implementar la Orden Ejecutiva sobre la Independencia Energética y la propuesta derogación del Plan de Energía Limpia.

  20. Informe sobre reptiles colombianos (I: Noticia sobre el primer hallazgo de la Tortuga Geoemyda Annulata (Gray en Colombia

    Directory of Open Access Journals (Sweden)

    Medem Fred


    Full Text Available Geoemyda annulata fue descrita por Gray en 1860, del Ecuador (Esmeraldas. El typus y dos paratypus que se conservan en el British Museum (Boulenger, 1889: 127. Dunn (1945: 320 afirma que G. annulata es muy común en la Zona del Canal de Panamá. Schmidt (1946: 8 coleccionó material de dicha Zona, como también en Barro Colorado, isla situada en la misma región. El límite norte de la distribución geográfica para G. annulata aparentemente es Costa Rica (Chelopus gabbii, Cope, 1876, puesto que al menos desconozco datos exactos sobre su existencia más al norte.  En Colombia G. annulata no ha sido encontrada según Dunn (op. cit.: 320, quien sugirió como "muy probable" su presencia en este país. Durante la expedición "Operación Truandó" realizada por la Armada Nacional en julio de 1955, el autor logró hallar un ejemplar de G. annulata y pudo comprobar que dicha tortuga pertenece a la fauna colombiana.


    Directory of Open Access Journals (Sweden)

    Nancy Yaneth Gelvez García


    Full Text Available Este artículo presenta los resultados obtenidos en el estudio de la calidad de servicio sobre redes IP en tráficos sensibles al retardo como la VoIP sobre la tecnología ATM y MPLS. Se analizaran diferentes topologías con características propias que permitirán evaluar valores tales como el retardo y el ancho de banda.

  2. Mesa redonda sobre nuevos modelos organizativos en la gestión de proyectos digitales


    Taladriz Mas, Margarita; Magriñá Contreras, Marta; Martín Marichal, Carmen; Cabo Rigol, Mercé; X Workshop Rebiun sobre proyectos digitales. Valencia, 7-8 Octubre de 2010


    Mesa redonda dentro del X Workshop Rebiun sobre proyectos digitales, celebrado en Valencia, 7-8 Ocubre de 2010, sobre: Nuevos modelos organizativos en la gestión de proyectos digitales. Moderador: José Manuel Barrueco (UV). Intervienen: Margarita Taladriz Mas(UC3M), Marta Magriñá Contreras (UNIRIOJA), Carmen Martín Marichal (ULPGC) y Mercé Cabo Rigol (UPF).

  3. Notas sobre la historia de la garza morena ardea cocoi (aves en Colombia

    Directory of Open Access Journals (Sweden)

    José Ignacio Borrero H.


    Full Text Available Una revisión de la bibliografía sobre esta especie, demuestra que si bien existe una serie de notas relacionadas con su distribución geográfica, prácticamente nada se ha escrito en relación con sus costumbres, fuera claro está, de comentarios muy generales consignados en manuales sobre faunas regionales.

  4. Investigación sobre implementación y gobernanza

    DEFF Research Database (Denmark)

    Cejudo,, Guillermo M.; May, Peter J.; Sætren, Harald


    . Cejudo, María del Carmen Pardo y Mauricio I. Dussauge Laguna (todos de la División de Ad­ministración Pública del CIDE), cerró con un panel sobre “investigación sobre implementación y gobernanza: direcciones y retos para el futuro”. Lo que sigue es una versión editada de esa discusión de clausura....

  5. Algunos relatos sobre santería, magia y etnomedicina en Cuba


    Carrascosa Palomera, Cruz


    Este artículo presenta una colección de relatos sobre santería, magia y etnomedicina en Cuba. Incluye información sobre ritos y prácticas de iniciación, de purificación, de curación. This paper offers a selection of stories about santería, magic and folk medicine in Cuba. Includes reports on iniciation, purification and curation rites and practices

  6. Investigação sobre o desamparo aprendido em humanos


    Mariana Januario Samelo


    A literatura sobre o desamparo aprendido utilizando humanos como participantes de pesquisa, tem encontrado dificuldades metodologicas. O presente experimento teve como objetivo geral estabelecer um procedimento que permitisse controle experimental suficiente para verificacao do efeito de uma historia de incontrolabilidade, com e sem feedback de erro, sobre a aprendizagem de uma nova resposta operante em sujeitos humanos. Estudantes universitarios foram divididos em quatro grupos (n=10), deno...

  7. Conocimiento sobre salud buco-dental de las embarazadas. Consultorio La California. 2012


    Yero Mier, Ileana María; García Rodríguez, Marisel; Reytor Saavedra, Eduardo; Nazco Barrios, Lidia Ester


    Fundamento: existe desconocimiento sobre salud bucal de las embarazadas, como consecuencia acuden con frecuencia a los servicios de estomatología. Objetivo: identificar el nivel de conocimiento sobre salud buco-dental en pacientes embarazadas del Consultorio La California. 2012. Metodología: se realizó estudio observacional descriptivo. La población y la muestra fueron 93 embarazadas que asistieron a la consulta estomatológica. Se analizaron diferentes afecciones e identificación de factores ...

  8. Reflexiones sobre la tutoría como función del profesor universitario


    López Lucas, María del Carmen


    En el artículo se reflexiona sobre la tutoría, los motivos, los ámbitos de aplicación, cómo hacer una tutoría personalizada y cómo la entrevista en la tutoría individual, y por último, se reflexiona sobre el momento más adecuado para realizarse.

  9. Estudio sobre el software libre orientado a personas con discapacidad visual


    Palomá Parra, Esaú


    Se pretende realizar un estudio sobre las herramientas TIC accesibles a las personas con discapacidad visual, que permita sugerir el diseño de un sistema universal accesible orientado a personas con discapacidad visual. Es pretén realitzar un estudi sobre les eines TIC accessibles a les persones amb discapacitat visual, que permeti suggerir el disseny d'un sistema universal accessible orientat a persones amb discapacitat visual. Master thesis for the Free Software program.

  10. EXTRATO DE CHÁ VERDE (Camellia sinensis PROMOVE AÇÃO ANTIMICROBIANA SOBRE Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Leandro Wagner Figueira


    Full Text Available É de grande importância ampliar as pesquisas científicas com plantas medicinais sobre micro-organismos. Foi verificado o efeito antimicrobiano do extrato de C. sinensis , sobre cultura planctônica e biofilme de S. aureus. Neste estudo foi verificada ação do extrato entre 50 a 0,09 mg/mL sobre cultura planctônica, para determinação da CIM e CBM. A ação do extrato sobre biofilme foi analisada pela exposição de 5 min ao produto vegetal a 200mg/mL. Foi utilizado o método de MTT para determinar a redução da viabilidade do biofilme. Nos grupos controles foram utilizadas clorexidina (+ e solução salina (-, sendo n = 12/grupo. A redução do biofilme foi analisada por ANOVA e Tukey Test (p ≤ 0,05. Em cultura planctônica as concentrações avaliadas não foram efetivas, contudo, utilizando-se a concentração de 200 mg/mL sobre o biofilme, foi verificada redução significativa. Com isso, concluiu-se que o extrato de chá verde demonstrou ação sobre biofilme de S. aureus provendo redução significativa em sua viabilidade.

  11. Borges sobre la traducción / Borges on translation

    Directory of Open Access Journals (Sweden)

    Suzanne JILL LEVINE


    Full Text Available  El presente artículo tiene por objeto exponer la personal teoría de Borges sobre la traducción, y en concreto la traducción literaria. A partir de la literatura secundaria, pero sobre todo de la propia obra de Borges al respecto ¾concretamente los ensayos Las dos maneras de traducir(1926, Las versiones homéricas (1932,Los traductores de las 1001 noches (1936,El enigma de Edward Fitzgerald (1951 y la «ficción» Pierre Menard, autor del Quijote(1939¾, se presentan y contextualizan las principales ideas del autor argentino, entre las que destaca el valor de la traducción como paradigma de lectura, escritura e interpretación de un texto. Asimismo se abordan aspectos que, si bien un sector de la teoría da hoy por supuestos, en su momento fueron pioneros, como son: la equiparación de original y traducción, la importancia del enfoque descriptivo y de la obra por encima del autor, el valor de la creatividad, la imposibilidad de que exista una sola traducción válida, el potencial de los errores de traducción, el concepto de ganancia a través de la traducción (no de pérdida, la (autocensura y la ideología, etc. The aim of this article is to present Borges’ personal translation theory, particularly regarding literary translation. The Argentine author’s main ideas are introduced and contextualised through secondary literature, but especially through Borges’ own works in this regard ¾specifically the essays The Two Ways to Translate (1926, The Homeric Versions (1932, The Translators of the 1001 Nights (1936, The Enigma of Edward Fitzgerald (1951 and the «ficción» Pierre Menard, Author of Don Quixote (1939. Among those ideas, the value of translation as a paradigm for reading, writing, and text interpretation stands out. The article also deals with aspects that were pioneering in their time, even though nowadays they are taken for granted by some scholars. Those aspects include placing both the original and

  12. Puente sobre el río Parramatta, Australia

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo


    , subdividido en 108 dovelas huecas de 50 t cada una. Entre ellas, y convenientemente espaciados, se han colocado unos diafragmas transversales, pretensados, que sirven de arriostramiento de los cuatro arcos entre sí. Sobre el extradós de los arcos se levantan los montantes que soportan el tablero del puente, que tiene 22 m de calzada, y dos andenes, de 1,80 m cada uno, para peatones. Las vigas pretensadas del tablero se han prefabricado en dos talleres próximos al puente, uno a cada lado del río. Para hormigonar los cuatro arcos se utilizó una cimbra metálica, única,, que se desplazaba de uno a otro. El tesado se realizó con series de gatos planos, tipo Freyssinet, intercalados entre cierto número de dovelas, que se expondrían bombeando aceite en su interior hasta conseguir cierto aumento de volumen; después se sustituía el aceite por mortero y se continuaba la operación en otra serie de gatos, hasta elevar el arco sobre su cimbra. Sucesivamente, se pasaba de uno a otro arco.

  13. Notas sobre el problema habitacional en 'El otro sendero'

    Directory of Open Access Journals (Sweden)


    Full Text Available L'article réunit des notes de lecture sur le livre 'El Otro Sendero', à propos de la construction de logements pour les secteurs à bas revenus. L'importance de ce livre pour le public national est reconnue au départ et l'on tente d'étudier ses propositions en ce qui concerne le logement (chapitre 2. Après avoir examiné les propositions du texte, on commente quelques erreurs dans l'analyse des faits. Le commentaire final dit: La profusion d'analyses erronées qui visent à mettre en évidence la 'longue marche vers la propriété privée', comme le manque d'analyses spécifiques sur le problème du logement et sur celui de la ville -qui constituent le contexte des informels dans les barriadas-, nous font penser que nous sommes confrontés à un schéma idéologique a priori plus qu'à une étude de la réalité urbaine. El artículo proporciona notas de lectura del libro 'El Otro Sendero' referentes a la producción de vivienda para los sectores de bajos ingresos. Se parte de reconocer la importancia que ha tenido este libro en la audiencia nacional y se intenta estudiar sus proposiciones sobre la vivienda (capítulo 2. Luego de examinar las propuestas presentes en el texto, se comentan algunas incorrecciones en el análisis de los hechos. El comentario final dice: La profusión de análisis erróneos que apuntan a destacar la 'larga marcha hacia la propiedad privada', así como la falta de análisis específicos sobre el problema de la vivienda y el de la ciudad -que constituyen el contexto de los informales en las barriadas-, nos hacen pensar que estamos frente a un esquema ideológico a priori más que frente a un estudio de la realidad urbana. The article consists of interpretative notes on the book 'El Otro Sendero', which refer to the production of housing for low-income sectors. It begins by recognizing the importance this book has had for the national audience, and proposes to examine its propositions about housing (chapter 2. An

  14. Puente sobre el río Enns, Austria

    Directory of Open Access Journals (Sweden)

    Polensky & Zöllner, Constructora


    Full Text Available A road bridge has been recently opened over the Enns river at Steyr (Austria. The purpose is to improve traffic and avoid the bottlenecks that often took place. The bridge is supplemented by three other works of lesser importance, namely two bridges and a tunnel for pedestrians. The bridge structure supporting the decks is cellular, box type. It has three compartments, and four vertical partitions, whose thickness varies from 6 m over the intermediate piles to 2.30 m at the crown. There are three spans, of 47, 101 and 70 m length. The bridge intrados forms a smooth curve. Two overhangs extend from the central structure, and provide sidewalks for pedestrians: the deck itself having a width of 17 m. The structure was made in successive overhangs, in 3.50 m sections. Longitudinal prestressing, by means of PZ-A-100 type cables, was done by applying an initial loading of 120 t. The cables run in tubes. After the concrete had reached a suitable strength, the cables were stretched. The tubes were then filled with cement mortar, and in this operation air suction equipment was utilised to make sure that no air cavities were left.Se ha construido y puesto en servicio un puente para carretera sobre el río Enns en Steyr (Austria, con objeto de mejorar la circulación de vehículos y evitar las congestiones que se producían frecuentemente. Complementan al puente otras tres obras de menor importancia, constituidas por dos puentes y un túnel para el paso de peatones. La estructura que soporta el tablero es celular, tipo cajón, de tres células y cuatro almas y tabiques verticales, con canto variable desde 6 m sobre las pilas intermedias a 2,30 m en la clave. El puente se subdivide en tres tramos de 47, 101 y 70 m de luz, respectivamente. El intradós sigue el perfil de una curva suave. Del cuerpo de la estructura salen dos ménsulas que soportan los dos andenes para peatones, quedando el tablero con una anchura total de 17 metros. La estructura se construy

  15. Sobre a morte da cobaya consecutiva á dupla Vagotomia

    Directory of Open Access Journals (Sweden)

    Miguel Ozorio de Almeida


    Full Text Available 1. A secção dos vagos na cobaya produza morte em prazos que variam de meia hora a algumas horas. 2. A morte se dá por intensas lesões pulmonares, caracterisadas por congestão e edema. 3. As cobayas introduzidas em camaras em que a atmosphera tem altas tensões de gaz carbonico, caem anesthesiadas ao fim de alguns segundos, seguindo-se logo depois a morte. Na autopsia, se encontram lesões pulmonares muito semelhantes ás que se verificam nas cobayas vagotomisadas. 4. Nas cobayas profundamente anesthesiadas pelo chloral, a sobrevida á vagotomia é muito maior que nas cobayas não anesthesiadas. Nesses casos a morte muitas vezes se dá quando o animal vem a despertar da anesthesia. 5. Foram feitas novas experiencias que demonstram produzir a novocaina uma interrupção completa de todas as fórmas de conductibilidade dos nervos. 6. Quando se produz a secção physiologica pela novocaina dos vagos na cobaya, observam-se modificações do typo respiratorio que se caracterisam por diminuição consideravel da frequencia e augmento da amplitude. A respiração não apresenta porém, o typo francamente dyspneico, istoé, ella não se faz com difficuldade. 7. A secção physiologia dos pneumogastricos permitte uma sobrevida muito maior que a secção cirurgica. 8. A morte nas condições da conclusão precedente se dá pelas mesmas lesões pulmonares que se encontram habitualmente depois de secção cirurgica, mas é produzida unicamente pela irritação dos pneumogastricos exercida pelas gotteiras de borracha e pelo algodão, depois que a novocaina é absorvida e que se dissipa a anesthesia local. 9. Quando se operam as secções dos vagos com irritações variaveis as sobrevidas são differentes. 10. A sangria immediata não tem effeito sobre o tempo de vida da cobaya vagotomisada. 11. A sangria tardia parece augmentar ligeiramente essa sobrevida. Todos os factos expostos neste trabalho demonstram: 1 De um lado a irritação sem secção dos

  16. Una mirada sobre el feminismo del Funk carioca

    Directory of Open Access Journals (Sweden)

    Hugo Alexander Buitrago Carvajal


    Full Text Available El presente texto analiza las condiciones sociales en las que  algunas cantantes de funk carioca  de los  últimos diez  años  se autoproclamaron feministas. Busca  caracterizar y problematizar las manifestaciones contemporáneas del feminismo en  las cantantes populares de funk  a través de una  indagación histórico hermenéutica. Para ello se realiza  una  contex- tualización histórica del funk  y una  revisión de las letras de algunos de los cantantes y las cantantes con  más  reconocimiento en  el género.  Así, se expone la propuesta de liberación sexual  y erotización del cuerpo femenino para confrontarla con la discusión desarrollada en blogs digitales sobre  la alienación de la mujer  que se supone conlleva el funk.  A partir de la confrontación con el feminismo de tercera ola se propone al funk como reafirmación de géne- ro, de clase baja y de etnia negra  que se consolida como  manifestación cultural feminista de las mujeres de favela. Ello, acompañado de un proceso de normalización e incorporación de este género musical a los valores  estándar, lo cual convierte el funk  en un discurso portador de postulados contradictorios.

  17. Un narrador sobre el caballo de la calesita

    Directory of Open Access Journals (Sweden)

    Graciela Villanueva


    Full Text Available Partiendo de la convicción de que las zonas de apertura y cierre de un texto, sobre todo en el caso de la ficción, son lugares privilegiados del flujo intertextual y de la comunicación entre el texto y el mundo, este artículo estudia las figuras de la continuidad y los modos en que aparece la temática del origen en los bordes de las ficciones saerianas. El análisis de los manuscritos confirma la importancia de los incipits y de los excipits como expresión de una escritura y de un proyecto en perpetuo movimiento.Partant de la conviction que les zones d’ouverture et de fermeture d’un texte, surtout lorsqu’il s’agit d’un texte de fiction, sont des lieux privilégiés de passage du flux intertextuel et de la communication entre le texte et le monde, cet article étudie les figures de la continuité et les formes qu’adopte la thématique de l’origine aux seuils des textes narratifs de fiction de Juan José Saer. L’analyse des manuscrits de l’auteur confirme l’importance des incipits et des excipits comme expression d’une écriture et d’un projet en mouvement perpétuel.With the conviction that the opening and closing lines of a text, especially in literary fiction, are privileged places of intertextual flow and exchange between words and world, this paper analyses the forms of continuity and the expression of origin on the threshold of Saer’s narrative fiction. Manuscript analysis confirms the importance of incipits and excipits as an expression of a writing project in perpetual motion.

  18. Interculturalismo y Republicanismo: cruce de miradas sobre la diversidad cultural

    Directory of Open Access Journals (Sweden)

    Wences, Isabel


    Full Text Available When we speak of managing cultural diversity or accommodation policy and the recognition of the difference two problems generally come to mind. First, the notion of communitarism models, which aim to strengthen cultural property using strategies that create closure and exclusion; second, the difficulty that stems from applying, without nuances, some of the principles of liberalism, such as universalism or rigid secularism, to all contexts. This paper explores other ways of approaching the challenge of living together harmoniously in cultural diversity, focusing, on one hand, on a pluralistic and inclusive form of republicanism and, on the other hand, on the Quebecois model of integration and cultural diversity management known as interculturalism. Likewise, it explores the possibilities of establishing ways of combining both approaches.Cuando se habla de gestionar la diversidad cultural o de políticas de acomodo y reconocimiento de la diferencia, muchas veces se piensa en modelos comunitaristas donde se pretende afianzar, de manera cerrada y exclusiva, bienes culturales densos o en la dificultad que conlleva aplicar sin matices algunos de los principios del liberalismo en determinados contextos, como son la universalidad o la laicidad rígida. En este trabajo se exploran otras formas de acercarse a este reto de convivir armónicamente en la diversidad cultural, en concreto las de, por una parte, un republicanismo pluralista e inclusivo y, por la otra, el modelo quebequés de integración y gestión de la diversidad cultural conocido como interculturalismo. Asimismo, se indaga sobre las posibilidades de entablar vías convergentes entre ambas.

  19. Considerações sobre Psicologia, trabalho e cotidiano

    Directory of Open Access Journals (Sweden)

    Sonia Regina Vargas Mansano


    Full Text Available A Psicologia Organizacional pode ser considerada uma das áreas de intervenção mais consolidadas no âmbito da Psicologia no Brasil, sendo que seus profissionais são requisitados de maneira recorrente para atuar junto ao setor de Recursos Humanos. Ao mesmo tempo, o cenário laboral contemporâneo continua a reproduzir e a sofisticar uma sistemática exploração dos trabalhadores, tanto no que diz respeito ao tempo de trabalho (cada vez mais ampliado pelas tecnologias de comunicação e controle quanto em relação às dimensões subjetivas que são colocadas a serviço da produção. O presente estudo propõe um debate sobre a inserção do psicólogo no setor de Recursos Humanos, problematizando três dimensões: a complexa relação estabelecida entre trabalhadores e organizações, a concepção de homem adotada por tais profissionais e o papel ético e político da psicologia diante das exigências laborais contemporâneas. Como conclusão parcial, consideramos que cabe a este profissional a difícil tarefa de abrir brechas no sistema rígido de acumulação e competitividade que predomina nas organizações capitalistas para apoiar e sustentar formas de intervenção que privilegiem a expansão vida e suas variações subjetivas.

  20. Efeito da Idade Materna sobre os Resultados Perinatais

    Directory of Open Access Journals (Sweden)

    Azevedo George Dantas de


    Full Text Available Objetivo: analisar a relação entre a idade materna e a ocorrência de resultados perinatais adversos na população do Rio Grande do Norte. Métodos: foram analisados os registros oficiais de 57.088 nascidos vivos no Estado do Rio Grande do Norte no ano de 1997. Os dados foram obtidos do Sistema de Informação sobre Nascidos Vivos do Ministério da Saúde. A população estudada foi dividida em Grupos I, II e III, segundo a faixa etária materna: 10 a 19, 20 a 34 e 35 anos ou mais, respectivamente. As variáveis analisadas foram: duração da gestação, peso ao nascer e tipo de parto. A análise estatística foi realizada utilizando-se o teste chi². Resultados: observamos uma maior incidência de parto pré-termo no Grupo I (4,3 %, em comparação ao Grupo II (3,7% (p = 0,0028. A taxa de cesariana foi menor nos Grupos I e III, em comparação ao Grupo II (p<0,0001. Evidenciamos freqüência significativamente maior de recém-nascidos de baixo peso nos Grupos I (8,4% e III (8,3%, quando comparados ao Grupo II (6,5% (p<0,0001. Conclusões: a gravidez nos extremos da vida reprodutiva esteve associada com maior freqüência de parto pré-termo e baixo peso ao nascer, entretanto, com relação ao tipo de parto, foi observada maior freqüência de parto normal do que no grupo de gestantes com idade entre 20 e 34 anos.

  1. Viaducto sobre el río Fiumarella, Italia

    Directory of Open Access Journals (Sweden)

    Morandi, Riccardo


    Full Text Available The viaduct over the Fiumarella river, which links Catanzaro and the Two Seas lines of communication, has recently been opened to the public. The central arch has a theoretical span of 231 m and a maximum rise of 62 m. It bridges a river, and is made of reinforced concrete. The cross section is a hollow rectangle. The arch supports a palisade of inclined, slender columns, upon which rests the deck. This is sufficiently wide to accommodate a pavement, 10.5 m wide, and two sidewalks, each 1.5 m wide. This project is remarkable because of the slender, logical design of each of its structural components, and also because the columns have a slope of 15° 30' with respect to the vertical. This inclination causes the columns to transmit to the outer surface of the arch loading components which tend to improve the stability of the bridge. Near the springers, the arch branches out into two legs, which at the base are distanced 22 m apart. This arrangement gives a better distribution of the loads on the foundations. The central span consists of two independent arches, the box section of which is 7.5x6.6 m at the springers, and 5.25x2 m at the crown. The neutral axis of the arch, whose total length is 274 m, corresponds to a fifth degree curve, such that at many points it is coincident with the funicular of forces due its own weight. Only at certain points is there some discontinuity, due to the concentrated loads and the corrections which have been applied to allow for the elastoplastic deformation of the material.El viaducto sobre el río Fiumarella, que constituye la unión entre Catanzaro y la vía de comunicación de Los dos Mares (Italia, ha entrado recientemente en servicio. El tramo central, de 231 m de luz teórica y 62 m de flecha, salva, el río con un arco de hormigón armado, de sección transversal hueca, formando una estructura tipo cajón. Este arco, junto con una serie de soportes inclinados, esbeltos, soportan el tablero de anchura

  2. Narrativas sobre género y sexualidad en médicos mexicanos. Sus implicaciones sobre las regulaciones corporales, sexuales y reproductivas

    Directory of Open Access Journals (Sweden)

    Itzel A. Sosa-Sánchez

    Full Text Available Resumen A partir de un estudio cualitativo, exploramos los vínculos entre discursos médicos sobre género y sexualidad, y las regulaciones corporales, sexuales y reproductivas en los espacios de salud reproductiva. Entrevistamos a médicos de servicios públicos de salud en México e indagamos sobre las prácticas reproductivas y sexuales de las usuarias, así como sobre las asignaciones sociales y profesionales de cuidado del cuerpo en las relaciones sexuales. Los testimonios revelan cómo los discursos y normatividades sobre género y sexualidad legitiman, en los espacios de salud reproductiva, las desigualdades sociales, especialmente las de género, y la doble moral sexual imperantes en la sociedad mexicana. Las mujeres emergen como saturadas de una sexualidad “desordenada” que debe ser controlada a través de diversas regulaciones corporales, sexuales y reproductivas. Estas regulaciones inciden en el reconocimiento de su autonomía sexual y reproductiva, e impactan negativamente en sus derechos.

  3. Conhecimento de idosos sobre seus direitos Conocimiento de los ancianos sobre sus derechos Knowledge of the elderly about their rights

    Directory of Open Access Journals (Sweden)

    Maristela Santini Martins


    Full Text Available OBJETIVOS: Identificar o conhecimento de idosos sobre seus direitos e se consideram que esses direitos são respeitados. MÉTODOS: Pesquisa exploratória, descritiva, de abordagem quantitativa e com coleta de dados prospectiva, através de entrevista. A amostra, composta por 63 idosos, foi probabilística, aleatória e estratificada por sexo e idade. RESULTADOS: Os direitos dos idosos eram conhecidos por 49,2% dos entrevistados. Dentre estes, os mais citados foram a gratuidade no transporte (50,0%, a prioridade no atendimento (38,1% e existência de assentos preferenciais nos meios de transporte (28,6%. Quanto ao respeito a esses direitos, 25,0% acreditavam que são respeitados e 44,4% que são respeitados parcialmente. CONCLUSÃO: A metade dos idosos entrevistados conhecia seus direitos e referiram que esses nem sempre são respeitados.OBJETIVOS: Identificar el conocimiento de los ancianos sobre sus derechos y evaluar si consideran que esos derechos son respetados. MÉTODOS: Se trata de una investigación exploratoria y descriptiva, con abordaje cuantitativo y recolección de datos prospectiva a través de entrevistas. La muestra, compuesta por 63 ancianos, fue probabilística, aleatoria y estratificada por género y edad. RESULTADOS: Los derechos de los ancianos fueron conocidos por 49,2% de los entrevistados. Entre los derechos, los más citados fueron la gratuidad en el transporte (50,0%, la prioridad en la atención (38,1% y la existencia de asientos preferenciales en los medios de transporte (28,6%. En cuanto al respeto a esos derechos, 25,0% creía que eran respetados y 44,4% que eran respetados parcialmente. CONCLUSIÓN: La mitad de los ancianos entrevistados conocían sus derechos y refirieron que estos no siempre fueron respetados.OBJECTIVES: To identify the knowledge of elderly people about their rights, and to assess whether they consider that these rights ware respected. METHODS: Exploratory and descriptive study with quantitative

  4. Conocimientos sobre derechos y deberes en salud en profesionales de medicina y enfermería, Bucaramanga, Colombia: Conocimientos sobre derechos-deberes en salud

    Directory of Open Access Journals (Sweden)

    Ludivia Esther Montaño Villalba


    Full Text Available Objetivo: Describir el nivel de conocimientos que profesionales en medicina y enfermería, que laboran en instituciones de salud públicas y privadas de la ciudad de Bucaramanga (Santander-Colombia, tienen sobre derechos y deberes en salud establecidos en la Constitución Política y en el Sistema General de Seguridad Social en Salud, 2010. Método: Estudio descriptivo, exploratorio, transversal. Se seleccionaron aleatoriamente instituciones, servicios y profesionales participantes. Se indagaron los conocimientos en cinco componentes que cobijaron temas sobre derechos y deberes en salud inscritos en la Constitución Política, en el Sistema General de Seguridad Social colombiano y en la jurisprudencia constitucional; igualmente, se indagó sobre el conocimiento de mecanismos jurídicos para acceder al derecho a la salud en el territorio nacional. Se construyeron promedios en términos de porcentaje total y por componente. Resultados: El promedio global de conocimientos fue 57,7 %, el de conocimientos generales sobre Constitución Política 39,4 % y el de conocimientos sobre el SGSSS 55,1 %. Los profesionales que reportaron mayores niveles de conocimientos fueron: hombres, especialistas administrativos, médicos, personas con mayor experiencia laboral y trabajadores del sector privado. Los egresados menores a cinco años obtuvieron menores promedios de conocimientos. Conclusiones: El nivel de conocimientos en derechos y deberes en salud entre los profesionales de medicina y enfermería en Bucaramanga fue deficiente.A pesar de que el conocimiento de estos temas es central en el desempeño de los profesionales del sector salud, se evidencia a partir de estos resultados, carencia de procesos de formación o educación continuada en el tema de derechos. Salud UIS 2013; 45 (1: 15-22


    Directory of Open Access Journals (Sweden)

    Bruno Focas Vieira MACHADO


    Full Text Available Este artigo pretende evidenciar determinados aspectos da leitura estruturalista de Benveniste sobre as fundamentações linguísticas encontradas em Freud, mais propriamente em seu texto “Sobre o sentido antitético das palavras primitivas”. Coloca-se em diálogo o artigo de Benveniste intitulado “Observações sobre a função da linguagem na descoberta freudiana” com as teorizações linguísticas apresentadas por Freud em seu texto supracitado. Busca-se, assim, uma interface entre os estudos linguísticos e psicanalíticos, problematizando a noção de língua primitiva trazida por Freud e confrontando-a com pressupostos da Linguística Estrutural defendida por Benveniste. A abordagem tecida é eminentemente teórica, buscando iluminar os pontos de divergência entre a concepção de linguagem na perspectiva de Freud e de Benveniste. Para atingir esse objetivo, buscou-se o estudo sobre a negação desenvolvida por Freud em seu texto “A negativa” e colocou-a em relação com as observações de Benveniste sobre o linguista Carl Abel, forte influência linguística no pensamento freudiano desenvolvido no texto “Sobre o sentido antitético das palavras primitivas”. Como conclusão, torna-se possível compreender que, se a língua é uma estrutura e um sistema, ela possui um caráter universal e a-histórico, o que contesta a tese freudiana sobre a existência de línguas primitivas.

  6. Consenso sobre o tratamento da dependência de nicotina

    Directory of Open Access Journals (Sweden)

    Marques Ana Cecilia P R


    Full Text Available Têm sido atribuídas à dependência de nicotina 20% das mortes nos EUA. Estudos têm mostrado que 30% a 50% das pessoas que começam a fumar escalam para um uso problemático. Nos últimos 20 anos, a educação e a persuasão não foram suficientes para promover uma mudança política, cultural e social relacionada ao comportamento de fumar. As intervenções para interromper o uso de tabaco ainda não estão integradas às rotinas dos serviços de saúde no mundo. A falta de estratégias de integração, de tempo disponível para acoplar ações assistenciais mais específicas e mesmo a percepção dos profissionais de saúde de que os tratamentos para a dependência de nicotina são pouco efetivos são algumas das barreiras apontadas. Assim, elaborar um consenso sobre a dependência de nicotina teve como objetivos: ? levantar dados epidemiológicos relevantes relacionados ao uso do tabaco no mundo e no Brasil; ? revisar as ações gerais e centrais da nicotina; ? elaborar um protocolo de triagem mínimo para serviços de atenção primária à saúde; ? recomendar diretrizes básicas de avaliação, diagnóstico e tratamento para todos os níveis de atenção à saúde em relação à dependência de nicotina; ? fornecer sugestões para a abordagem de grupos especiais de pacientes: adolescentes, gestantes, idosos, pacientes em regime de internação, obesos e pacientes com comorbidades psiquiátricas, cardiovasculares e respiratórias.


    Directory of Open Access Journals (Sweden)



    Full Text Available El propósito de este artículo es explorar el significado y los alcances de los cambios de perspectiva que a veces ocurren cuando vemos las cosas desde el punto de vista teórico, al producirse un cambio de paradigma en el conocimiento, o, si las vemos desde el uso práctico de la razón, cuando se produce un cambio en la personalidad o una "conversión". La mera cuestión sobre la posibilidad de un cambio radical de perspectiva es filosófica en un sentido profundo: sugiere la existencia de un campo de conocimiento metafísico que sería "libre" respecto de las proyecciones categoriales específicas y determinaciones que descansan en el sujeto de conocimiento, de manera que sería posible ver las cosas desde un punto de vista radicalmente diferente, uno que no sería posible sino al interior de un paradigma. Mis intuiciones son, en primer lugar, que la pregunta por la naturaleza de los cambios de perspectiva, metafísica como es, es más importante para la epistemología de lo que se ha admitido en la filosofía analítica y, en segundo lugar, que esta pregunta puede ser encarada no necesariamente al interior del marco de referencia de la metafísica, sino desde un concepto amplio de razón. En este sentido, los cambios de perspectiva pueden ser entendidos como una posibilidad que sólo puede hacerse inteligible dentro de una noción unificada de la razón, una concepción que ha sido ignorada por concepciones epistemológicas que acentúan su lado instrumental y que podemos remontar a algunos conceptos de la ontología fenomenológica que han sido re-interpretados a través de la lente de la teoría de la experiencia kantiana. Finalmente, sugiero que si miramos los cambios de perspectiva desde el punto de vista de una concepción unificada de la razón, de ello resulta una teoría del conocimiento mucho más fluida y más ligada al uso práctico de la razón que lo que se admite en las epistemologías analíticas que fueron populares durante

  8. Efeitos do exercicio agudo sobre biomarcadores sericos de ratos diabeticos

    Directory of Open Access Journals (Sweden)

    Fabio Milioni


    Full Text Available INTRODUÇÃO: As respostas ao exercício agudo dos biomarcadores, como a fosfatase alcalina (FA e a creatina quinase (CK séricas têm sido pouco investigadas em ratos diabéticos. OBJETIVOS: Verificar os efeitos do exercício físico aeróbio agudo sobre as concentrações de CK e FA, bem como, avaliar o estado hídrico em ratos diabéticos experimentais. MATERIAIS E MÉTODOS Foram utilizados ratos Wistar machos, adultos jovens, distribuídos em dois grupos: diabéticos (DA e controles (CA. O diabetes foi induzido por meio da administração de aloxana monoidratado Sigma(r (32 mg/kg de peso corporal. Duas semanas após confirmação do diabetes, ambos os grupos foram submetidos a uma sessão aguda de natação por 30 min, com carga aeróbia (4,5 % do peso corporal. Foram avaliados: glicose, hematócrito, CK, FA, albumina e a cinética de lactato durante o exercício por meio de coletas 25 µL de sangue da cauda dos animais, nos minutos 0, 10, 20 e 30 de exercício. RESULTADOS: ANOVA de dois fatores para medidas repetidas e o teste post hoc de Tukey apontaram diminuição significativa dos valores de glicemia após o exercício para o grupo DA, aumento significativo de CK pós-exercício para o grupo DA, aumento significativo de hematócrito para ambos os grupos após exercício e manutenção da FA após exercício para o grupo DA. CONCLUSÃO: O exercício agudo aeróbio foi eficiente no controle dos níveis glicêmicos de ratos diabéticos. Entretanto, deve ser aplicado com cautela, pois induziu altos valores de CK, sugerindo possíveis lesões teciduais.

  9. El puente de Brotonne sobre el Sena - Francia

    Directory of Open Access Journals (Sweden)

    Campenon, -


    Full Text Available This bridge solves the connection problem between Rouen and Le Havre. The need to preserve the maritime tradition of Rouen and to permit the heavy shipping traffic through the estuary forced a structural design which main part, 696.5 m long, consists of a 5-span triss-braced bridge. The central span, 320 m long, is the longest pre-stressed concrete span in the world. The structure also includes two access ramps. This article analyses the features and construction procedures of each element in the structure, namely: — Foundations, consisting on cylindrical piers for the main spans and piers on piles for the access ramps and viaducts. — The curved octagonal piles, creating an interesting aesthetical effect. — The deck consisting on a single monocelular girder, formed by twincore wedged, pieces, prestressed in all directions. — The tower with a constant 2.60 dimension crosswise and tapered from 4.80 to 2.84 meters lengthwise. — Tensors, prestressing, etc.

    Este puente resuelve el problema de comunicación entre Rouen y Le Havre. La necesidad de respetar la tradición marítima de Rouen y la navegación de barcos de gran tonelaje obligó a realizar una estructura cuya obra principal, de una longitud de 696,5 m, es un puente atirantado que tiene cinco tramos, de los cuales el central, de 320 m, constituye el récord del mundo de luz en hormigón pretensado. La estructura comprende, además, dos viaductos de acceso. En este artículo se hace un análisis de las características y procedimientos de construcción de cada uno de los elementos que componen la obra: — Las cimentaciones, que son columnas cilíndricas para las pilas principales, y sobre pilotes en las pilas de los viaductos de acceso. — Las pilas, de forma octogonal curvilínea, que producen un gran efecto estético. — El tablero es una viga monocelular, formada por dovelas de dos almas pretensadas en todas direcciones. — Las torres, cuya sección es


    Directory of Open Access Journals (Sweden)

    Gregorio Marañon


    Full Text Available

    Acaso en ningún otro país encuentres que la cocina tiene una escala tan diversa de matices como en la nuestra, desde el sustento rudimentario de los pastores que Cervantes comparó al de la dichosa edad dorada y Keiserling al de los habitantes de la edad de piedra, hasta los banquetes liberales y copiosos de los palacios y de los ricos labradores, que emulan al romano festín o a la generosidad de Camacho; y, en el centro de estos dos extremos, el cotidiano sustento de los más, sencillo, diverso, sabroso y pulcro, incapaz de hartar ni de aburrir, y, sobre todo esto, sazonado con patriarcal ascetismo.

    Porque no se olvide que entre nosotros, Dios vigila a los pucheros, y que el propio Altimiras, cocinero y tratadista famoso, dedicaba' sus recetas al beato Diego de Alcalá, rogándole, decía: "que dirijais mis operaciones para que, cumpliendo a vuestra imitación las obligaciones de mi estado cocineril, pueda gozar de vuestra compañía en el cielo"

    Gregorio Marañon

    Regocijemos a nuestros lectores con algunas noticias de las comidas en general y de los banquetes en particular, que nos dejó Francisco Martínez Motiño, cocinero que fue del rey Felipe III precisamente, en su "Arte de la cocina, pastelería, bizcochería y conservería", libro que se imprimió repetidas veces, pero cuya primera edición apareció en 1617, es decir, tres años antes del banquete a que se refiere el texto; suponemos que sus composiciones y recetas estarían de moda entonces: 'Tratado de cómo se ha de servir en los banquetes"...

  11. Algo sobre arte y literatura Something about Art and Literature

    Directory of Open Access Journals (Sweden)

    Alba Teresita Estrada Molné


    Full Text Available Este trabajo (i tiene como propósito divulgar el producto terminado del primero de los tomos o secciones derivados del Proyecto “Cultura para la Enseñanza del Inglés como Lengua Extranjera”. Dicha Sección consta de dos capítulos; el primero, un Panorama General del Arte y la Literatura Universal, Latinoamericano y Cubano. El segundo, orientaciones metodológicas, ejercicios y tipos de proyectos de utilización de factores y personalidades artísticos y literarios en el proceso formativo idiomático de los estudiantes. Para llevar a cabo este trabajo se han utilizado el análisis de texto, estudio de bibliografía clásica y actual, búsqueda de datos en Internet y Enciclopedias. En el trabajo metodológico se ha tenido en cuenta el enfoque Comunicativo para orientaciones, ejercicios y proyectos. Se concluye que este material está listo para su publicación y que es herramienta importante en manos del profesor de Lengua Extranjera. Se impartió curso de postgrado sobre los contenidos de esta secciónThis work has a purpose to spread the finished product of the first of the volume or sections derived of the Project “Culture for Teaching of English as Foreign Language”. This Section consist of two chapters; the first one is a General Panorama of the Art and the Universal, Latin American and Cuban literature; and the second one are methodological orientations, exercises and types of projects of use of factors and artistic and literary personalities in the process of the language formation. To carry out this work the text analysis they have been used, study of classic and current bibliography, search of data in Internet and Encyclopaedias. In the methodological work it has been kept in mind the Talkative focus for orientations, exercises and projects. The authors conclude that this material is clever for its publication and that it is important tool in the professor's of Foreign Language hands. Post grade course was imparted about the

  12. Tesis sobre la lingüística del hablar

    Directory of Open Access Journals (Sweden)

    Evgenia Vucheva


    Full Text Available Normal 0 21 false false false ES X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} El artículo presenta un programa para la descripción del lenguaje en sus principales dimensiones ontológicas: la designación, el significado y el sentido. Se exponen de forma concisa los tres planos semánticos del hablar (universal, histórico e individual, así como las unidades y categorías que les corresponden. Asimismo se establecen las respectivas delimitaciones teóricas y metodológicas para su estudio sistemático. Nuestro objetivo principal es trazar las pautas hacia la descripción del hablar como actividad humana compleja, como el producto de la interacción de fenómenos cognitivos, lingüísticos y psicosociales. En este sentido, el trabajo es un intento de buscar el programa integral, elaborado sobre una base lingüística, para trazar las posibles vías hacia una concepción coherente del hablar como fenómeno humano singular, de naturaleza pluridimensional, pero al mismo tiempo unitaria. 

  13. Recubrimientos por PVD decorativos sobre cerámicas

    Directory of Open Access Journals (Sweden)

    García, J. A.


    Full Text Available During the last years PVD coatings has been used for decorative purposes on ceramics and other substrates. Standards layers like TiN, CrN, TiCN, etc, give us the possibly of obtaining a wide range of colours, with a good mechanical, chemical properties. This paper gathers the works carried out in the Center of Advance Surface engineering of AIN during the three last years in the field of the decorative coatings. Different layer have been deposited by means of a METAPLAS 232 PVD equipment. A complete chemical and mechanical characterisation have been carried out on the different deposited layers like ultramicroindentation, scratch tests, wear resistance and GDOES.

    En los últimos años se ha venido estudiado la aplicabilidad de las técnicas de depósitos mediante métodos físicos en fase vapor (PVD, para la realización de recubrimientos sobre cerámicas y otros substratos con fines decorativos. Los recubrimientos estándar por PVD como el TiN, CrN, TiCN, etc, ofrecen la posibilidad de conseguir acabados de apariencia metálica, de una amplia gama de colores, y con buenas propiedades mecánicas y químicas, como resistencia a la abrasión, estabilidad térmica, o resistencia a la corrosión. En este trabajo se recogen las experiencias realizadas en el recubrimiento y caracterización de cerámicas decorativas, durante los tres últimos años, en el Centro de Ingeniería de Superficies de la Asociación de la Industria Navarra. Los distintos tipos de recubrimientos se han realizado mediante un equipo de PVD modelo METAPLAS 232, con seis evaporadores de arco eléctrico y sistema de limpieza iónica patentado AEGD. Los recubrimientos han sido caracterizados, tanto química como mecánicamente, empleando las más modernas técnicas tribológicas (ultramicrodureza, scrascth tests, resistencia al desgaste... y espectroscópicas óptica por descarga luminiscente (GDOES. Los resultados obtenidos muestran que las técnicas de PVD son una

  14. Consideraciones prácticas sobre la placa distalizadora Benac

    Directory of Open Access Journals (Sweden)

    Mariela González Fernández


    Full Text Available Existen muchas modalidades de tratamiento sin extracciones de la maloclusión de clase II. Una de ellas consiste en convertir la relación molar de clase II en una de clase I mediante el desplazamiento de los molares superiores hacia distal en las etapas iniciales del tratamiento. Este procedimiento resulta interesante y controvertido, ya que desplaza los dientes en contra de la tendencia normal de movimiento mesial que muestran durante toda la vida, y en la actualidad ha ganado interés. Prestigiosos investigadores han comenzado a profundizar en ella y han aparecido técnicas intraorales, en su mayoría fijas, muy novedosas, con materiales cada vez más efectivos. Todos estos aparatos son efectivos distalizadores, pero crean incomodidad al paciente, dificultan la higiene bucal y, lo más importante, son muy costosos. Por lo antes expuesto, se decidió realizar este trabajo, con el objetivo de ampliar los conocimientos que se tiene sobre la placa distalizadora Benac, un aparato intraoral removible, su modo de construcción y las ventajas de su uso. Se concluye que esta placa no solo resulta de muy bajo costo, sino que además permite una higiene bucal correcta, es más aceptada por el paciente y logra resultados similares a los alcanzados con técnicas más modernas.There are many variants of non-extraction treatment of class II malocclusion. One of these variants consists of turning class II into class I molar relation through the displacement of upper molar to distal position at the initial stages of the treatment. This procedure is interesting but controversial since it moves teeth contrary to the normal mesial movement that they show during the whole life. However, this method has aroused the interest of prestigious researchers who have begun to delve into its application, so novel and mostly fixed intraoral techniques that use increasingly effective materials have emerged. All these appliances are effective distalizers but bother the

  15. La Leche: consideraciones sobre la higiene y la alimentacion

    Directory of Open Access Journals (Sweden)

    Gonzalo Luque Forero


    Full Text Available

    I. De acuerdo con estudios realizados en las Universidades Nacional y de los Andes y la Secretaría de Salud, un alto porcentaje de las leches que se consumen en el Distrito Especial, presentaron adulteraciones y deficiente calidad fisicoquímica y microbiológica.

    Un bajo porcentaje cumplió con todas las normas del Ministerio de Salud y se trata de Plantas que reciben y procesan leches de hatos, en donde las instalaciones, la alimentación, la sanidad, la calidad genética y la producción
    están a la altura de los países industrializados.

    II. El consumo de leche en el país es bajo y no alcanza los niveles recomendados por los organismos de Salud.

    III. La leche es susceptible de contaminarse por la ignorancia, negligencia, prácticas fraudulentas o el empleo de técnicas inadecuadas en su procesamiento, transporte, conservación, comercialización e industrialización.

    IV. Se plantean interrogantes sobre la presencia en la leche, de residuos de antibióticos, pesticidas, hormonas, tranquilizantes, compuestos inorgánicos y la forma como puedan estar afectando la salud humana.

    V. La contaminación cada vez mayor del ambiente, el rápido transporte de los alimentos; sus técnicas de elaboración, los cambios en los hábitos alimentarios, han aumentado los peligros de enfermedades que se pueden trasmitir por los alimentos.

    VI. La Salud depende en buena parte de la alimentación y si los alimentos de origen animal son medios de propagación de agentes patógenos y tóxicos, la respuesta a este interrogante no es solamente cómo aumentar la producción, sino cómo alimentar una población afectada por pobreza y desnutrición con alimentos sanos.

  16. Aspectos relevantes sobre tuberculose para profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Alexandre Daronco


    Full Text Available A Tuberculose (TB é uma patologia infectocontagiosa com clínica ampla cujo agentecausador é o Mycobacterium tuberculosis (Bacilo de Koch, uma micobactéria aeróbia estrita. Apesar de tratar-se dedoença antiga, que acomete seres humanos há séculos, sendo uma importante causa de morte no mundo inteiro,diferentes pesquisas do Ministério da Saúde apontam números preocupantes no tocante a novos casos. Materiais eMétodos: O presente artigo de revisão procura, de forma objetiva e clara, explicitar os principais aspectos de interessepara profissionais de saúde no tocante a Tuberculose doença. O artigo divide-se em tópicos: Defi nição, Sintomatologia,Diagnóstico, Tratamento, Multirresistência, Profi laxia, Formas de Contágio e Formas de Prevenção. Foram utilizadasreferências atuais sobre o tema, incluindo Manuais, Guidelines e Artigos científicos diversos de bases de dados comoUp to Date e Science Direct. Discussão: Sinais e sintomas da doença aumentam o grau de suspeição da mesma, oque torna o pedido de exames para confirmação da infecção dentro de tempo hábil para instituição da terapêuticaadequada. Assim como diagnóstico e tratamento, medidas para evitar o contágio, em serviços de saúde, locaiscom aglomerações humanas e em residências, são de fundamental importância no combate a tuberculose. Osprofissionais de saúde devem atentar para possíveis casos de resistência aos fármacos e as indicações de profilaxia,pois tais variáveis são de extrema relevância no controle da disseminação da doença. Conclusão: Por tratar-se dedoença infecciosa que pode acometer todas as classes sociais, além de possuir formas diferentes de acometimento,o conhecimento básico acerca da Tuberculose é deveras imprescindível em serviços de saúde, desde a atençãoprimária até os centros de saúde com alta tecnologia.

  17. El primer centro nacional de debate sobre medicina familiar

    Directory of Open Access Journals (Sweden)

    Félix J. Sansó soberats


    Full Text Available El presente trabajo constituye el texto íntegro de la relatoría del I Centro Nacional de Debate sobre Medicina Familiar organizado por la UJC y realizado en la Facultad de Ciencias Médicas de Cienfuegos el día 3 de febrero de 1995. En este documento se presentan los principales criterios expresados por los más de 300 delegados que asistieron a aquel evento, entre los que estuvieron estudiantes de medicina y enfermería, enfermeras y licenciadas en enfermería relacionadas con la atención primaria, médicos recién graduados, residentes y especialistas en MGI; así como también responsables del plan, administrativos y políticos, a diferentes niveles. Esta relatoría constituye un interesante material, que nos expone la situación de la medicina familiar en Cuba en la primera mitad de la década de los 90. Su estudio permite comparar la situación de entonces con cualquier época anterior o posterior de la salud pública cubana, y evidencia el desarrollo alcanzado hasta hoy. Muestra, incluso, que algunas de las ideas expuestas en aquel encuentro constituyen aún verdaderos anhelos; y por tanto, cuánto se puede avanzar en el permanente empeño de perfeccionar nuestro modelo de Medicina Familiar.The present paper constitutes the full text of the Report of the First National Center of Debate on Family Medicine, organized by the Young Communist League and carried out in the Medical School in Cienfuegos province on February 3rd, 1995. This document set forth the main criteria stated by over 300 delegates participating in the event, among them medical and nursing students, nurses involved in primary health care, physicians who has just graduated, residents and Comprehensive General Medicine specialist as well as administrative and political representatives in charge of the plan at different levels. This report is an interesting material that shows the situation of family medicine in Cuba from the first half of the 90’s. The study of this

  18. Algunas reflexiones sobre Gaia, evolución y cultura

    Directory of Open Access Journals (Sweden)

    Pou Royo, Antonio


    Full Text Available Not available

    Durante los viajes que James Lovelock realizó por todo el mundo, rastreando el DDT y otros componentes traza con su invento del detector de captura de electrones, le llamó la atención la interconectividad química de toda la atmósfera con los seres vivos y su gran estabilidad, lo que le llevó a la concepción de una nueva teoría, la hipótesis Gaia, que él define como «Una nueva visión de las interacciones entre las partes vivas e inorgánicas del planeta. De ahí ha surgido la hipótesis, el modelo, en el cual la materia viva, el aire, los océanos y la superficie terrestre forman un sistema complejo que puede ser visto como un único organismo y que tiene la capacidad de mantener nuestro planeta como un lugar apto para la vida». Lyn Margulis, la conocida bióloga, dotó a la hipótesis de una base científica que la dio credibilidad, pero en mi parecer el éxito de la teoría entre el gran público radica más en la elección del nombre «Gaia», la antigua madre-diosa griega, y su posible connotación religiosa, que no en su aportación científica. El mismo Lovelock da pie a esa interpretación cuando afirma «... para mí, Gaia es un concepto religioso y científico a la vez, y es manejable en ambas esferas», aunque en otros momentos ha intentado matizar «De ningún modo veo a Gaia como un ser consciente, un Dios alternativo. Para mí Gaia está viva y es parte del universo inefable y yo soy una parte de ella». Desde el mundo científico se acepta mal esa ambivalencia y todavía hay quienes arquean las cejas al oír hablar de Gaia. Sin embargo la hipótesis ha facilitado un nuevo marco de referencia en el que ahora caben perspectivas más amplias e interesantes, como la simbiogénesis que propone Margulis. En el continuo debate sobre la evolución, y desde el punto de vista de su éxito social, es casi inevitable tratar de comparar Gaia con el evolucionismo de Darwin, aunque Lovelock se declara cien por

  19. Efectos del entrenamiento con vibraciones mecánicas sobre la ‘performance’ neuromuscular

    Directory of Open Access Journals (Sweden)

    Marzo Edir Da Silva


    Full Text Available Hace ya varias décadas que se estudian los efectos de las vibraciones sobre el organismo humano. En un principio se evaluaban estos efectos con respecto a patologías producidas por la exposición prolongada de tipo ocupacional. Sin embargo, se empezaron a hacer estudios sobre el posible beneficio de la aplicación de la vibración en deportistas y a la luz de los primeros hallazgos se concluyó que se producía una mejora en la flexibilidad. Fue el ruso Nazarov quien realizó esos primeros estudios con atletas, aplicando una vibración local. Poco a poco fueron surgiendo diversos estudios sobre la vibración local o aplicada a todo el cuerpo (WBV pero en otras variables como son la fuerza, la potencia y la capacidad de salto. A pesar de que no hay un consenso en la aplicación de protocolos de entrenamiento y los resultados que se obtienen, el entrenamiento con WBV está en auge porque parece ofrecer unos resultados benéficos de manera más rápida que el entrenamiento convencional. El propósito del presente artículo es realizar una revisión bibliográfica sobre la evolución del entrenamiento de WBV con sus aplicaciones y efectos sobre la performance muscular.

  20. Investigación sobre el cotidiano del sujeto: oportunidades para una ciencia aplicada

    Directory of Open Access Journals (Sweden)

    Manuel Amezcua


    Full Text Available Desde un modelo de investigación emergente, la Investigación Aplicada a los Cuidados, se propone reflexionar sobre una de las áreas de indagación: la Investigación sobre el Cotidiano del Sujeto. El cotidiano del sujeto se conceptualiza como un espacio de interacción social donde las personas ejercen autonomía para tomar decisiones y ejecutar acciones para cuidar su salud. A través de diseños principalmente cualitativos, la Investigación sobre el Cotidiano del Sujeto aporta evidencias útiles y pertinentes para la práctica enfermera porque hablan del contexto y desde la perspectiva de los sujetos. Estas evidencias pueden encuadrarse en cuatro grandes dimensiones: la comprensión del padecimiento humano ante la enfermedad, la cultura del cuidado, la percepción sobre las intervenciones en salud, y el cotidiano del cuidador. Finalmente se plantean algunos desafíos que nos propone la Investigación sobre el Cotidiano del Sujeto e implican tres dimensiones imprescindibles en el ejercicio del cuidado: la dimensión ética, política y científica.

  1. Reflexões sobre biopoder e pos-colonialismo: relendo Fanon e Foucault

    Directory of Open Access Journals (Sweden)

    Cunha Olívia Maria Gomes da


    Full Text Available Autores como Michel Foucault e Franz Fanon têm figurado de forma influente tanto em estudos sobre questões relativas a estratégias de poder e representação em contextos pós-coloniais, quanto em debates e análises de ordem teórica sobre pós-colonialismo. Particularmente, as noções de biopoder e governamentalidade, originárias do pensamento de Foucault, e as reflexões de Fanon sobre a construção de formas de subjetivação racializadas e coloniais, têm ensejado um amplo debate sobre a permanência e circulação de retóricas raciais transnacionais. Através da leitura de David Scott, em Refashioning Futures - Criticism after Postcoloniality (1999, e Paul Gilroy, em Against Race - Imagining Political Culture beyond the Color Line (2000, este ensaio procura identificar a pertinência da combinação de ambos os autores em estudos que, de forma distinta, se debruçam sobre a complexa relação entre corpo e modernidade e suas implicações nos campos político e intelectual contemporâneos.

  2. Aspectos biológicos y poblacionales de Nasonovia ribisnigri y Aulacorthum solani sobre lechuga

    Directory of Open Access Journals (Sweden)

    Vasicek Araceli


    Full Text Available Se estimó la influencia de los cultivares Criolla Blanca, Cuatro Estaciones y Gallega, sobre la biología y los parámetros poblacionales de Nasonovia ribisnigri y Aulacorthum solani (Homoptera: Aphidoidea a 10±1ºC y HR de 90%. Los períodos ninfal, pre-reproductivo y post-reproductivo de N. ribisnigri fueron más largos sobre Cuatro Estaciones, no así el reproductivo. En A. solani el período ninfal fue más largo sobre Criolla Blanca y Cuatro Estaciones resultando el reproductivo mayor sobre Cuatro Estaciones. Las tasas intrínsecas de crecimiento natural (r m de N. ribisnigri y A. solani fueron mayores sobre Criolla Blanca y Gallega, respectivamente. De acuerdo a la especie predominante convendría utilizar Cuatro Estaciones para N. ribisnigri y Criolla Blanca para A. solani, en épocas frías.

  3. As opinioes dos brasileiros sobre ciencia e tecnologia: o paradoxo da relacao entre informacao e atitudes

    Directory of Open Access Journals (Sweden)

    Yurij Castelfranchi


    Full Text Available Em muitos debates sobre as relações entre ciência e sociedade, em particular quanto à aceitação das tecnologias ou à percepção de seus riscos, existe uma hipótese subjacente: a de que a ignorância gera medo, e o medo gera desconfiança ou hostilidade contra a ciência e a tecnologia. Neste artigo mostramos que essa hipótese é questionável. Com base numa recente enquete nacional, apontamos que atitudes otimistas sobre ciência e tecnologia não dependem do nível escolar ou da informação declarada ou acessada pelas pessoas sobre o tema. Indivíduos com escassa informação possuem, em geral, atitudes positivas. Pessoas com maior escolaridade e acesso à informação possuem atitudes diversificadas, otimistas sobre alguns aspectos, porém mais críticas sobre outros.

  4. Cultura y compromiso afectivo: ¿influyen sobre la transferencia interna del conocimiento?

    Directory of Open Access Journals (Sweden)

    Aurora Irma Máynez Guaderrama


    Full Text Available En la nueva economía el conocimiento se reconoce como un activo estratégico, y su transferencia se destaca como una actividad relevante. Por ello, en este trabajo de investigación se examina la influencia de la cultura or ganizacional y del compromiso afectivo sobre la transferencia interna de conocimiento en la empresa; además, se analiza si la cultura de la organización influye significativamente sobre el compromiso afectivo. P ara ello, se llevó a cabo una investigación transversal en una muestra no probabilística de 342 sujetos que laboran en el sector industrial localizado en la frontera norte de México. El análisis estadístico se realizó a través de un modelo de ecuaciones estructurales. Los resultados confirman que la cultura organizacional incide positiva y significativamente sobre la transferencia interna de conocimiento y sobre el compromiso afecti vo. Asimismo, la evidencia empírica apunta que el compromiso afectivo no influye sobre la transferencia interna de conocimiento.

  5. Sistema de Pesquisaje Auditivo con PEAee sobre PDA

    Directory of Open Access Journals (Sweden)

    María del Carmen Hernández Cordero


    Full Text Available Normal 0 21 false false false ES-TRAD X-NONE X-NONE MicrosoftInternetExplorer4 st1:*{behavior:url(#ieooui } /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} El pesquisaje auditivo de todos los recién nacidos (universal constituye  una meta en salud a nivel mundial. Aunque existen técnicas fiables y efectivas para el pesquisaje, estas tienen limitaciones y pueden perfeccionarse. En los últimos años los Potenciales Evocados Auditivos de Estado Estable a Múltiples Frecuencias (PEAee MF se han propuesto como una alternativa efectiva para la evaluación de la audición a edad temprana y como método de detección. Sin embargo los equipos de PEAee existentes no están concebidos para su uso en la maternidad, tienen una interface con el usuario relativamente compleja y requieren conocimiento experto para su empleo adecuado. Con el objetivo de facilitar el uso del PEAee MF como método de pesquisaje, se diseño un equipo automático de pesquisaje auditivo. El equipo cuenta con dos unidades: una PDA (Personal Digital Assistant que recibe de manera inalámbrica la respuesta y un equipo registrador/estimulador, incorporando una nueva forma de estimulación auditiva. El presente trabajo describe el programa de cómputo sobre PDA y el algoritmo de funcionamiento que se desarrollo para este equipo. El sistema


    Directory of Open Access Journals (Sweden)

    Alberto Cardenas Escovar


    Full Text Available

    Presentadas en el Foro sobre Etica Médica de la 3a. Conferencia Médica Latinoamericana. celebrada en Santiago, Chile. con ocasión de la VII Reunión del Consejo Directivo de la Asociación Latinoamericana de Academias Nacionales de Medicina. Octubre 20 a 24 de 1981.

    En Diciembre del año pasado tuve el honor de representar a la Asociación Latinoamericana de Academias Nacionales de Medicina, por invitación de la Academia de Medicina de México y del Consejo Internacional de Organizaciones de las Ciencias Médicas (CIOMS, en la XIV MESA REDONDA que esta última organización celebró en la ciudad de México, y cuyo tema fue "La Etica Médica y La Educación Médica".
    Veintitrés países de América, Africa, Asia y Europa participaron en este encuentro. De la América Latina, estuvieron representados Argentina, Brasil, Colombia, Chile, México y Venezuela.
    Presidieron la conferencia Alfred Gelhorn (Director, Centro de Educación Biomédica, City College de Nueva York y Murillo Belchior (Presidente de CIOMS y del Consejo Federal de Medicina, Río de Janeiro, Brasil.

    De los tres capítulos estudiados, "Revisión Etica de la Investigación Clínica", "La Etica en la Educación Médica" y "Educación Médica y Gobierno", cabe destacar aquí los principios generales tilosóficos y de metodología, ya que los aspectos particulares relativos a problemas específicos de investigación, diagnóstico y tratamiento, tales como la manipulación genética, la fecundación in vitro, el control de la natalidad, la eutanasia, los
    transplantes, los nuevos medicamentos, etc., ya habían sido analizados en anteriores mesas redondas de CIOMS (París 1972, Ginebra 1973.
    Santiago Pavlovsky (Jefe, Departamento de Oncohematología, Instituto de Investigaciones Hematológicas, Buenos Aires, Argentina se refiere a la orientación de la investigación en la Argentina, donde una auténtica escuela ha estado

  7. Contabilidade ambiental: um estudo sobre sua aplicabilidade em empresas Brasileiras

    Directory of Open Access Journals (Sweden)

    Adalto de Oliveira Santos


    Full Text Available A globalização da economia e a conscientização da sociedade estão forçando, atualmente, as empresas a adotarem uma postura responsável perante o meio ambiente, isto é, produzir sem agressão à natu-reza.Para isto elas estão implantando um Sistema de Gestão Ambiental de acordo com as normas da série ISO 14000. Fazer este gerenciamento exige a aplicação de um considerável montante de recursos financeiros, devendo-se ter constante preocupação em controlá-los. En-tende-se que a contabilidade é uma das ferramentas mais eficientes e eficazes para este processo. Observa-se, no entanto, que poucas empresas, no Brasil, utilizam a contabilidade na sua gestão ambiental. Portanto, o principal objetivo da realização deste estudo é verificar qual o grau de desenvolvimento da Contabilidade Ambiental nas empresas brasileiras. Após uma revisão bibliográfica sobre o tema, foi elaborada uma pesquisa de campo que consistiu no envio de um questionário aos departamentos de contabilidade de indústrias potencialmente poluidoras. O universo compreendeu as empresas listadas no guia "As 500 maiores empresas do Brasil", edição 2000, da revista Exame; e a amostra foi de 50 empresas cujo faturamento, em 2000, ultrapassou US$ 50 bilhões.The globalization of the economy and the awareness of the society are forcing, currently, the companies to adopt a responsible position before the environment, that is, to produce without aggression the nature. For this they are implanting a System of Environmental Management in accordance with the norms of series ISO 14000. To make this management demands the application of a considerable sum of financial features, having itself to have constant preoccupation in controlling them. One understands that the accounting is one of the efficient tools most for this process. It is observed, however, that few companies, in Brazil, use the accounting in its environmental management. Therefore, the main objective of the

  8. Las batallas de Kuruyuki. Variaciones sobre una derrota chiriguana

    Directory of Open Access Journals (Sweden)


    Full Text Available Les batailles de Kuruyuki. Variations sur une défaite chiriguana Résumé: Kuruyuki est la dernière bataille qui a opposé, en 1892, une partie des Chiriguanos du Chaco bolivien contre les blancs. Elle marqua, pour les gens de l’époque, la fin de cette ethnie. Après un long silence sur ce thème, de la part des historiens comme des Chiriguanos eux-mêmes, les études se multiplient à partir de 1972, et avec elles les différentes explications, justifications et récupérations de l’événement. Crépuscule, suicide ou résurrection, union sacrée ou résultat de dissensions internes : l’histoire de Kuruyuki est, dans une large mesure, l’histoire de ses histoires. On analyse ici ces différentes histoires, en fonction de qui écrit ou parle, quand, et mû par quels intérêts immédiats. Théories anthropologiques, mouvements indiens et régionalismes sont quelques-uns des facteurs qui contribuent à les dessiner. Kuruyuki es la última batalla que enfrentó, en 1892, a una parte de los chiriguanos del Chaco boliviano con los blancos. Marcó, para la gente de la época, el fin de esta etnia. Después de un largo silencio sobre el tema, tanto de parte de los historiadores como de los mismos chiriguanos, los estudios se multiplican a partir de 1972, y con ellos las diferentes explicaciones, justificaciones y recuperaciones del acontecimiento. Ocaso, suicidio o resurrección, unión sagrada o resultado de discordias internas: la historia de Kuruyuki es, en gran medida, la historia de sus historias. Se analizan aquí estas diferentes historias, en función de quién escribe o habla, cuándo, y movido por cuáles intereses inmediatos. Teorías antropológicas, movimientos indígenas y regionalismos son algunos de los factores que contribuyen a moldearlas. The Battles of Kuruyuki. Variations on a Chiriguano defeat Abstract: The battle of Kuruyuki, in 1892, was the last time in which part of the Chiriguano of the Bolivian Chaco fought against

  9. Perspectivas sobre el desarrollo económico localizado

    Directory of Open Access Journals (Sweden)

    A. H. J. (Bert Helmsing


    Full Text Available La creciente movilidad de la producción y de los factores de producción puede haber generado una reversión de la polarización. Sin embargo, el desarrollo económico se localiza crecientemente en aglomeraciones económicas. La globalización es un fenómeno muy localizado. El propósito de este artículo es revisar tres perspectivas parcialmente sobrepuestas sobre el desarrollo económico local. Estas perspectivas corresponden en gran medida a tres factores que refuerzan la naturaleza localizada del desarrollo económico, es decir externalidades, aprendizaje colectivo y gobernabilidad. Las externalidades se refieren a fenómenos conocidos asociados con aglomeración. Más nuevo es el hecho de que constituyen una fuente de retornos crecientes. Se revisará esta nueva escuela de economía geográfica. Al mismo tiempo surgió una nueva geografía económica en base a agrupamientos y distritos industriales. Las externalidades se extienden y cambian de forma. La dinámica del desarrollo económico local puede ser vista desde la perspectiva de la economía evolucionaria. El aprendizaje en general y el aprendizaje colectivo en particular son conceptos centrales a nivel de las empresas y también a nivel de las instituciones territoriales. El aprendizaje aumenta y renueva las competencias locales para formular e implementar políticas económicas. La complejización de las relaciones entre empresas y entre empresas e instituciones territoriales es una fuente importante de sinergias y economías externas pero requiere nuevas formas de gobernabilidad, tanto a nivel industrial como territorialThe growing mobility of production and production factors could have contributed to a polarization reversal. However, it appears that economic development is increasingly localized in economic agglomerations. Globalization is a localized phenomenon. The purpose of this article is to review three partially overlapping perspectives on local economic development

  10. Decisões judiciais sobre acesso aos medicamentos em Pernambuco

    Directory of Open Access Journals (Sweden)

    Artur Stamford


    Full Text Available OBJETIVO: Analisar as decisões do sistema jurídico sobre acesso da população a medicamentos no Sistema Único de Saúde por via judicial quanto a critérios de decisão e eventuais pressões políticas e econômicas. MÉTODOS: Estudo documental descritivo e retrospectivo de abordagem qualitativa e quantitativa. A coleta de dados foi realizada na Superintendência Estadual de Assistência Farmacêutica de Pernambuco, utilizando-se como fontes de dados 105 ações judiciais e relatórios administrativos de janeiro a junho de 2009. Verificaram-se os medicamentos com pedido ou carta patente no banco de dados do Instituto Nacional de Propriedade Industrial para identificar a frequência das patentes nas ações judiciais. Os dados obtidos foram classificados conforme o Sistema Anatômico Terapêutico Químico. Para análise das decisões judiciais, foi utilizada a teoria dos sistemas sociais autopoiéticos. RESULTADOS: As ações judiciais somaram 134 medicamentos com valor estimado de R$ 4,5 milhões para atender aos tratamentos solicitados; 70,9% dos medicamentos estavam com carta patente ou pedido e se concentraram em três classes terapêuticas: antineoplásicos e moduladores imunológicos, aparelho digestório e metabolismo, órgãos dos sentidos. Foram identificadas seis ideias centrais com os critérios de decisão dos magistrados (Constituição Federal e prescrição médica e as pressões entre os sistemas do direito, da economia e da política quanto ao acesso a medicamentos. CONCLUSÕES: A análise das decisões judiciais fundamentadas na teoria dos sistemas sociais autopoiéticos permitiu identificar as estimulações mútuas (dependências entre o sistema do direito e demais sistemas sociais em relação à questão do acesso dos cidadãos aos medicamentos. Essas dependências foram representadas pela Constituição Federal e pela propriedade intelectual. A Constituição Federal e a prescrição médica foram identificadas como


    Directory of Open Access Journals (Sweden)

    Liz Abad MAXIMIANO


    Full Text Available A noção de paisagem acompanha a existência humana desde o início, uma vez que a sobrevivência dos seres humanos sempre dependeu de sua relação com o meio. Entretanto, a formulação de um conceito de paisagem ocorreu ao longo de muito tempo, começando a se manifestar mais claramente a partir das observações de pintores, artistas e poetas, tanto do Oriente quanto no Ocidente. Na Antigüidade o ambiente fora do controle humano era olhado com desconfiança e entendido como elemento hostil, daí serem construídos jardins fechados para lazer, contemplação ou plantio de algumas espécies. No Ocidente, a partir de Humboldt, iniciam estudos mais sistemáticos que levariam à compreensão de paisagem como resultante de um complexo de interações entre elementos naturais e humanos. Contudo, ainda haveria discussões sobre o conceito e o método de abordagem da paisagem, passando por ênfases nos aspectos geomorfológicos, biológico ou ocupação humana de um espaço. Em meio a tendências à especialização da década de 60, Bertrand, geógrafo francês, descartou que paisagem fosse uma simples junção de elementos geográficos; antes definiu-a como “combinação dinâmica, instável, dos elementos físicos, biológicos e antrópicos.” Na Geografia ocidental contemporânea paisagem é entendida como produto visual de interações entre elementos naturais e sociais que, por ocupar um espaço, pode ser cartografada em escala macro ou de detalhe, e classificada de acordo com um método ou elemento que a compõe. Paisagem não é o mesmo que espaço, mas parte dele; algo como um parâmetro ou medida multidimensional de análise espacial. Considerations about landscape concept Abstract Conceptions about landscape come together in human life, since mankind’s existence has always depended on his relationship with nature. However, the expression of a landscape concept took some time, and its first concrete manifestation came through arts, both

  12. Algunas consideraciones sobre la ética en el mercado

    Directory of Open Access Journals (Sweden)

    Montserrat Díaz Méndez


    Full Text Available La desconfianza generalizada hacia los dirigentes empresariales refuerza la importancia de la ética en la empresa, tanto en el ámbito meramente teórico-académico cuanto en la aplicación práctica de determinados principios morales a las actividades mercantiles. La responsabilidad social corporativa o empresarial es una concreción de la ética consistente en la asunción voluntaria por parte de las empresas de determinados comportamientos que implican una serie de obligaciones en su ámbito interno y externo. Se discute la necesidad o no de establecer por ley el contenido de la responsabilidad social corporativa y, por tanto, exigir su cumplimiento.Mantener su carácter voluntario no significa que el Estado no pueda establecer unas directrices claras sobre la dimensión social de las empresas, así como su implicación en la sociedad en la que viven y las ventajas para aquellas empresas que lo respeten. Los códigos éticos son un intento normativizador de la ética, que suponen un beneficio para el estado, ya que no se ve obligado a tener que producir normas de derecho positivo y crear sus correspondientes mecanismos de control de conflictos. Por su importancia económica, una especial atención ha merecido la regulación ética de las sociedades cotizadas. En cualquier caso, hay que concienciar de la necesidad de un comportamiento ético basado en la bondad y la justicia, partiendo de que quien actúa éticamente lo hace por convencimiento.The general distrust towards top management decisions has reinforced/ stressed the importance of business ethics. Social Corporate Responsibility (SCR is an specific aspect of ethics. It implies the voluntary assumption of certain behaviours and values which may involve several obligations for the company that will affect it as a whole. Nowadays, there exists a discussion about the need of whether establishing or not a law on the content of fulfillment. In this sense, it is important to consider that

  13. A pesquisa no ensino, sobre o ensino e sobre a reflexão dos professores sobre seus ensinos The research in teaching, on teaching and on the teachers' reflection about their teaching

    Directory of Open Access Journals (Sweden)

    Anna Maria Pessoa de Carvalho


    Full Text Available Este texto busca mostrar o trabalho desenvolvido no LaPEF (Laboratório de Pesquisa e Ensino de Física, no qual professores do ensino fundamental e médio que vêm trabalhando conosco no contexto dos projetos Fapesp/Escola Pública, pesquisadores que fazem seus mestrados e doutorados e professores da Faculdade de Educação da USP desenvolvem pesquisas no ensino, sobre o ensino e sobre a reflexão dos professores sobre seus ensinos, isto é, sobre formação de professores. Essas três modalidades de pesquisa foram se desenvolvendo a partir da seguinte questão: como o ensino que planejamos, com os pressupostos teóricos que escolhemos, baseados em resultados de pesquisas que já realizamos, estão modificando os alunos? Os problemas que dão origem às pesquisas no ensino são percebidos pelos professores durante as aulas nas escolas públicas e depois são debatidos e transformados em questões de investigação, por esse mesmo grupo, em discussões coletivas no LaPEF. As pesquisas sobre o ensino estão sendo elaboradas por mestrandos e doutorandos a fim de verificar algumas variáveis importantes para o desenvolvimento desse ensino. A diferença fundamental entre esses dois tipos de pesquisas não está em quem a faz, mas nos objetivos que pretendem alcançar. As pesquisas sobre a reflexão dos professores sobre o ensino abordam a problemática da formação continuada dos professores. Esse artigo pretende enfocar como esses três níveis de investigações se inter-relacionam, quais as semelhanças e diferenças entre eles, descrevendo principalmente os objetivos de cada um dos grupos e como esses definem diferentes problemas com distintas estruturas de coleta e análise de dados.This text expounds the work carried out at the LaPEF - Laboratory for the Research and Teaching of Physics - where elementary and high school teachers which have been working with us in projects of the FAPESP/Public School program, graduate students, and teachers

  14. La literatura sobre la industrialización colombiana: Balance y perspectivas

    Directory of Open Access Journals (Sweden)

    Paulo César León Palacios


    Full Text Available Este artículo presenta una revisión extensa y analítica de la literatura producida sobre el tema de la industria en Colombia, a través de los ámbitos teórico, metodológico y gnoseológico. Es una referencia necesaria tanto para expertos, en tanto propone un debate global y crítico sobre el tema, como para estudiantes o investigadores que deseen tener una visión panorámica del estado del arte sobre la industrialización sin tener que sumergirse más de lo necesario.

  15. Cultura e Diversidade. Considerações sobre a multiplicidade das manifestações

    Directory of Open Access Journals (Sweden)

    Milton Araújo Moura


    Full Text Available A diversidade cultural é hoje um tema estabelecido no contexto internacional das discussões sobre contemporaneidade. A questão fundamental deste artigo é a forma como as manifestações culturais podem ser produzidas, reconhecidas e legitimadas em termos de sua diversidade. Neste sentido, colocam-se elementos para perceber como esta problemática tem amadurecido no campo dos Estudos Culturais e, mais especificamente, na reflexão sobre o turismo cultural. Em seguida, a discussão é contextualizada em termos de Brasil. Após várias décadas em busca de nuclearidades de uma cultura brasileira, hoje se coloca, de preferência, o desafio de considerar a complexidade e multiplicidade desta formação. Finalmente, colocam-se alguns questionamentos mais radicais sobre a diversidade cultural.

  16. Psicoanálisis y ciencia: puntuaciones sobre una relación necesaria, aunque imposible

    Directory of Open Access Journals (Sweden)

    Ximena Castro


    Full Text Available El discurso científico ocupa hoy un lugar hegemónico cuando se trata de explicar prácticamente todos los fenómenos ligados a la existencia humana. El psicoanálisis lacaniano provee algunas claves que contribuyen a la configuración de un pensamiento crítico sobre este rasgo de nuestra época, a la vez que enriquece un debate epistemológico que sigue siendo vigente y necesario. En este artículo realizo un recorrido sobre la relación psicoanálisis y ciencia, situando algunas distinciones entre la ciencia moderna, la tecno- ciencia y el cientificismo, analizando sus puntos de convergencia y divergencia con el psicoanálisis, y proponiendo interrogantes sobre las vicisitudes del sujeto en el marco de un nuevo discurso, producido por la alianza de la ciencia con el capitalismo liberal.

  17. Construcionismo social e metapsicologia: um diálogo sobre o conceito de self

    Directory of Open Access Journals (Sweden)

    Carla Guanaes

    Full Text Available O conceito de self tem sido central nas teorias da psicologia clínica, sendo difícil encontrar, neste campo, estudos que prescindam desta noção. Contudo, alguns teóricos têm questionado concepções mais conhecidas de self, apontando seu caráter construído e situado. Neste artigo, apresentamos o modo como o self tem sido descrito em algumas propostas psicanalíticas e construcionistas sociais, visando a construção de algumas diferenças entre elas. Buscamos, assim, favorecer uma aproximação de estudiosos da área clínica com o construcionismo social, entendendo que esta abordagem favorece uma reflexão sobre o próprio processo de produção de conhecimento sobre o mundo e sobre o self.

  18. La influencia del liderazgo sobre el aprendizaje. El papel mediador del contexto organizativo

    Directory of Open Access Journals (Sweden)

    Susana Pérez López


    Full Text Available En este trabajo se analiza la relación existente entre liderazgo y aprendizaje organizativo. Con apoyo en investigaciones previas, se plantea un modelo cuya premisa básica es que la relación entre ambos conceptos es directa e indirecta, en la medida en que el liderazgo influye sobre el contexto organizativo en que se desarrolla el aprendizaje. El presente modelo teórico ha sido contrastado empíricamente a partir de una muestra de 162 empresas españolas, confirmándose la influencia del liderazgo sobre la cultura organizativa y el desarrollo de las políticas de recursos humanos, factores que, a su vez, influyen sobre el aprendizaje. Sin embargo, la relación directa entre liderazgo y aprendizaje organizativo no se confirma. Las implicaciones del estudio, limitaciones y futuras líneas de investigación son discutidas en el trabajo.

  19. Algunas reflexiones sobre el tabaquismo como factor de riesgo para diferentes enfermedades

    Directory of Open Access Journals (Sweden)

    Miriam Bolet Astoviza


    Full Text Available Se realizó una revisión sobre el tabaquismo como factor de riesgo para muchas enfermedades, entre ellas, las cardiovasculares, con el objetivo de profundizar sobre los efectos perjudiciales de esta drogadicción, y para que todos los médicos se actualicen sobre el tema. Trata la magnitud del problema, enfermedades que provoca, fumadores activos y pasivos, prevención y recomendaciones.A literature review on smoking as a risk factor in many diseases, particularly, the cardiovascular diseases was made to delve into the harmful effects of this drug addiction and to update the knowledge of all the physicians on this topic. This paper deals with the size of the problem, the diseases caused, active and passive smokers, prevention and recommendations.

  20. ¿El armario está abierto?: estudios sobre diversidad sexual en El Salvador

    Directory of Open Access Journals (Sweden)

    Amaral Palevi Gómez Arévalo


    Full Text Available El presente texto tiene por objetivo analizar 39 producciones universitarias sobre diferentes temáticas de diversidad sexual producidas entre 1988 a 2015, las cuales se organizan en 4 ejes/binomios: Prácticas sexuales/Cuerpos, Matrimonio/Familias, Identidades/Prejuicios y Derechos/Ciudadanías. Al mismo tiempo se proponen nuevas temáticas para investigar y se reflexiona sobre los retos al interior de la educación superior salvadoreña para constituir un campo de Estudios sobre Diversidad Sexual. Concluyendo, a pesar de la existencia dispersa de 39 producciones universitarias, las cuales son un avance, el armario de la academia salvadoreña está aún cerrado, y por tal motivo surge la pregunta ¿cómo lo podemos abrir?