WorldWideScience

Sample records for radiologiczna mapa polski

  1. Health Information in Polish (polski)

    Science.gov (United States)

    ... Tools You Are Here: Home → Multiple Languages → Polish (polski) URL of this page: https://medlineplus.gov/languages/polish.html Health Information in Polish (polski) To use the sharing features on this page, ...

  2. MAPAS CONCEPTUALES Y DIAGRAMAS V

    Directory of Open Access Journals (Sweden)

    Marcelo Prado Amaral Rosa

    2013-09-01

    Full Text Available MOREIRA, Marco Antônio (2006. Mapas conceituais ediagramas V [Mapas conceptuales y diagramas V],  PortoAlegre: Ed. do autor. ISBN 85-904420-8-X. 103 págs.Por Marcelo Prado Amaral Rosa - UCS - Brasil

  3. De GPS al mapa

    Directory of Open Access Journals (Sweden)

    Esteban Dörries

    2016-03-01

    Full Text Available Las coordenadas Lambert obtenidas a partir de mediciones con equipos GPS de mano, llamados a veces navegadores, en ciertos casos confunden al usuario, por diferir claramente de su posición real al ser graficadas en un mapa del Instituto Geográfico Nacional (IGN: Esto puede resolverse con suficiente exactitud mediante una transformación de Molodensky, seguida de la correspondiente proyección cartográfica. Sin embargo, los tres parámetros necesarios para la transformación, supuestamente válidos para Costa Rica, se encuentran en muchas variantes y producen obviamente resultados diferentes. En este trabajo se analizan los fundamentos del problema y sus posibles soluciones, culminando con un estudio comparativo de ocho casos, que permite seleccionar los valores más adecuados para los parámetros.

  4. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

  5. Lyginamosios konstrukcijos 1647 m. Ewangelie polskie y litewskie vertime

    Directory of Open Access Journals (Sweden)

    Artūras Judžentis

    2011-12-01

    Full Text Available Comparative constructions in the translation of Ewangelie polskie y litewskie (1647SummaryThe article deals with the comparative constructions in Ewangelie polskie y litewskie (1647, a book used for Gospel readings during Catholic mass. Attention is focused on the syntactic structure of these constructions and on the semantic relations that they express. The Gospels translated by Jaknavičius (it is thought that he translated a large majority of them were carefully compared with the remaining translations thought to be done an anonymous translator, and both were compared with the originals. The conclusions are layed out as follows:1. The main types of the modifying comparative constructions in the Gospels, translated by Jaknavičius, are those introduced by the subordinator kaip. The comparative standard of these constructions usually follows the criterion; a few cases of the opposite order of constituents correspond to the original.2. The standard preposing is characteristic of the comparative constructions with correlative subordinators. This order of constituents does not always correspond to that of the Polish original; however, this discrepancy can probably be related to unique aspects particular to Lithuanian.3. Comparative constructions with the negative standard of comparison and similar contrastive constructions with the subordinator jeigi… kaip and additive (copulative constructions with the subordinator kaip(o… ir are considered to be syntactic loan-translations.4. Comparative constructions with the phrase kaip būtų functioning as a subordinator and active participles are used by Jaknavičius to express non-evidential modality.5. The construction with the correlative conjunction kuo... tuo is used in Jaknavičius’ translation to denote the  emphasis of comparison between two similar structures.6. The comparison of the constructions with the genitive of the pronoun kiekas in the function of a subordinator, and the

  6. Polskie Gornictwo Naftowe i Gazownictwo in a liberalized european market

    International Nuclear Information System (INIS)

    Kaminski, P.

    2004-01-01

    Polskie Gornictwo Naftowe i Gaxownictwo (PGNiG) is the leading operator in the Polish natural gas market. Following Poland's membership of the European Union, the company must now face up to the new challenges of a liberalized gas market. The firm is currently changing its organisational methods in order to adapt its company structure to the requirements of gas directive No. 2003/55/CE. In conformity with the European recommendations, the transportation activities have been separated off from the company structure. Work is being carried out in order to separate the company PGNiG Przesyl which is the operator of the transport system. Preparatory measures are underway in order to facilitate PGNiG's flotation on the stock market. A successful privatisation will enable the company to continue its expansion and to obtain the capital it needs to face up to its investment related expenditure. PGNiG aims to be a highly competitive company, not only in Poland but also in Europe. To achieve this, investments are being made aimed at boosting national gas extraction, which will make it possible to improve the company's competitiveness. The firm seeks to be a key player to discussions focusing on infrastructure for the transportation of natural gas towards Europe and is carrying out negotiations with partners concerning the construction of connections known as 'interconnections' between the gas pipeline systems of the respective European countries. The company's participation in the planned construction of the Bernau-Szczecin pipeline is similar in nature to the project for the delivery of compressed natural gas. (author)

  7. Członkostwo Polski w NATO jako determinanta bezpieczeństwa politycznego i militarnego

    OpenAIRE

    Jakimowicz, Robert

    2016-01-01

    Publikacja jest poświęcona ćwierćwieczu polityki zagranicznej Polski od chwili przemian ustrojowych na przełomie 1989 i 1990 r. W zebranych artykułach zostały opisane zarówno sukcesy polskiej dyplomacji, jak i wyzwania, przed którymi stoi III Rzeczpospolita na arenie międzynarodowej. Monografia składa się z czterech bloków tematycznych. Trzy pierwsze dotyczą relacji Polski z poszczególnymi regionami – Unią Europejską, Europą Wschodnią oraz krajami pozaeuropejskimi, zaś czwarty dotyczy polityk...

  8. MAPA CONCEPTUAL PARA EL APRENDIZAJE BASADO EN PROBLEMAS

    Directory of Open Access Journals (Sweden)

    YURI GORBANEFF

    2009-01-01

    Full Text Available Se presentan los resultados del experimento sobre el uso de mapas conceptuales en el contexto del aprendizaje basado en problemas (ABP. El experimento fue realizado en la Universidad Javeriana (Bogotá, Colombia en el pregrado de administración. Se encontró que el mapa conceptual mejora el aprendizaje pero no afecta la percepción de los alumnos del método de ABP. Se recomienda incluir mapas conceptuales en los ejercicios de ABP.

  9. Mapa Conceptual Para El Aprendizaje Basado En Problemas

    Directory of Open Access Journals (Sweden)

    Yuri Gorbaneff

    2009-01-01

    Full Text Available Se presentan los resultados del experimento sobre el uso de mapas conceptuales en el contexto del aprendizaje basado en problemas (ABP. El experimento fue realizado en la Universidad Javeriana (Bogotá, Colombia en el pregrado de administración. Se encontró que el mapa conceptual mejora el aprendizaje pero no afecta la percepción de los alumnos del método de ABP. Se recomienda incluir mapas conceptuales en los ejercicios de ABP.

  10. Sobre Geoestatística e mapas

    Directory of Open Access Journals (Sweden)

    Paulo Milton Barbosa Landim

    2015-06-01

    Full Text Available A Geologia, até há bem pouco tempo, era freqüentemente considerada uma ciência baseada em interpretações puramente qualitativas dos fenômenos geológicos. Nos últimos 40 anos, porém, tem sido notável a mudança da fase descritiva para a utilização de métodos quantitativos, principalmente na área da Geologia Aplicada. Entre tantos temas relacionados com a quantificação em Geologia o assunto abordado neste artigo, que pretende ser de cunho didático, diz respeito à aplicação da Geoestatística na confecção de mapas geológicos. Na primeira parte do trabalho é feita uma introdução sobre os aspectos quantitativos na interpretação dos fenômenos geológicos, em seguida conceitos básicos sobre a metodologia geoestatística e, na última parte, uma aplicação clássica da geoestatística linear, baseada nos conceitos de estacionaridade da covariância e do variograma, para a confecção de mapas.

  11. Systematyka Gleb Polski - Stan Aktualny i Dalszy Rozwój

    Directory of Open Access Journals (Sweden)

    Kabała Cezary

    2014-10-01

    Full Text Available Piąte wydanie Systematyki gleb Polski umacnia zasadę klasyfikacji gleb w oparciu o ilościowo zdefiniowane poziomy i właściwości diagnostyczne. Nowe kryteria klasyfikacji bazują na podziałach międzynarodowych, jednak jednoczesne stosowanie rozwiązań zaczerpniętych z FAO-WRB i US Soil Taxonomy albo niekonsekwentne stosowanie ustalonych definicji jest powodem wewnętrznej niespójności klasyfikacji. Dalsze doskonalenie systematyki gleb Polski powinno objąć: wybórjednego międzynarodowego systemu referencyjnego dla poziomów i właściwości diagnostycznych, ustalenie hierarchii priorytetów klasyfikacyjnych i klucza do klasyfikacji gleb, doprecyzowanie definicji unikalnych poziomów diagnostycznych, opracowanie uniwersalnych zasad wyróżniania podtypów oraz doprecyzowanie kryteriów ilościowych na styku j ednostek. Należy również podj ąć próbę zmniej -szenia liczby typów i podtypów gleb, co może ułatwić odbiór, zrozumienie oraz nauczanie systematyki.

  12. Mapa Geologico de Venezuela a Escala 1:750,000

    Science.gov (United States)

    Hackley, Paul C.; Urbani, Franco; Karlsen, Alex W.; Garrity, Christopher P.

    2006-01-01

    Se presenta un mapa geologico digital de Venezuela sobre un fondo de relieve sombreado. Los datos geologicos e hidrologicos del norte del rio Orinoco proceden de la digitalizacion de mapas geologicos en papel a escala 1:500.000. Estos datos fueron integrados con el mapa geologico digital del Escudo de Guayana Venezolano, a su vez derivado de hojas en papel a escala 1:500.000. La informacion sobre los tipos de fallas mostrados en el mapa es igual que en las fuentes originales. Los poligonos geologicos fueron atribuidos por edad, litologia y nombre de la unidad siguiendo el Codigo geologico de Venezuela. Se incorporaron revisiones significativas de la geologia de la Cordillera de la Costa a partir de las nuevas hojas integradas a escala 1:25.000. Toda esta informacion geologico-estructural se sobrepuso a una imagen de relieve sombreado, producida por el procesamiento de los datos de radar interferometrico con 90 m (3 arcosegundos) de resolucion espacial obtenidos por la mision topografica de radar del transbordador espacial (SRTM). Las areas de la base de datos del SRTM carentes de informacion fueron llenadas por medio de la interpolacion de los datos de las celdas adyacentes. Para producir la imagen de relieve sombreado se uso una direccion de iluminacion de 315 deg con un angulo de 65 deg sobre el horizonte. La proyeccion usada en el mapa es conica equidistante, con latitudes de 4 y 9 deg norte como paralelos estandar y una longitud de 66 deg al oeste como meridiano central. Los datos en el mapa proceden primordialment de hojas a escala 1:500.000 y el producto esta preparado para una impresion optima en escala 1:750.000. Los usuarios pueden obtener ampliaciones mayores, sin embargo no se garantiza la precision del mapa a escalas mas detalladas. Especialmente en la region de Guayana, al sobreponer los mapas geologicos sobre la reciente imagen SRTM, se notan grandes discrepancias no sistematicas tanto en contactos como en fallas. Esto es debido a que los mapas

  13. Creatividad, mapas conceptuales y TIC en educación

    Directory of Open Access Journals (Sweden)

    Ricardo Chrobak

    2015-01-01

    Full Text Available Los mapas conceptuales, además de ser unas herramientas que nos permiten representar el conocimiento de manera gráfica y fomentar los aprendizajes, también pueden desarrollar la creatividad. En este trabajo mostramos diferentes relaciones existentes entre el proceso de construcción de mapas conceptuales y la creatividad humana. También se resalta la importancia del aprendizaje significativo y se profundiza en los diferentes principios que guían la creación de mapas conceptuales. Finalmente se presenta el software Cmaptools como una herramienta a tener en cuenta en los centros educativos ya que su utilización planificada puede tener resultados significativos en la mejora de los aprendizajes.

  14. Mapas de ruido: mecanismo de control del ruido ambiental

    OpenAIRE

    Chávez García, Kelvin

    2012-01-01

    Los primeros mecanismos de control del ruido ambiental fueron los mapas acústicos. La Directiva Europea 2002149/CE del Parlamento Europeo y del Consejo de Evatuacián y Gestión del Ruido Ambiental, exige, a los estados miembros,  se midan los niveles de ruido, en su entorno local, con  el fin de contar con indicadores de ruido comunes. elaborar mapas de ruido y planes de acción destinados a reducir los efectos nocivos de ruido ambiental.  Las directrices para la elaboración de l...

  15. Boom komiksowy. Polski rynek historii obrazkowych w latach 2000-2003

    Directory of Open Access Journals (Sweden)

    Mateusz Zapała

    2011-05-01

    Full Text Available Lata 2000-2003, ze względu na wzmożoną aktywność wydawniczą na polu historii obrazkowych oraz szum medialny jej towarzyszący, bywają określane „boomem komiksowym”. Gwałtowny wzrost koniunktury na komiks w początkach XXI wieku rozpoczęły należące do Egmont Polska: magazyn „Świat Komiksu” oraz imprint Klub Świata Komiksu (publikujący m.in. niebywale popularną serię Thorgal. Wkrótce po komercyjnym sukcesie Egmontu na rynek opowieści obrazkowych wkroczyli inni wydawcy, których można podzielić na dwie grupy. Pierwszą stanowili edytorzy, którzy wcześniej publikowali jedynie książki, np. wydawnictwa Amber, Muza, Siedmioróg. Drugi zbiór tworzyły oficyny stricte komiksowe, m.in. Kultura Gniewu, Mandragora, Post. „Boom komiksowy” doprowadził także do znacznych zmian w strukturze rynku periodycznych historii obrazkowych – prawie wszystkich odbiorców utracił TM-Semic (lider rynku komiksowego w latach 90, wydawca czasopism z przygodami superbohaterów, np. „Batmana”,  nowych czytelników zyskały natomiast niskonakładowe magazyny, które publikowały głównie polski komiks autorski (m.in. „AQQ”, „Krakers”, „KKK”, „Produkt”. W latach 2000-2003 rozwinął się również polski rynek mang (komiksów japońskich, którego liderem w tym czasie było wydawnictwo Japonica Polonica Fantastica (63% udział w rynku. Podczas „boomu komiksowego” rynek  historii obrazkowych skierowanych do dzieci zdominowała oferta Egmontu (np. magazyny „Kaczor Donald” i „Czarodziejki: W.I.T.C.H.” oraz cykl Gigant Poleca. Łącznie w latach 2000-2003 we wszystkich segmentach polskiego rynku komiksowego ukazało się 1455 pozycji komiksowych, czyli prawie o jedną czwartą więcej niż w ciągu całych lat dziewięćdziesiątych.

  16. Mapas de ruido: mecanismo de control del ruido ambiental

    Directory of Open Access Journals (Sweden)

    Kelvin Chávez García

    2012-12-01

    Full Text Available Los primeros mecanismos de control del ruido ambiental fueron los mapas acústicos. La Directiva Europea 2002149/CE del Parlamento Europeo y del Consejo de Evatuacián y Gestión del Ruido Ambiental, exige, a los estados miembros,  se midan los niveles de ruido, en su entorno local, con  el fin de contar con indicadores de ruido comunes. elaborar mapas de ruido y planes de acción destinados a reducir los efectos nocivos de ruido ambiental.  Las directrices para la elaboración de los  mapas  acústicos son en base a la normativa  Española sobre ruido. Los requerimientos  en base a la normativa, garantizan los resultados, lo cual permitirá elaborar los planes de acción. El estudio busca comunicar la necesidad de utilizar herramientas como  los  mapas  acústicos y ejercer un control de los  impactos por ruido ambiental.

  17. Progressive retinal atrophy in the Polski Owczarek Nizinny dog: a clinical and genetic study.

    Science.gov (United States)

    Svensson, Marika; Olsén, Lena; Winkler, Paige A; Petersen-Jones, Simon M; Bergström, Tomas; Garncarz, Yacek; Narfström, Kristina

    2016-05-01

    To describe ophthalmic, functional, structural, and genetical characteristics of progressive retinal atrophy (PRA) in the polski owczarek nizinny (PON) breed of dog. Client-owned PON dogs (n = 82) from Sweden. Routine examination for presumed inherited eye disease was performed in all dogs. Bilateral full-field electroretinography (ERG) was performed in 11 affected and 4 control dogs. Eyes from one affected dog were studied with light microscopy. DNA samples from 34 Swedish and 30 PON dogs collected by Michigan State University (MSU) were tested for the mutations causing the rcd4 and prcd forms of PRA. Sixteen of the eighty-two Swedish dogs were diagnosed with PRA. Slight vascular attenuation, first seen at 4.5 years of age, preceded changes in tapetal reflectivity. The initial ERG changes in affected dogs showed markedly diminished rod responses, while cone responses were barely affected. Eventually, cone responses were also reduced. Retinal morphology showed approximately a 50% reduction of photoreceptor nuclei in the outer nuclear layer. Fourteen of fifteen PRA-affected Swedish dogs and eighteen of twenty of the MSU PRA-affected dogs tested genetically were positive for the rcd4 mutation. All tested dogs were negative for the mutation causing prcd-PRA. PRA of PON dogs is a late-onset degenerative disease with slow progression. There is early loss of rod function, while the cone system deteriorates later. The rcd4 mutation in the C2ORF71 gene was associated with the majority of the PRA cases tested. The possibility of additional forms of PRA in the breed cannot be excluded. © 2015 American College of Veterinary Ophthalmologists.

  18. Itinerarios de aprendizaje flexibles basados en mapas conceptuales

    Directory of Open Access Journals (Sweden)

    Olga Lucía Agudelo

    2015-07-01

    Full Text Available Se estudia el uso de itinerarios de aprendizaje  basados en mapas conceptuales como una propuesta para un diseño instruccional más flexible que potencie el aprendizaje y se centre en el estudiante, generando procesos no lineales, caracterizando sus elementos, estableciendo relaciones entre ellos y configurando un modelo general con especificaciones para  cada nivel de educación. Mediante una metodología construida sobre el modelo SAM (Successive Aproximation Model, se ha estudiado el proceso de diseño, implementación y evaluación de itinerarios de aprendizaje, en los que se representan en mapas conceptuales y de manera organizada y no lineal, conjuntos de actividades  que permiten el desarrollo de las competencias que deben comprenderse, dominarse y demostrarse. Los resultados obtenidos muestran la adecuación del itinerario de aprendizaje basado en mapas conceptuales a las características de los sujetos, resolviendo situaciones de la realidad mediante la construcción y creación de nuevos esquemas y formas de gestión del conocimiento, al mismo tiempo que aporta reflexión sobre los principios del diseño curricular utilizando TIC y genera autonomía en el proceso de aprendizaje.

  19. Pozaszkolne uwarunkowania wiedzy uczniów szkół ponadgimnazjalnych o historii Polski XX w.

    Directory of Open Access Journals (Sweden)

    Michał Męziński

    2016-09-01

    Full Text Available Celem artykułu jest przedstawienie problematyki zróżnicowania poziomu wiedzy o historii Polski XX w. uczniów szkół ponadgimnazjalnych. Zarysowano kontekst teoretyczny i metodologiczno-badawczy oraz przedstawiono analizy poziomu wiedzy w zależności od wybranych charakterystyk uczniów. Analizy przeprowadzono z wykorzystaniem dwupoziomowych modeli regresji liniowej na danych z ogólnopolskiego, reprezentatywnego dla populacji uczniów szkół ponadgimnazjalnych, badania postaw wobec historii Polski XX w. Na jego podstawie zdiagnozowano znaczące różnice w poziomie wiedzy w zależności od typu szkoły ponadgimnazjalnej i płci. Podjęto próbę interpretacji dostrzeżonych różnic w szerszym kontekście – poprzez uwzględnienie dodatkowych czynników wyjaśniających: rodzinnych, szkolnych, indywidualnych, związanych z potencjalnymi zainteresowaniami historycznymi oraz natężeniem postaw wobec historii. Kontrola dodatkowych czynników (przede wszystkim natężenia postaw wpłynęła na zmniejszenie efektów typu szkoły i płci, jednakże pozostały one istotne.

  20. CONSISTENCIA ENTRE LOS MAPAS GLOBALES Y LOS MAPAS REGIONALES DE LA CUBIERTA TERRESTRE EN EL ESTADO DE MICHOACAN, MÉXICO

    Directory of Open Access Journals (Sweden)

    Luis Valderrama Landeros

    2011-01-01

    Full Text Available Desde hace algunos años se han realizado intentos para elaborar mapas globales utilizando diferentes tipos de imágenes, métodos y sistemas de nomenclatura. Estos mapas son difíciles de validar y su precisión a nivel local puede ser muy variable. El objetivo del presente estudio fue contribuir a la validación de los mapas globales de la cubierta terrestre, comparando cinco de ellos para el caso particular del Estado de Michoacán, México. Se tomó como referencia el mapa de la Comisión Nacional para el Conocimiento y Uso de la Biodiversidad de México y como criterios, la consistencia y el área espacial. Tomando en cuenta las leyendas iniciales, la comparación reveló incoherencias debidas en parte a las diferencias en los sistemas de clasificación. Después de establecer una leyenda unificada con seis categorías generales, la precisión global entre los mapas varió de un 9 a un 62 %. Solo 2 % de los pixeles coinciden en 4 mapas (principalmente ciudades y agua y 88 % coinciden en 2 ó 3 mapas. El principal problema es la distinción entre las áreas de cultivo y otro tipo de vegetación. Los mapas más recientes, basados en la nomenclatura propuesta por la FAO, muestran mayor exactitud pero aún no la suficiente para considerarlos como adecuados para detectar los principales tipos de cubierta terrestre. El uso de mapas globales de cobertura terrestre debe ser adecuadamente contextualizado en situaciones de gran diversidad.

  1. Mapa geomorfológico de colombia ecuatorial

    OpenAIRE

    Llano Buenaventura, Manuel del

    2012-01-01

    Esta primera aproximación al mapa geomorfológico general de Colombia, tuvo su principio hacia 1954, cuando elaboramos un croquis morfológico del occidente para estudios puramente pedológicos del Departamentode Antioquia. Sin embargo, trabajos posteriores por parte de la FAO en los Llanos Orientales y de la CVC en el valle central del Cauca, nos hicieron pensar en la necesidad de ampliar nuestros horizontes de exploración, convencidos de la importancia que iba tomandola geomorfología en el est...

  2. PROPUESTA METODOLÓGICA PARA REALIZAR MAPAS DE CONOCIMIENTO

    OpenAIRE

    MARCO DUEÑAS; DIANA ROJAS; MARÍA EUGENIA MORALES

    2012-01-01

    Recientemente Chavalarias y Cointet (2008) propusieron una metodología para construir mapas de conocimiento. En dicho estudio el corpus de información se construye a partir de un conjunto de palabras clave fijas y determinadas de forma exógena. En este artículo se replica esta metodología, pero a diferencia, el conjunto de palabras clave es construido a través de búsquedas recurrentes y relacionadas. Así, iniciando con un conjunto reducido de palabras clave pertenecientes a un paradigma cient...

  3. PROPUESTA METODOLÓGICA PARA REALIZAR MAPAS DE CONOCIMIENTO

    Directory of Open Access Journals (Sweden)

    MARCO DUEÑAS

    2012-01-01

    Full Text Available Recientemente Chavalarias y Cointet (2008 propusieron una metodología para construir mapas de conocimiento. En dicho estudio el corpus de información se construye a partir de un conjunto de palabras clave fijas y determinadas de forma exógena. En este artículo se replica esta metodología, pero a diferencia, el conjunto de palabras clave es construido a través de búsquedas recurrentes y relacionadas. Así, iniciando con un conjunto reducido de palabras clave pertenecientes a un paradigma científico se construye un corpus de artículos, los cuales a su vez citan otras palabras clave que son usadas como insumo para una segunda búsqueda. Este estudio tomó como base artículos relacionados con aplicaciones satelitales. La metodología propuesta permite de igual forma construir mapas de conocimiento, o determinar los campos paradigmáticos (Chavalarias y Cointet, 2008, es decir se obtienen clusters conectados, compuestos de palabras relacionadas entre sí bajo un criterio específico de proximidad y de interrelación, que vistos de forma global permiten identificar áreas específicas del conocimiento.

  4. Knowledge management: Postgraduate Alternative Evaluation Model (MAPA in Brazil

    Directory of Open Access Journals (Sweden)

    Deisy Cristina Corrêa Igarashi

    2013-07-01

    Full Text Available The Brazilian stricto sensu postgraduate programs that include master and / or doctorate courses are evaluated by Coordination for the Improvement of Higher Education Personnel (CAPES - Coordenação de Aperfeiçoamento de Pessoal de Nível Superior. The evaluation method used by CAPES is recognized in national and international context. However, several elements of the evaluation method can be improved. For example: to consider programs diversity, heterogeneity and specificities; to reduce subjectivity and to explain how indicators are grouped into different dimensions to generate a final result, which is scoring level reached by a program. This study aims to analyze the evaluation process by CAPES, presenting questions, difficulties and objections raised by researchers. From the analysis, the study proposes an alternative evaluation model for postgraduate (MAPA - Modelo de Avaliação para Pós graduação Alternativo which incorporates fuzzy logic in result analysis to minimize limitations identified. The MAPA was applied in three postgraduate programs, allowing: (1 better understanding of procedures used for the evaluation, (2 identifying elements that need regulation, (3 characterization of indicators that generate local evaluation, (4 support in medium and long term planning.

  5. MAPA: an interactive accelerator design code with GUI

    Science.gov (United States)

    Bruhwiler, David L.; Cary, John R.; Shasharina, Svetlana G.

    1999-06-01

    The MAPA code is an interactive accelerator modeling and design tool with an X/Motif GUI. MAPA has been developed in C++ and makes full use of object-oriented features. We present an overview of its features and describe how users can independently extend the capabilities of the entire application, including the GUI. For example, a user can define a new model for a focusing or accelerating element. If the appropriate form is followed, and the new element is "registered" with a single line in the specified file, then the GUI will fully support this user-defined element type after it has been compiled and then linked to the existing application. In particular, the GUI will bring up windows for modifying any relevant parameters of the new element type. At present, one can use the GUI for phase space tracking, finding fixed points and generating line plots for the Twiss parameters, the dispersion and the accelerator geometry. The user can define new types of simulations which the GUI will automatically support by providing a menu option to execute the simulation and subsequently rendering line plots of the resulting data.

  6. MAPA: an interactive accelerator design code with GUI

    International Nuclear Information System (INIS)

    Bruhwiler, David L.; Cary, John R.; Shasharina, Svetlana G.

    1999-01-01

    The MAPA code is an interactive accelerator modeling and design tool with an X/Motif GUI. MAPA has been developed in C++ and makes full use of object-oriented features. We present an overview of its features and describe how users can independently extend the capabilities of the entire application, including the GUI. For example, a user can define a new model for a focusing or accelerating element. If the appropriate form is followed, and the new element is 'registered' with a single line in the specified file, then the GUI will fully support this user-defined element type after it has been compiled and then linked to the existing application. In particular, the GUI will bring up windows for modifying any relevant parameters of the new element type. At present, one can use the GUI for phase space tracking, finding fixed points and generating line plots for the Twiss parameters, the dispersion and the accelerator geometry. The user can define new types of simulations which the GUI will automatically support by providing a menu option to execute the simulation and subsequently rendering line plots of the resulting data

  7. Polski rejestr chorych na stwardnienie rozsiane – stan obecny, perspektywy i problemy

    Directory of Open Access Journals (Sweden)

    Waldemar Brola

    2015-08-01

    Full Text Available Stwardnienie rozsiane jest postępującą zapalno-demielinizacyjną chorobą ośrodkowego układu nerwowego o nieznanej etiologii, dotykającą przede wszystkim ludzi młodych i stanowiącą najczęstszą przyczynę niesprawności neurologicznej w tej grupie wiekowej. Szacuje się, że w Polsce na stwardnienie rozsiane choruje około 40 000 osób, a rocznie stwierdza się około 2000 nowych przypadków. Wskaźniki te oparte są jedynie na statystykach Narodowego Funduszu Zdrowia i nie zawierają wielu istotnych danych, m.in. na temat postaci i przebiegu choroby, stopnia niepełnosprawności, rodzaju leczenia czy jakości życia chorych. W większości krajów europejskich takie informacje są zbierane przez narodowe rejestry chorych, często funkcjonujące już od lat. Polska była pod tym względem białą plamą na mapie świata i największym państwem o tak dużej liczbie chorych, w którym nie wprowadzono żadnej bazy danych. Wzorem innych krajów w 2013 roku powołano ogólnopolski rejestr chorych na stwardnienie rozsiane, którego celem było opisanie podstawowych parametrów epidemiologicznych zebranych ze wszystkich ośrodków zajmujących się leczeniem stwardnienia rozsianego. W artykule przedstawiono założenia polskiego Rejestru Chorych ze Stwardnieniem Rozsianym (RejSM i omówiono wyniki z regionu świętokrzyskiego, który jest najbardziej zaangażowany w zbieranie danych. Na dzień 31 grudnia 2013 roku chorobowość w tym rejonie Polski określono na 109,1/100 000, a zapadalność w latach 2011–2013 – na 4,1/100 000/rok. Wskaźniki te są wyższe od dotychczas publikowanych polskich danych. Przedstawiono również wstępną analizę samooceny jakości życia pacjentów oraz ograniczenia i problemy związane z dalszym rozwojem rejestru.

  8. MAPA: Implementation of the Standard Interchange Format and use for analyzing lattices

    Science.gov (United States)

    Shasharina, Svetlana G.; Cary, John R.

    1997-05-01

    MAPA (Modular Accelerator Physics Analysis) is an object oriented application for accelerator design and analysis with a Motif based graphical user interface. MAPA has been ported to AIX, Linux, HPUX, Solaris, and IRIX. MAPA provides an intuitive environment for accelerator study and design. The user can bring up windows for fully nonlinear analysis of accelerator lattices in any number of dimensions. The current graphical analysis methods of Lifetime plots and Surfaces of Section have been used to analyze the improved lattice designs of Wan, Cary, and Shasharina (this conference). MAPA can now read and write Standard Interchange Format (MAD) accelerator description files and it has a general graphical user interface for adding, changing, and deleting elements. MAPA's consistency checks prevent deletion of used elements and prevent creation of recursive beam lines. Plans include development of a richer set of modeling tools and the ability to invoke existing modeling codes through the MAPA interface. MAPA will be demonstrated on a Pentium 150 laptop running Linux.

  9. Controlled release of curcumin from poly(HEMA-MAPA) membrane.

    Science.gov (United States)

    Caka, Müşerref; Türkcan, Ceren; Aktaş Uygun, Deniz; Uygun, Murat; Akgöl, Sinan; Denizli, Adil

    2017-05-01

    In this work, poly(HEMA-MAPA) membranes were prepared by UV-polymerization technique. These membranes were characterized by SEM, FTIR, and swelling studies. Synthesized membranes had high porous structure. These membranes were used for controlled release of curcumin which is already used as folk remedy and used as drug for some certain diseases and cancers. Curcumin release was investigated for various pHs and temperatures. Optimum drug release yield was found to be as 70% at pH 7.4 and 37 °C within 2 h period. Time-depended release of curcumin was also investigated and its slow release from the membrane demonstrated within 48 h.

  10. Mapas de taxas epidemiológicas: uma abordagem Bayesiana

    Directory of Open Access Journals (Sweden)

    Assunção Renato Martins

    1998-01-01

    Full Text Available Neste artigo, apresentamos métodos estatísticos desenvolvidos recentemente para a análise de mapas de taxas de morbidade quando as unidades geográficas possuem pequenas populações de risco. Eles adotam a abordagem Bayesiana e utilizam métodos computacionais intensivos para estimação do risco de cada área. O objetivo dos métodos é separar a variabilidade das taxas devida às diferenças entre as regiões do risco subjacente daquela devida à pura flutuação aleatória. As estimativas de risco possuem um erro quadrático médio total menor que as estimativas usuais. Aplicamos esses novos métodos para estimar o risco de mortalidade infantil nos municípios de Minas Gerais em 1994.

  11. Relacíon de graficas, mapas y cuadros

    OpenAIRE

    Piel, Jean

    2013-01-01

    Graficas Pág. Variaciones del precio de la fanega de maíz y de cacao en la Real Almoneda de Guatemala en relación con la existencia de los jueces de milpas 192 Estructura de parentesco 249 La población indígena de San Andrés Sajcabajá de 1730 a 1820 278 Evolución demográfica de San Andrés entre 1921 y 1967 386 Evolución del poblamiento en Canilla de 1921 a 1967 388 Mapas La expansión de la federación quiché antes de 1524 28 La región de San Andrés Sajcabajá vista por Cortés y Larraz en 1768 2...

  12. Five New Records of Raphignathoid Mites (Acari: Raphignathoidea) from Poland/ Pięć Nowych Gatunków Roztoczy Z Nadrodziny Raphignathoidea (Acari) Stwierdzonych W Faunie Polski

    OpenAIRE

    Doðan Salih; Sevsay Sevgi; Mąkol Joanna; Zeytun Erhan; Buğa Evren

    2014-01-01

    Pięć nowych gatunków roztoczy (Acari: Raphignathoidea) zostało odnoto- wanych jako nowe dla fauny Polski: trzy z rodziny Stigmaeidae, Eustigmaeus rhodomela (Koch), Mediolata obtecta Dónel et Doóan, Stigmaeus glabrisetus Summers, jeden z rodziny Cryptognathidae, Favognathus cucurbita (Berlese), i jeden z rodziny Barbutiidae, Barbuda anguineus (Berlese). Ostatni z wymienio- nych jest jednocześnie pierwszym stwierdzeniem przedstawiciela rodziny Barbutiidae w Polsce.

  13. Five New Records of Raphignathoid Mites (Acari: Raphignathoidea from Poland/ Pięć Nowych Gatunków Roztoczy Z Nadrodziny Raphignathoidea (Acari Stwierdzonych W Faunie Polski

    Directory of Open Access Journals (Sweden)

    Doðan Salih

    2014-12-01

    Full Text Available Pięć nowych gatunków roztoczy (Acari: Raphignathoidea zostało odnoto- wanych jako nowe dla fauny Polski: trzy z rodziny Stigmaeidae, Eustigmaeus rhodomela (Koch, Mediolata obtecta Dónel et Doóan, Stigmaeus glabrisetus Summers, jeden z rodziny Cryptognathidae, Favognathus cucurbita (Berlese, i jeden z rodziny Barbutiidae, Barbuda anguineus (Berlese. Ostatni z wymienio- nych jest jednocześnie pierwszym stwierdzeniem przedstawiciela rodziny Barbutiidae w Polsce.

  14. JOGOS PAISAGÍSTICOS: MAPAS E ATLAS COMO CONCEITOS OPERATIVOS

    Directory of Open Access Journals (Sweden)

    Frederico Canuto

    2014-04-01

    Full Text Available O presente artigo coloca em discussão a produção de paisagens como prática que pode envolver diferentes agentes e percepções, não sendo estreitamente vinculado a um único olhar dito objetivo. A partir de tal discussão, mapas e atlas, instrumentos cartográficos por demais usuais, são aqui transformados em conceitos para se pensar a paisagem e sua produção na contemporaneidade levando em conta diferentes recortes epistemológicos, pontos de vista, agentes e sujeitos. Usando o conceito de espasmos advindo da critica do filósofo francês Gilles Deleuze a respeito das pinturas Francis Bacon, tais operadores serão discutidos como espaços autônomos de produção de paisagens a despeito de qualquer imagem exterior existente a priori. Serão usadas duas obras que, por sua vez, apontarão para a definição destes mesmos operadores: o trabalho artístico participativo Alter Bahnhof Vídeo Walk dos artistas Janet Cardiff e George Miller apresentado na DOCUMENTA XIII de Kassel em 2012 e o site interativo We feel Fine. An Exploration of Human Emotion, in Six Movements feito pelos designers Jonathan Harris e Sep Kamvar. E na conclusão, pretende-se discutir o mapa e atlas não como instrumentos de leitura de um real, mas eles mesmos como um real narrativo.

  15. Los mapas conceptuales en el aprendizaje de las cónicas

    OpenAIRE

    Díaz Contreras, Elmer

    2014-01-01

    La investigación titulada: Los mapas conceptuales en el aprendizaje de las cónicas, se realizó con el propósito de determinar los efectos de la integración y aplicación de mapas conceptuales en el aprendizaje de las ecuaciones relacionadas con la parábola, elipse e hipérbola. El estudio también examina si la forma de elaborar los mapas conceptuales tiene alguna relación con los aprendizajes de los estudiantes. La investigación utilizó un diseño cuasi experimental con dos grupos no equivalente...

  16. Heat of Absorption of CO2 in Aqueous Solutions of DEEA, MAPA and their Mixture

    DEFF Research Database (Denmark)

    Waseem Arshad, Muhammad; von Solms, Nicolas; Thomsen, Kaj

    2013-01-01

    A reaction calorimeter was used to measure the differential heat of absorption of CO2 in phase change solvents as a function of temperature, CO2 loading and solvent composition. The measurements were taken for aqueous solutions of 2-(diethylamino)ethanol (DEEA), 3-(methylamino)propylamine (MAPA......) and their mixture. The tested compositions were 5M DEEA, 2M MAPA and their mixture, 5M DEEA + 2M MAPA which gives two liquid phases on reacting with CO2. Experimental measurements were also carried out for 30% MEA used as a base case. The measurements were taken isothermally at three different temperatures 40, 80...... and 120°C at a CO2 feed pressure of 600kPa. In single aqueous amine solutions, heat of absorption increases with increase in temperature and depends on thetype of amine used. DEEA, a tertiary amine, has lower heat of absorption compared to MAPA being a diamine with primary and secondary amine functional...

  17. La escritura y el espacio: algunas notas sobre mapas y paisajes literarios

    OpenAIRE

    Gutiérrez, Menchu

    2009-01-01

    Un paisaje literario es la esencia vital del mapa íntimo y cambiante de todo escritor. Menchu Gutiérrez nos invita a disfrutar de la lectura del paisaje como experiencia intelectual, emocional y sensorial. Con viejos mapas y ecos de memoria, los escritores mencionados en su artículo tejen y destejen paisajes abstractos, mitad reales y mitad imaginados, conquistados a través de sus experiencias y tamizados por la intimidad de los recuerdos.

  18. El mapa cognitivo en los procesos de evaluación del aprendizaje

    Directory of Open Access Journals (Sweden)

    William R. Avendaño C.

    2012-07-01

    Full Text Available En este artículo se hace una revisión del mapa cognitivo de Reuven Feuerstein como instrumento de evaluación. El objetivo de este artículo, por lo tanto, es el análisis del mapa cognitivo en el marco de la evaluación, las ciencias cognitivas y su pertinencia como herramienta de uso en el aula de clase. Metodología: para el logro de ese objetivo se hizo una amplia revisión de la literatura en torno de la evaluación, la práctica de la calificación, los aportes de las ciencias cognitivas y los avances de la neurociencia, para concluir con el mapa cognitivo y un diseño propuesto para la sistematización de la información de acuerdo con los elementos del mapa cognitivo planteado por Feuerstein. Conclusiones: El mapa cognitivo es una herramienta de evaluación que responde a las necesidades de los estudiantes y al marco conceptual definido y aceptado por la comunidad académica. Las ventajas operativas del mapa cognitivo son evidentes a la luz de los avances del funcionamiento del cerebro y la mente en los procesos de aprendizaje.

  19. El mapa cognitivo en los procesos de evaluación del aprendizaje

    Directory of Open Access Journals (Sweden)

    William R. Avendaño C.

    2012-01-01

    Full Text Available En este artículo se hace una revisión del mapa cognitivo de Reuven Feuerstein como instrumento de evaluación. El objetivo de este artículo, por lo tanto, es el análisis del mapa cognitivo en el marco de la evaluación, las ciencias cognitivas y su pertinencia como herramienta de uso en el aula de clase. Metodología: para el logro de ese objetivo se hizo una amplia revisión de la literatura en torno de la evaluación, la práctica de la calificación, los aportes de las ciencias cognitivas y los avances de la neurociencia, para concluir con el mapa cognitivo y un diseño propuesto para la sistematización de la información de acuerdo con los elementos del mapa cognitivo planteado por Feuerstein. Conclusiones: El mapa cognitivo es una herramienta de evaluación que responde a las necesidades de los estudiantes y al marco conceptual definido y aceptado por la comunidad académica. Las ventajas operativas del mapa cognitivo son evidentes a la luz de los avances del funcionamiento del cerebro y la mente en los procesos de aprendizaje.

  20. Metoda szacunku potencjalnych efektów ekologicznych pozyskania energii biomasy drewna wierzby energetycznej na przykładzie Polski

    Directory of Open Access Journals (Sweden)

    Gawrońska Grażyna

    2016-04-01

    Full Text Available W pracy przedstawiono metodę szacunku potencjalnych efektów ekologicznych rozumianych jako zmniejszenie zanieczyszczenia powietrza atmosferycznego, które wynikają z zastosowania biomasy wierzby energetycznej jako paliwa alternatywnego dla węgla kamiennego. Praca ma charakter metodyczny, a bazę badawczą stanowią grunty ugorowane w Polsce w ujęciu województw pozyskane z Głównego Urzędu Statystycznego. W wyniku badań określono potencjalne efekty ekologiczne wyrażone niewyemitowaniem do powietrza atmosferycznego dwutlenku węgla w ilości 13 828 553 ton w ciągu roku oraz dwutlenku siarki w ilości 103 714 ton w ciągu roku oraz istotnym zmniejszeniem emisji tlenków azotu o ok. 26 274 ton w ciągu roku. Uzyskane efekty ekologiczne są szczególnie istotne na analizowanym obszarze, ze względu na poprawę jakości powietrza oraz zwiększenie udziału energii ze źródeł odnawialnych w strukturze zużycia pierwotnych nośników w bilansie paliwowo – energetycznym Polski.

  1. Do olfactory behaviour and marking responses of Konik polski stallions to faeces from conspecifics of either sex differ?

    Science.gov (United States)

    Jezierski, Tadeusz; Jaworski, Zbigniew; Sobczyńska, Magdalena; Ensminger, John; Górecka-Bruzda, Aleksandra

    2017-09-27

    The aim of the study was to assess whether adult stallions differentiate their olfactory and marking behaviour towards the excreta of their potential male rivals and mares. Four Konik polski stallions were individually exposed simultaneously to their own and each others' faeces as well as faeces of mares in oestrus vs. dioestrus. Five series of 30min observation sessions were conducted in a round pen each on two consecutive days from March to July, totaling in 5h observation per stallion. Stallions sniffed and displayed flehmen reaction towards mares' faeces significantly longer (P<0.01) than towards stallions' faeces. No significant differences were found in marking by defecations upon stallions' vs. mares' faeces. The stallions urinated exclusively on mares' faeces. Sniffing, flehmen, defecations and urinations performed towards faeces of mares in oestrus vs. dioestrus did not differ significantly. The results showed that stallions differentiate their olfactory behaviour towards excreta of conspecifics of different sex but perhaps not towards faeces of females in different reproductive status. This for the first time establishes that stallions exhibit different marking behaviour upon stallions' vs. mares' faeces. It is hypothesized that marking of other stallions' faeces by defecation may advertise presence of the stallion, whereas marking of mares' faeces by urination may serve to mask the presence of a mare to prevent potential rivals from locating the mare in an area where mares' faeces are found. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. O paulistano no mapa sociolinguístico brasileiro

    Directory of Open Access Journals (Sweden)

    Ronald Beline Mendes

    2012-01-01

    Full Text Available Este artigo traz notícia acerca dos trabalhos que vêm sendo desenvolvidos pelo Grupo de Estudos e Pesquisa em Sociolinguística da USP (GESOL-USP. Com o intuito de tornar a cidade de São Paulo e o paulistano mais presentes no mapa da sociolinguística brasileira, esses trabalhos organizam-se, sobretudo, em torno da construção de uma nova amostra da fala paulistana, que permita responder às seguintes perguntas centrais: "o que significa falar como paulistano?" e "quais são as variáveis e variantes linguísticas que o identificam?". Essa nova amostra (SP2010 será disponibilizada (áudio e transcrições para acesso público e para fins de pesquisa em página própria na Internet. Além de discutir os critérios que definem a construção de tal amostra, bem como os desafios nela envolvidos, esse artigo também faz um panorama dos trabalhos que se têm desenvolvido a partir dos dados que foram coletados durante a fase de preparação e de treinamento de jovens pesquisadores que nela trabalhariam (Amostra SP-Piloto. Finalmente, também delineia caminhos para trabalhos futuros dentro da agenda de pesquisa do grupo.

  3. PERCEPCIÓN DEL MUNDO: MAPAS MENTALES Y PROBLEMAS SOCIOAMBIENTALES

    Directory of Open Access Journals (Sweden)

    Antonio José Morales Hernández

    Full Text Available Resumen:Las personas construyen su imagen del mundo en relación con relatos que oyen de familiares y amigos, de noticias que observan en los medios de comunicación de masas... También es relevante la influencia del medio escolar, en especial desde materias como la Geografía, que les presenta no sólo hechos y datos del mundo, sino también una representación del planeta en un mapa. En este artículo queremos ofrecer una experiencia empírica sobre la construcción mental del mapamundi por parte de alumnos de Magisterio de Valencia. Con ello queremos mostrar la necesidad de trabajar este contenido de habilidades cartográficas para evitar la deformación de la explicación del planeta Tierra y sus problemas. Palabras ClaveMapas mentales, percepción de los problemas sociambientales, educación en valores. AbstractPeople build their own image of the world in relation to stories they hear from family and friends, news that they observed in the mass media... It is also relevant the influence of school environment, especially from the subject of Geography, which not only presents facts of the world, it is also a representation of the planet on a map.In this paper we want to provide of an empirical experience of the mental construction of the world map made by students that will be primary teachers in Valencia. With all we explained, we want to show the need of working this contents of cartographic skills to prevent deformation of the explanation of planet Earth and its problems.Key WordsMind mapping, perception of socio-environmental issues, education in valuesRésuméLes personnes construissent leur image du monde en rapport avec les récits qu’ils écoutent à d’autres membres de la famille et les amis, les nouvelles qu’ils observent aux mass media... Il est aussi remarquable l’influence du moyen scolaire, spécialement depuis des matières comme la Géographie, qui ne présente que des faits et des renseignements sur le monde, mais

  4. Przestrzenne nierówności oferty edukacyjnej w zdecentralizowanym systemie oświaty. Przypadek Polski

    Directory of Open Access Journals (Sweden)

    Mikołaj Herbst

    2014-03-01

    Full Text Available Decentralizacja edukacji, podobnie jak decentralizacja wszelkich usług publicznych, wiąże się z ryzykiem zwiększenia nierówności między jednostkami samorządu terytorialnego w zakresie ponoszonych nakładów i jakości usług. W większości państw próbuje się temu zaradzić poprzez ustanowienie krajowych standardów usług edukacyjnych oraz redystrybucję środków finansowych, która pozwala zneutralizować wpływ terytorialnych zróżnicowań bazy podatkowej. Niniejsze opracowanie poświęcone będzie analizie skutecznościowych działań w przypadku Polski. W pierwszej części, na podstawie danych panelowych na poziomie gmin, pokazujemy, że mimo różnych instrumentów wyrównawczych stosowanych przez rząd centralny, lokalna baza podatkowa w znaczącym stopniu wpływa na wysokość nakładów przeznaczanych na edukację gimnazjalną. W części drugiej porównujemy liczbę i charakter przedmiotowy godzin lekcyjnych w gimnazjach położonych w najbiedniejszych i najbogatszych gminach. Wedle naszych ustaleń czas nauczania dla uczniów z najbiedniejszych i najbogatszych środowisk nie jest istotnie różny. Nie występują także znaczące różnice wysokości wynagrodzeń nauczycieli. Biedne i bogate gminy różnią się natomiast zakresem indywidualnego wsparcia dla uczniów.

  5. Methods for shifting the pattern of energy deposition with a MAPA

    International Nuclear Information System (INIS)

    Guerquin-Kern, J.L.; Hagmann, M.J.; Levin, R.L.

    1987-01-01

    In earlier work the authors observed local heating in bone when an amputated human leg was treated with a MAPA. For this reason we have experimentally compared several methods for controlling the pattern of energy deposition. These methods include radial displacement of the phantom relative to the MAPA, adjusting phase and magnitude of the currents in the dipole elements, and the use of dielectric spacers between the bolus and parts of the phantom. Cylindrical homogeneous muscle-phantoms have been used in these tests. Both theory and experiments show that greater displacement of the pattern can be obtained using phase-shifting than is possible with radial displacement of the phantom. Dielectric spacers act as a shield by decoupling the phantom from the MAPA. The dielectric spacers are simple to use and give results that are stable and easy to predict

  6. Preparing high-density polymer brushes by mechanically assisted polymer assembly (MAPA)

    Science.gov (United States)

    Wu, Tao; Efimenko, Kirill; Genzer, Jan

    2001-03-01

    We introduce a novel method of modifying the surface properties of materials. This technique, called MAPA (="mechanically assisted polymer assembly"), is based on: 1) chemically attaching polymerization initiators to the surface of an elastomeric network that has been previously stretched by a certain length, Δx, and 2) growing end-anchored macromolecules using surface initiated ("grafting from") atom transfer living radical polymerization. After the polymerization, the strain is removed from the substrate, which returns to its original size causing the grafted macromolecules to stretch away from the substrate and form a dense polymer brush. We demonstrate the feasibility of the MAPA method by preparing high-density polymer brushes of poly(acryl amide), PAAm. We show that, as expected, the grafting density of the PAAm brushes can be increased by increasing Δx. We demonstrate that polymer brushes with extremely high grafting densities can be successfully prepared by MAPA.

  7. Mapa Hipertextual (MHTX): um modelo para organização hipertextual de documentos

    OpenAIRE

    Gercina Angela Borem de Oliveira Lima

    2004-01-01

    Este estudo visa a construção de um modelo estruturado semanticamente para auxiliar a organização e representação do conhecimento humano estruturado em hipertextos, baseado nas teorias da análise facetada e do mapa conceitual. O segundo passo neste estudo é a aplicação do modelo semântico para criar um protótipo chamado MAPA HIPERTEXTUAL (MHTX): um modelo para organização hipertextual de documentos que deverá ser utilizado para implementar a BTDECI UFMG (Biblioteca de Teses e Dissertações do...

  8. Análisis de mapas causales de impactos del turismo residencial

    OpenAIRE

    ANTONIO ALEDO; HUGO GARCÍA; GUADALUPE ORTIZ

    2010-01-01

    Este artículo presenta la novedad metodológica de aplicar los programas informáticos de análisis de redes sociales (Ucinet® y Netdraw®) al análisis de mapas causales con la finalidad de mejorar los procesos de diagnóstico del turismo residencial a escala local. En concreto, esta propuesta metodológica se articula en los siguientes pasos: primero, la identificación de los impactos a escala local y la elaboración de sus mapas causales con la participación de actores locales relevantes; segundo,...

  9. Enseñando comunicación con mapas conceptuales: experiencias y posibilidades

    Directory of Open Access Journals (Sweden)

    Carlos Araya Rivera

    2012-01-01

    Full Text Available Este ensayo reseña algunas experiencias en el uso de mapas conceptuales para la enseñanza de las Ciencias de la Comunicación, desarrolladas por el autor en tres cursos impartidos en la Universidad de Costa Rica entre el 2007 y el 2010. Se reflexiona en cuanto a la aplicación de esta herramienta y sus posibilidades didácticas, y se ofrece algunas recomendaciones para aprovechar mejor el potencial de los mapas conceptuales.

  10. A situation-specific theory of Midlife Women's Attitudes Toward Physical Activity (MAPA).

    Science.gov (United States)

    Im, Eun-Ok; Stuifbergen, Alexa K; Walker, Lorraine

    2010-01-01

    This paper presents a situation specific theory-the Midlife Women's Attitudes Toward Physical Activity (MAPA) theory-that explains how women's attitudes toward physical activity influence their participation in physical activity. Using the integrative approach of Im, the theory was developed based on the Attitude, Social Influence, and Self Efficacy Model; a review of the related literature; and a study of women's attitudes toward physical activity. As a situation-specific theory, the MAPA theory can be linked easily to nursing practice and research projects related to physical activity in midlife women, especially interventions aimed at increasing midlife women's participation in physical activity. Copyright 2010 Mosby, Inc. All rights reserved.

  11. [Agnieszka Bartoszewicz. Czas w małych miastach. Studium z dziejów kultury umysłowej póznośredniowiecznej Polski] / Raimo Pullat

    Index Scriptorium Estoniae

    Pullat, Raimo, 1935-

    2009-01-01

    Arvustus: Bartoszewicz, Agnieszka. Czas w małych miastach. Studium z dziejów kultury umysłowej póznośredniowiecznej Polski. Warszawa-Pułtusk, 2003. Poola hiliskeskaja linnadest. Ajaarvestusest, ajakasutuse rütmist ja vormist ning ettekujutusest ajast

  12. Análisis de mapas causales de impactos del turismo residencial

    OpenAIRE

    García, Hugo; Aledo, Antonio; Nogueira, Guadalupe

    2010-01-01

    Este artículo presenta la novedad metodológica de aplicar los programas informáticos de análisis de redes sociales (Ucinet® y Netdraw®) al análisis de mapas causales con la finalidad de mejorar los procesos de diagnóstico del turismo residencia

  13. Creación de mapas conceptuales con CMapTools versión 4.02

    OpenAIRE

    Orlando Abril, Diego; Patricia Vivas, Nidia

    2005-01-01

    El presente artículo resume las principales actividades para elaborar un mapa conceptual con CmapTools, pero no pretende ser una guía completa de creación de mapas conceptuales ni tampoco un tratado de gramática para la definición de las proposiciones representadas en ellos. Aquest article resumeix les principals activitats per a elaborar un mapa conceptual amb CmapTools, però no pretén ser una guia completa de creació de mapes conceptuals ni tampoc un tractat de gramàtica per a la definic...

  14. Etapy postępowania przymusowego w administracji względem obowiązków niepieniężnych w prawie Polski i Niemiec

    OpenAIRE

    Ostojski, Przemysław

    2013-01-01

    Wydział Prawa i Administracji Treść pracy dotyczy nie poruszanego jak dotąd szerzej w polskiej doktrynie prawa i orzecznictwie sądowoadministracyjnym tematu etapów postępowania egzekucyjnego w administracji w Polsce i w Niemczech. W założeniu opracowanie ma być próbą wykazania, iż polskie postępowanie egzekucyjne, podobnie jak niemieckie, składa się z trzech etapów. Wszystkie te etapy w prawie polskim odpowiadają zasadniczo budowie postępowania egzekucyjnego względem obowiązków pieniężnych...

  15. Zróżnicowanie parametrów geotechnicznych gruntów spoistych południowo-zachodniej Polski

    Directory of Open Access Journals (Sweden)

    Ewa Wojnicka-Janowska

    2017-09-01

    Full Text Available Podstawą w projektowaniu konstrukcji inżynierskiej lub jej elementów jest znajomość podłoża gruntowego, w szczególności jego parametrów geotechnicznych. Przedstawione opracowanie ma charakter analizy zmienności regionalnej parametrów geotechnicznych gruntów ilastych południowo-zachodniej Polski, pod względem stratygraficznym zaliczonych do utworów neogeńskich. W publikacji wykorzystano bieżące badania własne uzupełnione o archiwalne badania próbek gruntów ilastych pochodzących z Legnicy i Głogowa. Wyniki badań opracowano statystycznie oraz przedstawiono w formie tabelarycznej.

  16. Logoterapia: compreendendo a teoria através de mapa de conceitos

    Directory of Open Access Journals (Sweden)

    David Moises Barreto dos Santos

    2016-01-01

    Full Text Available El interés por la Logoterapia y Análisis Existencial ha crecido desde su creación, tanto por los clínicos y otros profesionales en diversos campos. Sin embargo, la comprensión de un sistema teórico no es una tarea fácil, especialmente para un principiante, requiere mucha dedicación, principalmente con respecto a las relaciones entre los conceptos. Por lo tanto, se pueden utilizar diagramas para explicar estas relaciones. En este sentido, el propósito de este artículo es presentar un mapa conceptual de Logoterapia y Análisis Existencial. Con esta finalidad, utilizamos el análisis contrastivo para organizar conceptos extraídos de textos especializados. El resultado se expresa como un mapa conceptual de las relaciones entre los principales conceptos del sistema teórico investigado.

  17. Mapa de energia baseado em predição para redes de sensores sem fio

    OpenAIRE

    Raquel Aparecida de Freitas Mini

    2004-01-01

    O objetivo deste trabalho é construir o mapa de energia de uma rede de sensores sem fio utilizando técnicas de predição. Em mapas de energia baseados em predição, cada nó sensor utiliza algoritmos de predição para modelar sua dissipação de energia com o objetivo de prever seu consumo de energia no futuro. Nesta situação, ao invés de enviar para o nó sorvedouro apenas sua quantidade de energia disponível, cada sensor envia também os parâmetros do modelo que descreve seu consumo de energia. O n...

  18. El mapa cognitivo en los procesos de evaluación del aprendizaje

    OpenAIRE

    William R. Avendaño C.; Abad E. Parada-Trujillo

    2012-01-01

    En este artículo se hace una revisión del mapa cognitivo de Reuven Feuerstein como instrumento de evaluación. El objetivo de este artículo, por lo tanto, es el análisis del mapa cognitivo en el marco de la evaluación, las ciencias cognitivas y su pertinencia como herramienta de uso en el aula de clase. Metodología: para el logro de ese objetivo se hizo una amplia revisión de la literatura en torno de la evaluación, la práctica de la calificación, los aportes de las ciencias cognitivas y los a...

  19. Importancia de Accesibilidad Web en Mapas Geográficos para la Educación

    Directory of Open Access Journals (Sweden)

    Tania Calle

    2015-11-01

    Full Text Available Este estudio presenta un análisis de las Pautas de Accesibilidad para el Contenido Web (WCAG 2.0 que pueden ayudar a mejorar la accesibilidad en los mapas geográficos, esto permite a estudiantes que tienen algún problema de discapacidad visual acceder al contenido geográfico. Para realizar este análisis se ha realizado un estudio del estado de arte de trabajos que aportan a esta investigación, además se presentan ciertas soluciones prácticas y herramientas que deben considerarse como es el uso de los Gráficos Vectoriales Redimensionables (SVG, el Lenguaje de Marcas de Hipertexto versión 5 (HTML 5 y las Hojas de Estilo en Cascada (CSS. También se presentan algunas recomendaciones para mejorar la accesibilidad web en los mapas geográficos y se proponen algunos trabajos a futuro.

  20. Importancia de Accesibilidad Web en Mapas Geográficos para la Educación

    Directory of Open Access Journals (Sweden)

    Tania Calle Jimémez

    2015-11-01

    Full Text Available Este estudio presenta un análisis de las Pautas de Accesibilidad para el Contenido Web (WCAG 2.0 que pueden ayudar a mejorar la accesibilidad en los mapas geográficos, esto permite a estudiantes que tienen algún problema de discapacidad visual acceder al contenido geográfico. Para realizar este análisis se ha realizado un estudio del estado de arte de trabajos que aportan a esta investigación, además se presentan ciertas soluciones prácticas y herramientas que deben considerarse como es el uso de los Gráficos Vectoriales Redimensionables (SVG, el Lenguaje de Marcas de Hipertexto versión 5 (HTML 5 y las Hojas de Estilo en Cascada (CSS. También se presentan algunas recomendaciones para mejorar la accesibilidad web en los mapas geográficos y se proponen algunos trabajos a futuro.

  1. Experimental characterization of the BSD MAPA for heating of the human thigh

    International Nuclear Information System (INIS)

    Guerquin-Kern, J.L.; Hagmann, M.J.; Levin, R.L.; Glatstein, E.J.

    1985-01-01

    The authors began a series of experiments in order to characterize a Mini-Annular Phased Array (MAPA) applicator from the BSD Medical Corp. prior to possible clinical implementation at NIH. Heating patterns have been measured in simple cylindrical phantoms as well as a full-sized phantom-filled half-mannequin which is representative of the part of the human body that is below the waist. Implantable electric field probes have been used as well as non-perturbing temperature probes in these tests. The authors describe the relationship of measurements of the external electric field to changes in the heating pattern caused by lateral displacement of the phantom relative to the MAPA. The dependence of usable bandwidth upon phantom size and position, as well as upon the degree of bolus filling, is also described. Several recent tests made using two different types of helical coil applicators with the phantom-filled half-mannequin are also described for comparison

  2. O Papel dos Mapas Conceituais na Educação Médica

    Directory of Open Access Journals (Sweden)

    Andréia Patrícia Gomes

    Full Text Available No âmbito do ensino da medicina, diante das imperiosas mudanças necessárias para a formação de um profissional que aprenda a aprender, a aprendizagem significativa de David Ausubel - pressuposto teórico para a construção de mapas conceituais - tem permitido uma genuína articulação dos conhecimentos necessários à prática médica, facultando, portanto, um aprendizado mais efetivo e permitindo a atuação em um contexto complexo e interdisciplinar. Em conformidade com o exposto, o presente manuscrito objetiva apresentar o papel dos mapas conceituais na educação médica.

  3. MapA, an iron-regulated, cytoplasmic membrane protein in the cyanobacterium Synechococcus sp. strain PCC7942.

    Science.gov (United States)

    Webb, R; Troyan, T; Sherman, D; Sherman, L A

    1994-08-01

    Growth of Synechococcus sp. strain PCC 7942 in iron-deficient media leads to the accumulation of an approximately 34-kDa protein. The gene encoding this protein, mapA (membrane-associated protein A), has been cloned and sequenced (GenBank accession number, L01621). The mapA transcript is not detectable in normally grown cultures but is stably accumulated by cells grown in iron-deficient media. However, the promoter sequence for this gene does not resemble other bacterial iron-regulated promoters described to date. The carboxyl-terminal region of the derived amino acid sequence of MapA resembles bacterial proteins involved in iron acquisition, whereas the amino-terminal end of MapA has a high degree of amino acid identity with the abundant, chloroplast envelope protein E37. An approach employing improved cellular fractionation techniques as well as electron microscopy and immunocytochemistry was essential in localizing MapA protein to the cytoplasmic membrane of Synechococcus sp. strain PCC 7942. When these cells were grown under iron-deficient conditions, a significant fraction of MapA could also be localized to the thylakoid membranes.

  4. Mapas mentales del centro histórico de Santa Marta

    Directory of Open Access Journals (Sweden)

    Ubaldo Rodríguez de Ávila Sharol Cortés

    2014-05-01

    Full Text Available Al establecer y definir las principales argumentaciones teóricas que pueden acotar (desde nuestra visión y definir los conceptos de representación socioespacial, estudiado a través de la técnica y a la vez metodología de Mapas Mentales, como una forma de conocimiento social, elaboramos este nuevo aporte en el que se plantea una investigación que quiere ofrecer un modelo acerca de cómo abordar metodológicamente el tema que nos ocupa. Extracto científico del trabajo de grado de los autores del mismo, estudiantes de grado de Psicología de la Universidad del Magdalena, titulado: Representación Socioespacial del Centro Hisórico de Santa Marta, situándonos en la necesidad de conocer los mapas mentales como construcción de la realidad y la manera como el conocimiento se construye en ella. De este modo, la principal meta que se traza es la comprensión de los Mapas Mentales que los sujetos que usan el centro Histórico de Santa Marta tienen formado. (Duazary 2006; 2:153-163

  5. Re-hacer la educación: los mapas del desarrollo humano

    Directory of Open Access Journals (Sweden)

    Alfonso FERNÁNDEZ HERRERÍA

    2010-07-01

    Full Text Available En el presente artículo exponemos sobre la base de una crítica a la educación actual, una propuesta de reconstrucción de la concepción de la educación, ampliando su significado en cuanto actividad que hace crecer a la persona, mejora la vida social y la relación con el entorno ecológico. Desde un concepto de educación como desarrollo de lo humano, y, por consiguiente, como aprendizaje a lo largo de toda la vida, los mapas del desarrollo humano son los mapas de la educación. Necesitamos transitar los itinerarios que están representados por estos mapas, enriquecerlos desde una perspectiva humanística y transpersonal, con el deseo de paliar, en lo posible, el malestar existente en la educación. Las esperanzas puestas décadas atrás en ella se han tornado hoy en desencantos, decepciones, incluso en desconfianzas y resentimientos. Las reformas educativas se suceden sin que, al parecer, encontremos vías de solución a nuestros problemas.

  6. Mapa educativo nacional. Una experiencia en la República Argentina

    Directory of Open Access Journals (Sweden)

    Horacio Rodolfo Bozzano

    2006-01-01

    Full Text Available El Proyecto Mapa Educativo Nacional (MEN es un SIG generado a partir del desarrollo e integración de 24 Mapas Educativos Provinciales sobre la base de un modelo conceptual general, con una visión dinámica de los 49.000 establecimientos educativos, así como de su contexto territorial. Los objetivos del trabajo son: a sistematizar los aportes al Proyecto MEN desde la teoría cartográfica, reconociendo instancias de concepción, construcción y comunicación de los mapas que lo integran, así como vinculaciones entre territorio, espacio y espacialidades emergentes de la concreción de la tarea; y b identificar en qué medida la concreción del Proyecto MEN en la República Argentina contribuye a fortalecer un enfoque dialéctico conocimiento-realidad sobre el territorio y la gestión aplicado a un objeto de estudio e intervención concreto de desarrollo institucional, con el propósito de promover un círculo virtuoso de transformación entre sujetos de cambio y agentes de desarrollo.

  7. Radiolabeling of new generation magnetic poly(HEMA-MAPA) nanoparticles with (131) I and preliminary investigation of its radiopharmaceutical potential using albino Wistar rats.

    Science.gov (United States)

    Avcıbaşı, Uğur; Demiroğlu, Hasan; Ediz, Melis; Akalın, Hilmi Arkut; Özçalışkan, Emir; Şenay, Hilal; Türkcan, Ceren; Özcan, Yeşim; Akgöl, Sinan; Avcıbaşı, Nesibe

    2013-12-01

    In this study, N-methacryloyl-l-phenylalanine (MAPA) containing poly(2-hydroxyethylmethacrylate) (HEMA)-based magnetic poly(HEMA-MAPA) nanobeads [mag-poly(HEMA-MAPA)] were radiolabeled with (131) I [(131) I-mag-poly(HEMA-MAPA)], and the radiopharmaceutical potential of (131) I-mag-poly(HEMA-MAPA) was investigated. Quality control studies were carried out by radiochromatographic method to be sure that (131) I binded to mag-poly(HEMA-MAPA) efficiently. In this sense, binding yield of (131) I-mag-poly(HEMA-MAPA) was found to be about 95-100%. In addition to this, optimum radiodination conditions for (131) I-mag-poly(HEMA-MAPA) were determined by thin-layer radiochromatography studies. In addition to thin-layer radiochromatography studies, lipophilicity (partition coefficient) and stability studies for (131) I-mag-poly(HEMA-MAPA) were realized. It was determined that lipophilicities of mag-poly(HEMA-MAPA) and (131) I-mag-poly(HEMA-MAPA) were 0.12 ± 0.01 and 1.79 ± 0.76 according to ACD/logP algorithm program, respectively. Stability of the radiolabeled compound was investigated in time intervals given as 0, 30, 60, 180, and 1440 min. It was found that (131) I-mag-poly(HEMA-MAPA) existed as a stable complex in rat serum within 60 min. After that, biodistribution and scintigraphy studies were carried out by using albino Wistar rats. It was determined that the most important (131) I activity uptake was observed in the breast, the ovary, and the pancreas. Scintigraphy studies well supported biodistribution results. Copyright © 2013 John Wiley & Sons, Ltd.

  8. P-MAPA immunotherapy potentiates the effect of cisplatin on serous ovarian carcinoma through targeting TLR4 signaling.

    Science.gov (United States)

    de Almeida Chuffa, Luiz Gustavo; de Moura Ferreira, Grazielle; Lupi, Luiz Antonio; da Silva Nunes, Iseu; Fávaro, Wagner José

    2018-01-17

    Toll-like receptors (TLRs) are transmembrane proteins expressed on the surface of ovarian cancer (OC) and immune cells. Identifying the specific roles of the TLR-mediated signaling pathways in OC cells is important to guide new treatments. Because immunotherapies have emerged as the adjuvant treatment for patients with OC, we investigated the effect of a promising immunotherapeutic strategy based on protein aggregate magnesium-ammonium phospholinoleate-palmitoleate anhydride (P-MAPA) combined with cisplatin (CIS) on the TLR2 and TLR4 signaling pathways via myeloid differentiation factor 88 (MyD88) and TLR-associated activator of interferon (TRIF) in an in vivo model of OC. Tumors were chemically induced by a single injection of 100 μg of 7,12-dimethylbenz(a)anthracene (DMBA) directly under the left ovarian bursa in Fischer 344 rats. After the rats developed serous papillary OC, they were given P-MAPA, CIS or the combination P-MAPA+CIS as therapies. To understand the effects of the treatments, we assessed the tumor size, histopathology, and the TLR2- and TLR4-mediated inflammatory responses. Although CIS therapy was more effective than P-MAPA in reducing the tumor size, P-MAPA immunotherapy significantly increased the expressions of TLR2 and TLR4. More importantly, the combination of P-MAPA with CIS showed a greater survival rate compared to CIS alone, and exhibited a significant reduction in tumor volume compared to P-MAPA alone. The combination therapy also promoted the increase in the levels of the following OC-related proteins: TLR4, MyD88, TRIF, inhibitor of phosphorylated NF-kB alpha (p-IkBα), and nuclear factor kappa B (NF-kB p65) in both cytoplasmic and nuclear sites. While P-MAPA had no apparent effect on tumor necrosis factor alpha (TNF-α) and interleukin (IL)-6, it seems to increase interferon-γ (IFN-γ), which may induce the Thelper (Th1)-mediated immune response. Collectively, our results suggest that P-MAPA immunotherapy combined with cisplatin

  9. Avaliação da aprendizagem em química com uso de mapas conceituais

    Directory of Open Access Journals (Sweden)

    Josiel Albino Lima

    2017-05-01

    Full Text Available O uso dos mapas conceituais representa uma importante ferramenta para o processo de avaliação do aprendizado do aluno, pois o professor pode observar a perspectiva do discente acerca da compreensão do assunto abordado, principalmente pela análise dos termos e das conexões propostos nos mapas. Dessa forma, busca-se envolver o aluno de maneira ativa na sua construção cognitiva, havendo uma avaliação formativa. Este trabalho fundamentou-se nos conceitos da aprendizagem significativa de David Ausubel, bem como no modelo representacional da estrutura cognitiva, proposto por Joseph Novak. O objetivo desse trabalho foi avaliar a contribuição do uso de mapas conceituais visando à aprendizagem significativa de conceitos inerentes da química orgânica. Para isso, foi apresentada uma sequência didática desenvolvida numa turma de 3º ano do ensino médio regular, abordando o assunto de funções da química orgânica e sua relação com as plantas medicinais. Observou-se que o uso de mapas conceituais para avaliação formativa constitui uma estratégia eficiente, pois a análise reflexiva dos mapas compreende um redirecionamento do processo contínuo e progressivo do discente.

  10. Mapa perceptual no contexto empresarial: aspectos relevantes para a sua elaboração

    Directory of Open Access Journals (Sweden)

    Luiza Venzke Bortoli

    2017-08-01

    Full Text Available Em um ambiente competitivo, torna-se indispensável posicionar-se melhor do que os concorrentes a fim de manter-se no mercado. O mapa perceptual é uma técnica que auxilia na visualização da posição que uma empresa ocupa no mercado em que está inserida. Os benefícios gerados por essa técnica já são vastamente difundidos no mercado consumidor, mas podem auxiliar executivos em tomadas de decisão a respeito do posicionamento de produtos e serviços no mercado industrial (B2B. Esta pesquisa tem por objetivo ressaltar aspectos relevantes a serem considerados na elaboração do mapa perceptual no contexto empresarial. Para verificar a aplicação do mapa perceptual no B2B, foi escolhida uma empresa, cujo principal serviço era o inventário de mercadorias, que presta serviços a outras empresas, em especial varejistas. Para a elaboração do mapa, detectou-se dois atributos relevantes: a percepção sobre o custo do inventário para a empresa contratante; e a percepção sobre a contribuição estratégica do inventário para a gestão da empresa. Ao analisar as percepções dos profissionais quanto aos atributos, verificou-se diferenças decorrentes do setor em que trabalham, indicando que o pesquisador não deve estar restrito ao setor responsável pelo serviço analisado, mas deve obter uma visão ampla do funcionamento organizacional. Com o melhor entendimento da dinâmica organizacional da empresa contratante, a empresa prestadora de serviço pode construir sua proposta de valor para um serviço, posicionando-o de acordo com as percepções do mercado, obtendo maior vantagem competitiva. Como resultado deste estudo, sugere-se que, ao desenvolver o mapa perceptual para o B2B, o pesquisador atente-se para os seguintes pontos: i setor em que o respondente da pesquisa trabalha; ii presença de setores diretamente ligados ao serviço analisado ; iii setores que possam dialogar frequentemente com o responsável pelo serviço em foco; iv

  11. 3D.07: CORRELATION BETWEEN THE ARTERIAL PRESSURE VARIABILITY ESTIMATED AT CLINICS, MAPA AND AMPA.

    Science.gov (United States)

    Abellan-Huerta, J; García-Escribano, I A; Soto, R M; Leal, M; Torres, A; Guerrero, B; Melgar, A C; Soto, M; Soria, F; Abellan-Aleman, J

    2015-06-01

    To measure the variability (VB) of the arterial pressure (AP) with the use of serial measurements at the clinics (VBCLIN), with 24 h ambulatory monitoring (MAPA) (VBMAPA) and home automonitoring -AMPA- (VBAMPA) and to estimate a relationship among each method. This is an observational, descriptive and transversal study assessed with 91 hypertensive patients in treatment and stable with AP MAPA was assessed to all the patients included in the study in order to obtain the VBMAPA and an AMPA in two non-consecutive weeks to obtain the VBAMPA (total of 54 measurements). 91 patients with 66 ± 7.7 years old and 58.2% males were recruited. AP values were 134 ± 14/82 ± 10 mmHg for systolic and diastolic APCLIN, respectively. AP values were 122 ± 17 / 68 ± 12 mmHg for systolic and diastolic APMAPA, respectively. AP values were 125 ± 13/75 ± 7 mmHg for systolic and diastolic APAMPA, respectively. The systolic VB for the three above methods was significantly correlated being maximal between VBCLIN and VBAMPA (r = 0.45; 0 MAPA methods is weak. This observation suggests that these are not interchangeable methodologies. Future studies focused on the relationship between VB -with different methods- and vascular target organ damage would be of great help in order to define the best analytical method.

  12. Leer la ciudad. Itinerarios, mapas y paisajes urbanos en la novela argentina de 1880

    Directory of Open Access Journals (Sweden)

    Fabio Espósito

    2007-09-01

    Full Text Available Este trabajo reconstruye los diferentes mapas de la ciudad que se van trazando a partir de los itinerarios, las localizaciones y los vínculos de los personajes en algunas novelas argentinas aparecidas en la década de 1880, con el objeto de demostrar que esta cartografía urbana es el emergente de una estructura de sentimiento legitimadora de la hegemonía de una clase y que se conecta, a su vez, con la necesidad de reducir y simplificar las relaciones sociales cada vez más problemáticas de la ciudad moderna.

  13. Estrategias de aprendizaje: uves heuristicas y mapas mentales para evidenciar aprendizajes en matematicas

    OpenAIRE

    Muñoz, Ruth Edith; Obando, Jorge Alejandro

    2009-01-01

    La investigación estableció como objetivo medir el impacto de los Mapas Mentales y las UVES Heurísticas, en el incremento de las habilidades matemáticas en los estudiantes del programa de Ingeniería de Sistemas del tercer semestre de la Universidad Cooperativa de Colombia, tomándose como muestra representativa a 20 estudiantes a los cuales se les implemento un diseño cuasiexperimental de series cronológicas. Inicialmente los estudiantes dieron respuesta a una encuesta de tipo cualitativo mane...

  14. Literatura chilena en digital: mapas, estéticas y conceptualizaciones

    OpenAIRE

    Carolina Gaínza C.

    2017-01-01

    En el presente artículo se busca analizar una experiencia estética vinculada a lo digital, que tiene como principales componentes la posibilidad de interactuar, participar y manipular las obras creadas en este formato. Con tal fin, se presentará un mapa de la literatura digital en Chile, para luego profundizar en el análisis de dos aspectos que permiten caracterizar una estética de lo digital: la hipertextualidad y el hackeo cultural. A partir de estos elementos y tomando en cuenta que la lit...

  15. Mapas conceptuales como primera fase del diseño de bases de datos

    OpenAIRE

    Gómez Gauchía, Héctor

    2005-01-01

    En nuestra asignatura de Bases de Datos los alumnos no entienden el proceso de diseño de bases de datos fácilmente. Hemos descubierto que es un problema previo a donde empieza el diseño de base de datos habitual, el problema está en la fase de formación de conceptos. Nuestra propuesta consiste en incluir, en el proceso, el uso de mapas conceptuales. Y, así, representar conocimiento declarativo a un nivel muy bajo, usando conceptos relacionados con frases de enlac...

  16. El Mapa de la Incapacidad en España una necesidad urgente

    OpenAIRE

    Araceli López-Guillén García; José Manuel Vicente Pardo

    2015-01-01

    Resumen: Es urgente adaptar los sistemas de recogida de datos en incapacidad laboral para conseguir una mejor explotación epidemiológica de los mismos que facilite conocer la situación, análisis y planificación estratégica sobre incapacidad, creando con una base de datos mínimos básicos el Mapa de la Incapacidad en España permitiendo conocer las causas y el impacto de las situaciones de incapacidad laboral, practicar una gestión integral de recursos, prevenir las situaciones de incapacidad la...

  17. Las telecomunicaciones en Venezuela: el caso de Internet y los nuevos mapas de consumo

    OpenAIRE

    Lic. Migdalia Pineda de Alcázar

    1999-01-01

    El trabajo hace referencia a las tendencias de crecimiento de las telecomunicaciones venezolanas en la década de los noventa, especialmente en los servicios de telefonía celular, televisión por suscripción y conexiones a Internet, para detenerse en el comportamiento de los usuarios del país frente a la red de redes. Se demuestra con el análisis de datos y cifras, cómo es la inserción de Venezuela en el entorno mundial y cómo los "mapas" de usos nacionales están acentuando los desequilibrios s...

  18. Mapa conceitual: seu potencial como instrumento avaliativo Conceptual map: its potential as an assessment instrument

    Directory of Open Access Journals (Sweden)

    Nadia Aparecida de Souza

    2010-12-01

    Full Text Available Os instrumentos avaliativos são numerosos; dentre eles, o mapa conceitual é uma das alternativas. Entretanto, cumpre questionar: quais as vantagens e as limitações do mapa conceitual como instrumento avaliativo? Assim, o presente trabalho objetivou delinear e analisar as vantagens e as limitações inerentes ao uso do mapa conceitual como instrumento avaliativo. A pesquisa privilegiou a abordagem qualitativa, na forma do estudo de caso. Desenvolvido durante o primeiro semestre de 2006 com 32 alunas do 3º ano de um curso de Pedagogia de uma universidade pública paranaense, o estudo utilizou questionário, entrevista e observação para a coleta de dados. A análise de conteúdo clássica facultou determinar as aprendizagens decorrentes da vivência, bem como a incidência de diferentes aspectos enunciados como facilitadores ou limitadores na utilização do mapa conceitual como instrumento avaliativo. Estes foram analisados não como antagônicos, mas como facetas de um mesmo fenômeno e, por isso, complementares e interdependentes.There is a great variety of instruments to assess learning. Conceptual maps are questioned in this text, as one of these possibilities. The objectives of this study are to identify and analyze the advantages and limitations inherent to the use of conceptual maps as assessment instruments. In the study, especially the qualitative approach is used in a case study. It was carried out during the first semester of 2006, involving 32 3rd-year students of a pedagogy course at a public university in the state of Paraná. The research was based on a questionnaire, an interview and observation for data collection. The analysis of the material allowed us to determine the actual learning emerging from the experience, as well as the incidence of different aspects which might have facilitated or hindered the use of conceptual maps as assessment instruments. These aspects were analyzed, not as opposites, but as complementary

  19. Report and recommendations to the Minister regarding the environmental assessment report for Polsky Energy Corporation's proposed undertaking Brooklyn Energy Centre, Queens County, Nova Scotia

    International Nuclear Information System (INIS)

    Beanlands, G.; Glover, D.; Beviss, H.

    1993-01-01

    A public consultation review was undertaken to assess the suitability and environmental compatibility of Polsky Energy Corporation's proposal for a wood-fired cogeneration plant in Brooklyn, Nova Scotia. The plant would supply 21.3 MW of power to the provincial utility and steam to a local paper company. Public hearings were held in January 1993 and presentations were received from the project proponent and various intervenors. The concerns identified in the hearing included adequacy of the supply of wood wastes and the percentage of supplementary fuels required; air emissions and water-related effluents; ash disposal; monitoring; noise and traffic; socioeconomic impacts; and decommissioning. The hearing panel, appointed by the Nova Scotia Environmental Control Council, considered all the information received and concluded that the proposed facility will not cause significant or unacceptable risks to the natural and social environments of the surrounding community. This is contingent upon effective monitoring, appropriate guidance by regulatory agencies, and opportunities for continued liaison with the community. Conditions recommended by the panel include no operation of the plant using less than 70% wood as the principal fuel supply; conducting of a fuel audit every two years; reduction of the safety risk associated with the projected increase in truck traffic; continuous monitoring of stack emissions; and a requirement for a decommissioning plan as part of the permitting process. 3 refs., 1 fig

  20. EL MAPA COMO RECURSO DIDÁCTICO EN LA ENSEÑANZA Y APRENDIZAJE DE LA GEOGRAFÍA.

    Directory of Open Access Journals (Sweden)

    José Francisco Sancho Comíns

    1996-12-01

    Full Text Available Las nuevas tecnologías afirman el valor indiscutibledel mapa como recurso didáctico.Profesores y alumnos tienen ahora nuevosmedios a su disposición que pueden facilitar sutrabajo; la atención debe ponerse en evitar unposible "activismo" que sería tan pernicioso omás que la "inactividad". No se trata de hacercosas, mapas en nuestro caso, sino de pensar lascosas, los mapas. La clase de geografía confundede hecho, la teoría y la práctica, siempre fueasí y debe seguir siéndole; separar una de otrapuede suponer la infravaloración de alguna delas partes y con ello la pérdida de un beneficioseguro para profesor y alumno.

  1. Salud pública y propiedad intelectual en Cuba: mapa conceptual

    Directory of Open Access Journals (Sweden)

    Beatriz García Delgado

    Full Text Available OBJETIVO:El objetivo de este estudio es el análisis del marco legal de salud y propiedad intelectual en Cuba y su incidencia en las condiciones de acceso de la población a los recursos de salud y el papel de los diferentes actores sociales. METODOLOGÍA: Se utilizó la metodología desarrollada por la Organización Panamericana de la Salud para la ejecución del Proyecto Mapa Conceptual sobre Salud Pública y Propiedad Intelectual. RESULTADOS: La información recobrada en específico sobre el marco legal y su evolución en el tiempo en Cuba relacionado con el Sistema Nacional de Salud, el Sistema de Propiedad Intelectual y el fortalecimiento de la industria biofarmacéutica del país, fue procesada y analizada generando el Mapa Conceptual sobre Salud Pública y Propiedad Intelectual de Cuba. CONCLUSIONES: El análisis de la experiencia cubana en la adecuación de su marco legal y la evaluación de la interrelación de los actores sociales permite observar cómo la voluntad política existente a lo largo de varias décadas ha impactado de manera positiva en el acceso a la salud de la población.

  2. La cartografía como relato: intervenir los mapas, narrar las ciudades

    Directory of Open Access Journals (Sweden)

    Esperanza López Parada

    2013-11-01

    Full Text Available El misterio que rodea el mapa de la primera ciudad imperial azteca, publicado en la traducción latina de la Segunda Carta de Relación de Hernán Cortés –su origen, su orientación, su autoría, su sentido–, se ve acompañado por los cambios que, con un claro sesgo ideológico, introducen las reproducciones posteriores en las imprentas de toda Europa. Si no resultan menos enigmáticos los rasgos que, en cambio, permanecen inalterados, tampoco arrojan luz sus nuevos empleos, independizándose ya de la relación cortesiana para ilustrar más crónicas o completar la descripción de otras ciudades americanas. El estudio de la suerte de aquel plano de la ciudad conquistada, que algunos atribuyeron al propio Durero, tendrá que habérselas con el proceso complejísimo por el que una representación como la cartográfica –que se busca sea descriptiva, objetiva, exacta– alcanza en este caso los modos y maneras de una ficción o un espejismo, hasta dejar de funcionar como mapa únicamente para convertirse en un ramillete de relatos entrecruzados.

  3. ESTRATEGIA DE ENSEÑANZA DE MAPAS PERCEPTUALES / PERCEPTUAL MAP TEACHING STRATEGY

    Directory of Open Access Journals (Sweden)

    Mario Chipoco

    2016-12-01

    Full Text Available RESUMEN: Este documento contiene el diseño de una estrategia para enseñar mapas perceptuales en un curso de gerencia de marca, con la adición de una técnica de modelado para elaborarlos. Los mapas perceptuales son herramientas para el análisis del posicionamiento de marca, y se enseñan en cursos de pregrado y postgrado. Sin embargo, es muy usual utilizar un marco puramente descriptivo y teórico, sin explicar los mecanismos para construirlos. Se presentan métodos basados en regresión multilineal y en análisis factorial como herramientas de modelado, para explicar en clase y proporcionar una mejor comprensión de esta materia. ABSTRACT: This paper comprises the design of a strategy to teach perceptual mapping in a Brand Management course, adding a modeling technique in order to elaborate such maps. Perceptual maps are tools used to analyze the positioning of a brand, and are taught in undergraduate and graduate courses. However, very frequently a purely descriptive and theoretical framework is used, disregarding the mechanisms to construct them. Methods based on multiple linear regression and factorial analysis are presented as modeling tools to explain and foster a better understanding of this subject in class.

  4. [Model of Analysis and Prevention of Accidents - MAPA: tool for operational health surveillance].

    Science.gov (United States)

    de Almeida, Ildeberto Muniz; Vilela, Rodolfo Andrade de Gouveia; da Silva, Alessandro José Nunes; Beltran, Sandra Lorena

    2014-12-01

    The analysis of work-related accidents is important for accident surveillance and prevention. Current methods of analysis seek to overcome reductionist views that see these occurrences as simple events explained by operator error. The objective of this paper is to analyze the Model of Analysis and Prevention of Accidents (MAPA) and its use in monitoring interventions, duly highlighting aspects experienced in the use of the tool. The descriptive analytical method was used, introducing the steps of the model. To illustrate contributions and or difficulties, cases where the tool was used in the context of service were selected. MAPA integrates theoretical approaches that have already been tried in studies of accidents by providing useful conceptual support from the data collection stage until conclusion and intervention stages. Besides revealing weaknesses of the traditional approach, it helps identify organizational determinants, such as management failings, system design and safety management involved in the accident. The main challenges lie in the grasp of concepts by users, in exploring organizational aspects upstream in the chain of decisions or at higher levels of the hierarchy, as well as the intervention to change the determinants of these events.

  5. PRODUÇÃO DE UM MAPA PEDOLÓGICO ASSOCIANDO TÉCNICAS COMUNS AOS MAPEAMENTOS DIGITAIS DE SOLOS COM DELINEAMENTO MANUAL DE UNIDADES DE MAPEAMENTO

    Directory of Open Access Journals (Sweden)

    Rodrigo Teske

    2015-08-01

    Full Text Available A produção de mapas pedológicos por meio de técnicas do mapeamento digital de solos (MDS pode ser dificultada pela falta de mapas pedológicos tradicionais de referência. Nessas situações, o conhecimento tácito do mapeador pode ser usado para o delineamento manual das unidades de mapeamento (UMs a partir de geração de um mapa de ocorrência de tipos de solos preditos pelo MDS. Os objetivos deste estudo foram avaliar e comparar mapas de solos gerados por dois métodos, um denominado “MDS direto”, em que foi gerado um mapa preditor de UMs com base no modelo estabelecido com informações provenientes de um mapa pedológico convencional de referência preexistente, e outro em que o modelo preditor foi estabelecido a partir do exame de atributos morfológicos de 193 perfis de solo para identificar os tipos de solos, gerando-se um mapa com a indicação de ocorrência de tipos de solos sobre o qual foi realizado o delineamento manual das UMs, com base em mudanças das feições da superfície do solo. As predições foram feitas usando árvores de classificação Simple Cart,correlacionando oito variáveis do terreno com a ocorrência de UMs identificadas com nomes de classes de solos do Sistema Brasileiro de Classificação de Solos. A acurácia dos mapas foi avaliada pela “verdade de campo” (verificação em campo do tipo de solo ocorrente e comparação com o previsto no mapa e pela concordância dos mapas gerados com o mapa de referência. Quando avaliado pela “verdade de campo”, a acurácia do mapa gerado pelo método MDS direto foi de 74 %, enquanto a acurácia do mapa de MDS com delineamento manual foi de 79 %. Os dois métodos apresentaram resultados satisfatórios; o método que usou o delineamento manual e a identificação em alguns locais dos tipos de solo no campo apresentou a vantagem de não necessitar de mapas pedológicos de referência para o treinamento dos modelos preditores.

  6. El lenguaje cartográfico en los mapas temáticos

    Directory of Open Access Journals (Sweden)

    Membrado, Joan Carles

    2015-06-01

    Full Text Available This paper analyzes the effectiveness of maps as transmitters of information. To this end, some basic concepts concerning the properties of cartographic language are examined, with the aim of helping the reader design maps conveying geographic information as clearly as possible. It also describes the innate taste of geographers for maps –how these attract and stimulate them. Then it deals with the emergence of the Internet and the new technologies allowing massive map visualization, downloading and production. The paper is illustrated with ten thematic maps, in which visual variables (i.e. size, shape, value, color, orientation and texture are combined with the different marks (points, lines, areas used by mapmakers to represent data.Este artículo analiza la eficacia del mapa como transmisor de información. Para ello examina algunos conceptos básicos acerca de las propiedades del lenguaje cartográfico, con el objetivo de diseñar mapas en que la información geográfica se trasmita de la manera más clara posible. También describe el gusto innato de los geógrafos por los mapas –la atracción y el estímulo que estos suponen para ellos–, para ocuparse luego de la irrupción de Internet y las nuevas tecnologías que permiten la consulta, descarga y producción masivas de mapas. El artículo está ilustrado con once mapas temáticos, en cada uno de los cuales una o varias variables visuales (tamaño, forma, valor, tono, orientación, textura se combinan con alguno de los grafismos con que el cartógrafo puede plasmar una información (punto, línea, área. [fr] Cet article analyse l’efficacité de la carte comme transmetteur d’informations. À cet effet, on y examine certains concepts de base sur les propriétés du langage cartographique, afin de faciliter la conception de cartes où l’information géographique soit transmise le plus clairement possible. On y décrit également le goût inné des cartes qu’éprouvent les g

  7. Potential therapeutic strategies for non - muscle invasive bladder cancer based on association of intravesical immunotherapy with p - mapa and systemic administration of cisplatin and doxorubicin.

    Science.gov (United States)

    Dias, Queila Cristina; Nunes, Iseu da Silva; Garcia, Patrick Vianna; Favaro, Wagner Jose

    2016-01-01

    The present study describes the histopathological and molecular effects of P-MAPA (Protein aggregate magnesium-ammonium phospholinoleate-palmitoleate anhydride) intravesical immunotherapy combined with systemic doxorubicin or cisplatin for treatment of non-muscle invasive bladder cancer (NMIBC) in an appropriate animal model. Our results showed an undifferentiated tumor, characterizing a tumor invading mucosa or submucosa of the bladder wall (pT1) and papillary carcinoma in situ (pTa) in the Cancer group. The histopathological changes were similar between the combined treatment with intravesical P-MAPA plus systemic Cisplatin and P-MAPA immunotherapy alone, showing decrease of urothelial neoplastic lesions progression and histopathological recovery in 80% of the animals. The animals treated systemically with cisplatin or doxorubicin singly, showed 100% of malignant lesions in the urinary bladder. Furthemore, the combined treatment with P-MAPA and Doxorubicin showed no decrease of urothelial neoplastic lesions progression and histopathological recovery. Furthermore, Akt, PI3K, NF-kB and VEGF protein levels were significantly lower in intravesical P-MAPA plus systemic cisplatin and in intravesical P-MAPA alone treatments than other groups. In contrast, PTEN protein levels were significantly higher in intravesical P-MAPA plus systemic cisplatin and in intravesical P-MAPA alone treatments. Thus, it could be concluded that combination of intravesical P-MAPA immunotherapy and systemic cisplatin in the NMIBC animal model was effective, well tolerated and showed no apparent signs of antagonism between the drugs. In addition, intravesical P-MAPA immunotherapy may be considered as a valuable option for treatment of BCG unresponsive patients that unmet the criteria for early cystectomy. Copyright® by the International Brazilian Journal of Urology.

  8. Strategie tłumaczy wobec zjawiska obcości kulturowej w przekładach dwudziestowiecznej prozy nowogreckiej na język polski

    Directory of Open Access Journals (Sweden)

    Natalia Jędraszak

    2015-09-01

    Full Text Available Translation strategies in the face of cultural specificity of the 20th century Modern Greek prose translated into Polish According to Werner Koller, there are two main types of translations of texts which are connected to literature and culture. These types are adaptation and transfer. Adaptation is a result of using a translation strategy called domestication which consists in removing from the text all the elements which may seem odd or strange to the target reader and replacing them by some well-known units of the target culture. Transfer is a result of using a strategy called foreignization, that is of introducing to the target text some units characteristic of the source culture which may raise connotations of strangeness and foreignness. The choice of the strategy lies with the translator and depends on his vision of the target reader. The aim of this paper is to analyze translations of three Modern Greek novels into Polish with special attention paid to solutions chosen by the translators in the face of two main translation problems which are results of cultural specificity of the text: lexical problems and allusions to some historical, cultural and social facts as well as to the information these solutions provide on the translators’ vision of the target reader.   Strategie tłumaczy wobec zjawiska obcości kulturowej w przekładach dwudziestowiecznej prozy nowogreckiej na język polski Werner Koller wyróżnia dwa główne rodzaje przekładu tekstów związanych z literaturą i kulturą: adaptację oraz transfer. Adaptacja jest wynikiem użycia strategii tłumaczeniowej zwanej udomowieniem, która polega na usunięciu z tekstu elementów, które czytelnikowi docelowemu mogłyby wydać się obce i zastąpieniu ich dobrze znanymi mu elementami kultury docelowej. Transfer natomiast polega na zastosowaniu strategii zwanej egzotyzacją, tj. wprowadzeniu do tekstu docelowego elementów charakterystycznych dla kultury źródłowej, kt

  9. Binary and ternary VLE of the 2-(diethylamino)-ethanol (DEEA)/ 3-(methylamino)-propylamine (MAPA)/ water system

    DEFF Research Database (Denmark)

    Hartono, Ardi; Saleem, Fahad; Waseem Arshad, Muhammad

    2013-01-01

    A mixed 2-(diethylamino)-ethanol (DEEA) and 3-(methylamino)-propylamine (MAPA) system could be an attractive alternative solvent to improve the performance of CO2 capture for low partial pressure cases. This solvent has the advantages of forming two liquid phases upon CO2 loading, one rich in CO2......-T-x-y, activity coefficient, excess enthalpy and freezing point depression for both the binary and ternary systems. However, a small inconsistency was observed between water activity coefficients determined from ebulliometer and freezing point depression measurements.......A mixed 2-(diethylamino)-ethanol (DEEA) and 3-(methylamino)-propylamine (MAPA) system could be an attractive alternative solvent to improve the performance of CO2 capture for low partial pressure cases. This solvent has the advantages of forming two liquid phases upon CO2 loading, one rich in CO2...... understand this system in designing the separation unit requires substantial work on characterization of the solvent. One important aspect is to provide equilibrium data. In this work new ebulliometric VLE data for the binary DEEA/H2O and DEEA/MAPA systems and the ternary DEEA/MAPA/H2O system are reported...

  10. Mapa de Potencial Eólico de la provincia Holguín

    Directory of Open Access Journals (Sweden)

    Jorge Proenza Velázquez

    2007-01-01

    Full Text Available En este trabajo, se aplican el modelo de microescala WasP 8.2 y el sistema de información geográfica ArcView 3.0 para obtener el mapa de d ensidad de potencia media anual del flujo de energía a 50 m de altura de la provincia Holguín, donde se representan las principales zonas geográficas del territorio con potenciales eólicos óptimos para la utilización del viento en la producción de energía eléctrica mediante la instalación de turbinas eólicas o aerogeneradores.

  11. Mapas de inundación por tsunamis en Playas del Coco y Puntarenas, Costa Rica

    Directory of Open Access Journals (Sweden)

    Zamora Sauma, Natalia

    2010-12-01

    Full Text Available La presente investigación presenta algunos de los resultados obtenidos por el proyecto "Mapa de inundación por tsunamis para Costa Rica, primera fase, Puntarenas y Playas del Coco". Muestra los resultados obtenidos con respecto a simulaciones realizadas. Explica información del ambiente tectónico de la zona. Finalmente, expone algunas de las acciones de reducción del riesgo de inundación por tsunami y mitigación This investigation includes some of the results obtained in the project "Flood Map by Tsunamis in Costa Rica, First Stage: Puntarenas and Playas del Coco." It shows the results obtained as a result of simulations. It explains information about the tectonic environment of the zone. Finally, it exposes some of actions to reduce tsunami flood risk and mitigation

  12. Energy deposition patterns within limb models heated with a mini annular phased array (MAPA) applicator

    International Nuclear Information System (INIS)

    Guerquin-Kern, J.L.; Hagmann, M.J.; Charny, C.K.; Levin, R.L.

    1986-01-01

    A series of experiments has been carried out in order to characterize a MAPA applicator prior to possible clinical implementation. The energy deposition patterns were determined in several human limb models of different complexities. The maximum energy deposition observed in a homogeneous cylindrical phantom was found to be at the middle of the applicator. For more realistically shaped, homogeneous limb models, the point of maximum energy deposition was shifted towards a smaller cross-sectional region; this was also the case for isolated human legs. Furthermore, significant heating was observed in the bone of the isolated legs. Such phenomena illustrate the limitation of using classical 2-D numerical models for predicting the energy deposition patterns in heterogeneous bodies

  13. El Mapa de la Incapacidad en España una necesidad urgente

    Directory of Open Access Journals (Sweden)

    Araceli López-Guillén García

    2015-09-01

    Full Text Available Resumen: Es urgente adaptar los sistemas de recogida de datos en incapacidad laboral para conseguir una mejor explotación epidemiológica de los mismos que facilite conocer la situación, análisis y planificación estratégica sobre incapacidad, creando con una base de datos mínimos básicos el Mapa de la Incapacidad en España permitiendo conocer las causas y el impacto de las situaciones de incapacidad laboral, practicar una gestión integral de recursos, prevenir las situaciones de incapacidad laboral, potenciar los mecanismos de detección de la enfermedad y los aspectos preventivos de la salud laboral, mejorar la gestión sanitaria que precisa y la protección socio laboral. Conclusiones: Proponemos la base mínima de datos para la elaborar el Mapa de Incapacidad. Conociendo el impacto incapacitante de la pérdida de salud en la población trabajadora se procederá a una mejor gestión y adecuación de recursos atencionales, promocionales, preventivos, reintegradores, y prestacionales en torno a la incapacidad temporal y permanente. Conocer nuestra población "incapacitada (por enfermedad" es fundamental para cualquier análisis sobre impacto y necesidades de protección social, para contrastarla con la población activa, la población en formación o inactiva previa a la edad laboral, y la población inactiva jubilada.

  14. A three-dimensional thermal and electromagnetic model of whole limb heating with a MAPA.

    Science.gov (United States)

    Charny, C K; Levin, R L

    1991-10-01

    Previous studies by the authors have shown that if properly implemented, the Pennes assumptions can be applied to quantify bioheat transfer during extremity heating. Given its relative numerical simplicity and its ability to predict temperatures in thermoregulated tissue, the Pennes model of bioheat transfer was utilized in a three-dimensional thermal model of limb heating. While the arterial blood temperature was assumed to be radially uniform within a cross section of the limb, axial gradients in the arterial and venous blood temperatures were computed with this three-dimensional model. A realistically shaped, three-dimensional finite element model of a tumor-bearing human lower leg was constructed and was "attached" mathematically to the whole body thermal model of man described in previous studies by the authors. The central as well as local thermoregulatory feedback control mechanisms which determine blood perfusion to the various tissues and rate of evaporation by sweating were input into the limb model. In addition, the temperature of the arterial blood which feeds into the most proximal section of the lower leg was computed by the whole body thermal model. The variations in the shape of the tissues which comprise the limb were obtained from computerized tomography scans. Axial variations in the energy deposition patterns along the length of the limb exposed to a miniannular phased array (MAPA) applicator were also input into this model of limb heating. Results indicate that proper positioning of the limb relative to the MAPA is a significant factor in determining the effectiveness of the treatment. A patient-specific hyperthermia protocol can be designed using this coupled electromagnetic and thermal model.

  15. Effects of P-MAPA Immunomodulator on Toll-Like Receptors and p53: Potential Therapeutic Strategies for Infectious Diseases and Cancer

    Directory of Open Access Journals (Sweden)

    Fávaro Wagner J

    2012-06-01

    Full Text Available Abstract Background Compounds that can act as agonists for toll-like receptors (TLRs may be promising candidates for the development of drugs against infectious diseases and cancer. The present study aimed to characterize the immunomodulatory effects of P-MAPA on TLRs in vitro and in vivo, as well as to investigate its potential as adjuvant therapy in infectious diseases and cancer. Methods For these purposes, the activity of P-MAPA on TLRs was assayed in vitro through NF-κB activation in HEK293 cells expressing a given TLR, and using an in vivo animal model for bladder cancer (BC. The antimicrobial activity of P-MAPA was tested against Mycobacterium tuberculosis (TB in vitro in an MIC assay, and in vivo using an aerosol infection model of murine tuberculosis. Antitumor effects of P-MAPA were tested in an animal model with experimentally induced BC. Moxifloxacin (MXF and Bacillus Calmette-Guerin (BCG were used as positive controls in the animal models. Results The results showed that P-MAPA, administered alone or in combination with MXF, induced significant responses in vivo against TB. In contrast, the compound did not show antimicrobial activity in vitro. P-MAPA showed a significant stimulatory effect on human TLR2 and TLR4 in vitro. In BC, TLR2, TLR4 and p53 protein levels were significantly higher in the P-MAPA group than in the BCG group. The most common histopathological changes in each group were papillary carcinoma in BC group, low-grade intraepithelial neoplasia in BCG group and simple hyperplasia in P-MAPA group. Concerning the toxicological analysis performed during BC treatment, P-MAPA did not show evidence for hepatotoxicity and nephrotoxicity. Conclusions In conclusion, P-MAPA acted as TLR ligand in vitro and improved the immunological status in BC, increasing TLR2 and TLR4 protein levels. P-MAPA immunotherapy was more effective in restoring p53 and TLRs reactivities and showed significantly greater antitumor activity than BCG

  16. Effects of P-MAPA Immunomodulator on Toll-Like Receptors and p53: Potential Therapeutic Strategies for Infectious Diseases and Cancer.

    Science.gov (United States)

    Fávaro, Wagner J; Nunes, Odilon S; Seiva, Fabio Rf; Nunes, Iseu S; Woolhiser, Lisa K; Durán, Nelson; Lenaerts, Anne J

    2012-06-18

    Compounds that can act as agonists for toll-like receptors (TLRs) may be promising candidates for the development of drugs against infectious diseases and cancer. The present study aimed to characterize the immunomodulatory effects of P-MAPA on TLRs in vitro and in vivo, as well as to investigate its potential as adjuvant therapy in infectious diseases and cancer. For these purposes, the activity of P-MAPA on TLRs was assayed in vitro through NF-κB activation in HEK293 cells expressing a given TLR, and using an in vivo animal model for bladder cancer (BC). The antimicrobial activity of P-MAPA was tested against Mycobacterium tuberculosis (TB) in vitro in an MIC assay, and in vivo using an aerosol infection model of murine tuberculosis. Antitumor effects of P-MAPA were tested in an animal model with experimentally induced BC. Moxifloxacin (MXF) and Bacillus Calmette-Guerin (BCG) were used as positive controls in the animal models. The results showed that P-MAPA, administered alone or in combination with MXF, induced significant responses in vivo against TB. In contrast, the compound did not show antimicrobial activity in vitro. P-MAPA showed a significant stimulatory effect on human TLR2 and TLR4 in vitro. In BC, TLR2, TLR4 and p53 protein levels were significantly higher in the P-MAPA group than in the BCG group. The most common histopathological changes in each group were papillary carcinoma in BC group, low-grade intraepithelial neoplasia in BCG group and simple hyperplasia in P-MAPA group. Concerning the toxicological analysis performed during BC treatment, P-MAPA did not show evidence for hepatotoxicity and nephrotoxicity. In conclusion, P-MAPA acted as TLR ligand in vitro and improved the immunological status in BC, increasing TLR2 and TLR4 protein levels. P-MAPA immunotherapy was more effective in restoring p53 and TLRs reactivities and showed significantly greater antitumor activity than BCG. The activation of TLRs and p53 may provide a hypothetical

  17. Impacto na reclassificação da hipertensão pela Monitorização Ambulatorial da Pressão Arterial (MAPA segundo a V Diretriz Brasileira de MAPA

    Directory of Open Access Journals (Sweden)

    Daniel Forestiero

    2013-02-01

    Full Text Available FUNDAMENTOS: Novas recomendações sobre valores de referência para normalidade em exames de monitorização ambulatorial da pressão arterial (MAPA foram propostas pela V Diretriz Brasileira de Monitorização Ambulatorial da Hipertensão Arterial, com base principalmente no estudo IDACO. OBJETIVOS: O presente estudo epidemiológico tem o objetivo de avaliar o impacto da adoção desses novos critérios em um ambulatório de referência em hipertensão arterial. MÉTODOS: Foram analisados resultados de 1.567 exames de MAPA realizados entre 2005 e 2010, excluídos 481 pacientes da amostra por não preencherem critérios mínimos de qualidade do exame. Para a classificação desses exames quanto à anormalidade, foram utilizados os valores de referência da IV Diretriz Brasileira de MAPA (2005 e comparados com as mudanças propostas na V Diretriz Brasileira de MAPA (2011. Foi realizada análise estatística pelo método do Q² de Pearson, considerando-se p significativo < 0,05. RESULTADOS: Para os 1.086 exames avaliados, houve importante diferença na proporção de pacientes com MAPA alterado, em especial para a variável pressão arterial sistólica do sono: 49% adotando os valores de corte de 2005 e 71% adotando os de 2011, com significância estatística, p < 0,0001. CONCLUSÕES: A recomendação da nova diretriz causou grande impacto na classificação da hipertensão pelos exames de MAPA dentro da população estudada. A questão sobre os limiares desses exames para metas terapêuticas de pacientes sabidamente hipertensos ainda está em aberto e carece de mais estudos, preferencialmente nacionais, para melhor definição do assunto.

  18. A mucus adhesion promoting protein, MapA, mediates the adhesion of Lactobacillus reuteri to Caco-2 human intestinal epithelial cells.

    Science.gov (United States)

    Miyoshi, Yukihiro; Okada, Sanae; Uchimura, Tai; Satoh, Eiichi

    2006-07-01

    Lactobacillus reuteri is one of the dominant lactobacilli found in the gastrointestinal tract of various animals. A surface protein of L. reuteri 104R, mucus adhesion promoting protein (MapA), is considered to be an adhesion factor of this strain. We investigated the relation between MapA and adhesion of L. reuteri to human intestinal (Caco-2) cells. Quantitative analysis of the adhesion of L. reuteri strains to Caco-2 cells showed that various L. reuteri strains bind not only to mucus but also to intestinal epithelial cells. In addition, purified MapA bound to Caco-2 cells, and this binding inhibited the adhesion of L. reuteri in a concentration-dependent manner. Based on these observations, the adhesion of L. reuteri appears due to the binding of MapA to receptor-like molecules on Caco-2 cells. Further, far-western analysis indicated the existence of multiple receptor-like molecules in Caco-2 cells.

  19. Effects of P-MAPA immunomodulator on Toll-like receptor 2, ROS, nitric oxide, MAPKp38 and IKK in PBMC and macrophages from dogs with visceral leishmaniasis.

    Science.gov (United States)

    Melo, L M; Perosso, J; Almeida, B F M; Silva, K L O; Somenzari, M A; de Lima, V M F

    2014-02-01

    Leishmania (L.) chagasi is the etiologic agent of visceral leishmaniasis (VL) that can be transmitted to humans and dogs. VL in Brazil represents a serious public health problem; therefore, it is important to study new alternatives to treat infected dogs. In dogs, the therapeutic arsenal against canine VL is limited. The immunomodulator protein aggregate magnesium-ammonium phospholinoleate-palmitoleate anhydride (P-MAPA) improves immunocompetence when the immune system is impaired, but its dependence on Toll-like receptors (TLRs) and the mechanisms involved in immune response remain unclear. The in vitro action of P-MAPA on the expression of TLR2 and TLR4, reactive oxygen species (ROS), nitric oxide (NO) and p38 mitogen-activated protein kinase (p38 MAPK) and IKK phosphorylation was studied in mononuclear cells from peripheral blood and macrophages from healthy and Leishmania-infected dogs. The PBMC or macrophages were isolated and cultured with different concentrations of P-MAPA (20,100 and 200 μg/ml) in a humid environment at 37°C with 5% CO(2). Observation revealed that Leishmania-infected dogs showed a decrease in TLR2 in macrophages compared with healthy dogs and in induction with P-MAPA. ROS were increased in PBMCs from Leishmania spp.-infected dogs compared with healthy dogs and P-MAPA improved ROS production. NO production was increased in culture supernatant from macrophages stimulated by P-MAPA in both healthy and Leishmania spp. infected dogs. Treatment of macrophages from healthy dogs with immunomodulatory P-MAPA induced p38 MAPK and IKK phosphorylation, suggesting signal transduction by this pathway. These findings suggest that P-MAPA has potential as a therapeutic drug in the treatment of canine visceral leishmaniasis. Copyright © 2014 Elsevier B.V. All rights reserved.

  20. Con en el desierto en el cuerpo. Mapas performáticos de jóvenes chilenas

    Directory of Open Access Journals (Sweden)

    Jimena Silva

    2014-01-01

    Full Text Available Para comprender las ideologías basadas en el género, esta es una investigación cualitativaque usóun modelo metodológico basado en mapas corporales, entrevistas y análisis intertextual de 47 estudiantes antofagastinas de las zonas mineras del norte chileno. En el análisis interpretativo de los elementos simbólicos en los mapas corporales se encontró que los mineros ven metafóricamente el cuerpo femenino como: cuerpo/mina, como agujero/penetrable (mujer como objeto sexual donde puede extraerse tesoro/riqueza. Las expresiones del cuerpo femenino, en tanto agente/transformador establecen un diálogo tenso en el que el poder de la mujer es perturbador en una cultura en la que el hombre es dominador. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs140175

  1. EL USO DE LOS MAPAS EN LA DIVERSIFICACIÓN CURRICULAR

    Directory of Open Access Journals (Sweden)

    Ramón López Domenech

    2002-12-01

    Full Text Available Resumen:Los alumnos de Diversificación Cumcular de la ESO (Ámbito Sociolingüisticodeben apren- der conceptos fundamentales de cartografía, Geografía Física, relieve, climatología y Geografía Urbana usando en el aula los sistemas de representaciónde todos esos conceptos, haciendo sus pro- pios mapas y gráficos y trabajando sobre ellos. Es cierto que toda Laenseñanza secundariadebe ser lo más práctica posible, pero en el caso de la Diversificación las actividades prácticas son básicas para desarrollar el método constructivista, propio de este nivel de enseñanza. Palabras clave:Programa de Diversificación, Sistemas de representación gráfica, Mapa, Planos, Trabajo Práctico en el aula, Método constructivista.Abstract:In ihe Secondary Diversification of Social Sciences pupils are to learn the basic elements ahout cartography, Physical Geography, mountains, climate and City Geography using in the classroom the graphics systems of representation for al1 of theses items, making iheir own maps and graphics and working on them. Certainly, the whole Secondary School system of work should be as pmcti- cal as possible, but in the Diversification Program the practica1 activities are basic for the develop ment of the Constructivistic Method, special for this school level. Keywords:Diversification, Graphic, Representation Systems, Maps, Plains, Practical scholar work, Constructivistic Method.Résumé:A I'école Secondaire, les élkves de Diversification Sócio-Linguistique (dont le Cumculum est appropié a ces éleves doivent apprendre des concepts fundamentaux de cartographie, Géographie Physique, relief, climatologie et Geographie Urbaine, en utilisant en classe les systémes de répre- sentation de tous ces concepts, faisant leun propes cartes et graphiques et travaillant sut tout cela. En effet, il est vrai que tout I'enseignement secondaire doit &re le plus pratique possible, mais dans ce cas la, les ativités pratiques concemant

  2. The Modernization of the Energy Sector in Poland vs. Poland's Energy Security / Modernizacja sektora energii w polsce a bezpieczeństwo energetyczne Polski

    Science.gov (United States)

    Frączek, Paweł; Kaliski, Maciej; Siemek, Paweł

    2013-06-01

    The paper discusses the essence of Poland's energy security, decisive factors for its attainment and the structure of primary energy sources of the country. It describes the main problem areas in functioning of the energy sector in Poland, as well as the conditions for its modernization. The issues of increasing the natural gas share in the country's structure of primary energy sources and a construction of the first nuclear power plant in Poland have been particularly emphasised. The paper stresses that without modernizing actions it will be impossible for Poland to fulfil international obligations concerning changes in the functioning of the energy sector. The study, analysing the conditions for increasing the role of natural gas in Poland, points at the necessity to expand the gas infrastructure, to increase a scale of gas production from domestic deposits and to complete liberalization of the energy industry. It also emphasises that a potential delay in the construction of the country's first nuclear power plant may limit competitiveness of the economy. W artykule omówiono istotę bezpieczeństwa energetycznego Polski, czynniki decydujące o jego osiągnięciu oraz strukturę źródeł energii pierwotnej w kraju. Przedstawiono główne problemy funkcjonowania sektora energii w Polsce oraz uwarunkowania jego modernizacji. Szczególny nacisk położono na kwestie zwiększenia udziału gazu ziemnego w krajowej strukturze źródeł energii pierwotnej oraz budowy pierwszej elektrownii atomowej w Polsce. Podkreślono, że bez podjęcia działań modernizacyjnych niemożliwe będzie wypełnienie zobowiązań międzynarodowych Polski dotyczących zmian w sposobie funkcjonowania sektora energii. Analizując uwarunkowania zwiększenia znaczenia gazu ziemnego w Polsce, wskazano na konieczność rozbudowy infrastruktury gazowniczej, zwiększenia skali wydobycia gazu ziemnego z krajowych złóż oraz na kwestię dokończenia liberalizacji branży. Podkreślono, że dla zwi

  3. Specific degradation of the mucus adhesion-promoting protein (MapA) of Lactobacillus reuteri to an antimicrobial peptide.

    Science.gov (United States)

    Bøhle, Liv Anette; Brede, Dag Anders; Diep, Dzung B; Holo, Helge; Nes, Ingolf F

    2010-11-01

    The intestinal flora of mammals contains lactic acid bacteria (LAB) that may provide positive health effects for the host. Such bacteria are referred to as probiotic bacteria. From a pig, we have isolated a Lactobacillus reuteri strain that produces an antimicrobial peptide (AMP). The peptide was purified and characterized, and it was unequivocally shown that the AMP was a well-defined degradation product obtained from the mucus adhesion-promoting protein (MapA); it was therefore termed AP48-MapA. This finding demonstrates how large proteins might inherit unexpected pleiotropic functions by conferring antimicrobial capacities on the producer. The MapA/AP48-MapA system is the first example where a large protein of an intestinal LAB is shown to give rise to such an AMP. It is also of particular interest that the protein that provides this AMP is associated with the binding of the bacterium producing it to the surface/lining of the gut. This finding gives us new perspective on how some probiotic bacteria may successfully compete in this environment and thereby contribute to a healthy microbiota.

  4. From proteomics to systems biology: MAPA, MASS WESTERN, PROMEX, and COVAIN as a user-oriented platform.

    Science.gov (United States)

    Weckwerth, Wolfram; Wienkoop, Stefanie; Hoehenwarter, Wolfgang; Egelhofer, Volker; Sun, Xiaoliang

    2014-01-01

    Genome sequencing and systems biology are revolutionizing life sciences. Proteomics emerged as a fundamental technique of this novel research area as it is the basis for gene function analysis and modeling of dynamic protein networks. Here a complete proteomics platform suited for functional genomics and systems biology is presented. The strategy includes MAPA (mass accuracy precursor alignment; http://www.univie.ac.at/mosys/software.html ) as a rapid exploratory analysis step; MASS WESTERN for targeted proteomics; COVAIN ( http://www.univie.ac.at/mosys/software.html ) for multivariate statistical analysis, data integration, and data mining; and PROMEX ( http://www.univie.ac.at/mosys/databases.html ) as a database module for proteogenomics and proteotypic peptides for targeted analysis. Moreover, the presented platform can also be utilized to integrate metabolomics and transcriptomics data for the analysis of metabolite-protein-transcript correlations and time course analysis using COVAIN. Examples for the integration of MAPA and MASS WESTERN data, proteogenomic and metabolic modeling approaches for functional genomics, phosphoproteomics by integration of MOAC (metal-oxide affinity chromatography) with MAPA, and the integration of metabolomics, transcriptomics, proteomics, and physiological data using this platform are presented. All software and step-by-step tutorials for data processing and data mining can be downloaded from http://www.univie.ac.at/mosys/software.html.

  5. Specific Degradation of the Mucus Adhesion-Promoting Protein (MapA) of Lactobacillus reuteri to an Antimicrobial Peptide ▿

    Science.gov (United States)

    Bøhle, Liv Anette; Brede, Dag Anders; Diep, Dzung B.; Holo, Helge; Nes, Ingolf F.

    2010-01-01

    The intestinal flora of mammals contains lactic acid bacteria (LAB) that may provide positive health effects for the host. Such bacteria are referred to as probiotic bacteria. From a pig, we have isolated a Lactobacillus reuteri strain that produces an antimicrobial peptide (AMP). The peptide was purified and characterized, and it was unequivocally shown that the AMP was a well-defined degradation product obtained from the mucus adhesion-promoting protein (MapA); it was therefore termed AP48-MapA. This finding demonstrates how large proteins might inherit unexpected pleiotropic functions by conferring antimicrobial capacities on the producer. The MapA/AP48-MapA system is the first example where a large protein of an intestinal LAB is shown to give rise to such an AMP. It is also of particular interest that the protein that provides this AMP is associated with the binding of the bacterium producing it to the surface/lining of the gut. This finding gives us new perspective on how some probiotic bacteria may successfully compete in this environment and thereby contribute to a healthy microbiota. PMID:20833791

  6. Nuevos migrantes, viejos racismos: Los mapas parlantes y la niñez migrante en Chile

    Directory of Open Access Journals (Sweden)

    Dery Lorena Suárez-Cabrera

    2015-07-01

    Full Text Available (descriptivo: El objetivo en este texto es exponer cómo la niñez migrante está siendo configurada como un nuevo sujeto problemático de los fenómenos migratorios en Chile, a partir de una focalización sobre la niñez proveniente del Perú y de la invisibilización de otros sujetos infantiles, señalando cuándo la migración es concebida como una amenaza desde diferentesescenarios sociales. En este sentido se expone una reflexión epistemológica y metodológica que lleva hacia otros senderos de las ciencias sociales y del “conocimiento como emancipación”, para retomar los mapas parlantes de la “Investigación Acción Participativa”; esto se hace con el fin de poner en relieve tales discursos estigmatizantes y visibilizar a la niñez migrante como sujeto de la experiencia desde sus narrativas identitarias.

  7. Communicative maps and challenges in the digital era = Mapas comunicativos e desafios na era digital

    Directory of Open Access Journals (Sweden)

    Hung, Elías Said

    2009-01-01

    Full Text Available O presente artigo realiza um trabalho reflexivo iniciado na tese apresentada pelo autor (Said, 2006 no Doutorado "Tecnologia, estruturas e tratamento da informação" da Universidad Complutense de Madrid. A partir deste trabalho avançou-se para a SIC, que se refere à sociedade da informação e do conhecimento, digitalização, telemática e propôs também um termo que se espera venha a ser recebido com interesse pela comunidade acad~emica e profissionais relacionados com o assunto tratado neste texto: mapas comunicativos, que será apresentado neste artigo, com o objetivo de contribuir para a geração de propostas que conduzam a soluções sobre como lidar com os desafios comunicativos colocados pelas realidades sócio-culturais, políticas e econômicas específicas das nossas sociedades

  8. Mapa mondi (Catalan Atlas of 1375), Majorcan cartographic school, and 14th century Asia

    Science.gov (United States)

    Lišèák, Vladimír

    2018-05-01

    This paper deals with the Mapa mondi drawn and written in about 1375. It is my starting study about this important map of the medieval period in the Catalan language and the finest work to come from the Majorcan cartographic school of the fourteenth century. The aim of this paper is to give a general overview of the publication with some details on descriptions of the portion of Asia, and in more details as regards China. This map is known also as the Catalan Atlas, because it is composed of several tables sketching out the world known at that time, from the Atlantic Coast of Europe to the Pacific Coast of East Asia. The main sources for the eastern parts of the world were travelogues of Marco Polo, John Mandeville, and Odoric of Pordenone. The presumable author of the Catalan Atlas, Cresques Abra-ham (1325-1387), a Jewish cartographer from Palma, was "master of mappæ mundi and compasses" to Peter IV (III), the King of Aragon. He worked on the atlas with his son Jehudà, who after the Aragonese persecutions of 1391, converted to Christianity. The atlas contained the latest information on Africa, Asia, and China and was considered to be the most complete picture of geographical knowledge as it stood in the later Middle Ages. The translations of original texts and interpretations, based on facsimiles of original source and on secondary sources until 2016, will be a part of this paper.

  9. Mapas cognitivos na avaliação da Aprendizagem Baseada em Problemas

    Directory of Open Access Journals (Sweden)

    Adriana Casale

    2011-01-01

    Full Text Available El objetivo de este estudio es investigar el aprovechamiento de los estudiantes del curso de Ingeniería Civil en el que fue aplicado el método "Aprendizaje Basado en Problemas" (PBL como parte de innovaciones pedagógicas implementadas en una asignatura del area de Ingeniería de Transportes. Para analisar el aprovechamiento de la muestra sometida a las alternativas instruccionales fueron utilizadas las respuestas de los estudiantesa un cuestionario para evaluación del aprendizaje elaborado por el profesor. Este instrumento contribuyó para evaluar y comparar el aprendizaje de la muestra con un grupo de alumnos sometidos al modelo tradicional de enseñanza. Las respuestas fueron agrupadas y analisadas por medio de mapas cognitivos, contribuyendo con la investigación de los efectos del método PBL y de la ocurrencia de aprovechamientos diferenciados entre los alumnos. Los resultados indican que los estudiantes obtuvieron mejor envolvimiento, desarrollos de comportamientos y actitudes, compromiso con el propio aprendizaje y un aprovechamiento significativamente mejor con el nuevo diseño de la asignatura.

  10. Nuevos migrantes, viejos racismos: Los mapas parlantes y la niñez migrante en Chile

    Directory of Open Access Journals (Sweden)

    Dery Lorena Suárez-Cabrera

    2015-01-01

    Full Text Available El objetivo en este texto es exponer cómo la niñez migrante estásiendo configurada como un nuevo sujeto problemático de los fenómenos migratorios en Chile,a partir de una focalización sobre la niñez proveniente del Perú y de la invisibilización de otrossujetos infantiles, señalando cuándo la migración es concebida como una amenaza desde diferentesescenarios sociales. En este sentido se expone una reflexión epistemológica y metodológica que llevahacia otros senderos de las ciencias sociales y del “conocimiento como emancipación”, para retomarlos mapas parlantes de la “Investigación Acción Participativa”; esto se hace con el fin de poner enrelieve tales discursos estigmatizantes y visibilizar a la niñez migrante como sujeto de la experienciadesde sus narrativas identitarias.

  11. Poland’s Innovativeness Against The Background Of EU Countries (Recent Research Results / Innowacyjność Polski Na Tle Krajów Ue (Najnowsze Wyniki Badań

    Directory of Open Access Journals (Sweden)

    Mikołajczyk Bożena

    2015-06-01

    Full Text Available Innowacyjność Europy stała się celem UE już w Strategii Lizbońskiej. W nowej Strategii Europa 2020 jednym z celów jest rozwój inteligentny czyli oparty na wiedzy i innowacji. Wymaga to podniesienia jakości edukacji, wyników działalności badawczej, transferu wiedzy i innowacji między krajami i większej komercjalizacji wyników badań. Stąd pomiar innowacyjności ewaluuje by ująć czynniki, które decydują o poziomie innowacyjności gospodarek. Stąd celem opracowania jest przedstawienie poziomu innowacyjności Polski na tle krajów UE za pomocą SII (Summary Innovation Index.

  12. Badania wykorzystania przez polskie biblioteki naukowe środków europejskich, grantów ministerialnych i samorządowych oraz dotacji sponsorów w latach 2000-2008

    Directory of Open Access Journals (Sweden)

    Aldona Chachlikowska

    2009-01-01

    Full Text Available Badania dotyczące pozyskiwania środków pomocowych przez polskie biblioteki naukowe przeprowadzone zostały w ramach wewnętrznych projektów badawczych Biblioteki Uniwersyteckiej w Poznaniu. Realizacji projektu podjął się Oddział Prac Naukowych, Wydawniczych i Dydaktycznych BU. Zadanie wykonano od września 2008 do czerwca 2009 roku. Zamierzeniem autorek artykułu było uzyskanie pełnej informacji na temat środków pozabudżetowych pozyskiwanych przez polskie biblioteki naukowe oraz określenie stopnia ich wykorzystania. Zastosowano metodę sondażu diagnostycznego z wykorzystaniem techniki ankiety. Przygotowany kwestionariusz ankiety wraz z informacją dla respondentów o celu prowadzonych badań skierowano do wszystkich bibliotek uniwersyteckich, bibliotek głównych uczelni technicznych, medycznych, ekonomicznych, bibliotek akademii wychowania fizycznego, uczelni pedagogicznych i rolniczych oraz do bibliotek publicznych posiadających status bibliotek naukowych. Łącznie wysłano 70 ankiet, odpowiedzi udzieliło 38 respondentów. Wskazany w artykule okres 2000-2008 był czasem zwiększonych możliwości uzyskiwania dodatkowych funduszy przez biblioteki. Najczęściej otrzymywane fundusze to dotacje ministerialne, dalej środki sponsorów na działalność podstawową. W poważnym stopniu wspierały biblioteki, głównie biblioteki publiczne, lokalne samorządy. Zauważalne były dotacje wspierające biblioteki przekazywane przez fundacje i środki ofiarowane przez sponsorów na działalność organizacyjną; ewenementem natomiast – subwencje unijne.

  13. Gombrowicz a polski film fabularny

    Directory of Open Access Journals (Sweden)

    Jacek Nowakowski

    2013-01-01

    Full Text Available This article presents the influence that Witold Gombrowicz’s work has had on Polish cinema. It covers several generations of directors, for example, Andrzej Munk (born in the 1920s, Roman Polański and Jerzy Skolimowski (born in the 1930 as well as Agnieszka Holland, Piotr Szulkin and Marek Koterski (born in the 1940s and 1950s, and discusses the topic of film adaptations of his books (Jerzy Skolimowski’s Ferdydurke and Jan Jakub Kolski’s Pornografia [Pornography]. The article shows that Polish cinema uses Gombrowicz’s works most of all by taking up the issue of life’s authenticity and inauthenticity as well as to demythologize Polish tradition and history. As for esthetics, it employs Gombrowicz’s favorite style, i.e. the grotesque.

  14. Mapa de usos potenciales de la tierra de Galicia. Una perspectiva arqueológica

    Directory of Open Access Journals (Sweden)

    Currás Refojos, Brais X.

    2014-06-01

    Full Text Available A digital version of the map of potential land use of Galicia is here presented, adapted to a reclassification of three types of potential land use, established using historical criteria. An analytical procedure is developed to select the land-types and the system used for their digitalisation. In the final part the map is used to critically revise the possibilities of using this record for territorial characterisation in archaeological research.La cartografía de usos potenciales de la tierra es una herramienta de gran utilidad en el estudio de las formas de poblamiento y su relación con la explotación de los recursos agrícolas desde el enfoque de la arqueología del paisaje. La digitalización de esta información permite su aplicación sistemática en el análisis del territorio mediante SIG. En este trabajo se presenta el Mapa de usos potenciales de la tierra de Galicia, reclasificado en tres tipos establecidos en función de criterios históricos. Se muestra el procedimiento analítico desarrollado para la selección y clasificación de los tipos de tierra y su sistema de digitalización. Se examina la validez de esta fuente para la investigación arqueológica de las formas agrícolas en la antigu.edad desde el punto de vista del análisis del territorio y se ofrece una visión crítica sobre sus ventajas y limitaciones.

  15. O mapa íntimo: três telas de Frida Kahlo Frida Kahlo's intimate map

    Directory of Open Access Journals (Sweden)

    Fabiano Seixas Fernandes

    2008-04-01

    Full Text Available O artigo apresenta análises de três telas da pintora mexicana Frida Kahlo - Las dos Fridas, Autorretrato en la frontera entre México y Estados Unidos e Lo que el agua me dio - e está dividido em três partes, cada qual tratando de uma tela em particular, para, no momento seguinte, ligar seu estudo ao das demais. Norteia a leitura das primeiras a discussão da relação nacional/estrangeiro no trabalho de Kahlo; a análise da terceira mostra a superação da dicotomia através do conceito de mapa íntimo, no qual entra em cena uma tênue e instável territorialização da memória através da representação pictórica.This article analyses three works by Mexican painter Frida Kahlo: Las dos Fridas (The Two Fridas, Autorretrato en la frontera entre México y Estados Unidos (Self-Portrait on the Borderline between Mexico and the United States, and Lo que el agua me dio (What the Water Gave Me. Each work is first analyzed separately and then connected with the others. The analysis of the first two is guided by the national/foreign dichotomy present in Kahlo; the analysis of the third shows the overcoming of the dichotomy through the concept of intimate map - in which a feeble and ever-changing territorialization of memory via plastic expression comes to show.

  16. Modelo multicritério aditivo na geração de mapas de suscetibilidade à erosão em área rural

    Directory of Open Access Journals (Sweden)

    Gustavo Souza Valladares

    2012-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a geração de um mapa de suscetibilidade à erosão, em área rural, no Município de Guararapes, SP, por meio de modelo multicritério aditivo. Foram utilizados mapas digitais dos temas: relevo (declividade e comprimento das rampas; pedologia (obtida em campo; uso e cobertura das terras da região; e interpretação do modelo digital de elevação. Os mapas digitais foram tratados em ambiente de sistema de informação geográfica, por meio do método multicritério aditivo, e validados pelo modelo da equação universal de perda de solo (USLE. Foram geradas cinco classes de suscetibilidade à erosão: baixa, moderada, alta, muito alta e altíssima. O mapa de risco obtido por multicritério aditivo teve boa correspondência com o modelo USLE. O mapa de suscetibilidade à erosão pode ser aplicado ao planejamento agrícola e ambiental da área rural do Município de Guararapes.

  17. Natural killer cell activity, lymphocyte proliferation, and cytokine profile in tumor-bearing mice treated with MAPA, a magnesium aggregated polymer from Aspergillus oryzae.

    Science.gov (United States)

    Justo, G Z; Durán, N; Queiroz, M L S

    2003-08-01

    The present study examined the effects of MAPA, an antitumor aggregated polymer of protein magnesium ammonium phospholinoleate-palmitoleate anhydride, isolated from Aspergillus oryzae, on concanavalin A (Con A)-induced spleen cell proliferation, cytokine production and on natural killer (NK) cell activity in Ehrlich ascites tumor-bearing mice. The Ehrlich ascites tumor (EAT) growth led to diminished mitogen-induced expansion of spleen cell populations and total NK activity. This was accompanied by striking spleen enlargement, with a marked increase in total cell counts. Moreover, a substantial enhancement in IL-10 levels, paralleled by a significant decrease in IL-2 was observed, while production of IL-4 and interferon-gamma (IFN-gamma) was not altered. Treatment of mice with 5 mg/kg MAPA for 7 days promoted spleen cell proliferation, IL-2 production and NK cell activity regardless of tumor outgrowth. In addition, MAPA treatment markedly enhanced IFN-gamma levels and reduced IL-10 production relative to EAT mice. A 35% reduction in splenomegaly with normal number of nucleated cells was also found. Altogether, our results suggest that MAPA directly and/or indirectly modulates immune cell activity, and probably disengages tumor-induced suppression of these responses. Clearly, MAPA has an impact and may delay tumor outgrowth through immunotherapeutic mechanisms.

  18. Equilibrium Total Pressure and CO2 Solubility in Binary and Ternary Aqueous Solutions of 2-(Diethylamino)ethanol (DEEA) and 3-(Methylamino)propylamine (MAPA)

    DEFF Research Database (Denmark)

    Waseem Arshad, Muhammad; Svendsen, Hallvard Fjøsne; Fosbøl, Philip Loldrup

    2014-01-01

    Equilibrium total pressures were measured and equilibrium CO2 partial pressures were calculated from the measured total pressure data in binary and ternary aqueous solutions of 2-(diethylamino)ethanol (DEEA) and 3-(methylamino)propylamine (MAPA). The measurements were carried out in a commercially...... available calorimeter used as an equilibrium cell. The examined systems were the binary aqueous solutions of 5 M DEEA, 2 M MAPA, and 1 M MAPA and the ternary aqueous mixtures of 5 M DEEA + 2 M MAPA (5D2M) and 5 M DEEA + 1 M MAPA (5D1M), which gave liquid–liquid phase split upon CO2 absorption. The total...... pressures were measured and the CO2 partial pressures were calculated as a function of CO2 loading at three different temperatures 40 °C, 80 °C, and 120 °C. All experiments were reproduced with good repeatability. The measurements were carried out for 30 mass % MEA solutions to validate the experimental...

  19. Los mapas conceptuales y su influencia en lo afectivo-valorativo del estudiante para aprender biología

    Directory of Open Access Journals (Sweden)

    Acosta, Savier

    2010-09-01

    Full Text Available El objetivo de esta investigación fue identificar la influencia de los mapas conceptuales en lo afectivo-valorativo del estudiante para aprender Biología. Las teorías que sirvieron de apoyo las fueron Díaz y Hernández (2007, Novak (1998. La investigación se realizó en la Unidad Educativa José Antonio Almarza; fue de tipo experimental con un diseño cuasi-experimental. La población estuvo conformada por 468 estudiantes, de donde se seleccionó una muestra de 68 estudiantes (33 del grupo control y (35 el grupo experimental. La técnica utilizada para recolectar información fue la observación; el instrumento, una hoja de registro validado previamente por expertos en el área. Se aplicó la prueba t de student para establecer los grados de significancia entre el pre y postest, el análisis de los resultados se efectuó mediante la estadística descriptiva y la inferencial a través de frecuencias, porcentajes, media y la desviación estándar. Como resultados los mapas conceptuales aumentan en los estudiantes su responsabilidad para aprender Biología, respeto hacia la forma de pensar de los demás, valoración del trabajo en equipo, importancia para aprender Biología e incorporación de experiencias significativas del contexto. En conclusión que los mapas conceptuales ejercen influencia en el desarrollo de sentimientos y valores en los estudiantes para aprender dicha ciencia.

  20. El uso del mapa mental como herramienta didáctica en los procesos de investigación

    Directory of Open Access Journals (Sweden)

    José Roig Zamora

    2013-01-01

    Full Text Available Este artículo desarrolla una innovación que se aplicó a los procesos de investigación realizados por los estudiantes del nivel de Licenciatura de la carrera de Ingeniería Industrial, es decir, la implementación de mapas mentales. En este caso, se presenta una fundamentación teórica sobre el concepto y la aplicación de los mapas mentales en la construcción del conocimiento y, posteriormente, la sistematización de los resultados obtenidos en la aplicación de esta estrategia didáctica respecto a los procesos de investigación desarrollados por los estudiantes en su proyecto de graduación de la carrera. En la aplicación de la innovación se consideraron tres investigaciones desarrolladas bajo la modalidad de Proyecto de Graduación entre los años 2010 y 2012, en las cuales participaron ocho estudiantes. La sistematización de esta experiencia permitió determinar que el mapa mental es una herramienta que facilita la toma de decisiones en relación con la organización y la reorganización de las fases de un proceso de investigación; asimismo, posibilita la construcción y reconstrucción del conocimiento científico y académico por parte del estudiantado.

  1. Improvement in clinical signs and cellular immunity of dogs with visceral leishmaniasis using the immunomodulator P-MAPA.

    Science.gov (United States)

    Santiago, Maria Emília B; Neto, Luiz Silveira; Alexandre, Eduardo Costa; Munari, Danísio Prado; Andrade, Mariana Macedo C; Somenzari, Marcos Arruda; Ciarlini, Paulo César; de Lima, V M F

    2013-09-01

    This study investigated the immunotherapeutic potential of the protein aggregate magnesium-ammonium phospholinoleate-palmitoleate anhydride immuno-modulator (P-MAPA) on canine visceral leishmaniasis. Twenty mongrel dogs presenting clinical symptoms compatible with leishmaniasis and diagnosis confirmed by the detection of anti-leishmania antibodies were studied. Ten dogs received 15 doses of the immunomodulator (2.0 mg/kg) intramuscularly, and 10 received saline as a placebo. Skin and peripheral blood samples were collected following administration of the immunomodulator. The groups were followed to observe for clinical signals of remission; parasite load in the skin biopsies using real-time PCR, the cytokines IL-2, IL-10 and IFN-γ in the supernatant of peripheral blood mononuclear cells stimulated in vitro with either total promastigote antigen or phytohemagglutinin measured by capture ELISA, and changes in CD4⁺ and CD8⁺ T cell subpopulations evaluated by flow cytometry. Comparison between the groups showed that treatment with the immunomodulator promoted improvement in clinical signs and a significant reduction in parasite load in the skin. In peripheral blood mononuclear cell cultures, supernatants showed a decrease in IL-10 levels and an increase in IL-2 and IFN-γ. An increase in CD8⁺ T cells was observed in peripheral blood. In addition, the in vitro leishmanicidal action of P-MAPA was investigated using 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and no leishmanicidal activity was detected. These findings suggest that P-MAPA has potential as an immunotherapeutic drug in canine visceral leishmaniasis, since it assists in reestablishing partial immunocompetence of infected dogs. Copyright © 2013 Elsevier B.V. All rights reserved.

  2. Algoritmo eficiente para cálculo de mapas de visibilidade em terrenos armazenados em memória externa

    OpenAIRE

    Magalhães, Mirella Antunes de

    2009-01-01

    Com a maior disponibilidade de dados detalhados de terrenos, muitas aplicações precisam processar grandes áreas geográficas em alta resolução. O processamento massivo de dados envolvido em tais aplicações criou grandes desafios para os SIGs e necessita de algoritmos otimizados tanto para processamento interno quanto para transferência de dados. Uma dessas aplicações é o cálculo de mapas de visibilidade ou viewshed, que consiste em obter o conjunto de pontos visíveis a partir de um ponto p. Ne...

  3. Mapas de Entornos Mediante Navegacion Difusa y Sistema de Teleoperacion de una Plataforma Pioneer P3-DX

    Directory of Open Access Journals (Sweden)

    Daniel Granda

    2013-11-01

    Full Text Available El presente proyecto describe el diseno e implementacion de aplicaciones de Teleoperacion, Adquisicion de Datos, Control Difuso de Velocidad y Mapeo de Entornos en 2D, para la plataforma movil Pioneer P3-DX mediante el uso de sonares, odometrıa y software libre GNU/Linux. El proyecto brinda una guıa para utilizar los conceptos de programacion en Python, que permite crear aplicaciones de manera versatil mediante el uso de librerıas como: GTK para el desarrollo del entorno grafico, PYFUZZY para el desarrollo del controlador difuso de velocidad y OPENCV para mostrar los mapas del entorno.

  4. N-Methylamino Pyrimidyl Amides (MAPA): Highly Reactive, Electronically-Activated Amides in Catalytic N-C(O) Cleavage.

    Science.gov (United States)

    Meng, Guangrong; Lalancette, Roger; Szostak, Roman; Szostak, Michal

    2017-09-01

    Despite recent progress in catalytic cross-coupling technologies, the direct activation of N-alkyl-N-aryl amides has been a challenging transformation. Here, we report the first Suzuki cross-coupling of N-methylamino pyrimidyl amides (MAPA) enabled by the controlled n N → π Ar conjugation and the resulting remodeling of the partial double bond character of the amide bond. The new mode of amide activation is suitable for generating acyl-metal intermediates from unactivated primary and secondary amides.

  5. Proposta de um Mapa Estratégico para uma Universidade Pública

    Directory of Open Access Journals (Sweden)

    Vinicius Abilio Martins

    2015-08-01

    Full Text Available A ferramenta de tradução da estratégia, medição e avaliação do desempenho organizacional chamado Balanced Scorecard (BSC vem sendo estudada de forma crescente desde a sua publicação em 1990. O formato inicialmente proposto é aplicado muito bem às empresas privadas. Porém, sua aplicação em organizações não pertencentes ao ramo privado não foi contemplado nos estudos iniciais. Este artigo tem por objetivo apresentar uma proposição de um mapa estratégico na forma do Balanced Scorecard para a Universidade Estadual do Oeste do Paraná (UNIOESTE, localizada na região Oeste daquele estado. Foram utilizados dados secundários relacionados ao Plano de Desenvolvimento Institucional, dentre outros documentos relacionados com a estratégia da instituição. Este estudo de caso se classifica como exploratório e qualitativo. A UNIOESTE possui, além da Reitoria, 5 campis localizados nas cidades de Cascavel, Toledo, Foz do Iguaçu, Marechal Cândido Rondon e Francisco Beltrão, além do Hospital Universitário do Oeste do Paraná (HUOP. Conta com corpo docente composto por 1.229 docentes e 1.267 agentes universitários. Para o problema desta pesquisa, tem-se: é possível a criação de um Balanced Scorecard para uma Universidade Pública? Para o tratamento dos dados, utilizou-se a análise de conteúdo, apoiado pelo software ATLAS.ti. Ao final do trabalho, propôs-se um total de 5 perspectivas: Educacional, Financeira, Sociedade, Aprendizado e Crescimento e Processos Internos, distribuídos nestas perspectivas, 16 objetivos estratégicos e 30 indicadores estratégicos. A contribuição deste artigo consiste em apresentar as especificidades não abordadas no modelo tradicional, proposto por Kaplan e Norton, a uma instituição que se apresenta nas características de instituição pública e voltada para o ensino superior.

  6. Literatura chilena en digital: mapas, estéticas y conceptualizaciones

    Directory of Open Access Journals (Sweden)

    Carolina Gaínza C.

    2017-01-01

    Full Text Available En el presente artículo se busca analizar una experiencia estética vinculada a lo digital, que tiene como principales componentes la posibilidad de interactuar, participar y manipular las obras creadas en este formato. Con tal fin, se presentará un mapa de la literatura digital en Chile, para luego profundizar en el análisis de dos aspectos que permiten caracterizar una estética de lo digital: la hipertextualidad y el hackeo cultural. A partir de estos elementos y tomando en cuenta que la literatura digital es aquella creada para ser leída en la pantalla de un dispositivo electrónico, se analizan el poema A veces cubierto por las aguas de Carlos Cociña y el poemario Clickable poem@s de Luis Correa-Díaz. Estas obras nos permiten preguntarnos por el estatus de la literatura y la poesía en la era digital, vinculadas a una experiencia estética que pone énfasis en la intervención y el deseo de participación. PALABRAS CLAVE: literatura digital en Chile, poesía digital, estética digital, hipertexto. This article examines an aesthetic experience associated with the digital, which is characterized by the ability of the reader to interact, participate, and manipulate literary works created in this format. First, a map of Chilean digital literature will be presented and then two aspects will be analyzed which allow a description of an aesthetic of the digital: hypertextuality and cultural hacking. As a result of this analysis, and considering that digital literature is that which is created to be read on the screen of an electronic device, two poems will be investigated: A veces cubierto por las aguas by Carlos Cociña and Clickable poem@s by Luis Correa-Díaz. These texts allow us to think about the status of literature and poetry in the digital era, linked with an aesthetic experience which emphasizes intervention and the wish to participate. Keywords: Digital literature in Chile, digital poetry, digital aesthetics, hypertext.

  7. Redesenhando o Mapa Eleitoral do Brasil: uma proposta de reforma política incremental

    Directory of Open Access Journals (Sweden)

    Octavio Amorim Neto

    2011-06-01

    Full Text Available Este artigo oferece uma proposta de reforma incremental do sistema eleitoral da Câmara dos Deputados. A natureza incremental da proposta se funda na suposição segundo a qual o sistema político é uma arquitetura complexa e delicada, sendo a possibilidade de piorá-lo com mudanças ambiciosas e intempestivas bem maior do que a de aperfeiçoá-lo. A proposta mantém o sistema de representação proporcional com lista aberta, mas altera duas variáveis-chave, uma vez que reduz a magnitude média das circunscrições eleitorais e estabelece uma regra proporcional de distribuição de cadeiras entre partidos coligados. A operacionalização da reforma leva a um novo desenho do mapa eleitoral do país, com circunscrições eleitorais menores dentro de 12 estados. O artigo também apresenta os resultados de um exercício de simulação feito com base nos dados das eleições de 2006 que recalcula a composição partidária da Câmara dos Deputados a partir das regras aqui preconizadas.This article presents a proposal for an incremental reform of the electoral system of the Chamber of Deputies. The incremental nature of the proposal rests on the assumption that this political system is a complex and delicate architecture, and therefore, abrupt and ambitious changes are more likely to make it worse than to improve it. The proposal advocated here maintains the current system of open-list proportional representation, but it changes two key variables of this electoral system, since it reduces its average district magnitude and establishes a proportional distribution of seats among parties that form electoral coalitions. The way the reform is operationalized leads to a redesign of the electoral map of the country, with smaller districts within 12 states. The article also presents the results of a simulation exercise based on data from the 2006 elections, whereby the party makeup of the Chamber of Deputies is recalculated according to the rules proposed

  8. Postawy studentów wybranych szkół wyższych Polski wschodniej wobec cukrzycy = Attitudes of students from east Poland's selected academies towards diabetes

    Directory of Open Access Journals (Sweden)

    Olga Dąbska

    2016-12-01

    4Zakład Profilaktyki Chorób Przewodu Pokarmowego, Uniwersytet Jana Kochanowskiego w Kielcach   Słowa kluczowe: cukrzyca, stosunek do choroby, opinia publiczna   Streszczenie Wstęp. Czynnikami, które w znacznym stopniu kreują przekonania i zachowania zdrowotne ludności są posiadana wiedza oraz postawy społeczne, rozwijające się pod wpływem otaczającego środowiska. Przejawianie antyzdrowotnych zachowań, związanych w dużym stopniu z postępem cywilizacyjnym oraz niski poziom wiedzy diabetologicznej wśród młodych ludzi sprawia, iż stanowią oni grupę, która w sposób szczególny narażona jest na rozwój cukrzycy. Cel pracy. Poznanie postaw studentów wybranych szkół wyższych Polski wschodniej wobec cukrzycy. Materiał i metody. Badanie przeprowadzono na grupie 150 studentów. Narzędzie badawcze stanowiła ankieta Badanie Postaw Wobec Cukrzycy DAS3 Centrum Badań i Szkoleń na Temat Cukrzycy Uniwersytetu Michigan. Analizy materiału badawczego dokonano przy użyciu programu Microsoft Office Excel. Wyniki. Znaczna część badanych (74% jest zdania, iż cukrzyca dotyka prawie każdej dziedziny życia diabetyka, a 89% sądzi, że choroba ta zmienia podejście do życia. Odnośnie roli chorego w procesie terapii 77% ankietowanych zgadza się, że osoby z cukrzycą są najważniejszymi członkami zespołu opieki diabetologicznej. Z kolei 89% studentów uważa, iż pracownicy medyczni powinni nabyć kompetencje w zakresie sprawowania funkcji edukatora diabetologicznego. Wnioski. Postawy studentów w większości podkreślają istotę najbliższego otoczenia w walce z chorobą. Badani twierdzą, że wszystkie typy cukrzycy są wielce uciążliwe dla życia chorego. Ankietowani byli zgodni, co do konieczności doskonalenia umiejętności edukatorskich i komunikacyjnych przez personel medyczny.       Key words: diabetes, attitude towards medical condition, public opinion   Summary Introduction. Knowledge (or lack thereof and social attitudes

  9. El uso de mapas conceptuales progresivos como estrategia de ense??anza y aprendizaje en la formaci??n de profesores en Biolog??a

    OpenAIRE

    Aparecida Soares Mendon??a, Concei????o

    2013-01-01

    La investigaci??n realizada con alumnos de la formaci??n de profesores tuvo como objetivo comprender c??mo el uso de los mapas conceptuales puede favorecer el aprendizaje significativo. Se parte del hecho de que los futuros profesores presentan dificultades en el aprendizaje de varios conceptos. Se considera que los mapas, como instrumento did??ctico, es un valioso instrumento de diagn??stico y evaluaci??n, favoreciendo el aprendizaje de conceptos. Durante la intervenci??n pedag??gica, se bus...

  10. Mapa y Cédula Escolar como dispositivos de planificación y gestión de políticas públicas educativas

    OpenAIRE

    Ghea, María Elisa

    2010-01-01

    "Mapa y Cédula Escolar como dispositivos de Planificación y Gestión de políticas públicas educativas", es un trabajo de tesis que propone abordar la conformación de sociedades de la información mediante la selección y análisis de determinadas herramientas informativas particulares como Mapa y Cédula Escolar, dos dispositivos comunicacionales de estadística y relevamiento de datos, elaborados en el año 2000 para conocer, comprender y planificar las políticas en el sistema educativo de la provi...

  11. Fóruns de discussão e mapas conceptuais na aprendizagem do texto argumentativo : uma experiência no 11.º ano

    OpenAIRE

    Lopes, Luísa Diz; Morais, Carlos

    2013-01-01

    Este artigo centra-se na problemática da utilização dos recursos digitais no processo de ensino e aprendizagem. Utilizaram-se no desenvolvimento de atividades programáticas da disciplina de Português mapas de conceitos e fóruns de discussão, com uma turma de 11.º ano, durante dois períodos letivos. O principal objetivo consistiu em apreciar as perceções dos alunos sobre a influência da utilização dos fóruns de discussão e de mapas de conceitos na aprendizagem do texto argumenta...

  12. FUNDAMENTOS TEÓRICOS Y METODOLÓGICOS PARA EL MAPA DEL ARTE RUPESTRE CUBANO. COMENTARIOS GENERALES

    Directory of Open Access Journals (Sweden)

    Divaldo A. Gutiérrez Calvache

    2010-06-01

    Full Text Available ResumenSe revisa y adopta un concepto propio para la elaboración del Mapa del Arte Rupestre Cubano, entendido como instrumento para el conocimiento de este patrimonio arqueológico, y de los datos comprobados en nuestro archipiélago. Se realiza una introducción histórica sobre el nacimiento y evolución de los criterios cartográficos para el arte rupestre cubano y se describen modelos que ejemplifican las diferentes experiencias obtenidas en la construcción de las fases operativas, bases de datos y tipos de mapas realizados para la obtención definitiva de dicha herramienta cartográfica.AbstractIt revises and adopts a specific concept for Cuba's Rock Art Map, understood as a tool for knowledge of the archaeological heritage of the data recorded in our island. It performs a historical introduction about the birth and evolution of mapping criteria for the Cuban rock art and it describes some models who exemplify the different experiences in the construction and operation phases, databases and types of maps made for obtaining final Cuban rock art map.

  13. APRENDIZAJE ACTIVO Y MAPAS CONCEPTUALES: APLICACIÓN A LOS CIRCUITO DE CORRIENTE ALTERNA

    Directory of Open Access Journals (Sweden)

    Isabel Escobar

    2017-07-01

    érdidas. En este artículo presentamos un mapa conceptual utilizando la CmapTools para que se utilice como una nueva herramienta para analizar de manera lógica la estructura subyacente en los circuitos de corriente alterna, con el objetivo de ofrecer a los estudiantes de las especialidades de Ciencias e Ingeniería otra opción para intentar lograr un aprendizaje significativo de esta importante parte de la física.

  14. Algunos dibujos de la primera arquitectura de Nueva España: mapas, planos y proyectos de arquitectura del siglo XVI

    OpenAIRE

    Moya Olmedo, Pilar

    2014-01-01

    Moya Olmedo, P. (2014). Algunos dibujos de la primera arquitectura de Nueva España: mapas, planos y proyectos de arquitectura del siglo XVI. P+C: proyecto y ciudad: revista de temas de arquitectura (5), 75-88. ISSN 2172-9220 (ISOC; LATINDEX; DIALNET; RESH; DICE; MIAR)

  15. Los mapas de riesgo de corrupción incidencias en la prevención de la corrupción. Estudio de caso

    OpenAIRE

    Cuesta Gómez, Albert Fredy

    2015-01-01

    En la presente tesis se analizan los mapas de riesdo de corrupción, para determninar su incidencia en la prevención de la corrupción, análisis efectuado desde la mirada neoinstitucional. Se presentan diferentes definiciones de corrupción, y se describen los mecanismos utilizados para medir a nivel mundial como nacional. -

  16. La utilizacion de los mapas conceptuales en la ensenanza de biologia y su efecto sobre el dominio del proceso de fotosintesis en los estudiantes universitarios

    Science.gov (United States)

    Gonzalez Rivera, Maria M.

    Se investigo el efecto de los mapas conceptuales sobre el dominio del proceso de fotosintesis en estudiantes universitarios. La investigacion utilizo dos estrategias: mapas conceptuales individuales y mapas conceptuales colaborativos, con el fin de investigar si existen diferencias significativas en el dominio del proceso de fotosintesis. El analisis de los datos incluyo aspectos cualitativos y cuantitativos. Se desprende del estudio que el 80% de los estudiantes describen la utilizacion de los mapas conceptuales como una experiencia beneficiosa. El 70% de los estudiantes expreso que los mapas conceptuales son utiles en el aprendizaje del proceso de fotosintesis y el 61% indico que facilitan la comprension de los conceptos. Los hallazgos mas importantes del analisis cuantitativo indican que los estudiantes que utilizaron los mapas conceptuales mejoraron significativamente su desempeno en la posprueba global. Se utilizo la prueba Mann-Whitney para investigar si existian diferencias significativas en la posprueba y preprueba global, el valor de W = 1945.0, para un valor p de 0.00, lo cual establece diferencias significativas. Para determinar si existian diferencias significativas entre la posprueba y preprueba del grupo individual, se realizo la prueba nuevamente. El valor de W correspondio a 490.5, que es significativo, con un valor p de 0.00. Se concluye que existen diferencias significativas entre la ejecucion de la posprueba y preprueba del grupo individual. Los datos proveen suficiente evidencia para sostener que los estudiantes que utilizaron la estrategia de mapas conceptuales individuales mejoraron el dominio del proceso de fotosintesis significativamente. Se realizo nuevamente la prueba para los resultados de posprueba y preprueba del grupo colaborativo. El valor de W correspondio a 446 con un valor p de 0.00. Se concluyo que existen diferencias significativas entre la ejecucion de la posprueba y preprueba del grupo colaborativo. Finalmente, se efectuo una

  17. Mapa de risco no Brasil: as limitações da aplicabilidade de um modelo operário

    Directory of Open Access Journals (Sweden)

    Ubirajara A. de O. Mattos

    1994-06-01

    Full Text Available O texto tece considerações sobre as limitações encontradas na aplicação do Mapa de Risco no Brasil, sob o ponto de vista legal e metodológico. Inicialmente, são apresentadas conceituação, origem e importância desta metodologia na Reforma Sanitária Italiana. A seguir, são colocadas as versões quanto a sua introdução no Brasil, no início da década de 80, e a sua repercussão nas empresas após ter se tornado exigência legal para aquelas empresas que possuam Cipa. Finalmente, é feita uma breve discussão quanto à sua eficácia na prevenção de riscos à saúde pelos trabalhadores.

  18. El mapa no es el territorio: un ensayo sobre el estado de la economía

    Directory of Open Access Journals (Sweden)

    John Kay

    2014-06-01

    Full Text Available Gran parte de la economía moderna, incluidos en particular los paradigmas dominantes en macroeconomía y economía financiera, supone que hay un modelo “verdadero” del mundo, el cual se puede deducir de un conjunto de axiomas basados en la elección racional. Pero en realidad no hay, ni puede haber, un modelo que describa “el mundo tal como es realmente”. Los modelos son herramientas útiles en economía, e incluso indispensables, pero son necesariamente parciales, provisionales y específicos al contexto. El enfoque de la economía debe ser pluralista, es decir, debe usar el razonamiento inductivo y el razonamiento deductivo. El mapa no es el territorio.

  19. MAPA DE COMPETITIVIDAD EN DISEÑO: VALIDACIÓN EN EMPRESAS DEL SECTOR LÁCTEO

    Directory of Open Access Journals (Sweden)

    AIDA MANRIQUE LÓPEZ

    2017-01-01

    Full Text Available Este artículo integra el proceso, los resultados y las reflexiones de la investigación realizada con el propósito de identificar la situación y las perspectivas del diseño en algunas entidades públicas y privadas del sector lácteo, y explorar las formas de gestión utilizadas por un grupo de empresas de diferentes tamaños mediante el ajuste y la validación de una herramienta diagnóstica, en una muestra de 8 empresas productoras y comercializadoras de productos lácteos de Bogotá Región. Se exponen el marco conceptual y el proceso de actualización y validación de la herramienta Mapa de Competitividad en Diseño –MCD–, a partir de la teoría de las capacidades empresariales y los factores de competitividad determinantes del éxito empresarial. Los resultados permiten identificar las áreas o campos de actuación (producto, comunicación y entorno y los niveles de integración (estrategia, política, programa y proyecto del diseño en las empresas, y determinan tipologías según modelos de incorporación de la gestión del diseño en estas organizaciones. El trabajo rea- lizado muestra la eficacia del Mapa de Competitividad en Diseño según Capacidades –MCDC–, resultante del ajuste, tanto para analizar los niveles de integración de la gestión de diseño desde los factores internos e xplicativos de la competitividad empresarial en las empresas, como para realizar análisis transversal de alcance sectorial.

  20. EL LENGUAJE CARTOGRÁFICO Y LA ENSEÑANZA DEL CLIMA: UN ANÁLISIS DE LOS MAPAS EN LOS LIBROS DE TEXTO DE ESPAÑA Y BRASIL

    Directory of Open Access Journals (Sweden)

    Adriano Rodrigo Oliveira

    2006-12-01

    Full Text Available Este trabajo tiene como objetivo analizar el lenguaje cartográfico de los mapas de clima de determinados libros de texto de la Enseñanza Secundaria Obligatoria de España y Brasil. El referencial teórico y metodológico para analizar los mapas está basado en la Semiología Gráfica, y las conclusiones apuntan hacia una revisión de los elementos externos e internos de la Comunicación cartográfica de los mapas en los libros de texto.

  1. IMPACTO DEL USO DEL SOFTWARE CMAP-TOOLS EN LA TÉCNICA DE LOS MAPAS CONCEPTUALES

    Directory of Open Access Journals (Sweden)

    Susy Karina Dávila Panduro

    2012-12-01

    Full Text Available La investigación tuvo como objetivo: aplicar el software Cmap-Tools en el uso de mapas conceptuales para cátedras de Ciencias Sociales en la Facultad de Ciencias de la Educación y Humanidades de la UNAP en la ciudad de Iquitos, en el año 2011. El estudio pertenece al tipo experimental y el diseño fue el pre-experimental de tipo Diseño de Comparación Estática o Comparación de Grupos sólo. La población estuvo conformada por los estudiantes de la especialidad de Ciencias Sociales de la Facultad de Ciencias de la Educación y Humanidades de la UNAP que hacen un total de 147, la determinación de la muestra fue en forma no probabilística intencionada y estuvo conformada por 44 estudiantes.La técnica que se  empleó en la recolección de los datos fue: la encuesta, el instrumento fue el cuestionario.Para el procesamiento de los datos se utilizó el programa computarizado SPSS versión 17 en español con lo que se obtuvo la matriz de datos con lo que se organizó los datos en tablas y gráficos.Para el análisis e interpretación de los datos se empleó la estadística descriptiva: frecuencia, promedios simples y porcentaje y la estadística inferencial no paramétrica  de Chi Cuadrada (X2. Para la constatación de la hipótesis principal se utilizó la prueba estadística inferencial no paramétrica X2 de Chi Cuadrada con µ = 0,01; gl = 2 obteniendo X2c = 25,83; X2t = 9,21; es decir X2c> X2t se aceptó la hipótesis de la investigación: “A través de la aplicación del software Cmap-Tools se mejorará el uso de mapas conceptuales para cátedras de Ciencias Sociales en la Facultad de Ciencias de la Educación y Humanidades de la UNAP en la ciudad de Iquitos en el año 2011”.

  2. IMPACTO DEL USO DEL SOFTWARE CMAP-TOOLS EN LA TÉCNICA DE LOS MAPAS CONCEPTUALES

    Directory of Open Access Journals (Sweden)

    Susy Karina Dávila Panduro

    2012-12-01

    Full Text Available La investigación tuvo como objetivo: aplicar el software Cmap-Tools en el uso de mapas conceptuales para cátedras de Ciencias Sociales en la Facultad de Ciencias de la Educación y Humanidades de la UNAP en la ciudad de Iquitos, en el año 2011. El estudio pertenece al tipo experimental y el diseño fue el pre-experimental de tipo Diseño de Comparación Estática o Comparación de Grupos sólo. La población estuvo conformada por los estudiantes de la especialidad de Ciencias Sociales de la Facultad de Ciencias de la Educación y Humanidades de la UNAP que hacen un total de 147, la determinación de la muestra fue en forma no probabilística intencionada y estuvo conformada por 44 estudiantes.La técnica que se  empleó en la recolección de los datos fue: la encuesta, el instrumento fue el cuestionario.Para el procesamiento de los datos se utilizó el programa computarizado SPSS versión 17 en español con lo que se obtuvo la matriz de datos con lo que se organizó los datos en tablas y gráficos.Para el análisis e interpretación de los datos se empleó la estadística descriptiva: frecuencia, promedios simples y porcentaje y la estadística inferencial no paramétrica  de Chi Cuadrada (X2. Para la constatación de la hipótesis principal se utilizó la prueba estadística inferencial no paramétrica X2 de Chi Cuadrada con µ = 0,01; gl = 2 obteniendo X2c = 25,83; X2t = 9,21; es decir X2c> X2t se aceptó la hipótesis de la investigación: “A través del aplicación del software Cmap-Tools se mejorará el uso de mapas conceptuales para cátedras de Ciencias Sociales en la Facultad de Ciencias de la Educación y Humanidades de la UNAP en la ciudad de Iquitos en el año 2011”.

  3. PathMAPA: a tool for displaying gene expression and performing statistical tests on metabolic pathways at multiple levels for Arabidopsis

    Directory of Open Access Journals (Sweden)

    Ma Ligeng

    2003-11-01

    Full Text Available Abstract Background To date, many genomic and pathway-related tools and databases have been developed to analyze microarray data. In published web-based applications to date, however, complex pathways have been displayed with static image files that may not be up-to-date or are time-consuming to rebuild. In addition, gene expression analyses focus on individual probes and genes with little or no consideration of pathways. These approaches reveal little information about pathways that are key to a full understanding of the building blocks of biological systems. Therefore, there is a need to provide useful tools that can generate pathways without manually building images and allow gene expression data to be integrated and analyzed at pathway levels for such experimental organisms as Arabidopsis. Results We have developed PathMAPA, a web-based application written in Java that can be easily accessed over the Internet. An Oracle database is used to store, query, and manipulate the large amounts of data that are involved. PathMAPA allows its users to (i upload and populate microarray data into a database; (ii integrate gene expression with enzymes of the pathways; (iii generate pathway diagrams without building image files manually; (iv visualize gene expressions for each pathway at enzyme, locus, and probe levels; and (v perform statistical tests at pathway, enzyme and gene levels. PathMAPA can be used to examine Arabidopsis thaliana gene expression patterns associated with metabolic pathways. Conclusion PathMAPA provides two unique features for the gene expression analysis of Arabidopsis thaliana: (i automatic generation of pathways associated with gene expression and (ii statistical tests at pathway level. The first feature allows for the periodical updating of genomic data for pathways, while the second feature can provide insight into how treatments affect relevant pathways for the selected experiment(s.

  4. A tertiary approach to improving equity in health: quantitative analysis of the Māori and Pacific Admission Scheme (MAPAS) process, 2008-2012.

    Science.gov (United States)

    Curtis, Elana; Wikaire, Erena; Jiang, Yannan; McMillan, Louise; Loto, Rob; Airini; Reid, Papaarangi

    2015-01-20

    Achieving health equity for indigenous and ethnic minority populations requires the development of an ethnically diverse health workforce. This study explores a tertiary admission programme targeting Māori and Pacific applicants to nursing, pharmacy and health sciences (a precursor to medicine) at the University of Auckland (UoA), Aotearoa New Zealand (NZ). Application of cognitive and non-cognitive selection tools, including a Multiple Mini Interview (MMI), are examined. Indigenous Kaupapa Māori methodology guided analysis of the Māori and Pacific Admission Scheme (MAPAS) for the years 2008-2012. Multiple logistic regression models were used to identify the predicted effect of admission variables on the final MAPAS recommendation of best starting point for success in health professional study i.e. 'CertHSc' (Certificate in Health Sciences, bridging/foundation), 'Bachelor' (degree-level) or 'Not FMHS' (Faculty of Medical and Health Sciences). Regression analyses controlled for interview year, gender and ancestry. Of the 918 MAPAS interviewees: 35% (319) were Māori, 58% (530) Pacific, 7% (68) Māori/Pacific; 71% (653) school leavers; 72% (662) females. The average rank score was 167/320, 40-80 credits below guaranteed FMHS degree offers. Just under half of all interviewees were recommended 'CertHSc' 47% (428), 13% (117) 'Bachelor' and 38% (332) 'Not FMHS' as the best starting point. Strong associations were identified between Bachelor recommendation and exposure to Any 2 Sciences (OR:7.897, CI:3.855-16.175; p workforce development. The application of the MMI within an equity and indigenous cultural context can support a holistic assessment of an applicant's potential to succeed within tertiary study. The new MAPAS admissions process may provide an exemplar for other tertiary institutions looking to widen participation via equity-targeted admission processes.

  5. MAPA em portadores de DPOC com dessaturação no sono MAPA en portadores de EPOC con desaturación durante el sueño ABPM in COPD patients with sleep desaturation

    Directory of Open Access Journals (Sweden)

    Neila Anders Aidar

    2009-09-01

    Full Text Available FUNDAMENTO: A hipoxemia no período de sono pode, por mecanismo de ativação simpática, alterar a pressão arterial. Poucos estudos demonstram os parâmetros pressóricos em portadores de DPOC, que não têm apnéia do sono, mas que dessaturam nesse período. OBJETIVOS: Analisar os parâmetros pressóricos em pacientes com DPOC e dessaturação no sono, não causada por apnéia. MÉTODOS: Treze pacientes com DPOC foram submetidos à espirometria, gasometria arterial, polissonografia e MAPA para avaliação pressórica. Quatorze pacientes sem DPOC foram submetidos à espirometria, oximetria e MAPA. As análises pressóricas foram feitas tanto na vigília quanto no sono. Os dois grupos foram constituídos por pacientes sem antecedentes hipertensivos. RESULTADOS: Os dois grupos eram semelhantes em relação à idade, altura, peso e índice de massa corporal. Houve diferença significativa (p FUNDAMENTO: La hipoxemia en el período de sueño puede, por mecanismo de activación simpática, alterar la presión arterial. Pocos estudios demuestran los parámetros de presión en portadores de EPOC, que no tiene apnea del sueño, y que desaturan en ese período. OBJETIVO: Analizar los parámetros de presión en pacientes con EPOC y desaturación en el sueño, no causada por apnea. MÉTODOS: Trece pacientes con EPOC se sometieron a la espirometría, la gasometría arterial, la polisonografía y al MAPA para la evaluación de presión. Un total de 14 pacientes sin EPOC se sometieron a la espirometría, la oximetría y MAPA. Los análisis de presión se hicieron tanto en la vigilia como en el sueño. Los dos grupos estaban conformados por pacientes sin antecedentes hipertensivos. RESULTADOS: Los dos grupos se asemejaban respecto a la edad, la altura, el peso e el índice de masa corporal. Hubo diferencia significativa (p BACKGROUND: Sleep hypoxemia may change blood pressure by sympathetic activation. Few studies have analyzed blood pressure parameters in

  6. Análise de correspondência - uma ferramenta útil na interpretação de mapas de produtividade

    Directory of Open Access Journals (Sweden)

    J. R. P. Carvalho

    2002-06-01

    Full Text Available O objetivo do presente trabalho foi apresentar a Análise de Correspondência como um método estatístico multivariado que pode ajudar na interpretação de mapas de produtividade. Para tal, levantou-se a hipótese de a utilização de mapas de produtividade, para delimitar regiões homogêneas no campo, depender da estabilidade espacial e temporal desta variável, tornando-se preocupante seu uso indiscriminado como ferramenta de informação preditiva. Quatro mapas de produtividade foram usados neste trabalho, relativos a amostras coletadas de componentes de produção para arroz em 1994, milho em 1995, algodão em 1996 e milho em 1998, em uma malha com 110 pontos, espaçados de 10 x 10 m, da estação experimental do Instituto Agronômico de Campinas em Votuporanga (SP. Os dados originais de produtividade foram categorizados e analisados por meio da Análise de Correspondência Simples e Múltipla. Concluiu-se que existe grande dissimilaridade entre as culturas, ou classes de culturas, medidas por meio da distância euclidiana no plano.

  7. Heat-Treatment-Responsive Proteins in Different Developmental Stages of Tomato Pollen Detected by Targeted Mass Accuracy Precursor Alignment (tMAPA).

    Science.gov (United States)

    Chaturvedi, Palak; Doerfler, Hannes; Jegadeesan, Sridharan; Ghatak, Arindam; Pressman, Etan; Castillejo, Maria Angeles; Wienkoop, Stefanie; Egelhofer, Volker; Firon, Nurit; Weckwerth, Wolfram

    2015-11-06

    Recently, we have developed a quantitative shotgun proteomics strategy called mass accuracy precursor alignment (MAPA). The MAPA algorithm uses high mass accuracy to bin mass-to-charge (m/z) ratios of precursor ions from LC-MS analyses, determines their intensities, and extracts a quantitative sample versus m/z ratio data alignment matrix from a multitude of samples. Here, we introduce a novel feature of this algorithm that allows the extraction and alignment of proteotypic peptide precursor ions or any other target peptide from complex shotgun proteomics data for accurate quantification of unique proteins. This strategy circumvents the problem of confusing the quantification of proteins due to indistinguishable protein isoforms by a typical shotgun proteomics approach. We applied this strategy to a comparison of control and heat-treated tomato pollen grains at two developmental stages, post-meiotic and mature. Pollen is a temperature-sensitive tissue involved in the reproductive cycle of plants and plays a major role in fruit setting and yield. By LC-MS-based shotgun proteomics, we identified more than 2000 proteins in total for all different tissues. By applying the targeted MAPA data-processing strategy, 51 unique proteins were identified as heat-treatment-responsive protein candidates. The potential function of the identified candidates in a specific developmental stage is discussed.

  8. High-throughput sequencing of Campylobacter jejuni insertion mutant libraries reveals mapA as a fitness factor for chicken colonization.

    Science.gov (United States)

    Johnson, Jeremiah G; Livny, Jonathan; Dirita, Victor J

    2014-06-01

    Campylobacter jejuni is a leading cause of gastrointestinal infections worldwide, due primarily to its ability to asymptomatically colonize the gastrointestinal tracts of agriculturally relevant animals, including chickens. Infection often occurs following consumption of meat that was contaminated by C. jejuni during harvest. Because of this, much interest lies in understanding the mechanisms that allow C. jejuni to colonize the chicken gastrointestinal tract. To address this, we generated a C. jejuni transposon mutant library that is amenable to insertion sequencing and introduced this mutant pool into day-of-hatch chicks. Following deep sequencing of C. jejuni mutants in the cecal outputs, several novel factors required for efficient colonization of the chicken gastrointestinal tract were identified, including the predicted outer membrane protein MapA. A mutant strain lacking mapA was constructed and found to be significantly reduced for chicken colonization in both competitive infections and monoinfections. Further, we found that mapA is required for in vitro competition with wild-type C. jejuni but is dispensable for growth in monoculture.

  9. O uso de mapas conceituais como recurso didático para aprendizagem de conceitos na disciplina de Interação Humano-Computador

    Directory of Open Access Journals (Sweden)

    André Barros de Sales

    2012-12-01

    Full Text Available http://dx.doi.org/10.5007/1807-0221.2012v9n14p66 A busca por mecanismos para melhorar o processo de ensino-aprendizagem tem sido um dos desafios dos educadores. Nesse contexto e diante da necessidade de oferecer ao aluno recursos didáticos que o envolva no processo de aprendizagem surgem os Mapas Conceituais que são alicerçados na teoria da aprendizagem significativa de Ausubel. Assim, o presente trabalho tem como objetivo analisar a avaliação dos alunos quanto à abordagem dos mapas conceituais em sala de aula, para avaliar o potencial didático dessa ferramenta. Participaram desse estudo 16 alunos matriculados na disciplina de Interação Humano-Computador do curso de Engenharia de Software da Universidade de Brasília. Esses avaliaram o uso de mapas conceituais como potencial recurso didático para aprendizado de novos conceitos.

  10. El Quinquenio de Rafael Reyes y la transformación del mapa político-administrativo colombiano

    Directory of Open Access Journals (Sweden)

    Carlos Andrés Quinche Castaño

    2011-01-01

    Full Text Available Tras la expedición de la Constitución de 1886, la división políticoadministrativa del territorio colombiano permaneció invariable durante 18 años, hasta la creación del Departamento de Nariño, de acuerdo con los parámetros establecidos en la ley. Sin embargo, durante el primer año del gobierno de Rafael Reyes en 1905, fueron instituidos seis nuevos departamentos, para luego, ya en 1908, subdividir el territorio nacional en 34 secciones. El movimiento contrarreformista que siguió a la administración de Reyes en 1909 restableció la división territorial existente antes del Quinquenio, pero ciertas resistencias locales permitieron que algunos de los nuevos departamentos creados recientemente lograran subsistir. El presente artículo constituye una revisión histórica de las transformaciones que sufrió el ordenamiento territorial colombiano durante el gobierno de Reyes, todo con el fin de dar cuenta del papel que cumple el Quinquenio en la definición del mapa político administrativo del país.

  11. ANÁLISE DA IMPLEMENTAÇÃO DE ESTRATÉGIA EM EMPRESA HOSPITALAR COM USO DE MAPAS COGNITIVOS

    Directory of Open Access Journals (Sweden)

    Fernanda de Menezes Guimarães

    2009-10-01

    Full Text Available Este artigo analisa os fatores de influência na implementação de uma estratégia no ambiente hospitalar.Tal estratégia é a implementação do Time de Resposta Rápida em unidades de internação, buscandoqualidade e segurança na assistência ao paciente hospitalizado. A escolha baseou-se em analisar umaestratégia que tivesse gerado resultados positivos para a instituição em estudo. O trabalho utilizou-se depesquisa qualitativa de caráter exploratório, sendo um Estudo de Caso único, realizado em um hospitalprivado de Porto Alegre (RS. Foram realizadas entrevistas em profundidade e também foram aplicadosMapas Cognitivos Causais. Como resultados da pesquisa, o fator diferencial identificado que determinouo sucesso da implementação do Time de Resposta Rápida foi o componente humano. Tal processoem estudo também teve êxito pela congregação de múltiplos fatores que se tornaram facilitadores paragarantir esse sucesso. Como contribuição acadêmica, o Mapeamento Cognitivo traz uma possibilidadepara compreender-se melhor o pensamento dos níveis hierárquicos no processo da estratégia.

  12. 'Ya la comedia es un mapa': Cervantes y la teatralización del espacio geográfico

    Directory of Open Access Journals (Sweden)

    Jörg Dünne

    2012-08-01

    Full Text Available The article is concerned with an analysis of how the Spanish Golden Age comedy and the staging of geographical space are related. The example of a "comedia de santos" by Miguel de Cervantes, El Rufián dichoso, will show that its author, like Shakespeare or Lope de Vega, introduces a predominantly geographical meaning into the traditional topos of the theatrum mundi; moreover, he uses the theatre scene and maps for constituting other spaces that cannot be visualized directly and that might be called "metageographical" spaces. Thus, Baroque literature opens the way for a new technique of spatial imaginationEl artículo se propone analizar la relación entre la comedia española del Siglo de Oro y la puesta en escena del espacio geográfico. Al ejemplo de una "comedia de santos" de Miguel de Cervantes, El Rufián dichoso, quisiéramos mostrar, que su autor, como Shakespeare o Lope de Vega, introduce una significación prioritariamente geográfica en el topos tradicional del theatrum mundi; pero además utiliza la escena y los mapas para constituir otros espacios que no pueden ser visualizados directamente y que uno podría llamar espacios "metageográficos". Así, la literatura barroca da lugar a una nueva técnica de la imaginación espacial

  13. Status of MAPA (Modular Accelerator Physics Analysis) and the Tech-X Object-Oriented Accelerator Library

    Science.gov (United States)

    Cary, J. R.; Shasharina, S.; Bruhwiler, D. L.

    1998-04-01

    The MAPA code is a fully interactive accelerator modeling and design tool consisting of a GUI and two object-oriented C++ libraries: a general library suitable for treatment of any dynamical system, and an accelerator library including many element types plus an accelerator class. The accelerator library inherits directly from the system library, which uses hash tables to store any relevant parameters or strings. The GUI can access these hash tables in a general way, allowing the user to invoke a window displaying all relevant parameters for a particular element type or for the accelerator class, with the option to change those parameters. The system library can advance an arbitrary number of dynamical variables through an arbitrary mapping. The accelerator class inherits this capability and overloads the relevant functions to advance the phase space variables of a charged particle through a string of elements. Among other things, the GUI makes phase space plots and finds fixed points of the map. We discuss the object hierarchy of the two libraries and use of the code.

  14. Mapas de taxas epidemiológicas: uma abordagem Bayesiana Maps of epidemiological rates: a Bayesian approach

    Directory of Open Access Journals (Sweden)

    Renato Martins Assunção

    1998-10-01

    Full Text Available Neste artigo, apresentamos métodos estatísticos desenvolvidos recentemente para a análise de mapas de taxas de morbidade quando as unidades geográficas possuem pequenas populações de risco. Eles adotam a abordagem Bayesiana e utilizam métodos computacionais intensivos para estimação do risco de cada área. O objetivo dos métodos é separar a variabilidade das taxas devida às diferenças entre as regiões do risco subjacente daquela devida à pura flutuação aleatória. As estimativas de risco possuem um erro quadrático médio total menor que as estimativas usuais. Aplicamos esses novos métodos para estimar o risco de mortalidade infantil nos municípios de Minas Gerais em 1994.This article presents statistical methods recently developed for the analysis of maps of disease rates when the geographic units have small populations at risk. They adopt the Bayesian approach and use intensive computational methods for estimating risk in each area. The objective of the methods is to separate the variability of rates due to differences between regions from the background risk due to pure random fluctuation. Risk estimates have a total mean quadratic error smaller than usual estimates. We apply these new methods to estimate infant mortality risk in the municipalities of the State of Minas Gerais in 1994.

  15. Psicanálise e neurociências: um mapa dos debates Psicoanálisis y neurociencias: un mapa de los debates Psychoanalysis and neurosciences: a map of the debates

    Directory of Open Access Journals (Sweden)

    Marcia Moraes Davidovich

    2010-12-01

    Full Text Available Este artigo pretende apresentar um mapa panorâmico dos debates em torno da relação e da possível articulação entre a psicanálise e as neurociências. No campo psicanalítico são identificados três grupos principais, definidos a partir de seus pressupostos: (1 hibridação, (2 isolamento e (3 interlocução. O primeiro grupo entende ser necessária a construção de um campo híbrido, já que as neurociências poderiam fornecer à psicanálise fundamentos e instrumentos metodológicos e conceituais mais sólidos sobre o funcionamento psíquico. Esta proposta vem sendo desenvolvida com a fundação da neuropsicanálise. Já o segundo grupo, marcado fortemente pelo discurso lacaniano, é refratário a qualquer forma de articulação, por considerá-las todas epistemologicamente inviáveis, resultando necessariamente em uma submissão da psicanálise aos ditames cientificistas atuais. Por fim, o terceiro grupo entende ser a interlocução, sem a hierarquização dos modelos em jogo, fonte fértil para a formulação de novas hipóteses teóricas e para a revisão do edifício conceitual da psicanálise.Este artículo pretende presentar un mapa panorámico de los debates sobre la relación y la posible articulación entre Psicoanálisis e Neurociencias. En el campo psicoanalítico, son identificados tres grupos principales, definidos a partir de sus presuposiciones: (1 hibridismo, (2 aislamiento e (3 interlocución. El primer grupo entiende como necesaria la construcción de un campo híbrido, ya que las Neurociencias podrían suministrar a la Psicoanálisis fundamentos e instrumentos metodológicos y conceptuales más sólidos sobre el funcionamiento psíquico. A su vez el segundo grupo, marcado fuertemente por el discurso lacaniano, es refractario a cualquier forma de articulación por considerarla epistemológicamente inviable y resultando necesariamente en una sumisión de la psicoanálisis al dictamen cientificista actual. Por último

  16. Graphic proposal for multi thematic maps: the case of geoenvironmental diagnostic map of the Igarapava hydroelectric power plant; Proposta grafica para mapas politematicos: o caso do mapa diagnostico geoambiental da U.H.E. de Igarapava

    Energy Technology Data Exchange (ETDEWEB)

    Carmo, Valeria Amorim do [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Inst. de Geociencias. Dept. de Geografia

    1995-12-31

    This article aims at developing a graphic proposal for multithematic diagnostic map. The research`s objective is the analysis of the legends of the maps entitled Mapa Diagnostico Geoambiental da Usina Hidreletrica de Igarapava (Geoenvironmental Diagnostic map of the Igarapava Hydroelectric Plant). The analysis emphases on identifying and solving problems resulting in non-respect of the graphic transcription laws which prejudice the map`s clarity. Upon analyzing both versions of the maps, it appeared that these problems were basically resulting from bad legibility and visualization and the inadequate use of retina`s variables in the translation of graphic density and both retinian and angular separation. Graphic density was reduced and retinian separation was improved through leading a better contrast between elements of cartographic base and the Geoenvironment Synthesis Map. The angular separation was increased by using simplified forms to better visualization of the spatial structure of the information. That aspect was laos improved by creating a series of small maps to accompany the legend. Point and line elements were represented on the same map so to not prejudice hierarchical relationship between elements. All these modifications were done without affecting information extraction of the various levels of the Geoenvironmental Synthesis (BASE MAP, VEGETATION and LAND USE, HUMAN ASPECTS, CULTURAL ASPECTS AND ENVIRONMENTAL DYNAMIC). The visualization of the document as a whole was greatly improved with respect to the original proposed format. This research is but one of the various steps to the preparation of an environmental map that aims at giving clear visibility to the thousands of words of an environmental study report. (author) 4 refs., 8 figs.

  17. Aplicação do mapa conceitual: resultados com diferentes métodos de ensino-aprendizagem

    Directory of Open Access Journals (Sweden)

    Diana Paula de Souza Rego Pinto Carvalho

    2016-01-01

    Full Text Available Objetivo: analizar el resultado de una intervención de enseñanza aliada a un método tradicional para el desarrollo del concepto de complicaciones de la herida quirúrgica postoperatoria para uso en el pregrado en enfermería. Método: estudio de análisis cualitativo casi-experimental, aplicado por medio de una intervención de enseñanza en los estudiantes de enfermería de pregrado. La recolección de datos se dio en dos etapas, y los estudiantes fueron divididos al azar en los subgrupos I y II. Para facilitar la recopilación de datos, los estudiantes desarrollaron mapas conceptuales con la ayuda de las herramientas de software Cmap Tools®. Los datos fueron analizados mediante la técnica de análisis de contenido, identificando 12 categorías. Resultados: el subgrupo II mostró resultados positivos en relación con el subgrupo I, ya que la asociación de los dos métodos de enseñanza que utilizan la técnica de MC podría promover la capacidad de articular los conceptos desarrollados con conocimientos previos. Conclusión: se encontró que la asociación de la intervención docente con base teórica en la Teoría del Aprendizaje Significativo, más el método tradicional y el uso de la técnica de MC estimulan un buen desempeño de los estudiantes en el proceso de enseñanza-aprendizaje.

  18. Expression of the mucus adhesion genes Mub and MapA, adhesion-like factor EF-Tu and bacteriocin gene plaA of Lactobacillus plantarum 423, monitored with real-time PCR.

    Science.gov (United States)

    Ramiah, K; van Reenen, C A; Dicks, L M T

    2007-05-30

    Expression of the mucus adhesion genes Mub and MapA, adhesion-like factor EF-Tu and bacteriocin gene plaA by Lactobacillus plantarum 423, grown in the presence of bile, pancreatin and at low pH, was studied by real-time PCR. Mub, MapA and EF-Tu were up-regulated in the presence of mucus, proportional to increasing concentrations. Expression of MapA was up-regulated in the presence of 3.0 g/l bile and 3.0 g/l pancreatin at pH 6.5. Similar results were recorded in the presence of 10.0 g/l bile and 10.0 g/l pancreatin at pH 6.5. Expression of Mub was down-regulated in the presence of bile and pancreatin, whilst the expression of EF-Tu and plaA remained unchanged. Expression of Mub and MapA remained unchanged at pH 4.0, whilst expression of EF-Tu and plaA were up-regulated. Expression of MapA was down-regulated in the presence of 1.0 g/l l-cysteine HCl, suggesting that the gene is regulated by transcription attenuation that involves cysteine.

  19. Orientação metodológica para construção e leitura de mapas temáticos

    Directory of Open Access Journals (Sweden)

    Rosely Sampaio Archela

    2008-06-01

    Full Text Available L'article systématise les concepts fondamentaux du processus cartographique qui doivent être respectés dans la construction de cartes utiles à l'analyse et à la compréhension de l'espace géographique. Il établit une corrélation entre les cartes produites avec l’aide de logiciels gratuits, la sémiologie graphique et la préparation faite par le "constructeur" de cartes. Une analyse didactique présente un classement des types de cartes en fonction du mode d'expression, de l’échelle, du contenu, du type d'implantation, du niveau d'organisation, des variables visuelles et des méthodes de cartographie, afin de contribuer à la formation des "constructeurs" et des "lecteurs" de cartes. Finalement, il analyse le langage cartographique présent dans des cartes à plusieurs échelles.The article systematizes the fundamental concepts of the cartographic process which must be respected in the construction of maps if they are to be useful for the analysis and the comprehension of geographical space. It establishes a correlation between the maps produced with the assistance of free softwares, graphic semiology and the preparation made by the "manufacturer" of the maps. A didactic analysis  introduces a classification of the types of maps according to the mode of expression, scale, contents, type of implantation, level of organization, visual variables and methods of cartography, in order to contribute to the training of the "manufacturers" and "readers" of charts. Finally, it analyzes the cartographic language present in maps at several scales.O artigo sistematiza os conceitos fundamentais do processo cartográfico que devem ser observados na construção de mapas úteis para a análise e compreensão do espaço geográfico. Estabelece uma correlação entre os mapas gerados com auxilio de softwares livres, a semiologia gráfica e o preparo do “construtor” de mapas. Por meio de uma exposição didática, apresenta uma classifica

  20. Specyficzne warianty języków narodowych: polski północnokresowy i niemiecki nadwołżański. Perspektywy badań porównawczych

    Directory of Open Access Journals (Sweden)

    Jolanta Mędelska

    2015-12-01

    . In the Soviet period, a peculiar cultural dialect developed, based on the dialects of Volga German. The author discusses the points of contact and divergence in the history of Volga German and Polish Northern Kresy dialect, indicating possible directions for comparative research.   Specyficzne warianty języków narodowych: polski północnokresowy i niemiecki nadwołżański. Perspektywy badań porównawczych Autorka zajmuje się szczególnymi kodami językowymi: polszczyzną północnokresową i niemczyzną nadwołżańską. Są to odmiany języków narodowych, które rozwijały się w niezwykłych warunkach. Oba znajdowały się poza terytorium etnicznym i występowały głównie w postaci rozległych wysp językowych. Polszczyzna północnokresowa ukształtowała się na ziemiach dzisiejszej Litwy, Białorusi, Łotwy w dwóch odmianach. Polacy dobrowolnie przenoszący się do miast i miasteczek Wielkiego Księstwa Litewskiego przenieśli na te tereny język polski, który z czasem przejmowały miejscowe warstwy wyższe, polonizując się i wytwarzając specyficzny miejscowy dialekt kulturalny. W II połowie XIX w. dialekt ten zaczęli przejmować chłopi litewscy i białoruscy. W ten sposób powstały zwarte obszary języka polskiego za północno-wschodnią granicą etniczną, czyli gwary północnokresowe. Obie odmiany polszczyzny rozwijały się w Imperium Rosyjskim, gdzie poddawane były rusyfikacji. Ponownie trafiły w orbitę silnego oddziaływania języka rosyjskiego po II wojnie światowej. W Litewskiej Socjalistycznej Republice Radzieckiej na ich podstawie ukształtował się nowy północnokresowy dialekt kulturalny. Dialekty niemieckie Powołża należą do gwar przeniesionych, trafiły nad Wołgę w XVIII w. wraz z przybyszami z różnych stron Niemiec, na nowym miejscu uległy modyfikacji, polegającej głównie na wymieszaniu poszczególnych gwar. Długo rozwijały się w izolacji zarówno od rosyjskiego otoczenia, jak i od innych odmian j

  1. O uso de geotecnologias na elaboração de mapas de ruído The use of geotechnologies in the noise mapping

    Directory of Open Access Journals (Sweden)

    Évely Mara Scariot

    2012-03-01

    Full Text Available A elaboração de mapas de ruído com o apoio das geotecnologias é uma poderosa ferramenta para visualização e compreensão do comportamento do ruído em determinada área. Nesta pesquisa avaliaram-se os níveis de pressão sonora em uma região de aproximadamente 18 ha, composta por indústrias, residências, criação de animais e uma avenida movimentada no entorno do município de Campo Grande (MS. Efetuaram-se análises semivariográficas das amostras e os mapas de ruído foram desenvolvidos utilizando-se krigagem, que se mostrou adequada, desde que os dados coletados fossem representativos e os pontos de amostragem coerentes com a situação que se queria avaliar. Os mapas de ruído permitiram identificar as regiões mais críticas, as fontes e suas respectivas áreas de influência, além de verificar onde são ultrapassados os limites normativos de pressão sonora.Geotechnologies application in noise mapping consists in a powerful tool to visualize and understand the sound distribution in a specific area. This research was done at the city of Campo Grande, Mato Grosso do Sul, Brazil, in an area of approximately 18 ha, where there are industries, residences, animal breeding and an avenue. Sound level pressures were explored, semivariografic analysis were done and noise maps were developed using kriging, that demonstrated to be appropriated, since that the collected data were representative and the sampling points coherent with the situation that needed to be evaluated. The noise maps permitted to identify the most critical regions, the sources and their influence areas, as verify where the normative limit values for sound pressure exceed.

  2. Mapas conceituais: estratégia de ensino/aprendizagem e ferramenta avaliativa Conceptual maps: teaching and learning strategies and an evaluative tool

    Directory of Open Access Journals (Sweden)

    Nadia Aparecida de Souza

    2010-12-01

    Full Text Available O presente ensaio tem por objetivo apresentar uma reflexão sobre as potencia lidades do mapa conceitual como estratégia de ensino/aprendizagem e ferramenta ava liativa. Revisitar o referencial teórico relativo à temática possibilitou contemplar a utili dade do mapa conceitual sob diferentes perspectivas: daquele que ensina e daquele que aprende. Valer-se dos mapas conceituais como estratégias de ensino/aprendizagem, também e concomitantemente como ferramenta avaliativa, é criar possibilidades para a organiza ção do conhecimento pela promoção de experiências educativas que provoquem não somen te reflexão, busca de compreensão e processamento profundo da informação, mas tam bém o desenvolvimento da autorregulação, da metacognição e do aprender a aprenderThis essay has the purpose of reflecting upon the potential benefits of con ceptual map as teaching and learning strategies and an evaluative tool. To revisit the the oretical framework of this theme made it possible to analyze the utility of conceptual map under different perspectives: the teachers´ and the students´. It became clear that the use of conceptual map as teaching and learning strategies, as well as an evaluative tool, leads to knowledge organization by means of promotion of learning experiences which not only generate reflection, comprehension and deep processing of information, but also contributes to the development of metacognition, self-regulation and learning to learn processes

  3. Influencia del uso de mapas conceptuales en la construcción de la habilidad. Clasificación en Ciencias Naturales

    OpenAIRE

    Amaya Moyano, Blanca Lilia

    2003-01-01

    Tesis (Maestría en Educación y Desarrollo Humano). Universidad de Manizales. Facultad de Ciencias Sociales y Humana. CINDE, 2003 El presente trabajo de investigación Influencia del uso de mapas conceptuales en la construcción de la habilidad clasificación en ciencias naturales, parte de la consideración de que la dinámica del mundo contemporáneo y globalizado, exige la formación de ciudadanos con capacidad para comprender los cambios que se producen en la sociedad y para enfrentar un mu...

  4. Mapas de ruta para comprender los intereses estratégicos y éticos de la política exterior y de seguridad canadiense

    OpenAIRE

    Rodríguez-Morales, Federmán

    2010-01-01

    Este artículo intenta explorar los intereses estratégicos y éticos de la política exterior y de seguridad canadiense. La investigación sugiere que no solo la relación estratégica con los Estados Unidos sino también la necesidad de consolidar su liderazgo internacional, junto con sus preocupaciones liberales, sustentan la naturaleza de la agenda de seguridad internacional de Canadá. Estos intereses han sido explicados a la luz de los respectivos “mapas de ru-ta” que les imprimen sentido. Por u...

  5. O mapa mental, um organizador gráfico como estratégia didática para a construção do conhecimento

    OpenAIRE

    Muñoz González, Juan Manuel; Universidad de Córdoba; Ontoria Peña, Antonio; Universidad de Córdoba; Molina Rubio, Ana; Universidad de Córdoba

    2012-01-01

    En este trabajo, buscamos registrar el impacto de los mapas mentales como organizadores gráficos en la construcción del conocimiento. Realizamos la investigación con 140 estudiantes universitarios de segundo curso de la Titulación de Magisterio, en la especialidad de Educación Primaria. Optamos por el modelo cualitativo de investigación, al aplicar un cuestionario autorreflexivo al alumnado; para el procesamiento de los datos, utilizamos el programa Atlas.ti. Señalamos, como síntesis, que el ...

  6. Recuperação de informação em dados ligados: um modelo baseado em mapas conceituais e análise de redes complexas

    Directory of Open Access Journals (Sweden)

    Henrique Monteiro CRISTOVÃO

    Full Text Available Resumo Este artigo apresenta um modelo para recuperação de informação em dados abertos ligados, usando métodos e operações de redes complexas para classificação e seleção de informações, bem como mapas conceituais para apresentação das informações recuperadas ao usuário. O modelo evidencia os relacionamentos entre os termos de consulta que representam uma necessidade informacional e os apresenta enquanto mapas conceituais. A hipótese subjacente é que o relacionamento do usuário com a informação recuperada ocorre à luz da equação fundamental da Ciência da Informação de Brookes, em que a estrutura cognitiva do cognoscente é uma rede complexa que é modulada pela informação recuperada, a qual, por sua vez, é derivada de uma rede complexa. A rede complexa final é mapeada em um mapa conceitual resultante aprimorado com heurísticas. Com características qualitativas e o emprego de abordagem exploratória, a pesquisa realizou primeiramente um teste piloto de recuperação da informação, que permitiu aferir os algoritmos empregados no ranqueamento e seleção nas redes de informação intermediárias, servindo de base para implementação de um protótipo. O protótipo empregou uma base de conhecimento de dados abertos ligados (linked open data, derivada da DBpedia, sobre a qual foram realizadas operações de análise de redes complexas, apresentando revocação e precisão relevantes, perante uma validação aplicada a um grupo de 17 usuários. Os resultados são promissores quanto ao uso de operações de redes complexas e mapas conceituais na recuperação de informação, especialmente em dados ligados. Como continuidade da pesquisa, observou-se demanda por ações mais interativas e pela realização de experimentos em outras bases de conhecimento.

  7. Banca pública venezolana: reconfiguración del mapa de financiación al desarrollo nacional

    Directory of Open Access Journals (Sweden)

    Marianela Acuña Ortigoza

    2014-01-01

    Full Text Available Durante el período 2000-2011 se producen en Venezuela cambios institucionales que posibilitan la reconfiguración del mapa de financiación al desarrollo nacional. El nuevo marco constitucional, surgido de la aprobación de la Constitución de la Republica Bolivariana de Venezuela de 1999, los lineamientos establecidos en los Planes de la Nación 2001-2007 y 2007-2013, y la manifestación de contradicciones entre la práctica financiera y los objetivos de política pública, se constituirán en el curso del período, en condicionantes permanentes de las transformaciones institucionales del sistema financiero. El objetivo de esta investigación es explicar los cambios institucionales que se han producido en la banca pública venezolana y los resultados alcanzados en relación a los objetivos de la política económica. Mediante una investigación documental con diseño bibliográfico, se explica la experiencia venezolana de transformación de la banca pública y la política pública definida para producir esos cambios, considerando el uso de la capacidad de apalancamiento del sistema financiero como elemento de democratización financiera y dinamizador del desarrollo nacional. Los resultados de la investigación permiten concluir que durante el período 2000-2011 la política económica venezolana persigue modificar los rasgos distintivos del sistema financiero venezolano, y en particular del sector bancario público, y profundizar las transformaciones gradualmente producidas en el sector, de acuerdo a los objetivos de democratización del capital, incremento de la participación del Estado en la actividad financiera y redireccionamiento de la actividad bancaria a los propósitos del desarrollo nacional.

  8. Mapas de Significados Espaciais e Vivência Geracional de Homens e Mulheres Nikkeys de Maringá e Londrina, Paraná. DOI: 10.5212/Rlagg.v.6.i1.0005

    OpenAIRE

    Kataoka, Caio Shigueharu; Universidade Estadual de Ponta Grossa; Ornat, Marcio Jose; Universidade Estadual de Ponta Grossa

    2014-01-01

    Este artigo problematiza a relação entre os mapas de significados espaciais e a vivência geracional de homens e mulheres nikkeys no Norte do Paraná. Nosso recorte espacial refere-se às cidades de Maringá e Londrina, tendo visto o fato de apresentarem tanto considerável população relativa de japoneses, quanto expressiva manifestação cultural, organizada segundo Associações Culturais e Esportivas. O campo realizado evidencia os diferentes mapas de significados espaciais constituídos por homens ...

  9. Estudio comparativo de los mapas forestales de España a escala 1:200.000, 1:50.000 y 1:25.000 para las principales especies forestales en Galicia

    OpenAIRE

    Martínez Huerta, Diego

    2013-01-01

    El Mapa Forestal de España (MFE) es una herramienta fundamental en diversos campos relacionados con el medioambiente (incendios forestales, cambio climático, sumideros de CO2, usos de suelo y ordenación del territorio). Se analiza aquí la evolución en Galicia de la superficie de Castanea sativa, Pinus pinaster, Pinus sylvestris y Quercus pyrenaica en los tres Mapas Forestales (MFE200, MFE50 y MFE25) disponibles en formato digital hoy en día, así como la evolución del estado de la masa de Pinu...

  10. Convergencia de Los Mapas Conceptuales, las TIC y el e-learning en el proceso de enseñanza-aprendizaje.

    Directory of Open Access Journals (Sweden)

    Lydia Rosa Ríos Rodríguez

    2006-10-01

    Full Text Available Este artículo trata sobre los beneficios que aportan las tecnologías de la Informática, las comunicaciones, los mapas conceptuales y el e-learning al proceso de enseñanza – aprendizaje. Destaca al desarrollo de los sistemas de enseñanza asistidas por computadoras, desde los programas lineales hasta los actuales software educativos de enseñanza a distancia, el aporte que las técnicas de inteligencia artificial, internet, los foros de especialistas (como espacio abierto para la difusión de trabajos de investigación sobre temas específicos, las video conferencias interactivas, el uso de entrenadores, tutoriales inteligentes, simuladores, videos y otros medios que hacen más fácil la adquisición del conocimiento. Por ultimo se propone una herramienta: Software educativo de enseñanza a distancia “Mapa Conceptual del tema Programación Lógica”, que se está confeccionando por el grupo de desarrollo del software para la enseñanza, el cual ayudará a suplir las carencias (intelectuales y materiales que surjan en el país.

  11. Comparación de métodos de interpolación para la generación de Mapas de Ruido en entornos urbanos

    Directory of Open Access Journals (Sweden)

    Diego Murillo

    2012-06-01

    Full Text Available En este trabajo se presenta el estudio efectuado con el propósito de analizar la congruencia de los métodos de interpolación en la generación de mapas de ruido. Para esto, se realizaron mediciones del nivel de presión sonora equivalente de acuerdo con la resolución 0627 del Ministerio del Medio Ambiente, Vivienda y Desarrollo Territorial en dos áreas de la ciudad de Medellín. Para la obtención de las curvas de niveles de ruido se utilizaron los métodos de interpolación Kriging e IDW en el software SIG ArcGis. En el aplicativo se varió la configuración de los parámetros de entrada y se efectuó un análisis estadístico para determinar qué modelo presentaba resultados más precisos. Por último, se llevó a cabo una valoración del mapa de ruido obtenido comparándolo con la legislación colombiana.

  12. ¿Cómo la estrategia de mapas mentales y conceptuales estimulan el desarrollo de la inteligencia espacial en estudiantes universitarios?

    Directory of Open Access Journals (Sweden)

    Bertha Marlén Velásquez Burgos

    2011-01-01

    Full Text Available El presente artículo explicita los resultados del proyecto de investigación titulado ¿Cómo la estrategia de mapas mentales y conceptuales estimulan el desarrollo de la inteligencia visual-espacial en estudiantes de la universidad? desarrollado en el marco de la Teoría de las Inteligencias Múltiples de Gardner, así como en el trabajo realizado por Novak y Buzán en torno de los mapas conceptuales y mentales. El resultado de la investigación evidencia que el uso de esta estrategia se constituye en herramienta que potencian la inteligencia visual-espacial, por cuanto estimulan: la creación de imágenes con el fin de explicar una idea; el desarrollo de la memoria visual para ejecutar y recrear percepciones anteriores; el perfeccionamiento del sentido artístico y estético; la práctica para controlar el movimiento motor fino; la práctica del arte visual, por cuanto hay retención de objetos, figuras, colores, proporción y perspectiva; entre otras habilidades centrales que caracterizan este tipo de inteligencia.

  13. MODELOS DIDÁTICOS E MAPAS CONCEITUAIS: BIOLOGIA CELULAR E AS INTERFACES COM A INFORMÁTICA EM CURSOS TÉCNICOS DO IFMS

    Directory of Open Access Journals (Sweden)

    Airton José Vinholi Júnior

    2014-05-01

    Full Text Available Considerando as dificuldades inerentes ao conteúdo de Biologia celular, foi proposta a confecção e uso de modelos didáticos como meio potencialmente significativo para efetivar a aprendizagem de conceitos sobre célula em estudantes do IFMS/Ponta Porã. Procurou-se, com o uso de Mapas Conceituais, favorecer uma organização dos conhecimentos sobre essa temática, de modo a promover uma visão mais integradora do conteúdo. O estudo fundamentou-se na Teoria da Aprendizagem Significativa de David Ausubel. Com base nos conhecimentos prévios, foi preparada a sequencia didática, que se subordinou também aos princípios da diferenciação progressiva e reconciliação integrativa, utilizando Mapas Conceituais. Tais dados, após serem descritos e analisados, permitiram inferir a ocorrência da evolução conceitual e Aprendizagem Significativa. O trabalho demonstra união de conhecimento de área básica e técnica para contribuir com o ensino e aprendizagem em cursos de educação profissional e tecnológica do IFMS.

  14. An alternative methionine aminopeptidase, MAP-A, is required for nitrogen starvation and high-light acclimation in the cyanobacterium Synechocystis sp. PCC 6803.

    Science.gov (United States)

    Drath, Miriam; Baier, Kerstin; Forchhammer, Karl

    2009-05-01

    Methionine aminopeptidases (MetAPs or MAPs, encoded by map genes) are ubiquitous and pivotal enzymes for protein maturation in all living organisms. Whereas most bacteria harbour only one map gene, many cyanobacterial genomes contain two map paralogues, the genome of Synechocystis sp. PCC 6803 even three. The physiological function of multiple map paralogues remains elusive so far. This communication reports for the first time differential MetAP function in a cyanobacterium. In Synechocystis sp. PCC 6803, the universally conserved mapC gene (sll0555) is predominantly expressed in exponentially growing cells and appears to be a housekeeping gene. By contrast, expression of mapA (slr0918) and mapB (slr0786) genes increases during stress conditions. The mapB paralogue is only transiently expressed, whereas the widely distributed mapA gene appears to be the major MetAP during stress conditions. A mapA-deficient Synechocystis mutant shows a subtle impairment of photosystem II properties even under non-stressed conditions. In particular, the binding site for the quinone Q(B) is affected, indicating specific N-terminal methionine processing requirements of photosystem II components. MAP-A-specific processing becomes essential under certain stress conditions, since the mapA-deficient mutant is severely impaired in surviving conditions of prolonged nitrogen starvation and high light exposure.

  15. Intra-Eu Capital Movements: Ten Years Of Poland’S Experiences As An Eu Member In The Global Context / Wewnątrz-Unijne Przepływy Kapitałowe: Doświadczenia 10 Lat Członkostwa Polski W Unii Europejskiej

    Directory of Open Access Journals (Sweden)

    Witkowska Janina

    2015-08-01

    Full Text Available Celem artykułu jest analiza i ocena konsekwencji ustanowienia swobodnego przepływu kapitału między Polską i innymi krajami członkowskimi Unii Europejskiej (EU z perspektywy dziesięciu lat jej członkostwa w UE. Szczególną uwagę zwrócono na rolę wewnątrz-unijnych bezpośrednich inwestycji zagranicznych (BIZ napływających do polskiej gospodarki. Rozszerzenie UE w 2004r. spowodowało poważne prawne i ekonomiczne procesy dostosowawcze w nowych krajach członkowskich. Ustanowienie swobodnego przepływu kapitału, jako jednej z czterech tzw. swobód w ramach jednolitego rynku europejskiego, było koniecznością między UE15 i nowymi krajami członkowskimi. Nowe kraje członkowskie UE musiały tego dokonać w stosunkowo krótkim okresie. Ustanowienie swobody przepływu kapitału między Polską a resztą UE nie tylko nie spowodowało zakłóceń w jej gospodarce, ale przyczyniło się do stabilizacji sfery ekonomicznej i społecznej. Wewnątrz-unijne BIZ ułatwiają procesy restrukturyzacji polskiej gospodarki. Rola inwestorów zagranicznych w sferze zatrudnienia i handlu zagranicznego jest znacząca dla stabilizacji sytuacji ekonomicznej Polski. Zaangażowanie inwestorów zagranicznych w procesy innowacyjne, chociaż rosnące, nie zmienia radykalnie pozycji Polski w tym obszarze. Według unijnych rankingów innowacyjności, Polska należy do grupy raczej słabych innowatorów.

  16. Elaboração do mapa de recursos: processo de apoio ao planejamento de um novo negócio de internet

    Directory of Open Access Journals (Sweden)

    Josué Vitor de Medeiros Júnior

    2015-10-01

    Full Text Available O artigo tem como objetivo apresentar a aplicação de um método de elaboração do Mapa de Recursos para apoiar o planejamento de um novo negócio baseado na internet a partir da percepção do seu empreendedor. O mapa de recursos resultante é uma representação visual das inter-relações entre os recursos estratégicos, assim caracterizados em função dos pressupostos teóricos da Visão Baseada em Recursos (VBR, bem como da Dinâmica de Sistemas, que caracteriza tais representações por enlaces de feedback, fluxos e acumulações, responsáveis por comportamentos de aspectos sistêmicos como o desempenho organizacional. Em relação a metodologia, a pesquisa se caracteriza como exploratória descritiva, subtipo estudo de caso e para a coleta de dados foram utilizados questionários e entrevistas com o empreendedor responsável pelo negócio. O método da elaboração do mapa ocorreu em algumas etapas como levantamento e seleção dos recursos estratégicos da empresa, definição dos fluxos de acúmulo dos recursos e os relacionamentos entre eles, identificação das políticas de desenvolvimento dos recursos, incorporação de variáveis financeiras e identificação das capacidades responsáveis pelo desenvolvimento do negócio. Como resultados da pesquisa, obteve-se a identificação e classificação dos recursos estratégicos da organização e como esses recursos se inter-relacionam e impactam no seu desempenho. A originalidade do trabalho se justifica pela construção do mapa de recursos em uma empresa nascente, auxiliando o empreendedor a identificar e explorar os recursos estratégicos iniciais e como a tomada de decisão por parte do empreendedor pode impactar no desempenho da empresa. Como contribuição, o processo de elaboração do mapa, através de uma representação visual não linear dos recursos estratégicos, a partir do modelo mental do empreendedor, mostrou-se como um processo de aprendizado e reflexão sobre

  17. Wpływy polskie w jidysz według "History of the Yiddish Language" Maxa Weinreicha – przegląd i próby weryfikacji

    Directory of Open Access Journals (Sweden)

    Michał Gajek

    2016-12-01

    Full Text Available Polish influence on Yiddish as described in Max Weinreich’s History of the Yiddish Language – overview and attempts at verification The Article concentrates on the findings regarding Slavic influence on Yiddish, described in the newest English-language edition of Max Weinreich’s History of the Yiddish Language – a canonical title for modern Yiddish studies. Its first task is to acquaint Polish readers with M. Weinreich’s propositions and findings on the general character of Polish-Yiddish and Slavic-Yiddish language contact. This will also be taken as an opportunity to briefly review the research on this subject conducted by Polish scholars. Additionally, the article will elaborate (albeit not exhaustively on the attempts to question and verify M. Weinreich’s theories which may prove interesting from the point of view of Slavic studies. Its second, equally important task is to describe chosen examples of the results of Slavic influence, in which Polish played a significant role, as they present themselves in the lexicon, morphology, word formation and syntax of Yiddish.   Wpływy polskie w jidysz według History of the Yiddish Language Maxa Weinreicha – przegląd i próby weryfikacji Artykuł skupia się na ustaleniach na temat wpływów słowiańskich w jidysz, zawartych w najnowszym, anglojęzycznym wydaniu pracy Maxa Weinreicha pt. History of the Yiddish Language, mającej status pozycji kanonicznej współczesnej jidyszystyki. Jego pierwszym celem jest przybliżenie polskiemu czytelnikowi tez i ustaleń M. Weinreicha, dotyczących ogólnego charakteru językowych kontaktów polsko- i słowiańsko-żydowskich. Przy tej okazji uwzględnione zostaną informacje na temat badań, jakie do tej pory poczynili w tej materii językoznawcy polscy. Ponadto (niewyczerpująco poruszona zostanie kwestia prób weryfikacji i podważenia jego twierdzeń, interesująca z punktu widzenia slawistyki. Drugim, nie mniej wa

  18. O Mapa da Estrada.

    Directory of Open Access Journals (Sweden)

    Cristina Soreanu Pecequilo

    2011-08-01

    Full Text Available O presente artigo busca analisar as nova conformação política existente no Oriente Médio, pautada por novos constrangimentos tal como a retomada das negociações de paz entre Israel e Palestina e a reconstrução do Iraque, após a queda de Saddam Hussein.

  19. 25 lat polityki zjednoczonych Niemiec wobec Polski

    OpenAIRE

    Trzcielińska-Polus, Aleksandra

    2017-01-01

    Im Artikel wird die Politik Deutschlands gegenüber Polen seit der Unterzeichnung des Vertrages über gute Nachbarschaft und freundschaftliche Zusammenarbeit am 17. Juni 1991 bis heute dargestellt. Der Vertrag markierte die historische Wende in den vielschichtigen deutsch-polnischen Beziehungen und eröffnete ein neues Kapitel. Man sprach damals von der Werte- und Interessengemeinschaft. Später aber war auch die Rede von einer Konflikt- und Streitgemeinschaft. Deswegen wurden die vergangenen 25 ...

  20. Mapa de preferência de sorvetes ricos em fibras Preference map of high-fiber ice cream

    Directory of Open Access Journals (Sweden)

    Regiane Lopes de Sales

    2008-12-01

    Full Text Available Quatro amostras de sorvete foram preparadas adicionando-se diferentes concentrações de granola e Frutooligossacarídeo (FOS. Foi avaliado o teor de fibras segundo método AOAC. A avaliação da aceitabilidade sensorial foi realizada por 78 consumidores, com idade entre 15 e 25 anos. Estes avaliaram a aceitação global das formulações, utilizando a escala hedônica de nove pontos, em uma única seção, de forma monádica. O experimento foi estruturado segundo delineamento em blocos inteiramente casualizados. Os resultados foram submetidos à análise de variância, ao teste de médias de Tuckey e à metodologia do Mapa de Preferência interno para análise dos componentes principais. As amostras controle e as adicionadas de FOS tiveram melhor aceitação. A amostra contendo somente FOS foi a que mais se aproximou do produto tradicional, não diferindo significativamente quanto à aceitação global. A granola distinguiu-se estatisticamente do produto tradicional. O teor de fibras analisado foi superior ao fornecido pelo fabricante da granola. As concentrações de fibras nos sorvetes variaram de 0,9 a 5,45 g.100 g-1 de sorvete, com a maior concentração de fibras provenientes do FOS. Esse resultado permite concluir que o FOS é um ingrediente promissor no desenvolvimento de produtos ricos em fibras.Four samples of ice cream were prepared with four different concentrations of granola and fructooligosaccharide (FOS. The concentration of fiber was evaluated using the AOAC method. The acceptance evaluation was conducted by 78 consumers between 15 and 25 years of age. The consumers evaluated the global acceptance of the formulations through the structured 9-point hedonic scale, in a single section, in a monadic form. The experiment was structured by a Randomized Complete Block Design. The results were submitted to the analysis of variance, Tukey test, and to the preference mapping technique for principal component analysis. The control samples

  1. Mapa digital de solos: uma proposta metodológica usando inferência fuzzy Digital soil map: a methodological proposal using fuzzy inference

    Directory of Open Access Journals (Sweden)

    Claudia C. Nolasco-Carvalho

    2009-02-01

    Full Text Available Elaborou-se um mapa digital de solos de uma área na região de Mucugê, BA, com o objetivo de avaliar o uso de geotecnologias na cartografia de solos. A metodologia desenvolvida a partir do modelo de inferência para solos - SoLIM , requer o conhecimento prévio da área por um especialista em mapeamento e está alicerçada na equação dos fatores de formação do solo e no modelo de distribuição dos solos na paisagem. Os dados, advindos do Modelo Digital do Terreno - MDT, da vegetação e da geologia, foram associados ao conhecimento do pedólogo e integrados em ambiente SIG (Sistema de Informações Geográficas sob inferência fuzzy. A modelagem por lógica fuzzy permitiu apontar as incertezas e transições da cobertura pedológica e gerou um mapa digital de solo que, quando comparado com o mapa convencional da área, mostrou menor generalização no domínio de espaços e parâmetros, ou seja, um refinamento da escala, porém a aplicabilidade da metodologia depende da validação de campo e da repetição em outras áreas.A digital soil map was elaborated for an area in the region of Mucugê-BA using data integration derived from a digital elevation model (DEM of the vegetation and geology that was associated with a soil scientist's knowledge and correlated in a GIS environment (Geography Information System under fuzzy inference, as a methodological proposal. The methodology was developed and based on the soil-land inference model - SoLIM, on the soil factor equation and the soil-landscape model. The fuzzy logic is able to simulate the uncertainty and transitions that often appear in pedologic systems. The results show that the methodology allows the generation of digital soil maps with increased scale and to reduce soil classe generalizations in the space and parameter domain. However, this methodology is very dependent upon the soil expert's knowledge and accuracy of the data base. To verify the applicability of the methodology the

  2. Mapa estratégico para uma indústria do setor lácteo [doi: 10.5329/RECADM.2013001

    Directory of Open Access Journals (Sweden)

    Silvana Anita Walter

    2013-04-01

    Full Text Available Este estudo objetivou desenvolver, a partir das perspectivas tradicionais do Balanced Scorecard e da do meio ambiente, um mapa estratégico para uma indústria do setor lácteo. Desenvolveu-se uma pesquisa descritiva com estudo de caso e coleta de dados por meio de entrevistas, documentos, observação participante e questionário. Para análise dos dados, empregou-se, com o auxílio do Atlas.ti 5.0, a análise documental e de conteúdo do tipo temática. As análises permitiram observar que a empresa possui como desafio ampliar a captação de matéria-prima e melhorar o sistema de informação; que realiza parcerias em produtos e em pesquisa; e que procura inovar em equipamentos e produtos, além de ser pioneira no Brasil no tocante à produção de soro concentrado de leite. Como implicação gerencial, destaca-se a criação do mapa estratégico. A inclusão da perspectiva do meio ambiente e a proposição de medidas para empresas do setor lácteo se caracterizam como contribuição teórica.   Palavras-chave: Ferramenta estratégica; Balanced Scorecard; Mapa estratégico; Perspectiva do Meio Ambiente; Empresa de Lácteo.     STRATEGIC MAP FOR A DAIRY COMPANY   ABSTRACT This study aimed to develop, from the traditional perspectives of the Balanced Scorecard and from the environment, a strategic map for an industry in the dairy sector. It was developed a descriptive research with case study and data collection through interviews, documents, participant observation and questionnaire. For data analysis, it was used, with the aid of Atlas.ti 5.0, the documental and content analysis of the thematic type. The analysis had pointed out that the company has as a challenge to expand the collection of raw materials and improve the information system; which carries partnerships in products and in research; and seeks to innovate in equipment and products, besides being a pioneer in Brazil in terms of concentrated milk whey production. As a managerial

  3. Increased toll-like receptors and p53 levels regulate apoptosis and angiogenesis in non-muscle invasive bladder cancer: mechanism of action of P-MAPA biological response modifier

    International Nuclear Information System (INIS)

    Garcia, Patrick Vianna; Seiva, Fábio Rodrigues Ferreira; Carniato, Amanda Pocol; Mello Júnior, Wilson de; Duran, Nelson; Macedo, Alda Maria; Oliveira, Alexandre Gabarra de; Romih, Rok; Nunes, Iseu da Silva; Nunes, Odilon da Silva; Fávaro, Wagner José

    2016-01-01

    The new modalities for treating patients with non-muscle invasive bladder cancer (NMIBC) for whom BCG (Bacillus Calmette-Guerin) has failed or is contraindicated are recently increasing due to the development of new drugs. Although agents like mitomycin C and BCG are routinely used, there is a need for more potent and/or less-toxic agents. In this scenario, a new perspective is represented by P-MAPA (Protein Aggregate Magnesium-Ammonium Phospholinoleate-Palmitoleate Anhydride), developed by Farmabrasilis (non-profit research network). This study detailed and characterized the mechanisms of action of P-MAPA based on activation of mediators of Toll-like Receptors (TLRs) 2 and 4 signaling pathways and p53 in regulating angiogenesis and apoptosis in an animal model of NMIBC, as well as, compared these mechanisms with BCG treatment. Our results demonstrated the activation of the immune system by BCG (MyD88-dependent pathway) resulted in increased inflammatory cytokines. However, P-MAPA intravesical immunotherapy led to distinct activation of TLRs 2 and 4-mediated innate immune system, resulting in increased interferons signaling pathway (TRIF-dependent pathway), which was more effective in the NMIBC treatment. Interferon signaling pathway activation induced by P-MAPA led to increase of iNOS protein levels, resulting in apoptosis and histopathological recovery. Additionally, P-MAPA immunotherapy increased wild-type p53 protein levels. The increased wild-type p53 protein levels were fundamental to NO-induced apoptosis and the up-regulation of BAX. Furthermore, interferon signaling pathway induction and increased p53 protein levels by P-MAPA led to important antitumor effects, not only suppressing abnormal cell proliferation, but also by preventing continuous expansion of tumor mass through suppression of angiogenesis, which was characterized by decreased VEGF and increased endostatin protein levels. Thus, P-MAPA immunotherapy could be considered an important therapeutic

  4. Increased toll-like receptors and p53 levels regulate apoptosis and angiogenesis in non-muscle invasive bladder cancer: mechanism of action of P-MAPA biological response modifier.

    Science.gov (United States)

    Garcia, Patrick Vianna; Seiva, Fábio Rodrigues Ferreira; Carniato, Amanda Pocol; de Mello Júnior, Wilson; Duran, Nelson; Macedo, Alda Maria; de Oliveira, Alexandre Gabarra; Romih, Rok; Nunes, Iseu da Silva; Nunes, Odilon da Silva; Fávaro, Wagner José

    2016-07-07

    The new modalities for treating patients with non-muscle invasive bladder cancer (NMIBC) for whom BCG (Bacillus Calmette-Guerin) has failed or is contraindicated are recently increasing due to the development of new drugs. Although agents like mitomycin C and BCG are routinely used, there is a need for more potent and/or less-toxic agents. In this scenario, a new perspective is represented by P-MAPA (Protein Aggregate Magnesium-Ammonium Phospholinoleate-Palmitoleate Anhydride), developed by Farmabrasilis (non-profit research network). This study detailed and characterized the mechanisms of action of P-MAPA based on activation of mediators of Toll-like Receptors (TLRs) 2 and 4 signaling pathways and p53 in regulating angiogenesis and apoptosis in an animal model of NMIBC, as well as, compared these mechanisms with BCG treatment. Our results demonstrated the activation of the immune system by BCG (MyD88-dependent pathway) resulted in increased inflammatory cytokines. However, P-MAPA intravesical immunotherapy led to distinct activation of TLRs 2 and 4-mediated innate immune system, resulting in increased interferons signaling pathway (TRIF-dependent pathway), which was more effective in the NMIBC treatment. Interferon signaling pathway activation induced by P-MAPA led to increase of iNOS protein levels, resulting in apoptosis and histopathological recovery. Additionally, P-MAPA immunotherapy increased wild-type p53 protein levels. The increased wild-type p53 protein levels were fundamental to NO-induced apoptosis and the up-regulation of BAX. Furthermore, interferon signaling pathway induction and increased p53 protein levels by P-MAPA led to important antitumor effects, not only suppressing abnormal cell proliferation, but also by preventing continuous expansion of tumor mass through suppression of angiogenesis, which was characterized by decreased VEGF and increased endostatin protein levels. Thus, P-MAPA immunotherapy could be considered an important therapeutic

  5. A CARTOGRAFIA PROSPECTIVA E A GERAÇÃO DE MAPAS PREDITIVOS DO USO E COBERTURA DA TERRA – ESTUDO DE CASO: Perímetro urbano de Paranaguá – Paraná – Brasil

    Directory of Open Access Journals (Sweden)

    Arnaldo Eugênio Ricobom

    2014-04-01

    Full Text Available O objetivo deste artigo é descrever a produção de mapas preditivos, dentro da Cartografia Prospectiva, confeccionados com o auxílio dos Sistemas de Informação Geográfica (SIG, por intermédio da geração de um modelo têmporo-espacial. Essa modelagem emprega duas técnicas consecutivas, a dos algoritmos da cadeia de Markov de 2ª ordem e a dos Autômatos Celulares (CA. A modelagem dos algoritmos da Cadeia de Markov de 2ª ordem mostra como o sistema evoluirá no tempo, já a modelagem dos Autômatos Celulares (CA mostra qual o espaço (tamanho, forma e direção que um sistema ocupará futuramente. Para o desenvolvimento desta modelagem foi utilizado o software IDRISI - ANDES. A área piloto escolhida foi o perímetro urbano de Paranaguá, para o qual foram confeccionados mapas originais de uso e ocupação da terra, para os anos de 1980, 2003, 2006 e 2009. Os resultados das modelagens foram os mapas preditivos têmporo-espaciais para os anos de 2003, 2006 e 2009. Tais mapas preditivos foram comparados, avaliados e validados com os originais para estas datas. Os resultados demonstraram que as duas técnicas de modelagem aplicadas consecutivamente são eficientes para a geração de mapas preditivos, que mostrem a projeção de dinâmicas têmporo-espaciais, contudo recomenda-se que os resultados também sejam analisados mediante o conhecimento geográfico de cada área.

  6. Estudo de dois mapas do geógrafo Robert de Vaugondy relativos ao Reino de Portugal do Século XVIII (1751

    Directory of Open Access Journals (Sweden)

    Marco Pais Neves dos Santos

    2013-07-01

    Full Text Available Analisamos dois mapas alusivos ao reino de Portugal, datados de 1751, publicados em Paris e assinados pelo geógrafo Robert de Vaugondy, a saber: Partie Septentrionale du Royaume de Portugal, par le Sr. Robert, Geographe ordinaire du Roy. Avec Privilege. 1751. e Partie Meridionale du Royaume de Portugal, par le Sr. Robert, Geographe ordinaire du Roy. Avec Privilege. 1751., com o objetivo de propor uma explicação para as divisões administrativas cartografadas. Como suporte ao objeto do trabalho, caracterizamos de forma concisa a evolução dos limites administrativos do reino de Portugal, desde a sua formação até a atualidade, e abordamos a vida e obra de Robert de Vaugondy. Concluímos ser o mais consentâneo com a lógica representarem divisões eclesiásticas.

  7. Metamorfoses da colonização: o rio Tocantins e a expansão para o oeste em mapas e relatos (século XVIII

    Directory of Open Access Journals (Sweden)

    Júnia Ferreira Furtado

    Full Text Available Resumo Para compreender o movimento de abertura do interior do Brasil, este artigo analisa dois relatos manuscritos e um mapa do rio Tocantins que desnudam o progressivo domínio que os luso-brasileiros alcançavam sobre a natureza local, permitindo efetivar a colonização desse espaço e objetivando-se analisar a atuação dos colonos nesse espaço. Busca-se apreender as formas transitórias e permanentes de colonização que iam se estabelecendo ao longo dessa rota fluvial, como fazendas, núcleos urbanos, casas fortes, para proteção contra o ataque de gentios; bem como a construção imaginária que os colonizadores iam compondo do Brasil e de seus espaços do interior, especialmente os que apresentavam riquezas minerais.

  8. Elaboración de mapas digitales de inundación por tsunamis para Machala y Salinas basados en el tsunami histórico de 1953

    OpenAIRE

    Rentería, W.

    2007-01-01

    Para la generación de mapas digitales de inundación es necesario tener presente los conceptos de cartografía y modelación numérica de tsunamis, usando como nexo a los Sistemas de Información Geográfica (SIG). La utilización SIG no es nuevo en el modelamiento de tsunamis, sin embargo el uso general de esta técnica en países como el Ecuador es reciente. Por esta razón, como contribución a la determinación del riesgo por tsunamis, se presenta esta metodología para elaborar cartas digitales de in...

  9. El levantamiento del mapa topográfico a escala 1:50.000 en Cataluña (1912-1932)

    OpenAIRE

    Urteaga, Luis (Urteaga González); Nadal, Francesc, 1958-

    2013-01-01

    El primer levantamiento topográfico a gran escala del territorio catalán, efectuado con carácter sistemático, completo y uniforme, fue realizado entre 1912 y 1932. Este artículo estudia la organización del citado levantamiento, que formaba parte de la ejecución del Mapa topográfico de España a escala 1:50.000, y que en Cataluña fue llevado a término por el Instituto Geográfico y Estadístico y el Depósito de la Guerra. Se analiza el desarrollo de las labores topográficas, y se describe el pers...

  10. Geração de mapas de anomalia Bouguer a partir de dados gravimétricos terrestres e do EGM2008

    Directory of Open Access Journals (Sweden)

    Gilberto Gagg

    2017-05-01

    Full Text Available Um dos propósitos da determinação da gravidade é a obtenção das anomalias da gravidade. O campo de gravidade é um campo potencial e sofre influência da constituição geológica, pois a densidade das rochas gera pequenas variações nos valores de gravidade. As reduções matemáticas buscam eliminar a influência de fatores que interferem no campo de gravidade. A anomalia Bouguer remove o efeito gravitacional das rochas existentes entre o ponto de observação e o nível de referência. Dados da missão gravimétrica GRACE (Gravity Recovery and Climate Experiment tem auxiliado na densificação das informações, pois muitos modelos geopotenciais são deficientes devido a irregular distribuição dos dados gravimétricos. Assim, efetuou-se um estudo para o estado do Rio Grande do Sul-RS, visando gerar mapas de anomalia Bouguer através de uma análise gravimétrica sob dois aspectos: uso exclusivo de dados do modelo EGM2008 (envolve uso de dados GRACE, e uso combinado de dados EGM2008 (porção oceânica e porção continental externa ao RS com dados terrestres de campo para o Rio Grande do Sul. Concluiu-se que o emprego de dados de missão satelitais facilmente acessíveis, permitiu gerar mapas de anomalias Bouguer que atendem objetivos de cunho geral e até regional, com a vantagem de serem atuais e uniformemente espaçados.

  11. Modelo de Análise e Prevenção de Acidentes - MAPA: ferramenta para a vigilância em Saúde do trabalhador

    Directory of Open Access Journals (Sweden)

    Ildeberto Muniz de Almeida

    2014-12-01

    Full Text Available A análise de acidentes de trabalho é importante para a vigilância e a prevenção desses eventos. Métodos atuais de análise buscam superar visões reducionistas que enxergam essas ocorrências como eventos simples explicados por erros dos operadores. O objetivo do artigo é analisar o modelo de análise e prevenção de acidentes (MAPA e seu uso em intervenções de vigilância, destacando aspectos vivenciados na apropriação da ferramenta. Optou-se por método descritivo analítico apresentando as etapas do modelo. Para ilustrar contribuições e ou dificuldades foram selecionados casos nos quais foi usada a ferramenta em contexto de serviço. O MAPA integra abordagens teóricas já experimentadas em estudos de acidentes fornecendo apoio conceitual útil desde a etapa de coleta de dados à conclusão e intervenção. Além de revelar fragilidades da abordagem tradicional, ajuda a identificar determinantes organizacionais como falhas gerenciais, de concepção de sistemas e da gestão de segurança envolvidas na acidentalidade. Os principais desafios encontram-se no domínio dos conceitos pelos usuários, na exploração de aspectos organizacionais mais à montante na cadeia de decisões ou em níveis superiores da hierarquia, bem como na intervenção para mudanças nos determinantes destes eventos.

  12. Mapas conceituais e avaliação formativa: tecendo aproximações Conceptual maps and formative evaluation: drawing relationships

    Directory of Open Access Journals (Sweden)

    Nadia Aparecida de Souza

    2010-12-01

    Full Text Available Tendo a avaliação formativa como pano de fundo e a aprendizagem significativa como horizonte possível, o texto intenta evidenciar o mapa conceitual como ferramenta particularmente relevante às intenções formativas, porque favorável à regulação do ensino e à autorregulação da aprendizagem e pertinente enquanto estratégia de ensino/aprendizagem. Revisitar o referencial teórico relativo à temática favoreceu: (a contemplar a utilidade do mapa conceitual - empreendido enquanto estratégia de ensino e/ou avaliação - sob diferentes perspectivas: a daquele que ensina/avalia e a daquele que aprende/é avaliado; (b aquilatar o quanto se valer dos mapas conceituais é criar alternativas para a organização do conhecimento, pela promoção de experiências educativas que incitem não somente a reflexão, a busca de compreensão e o processamento profundo da informação, mas também o desenvolvimento da autorregulação, da meta cognição e do aprender a aprender; (c repensar a importância dos meios utilizados para avaliar a aprendizagem, que não podem ser quaisquer meios, mas aqueles que favoreçam uma percepção clara das aprendizagens edificadas e daquelas ainda em curso, orientando e viabilizando ações de superação; e, (d conferir novo sentido à tarefa de ensinar a aprender, compreendida como auxílio permanente na elaboração do saber, pelo desvelamento das razões que subjazem às dificuldades a serem superadas.Having formative evaluation as its backdrop, and significant learning as its possible horizon, the text aims at exposing conceptual maps as a particularly relevant tool for formative purposes, due to its positive influence on the regulation of teaching and to the self-regulation of learning, and pertinent as a teaching/learning strategy. Revisiting the theoretical framework related to this theme made it possible: (a to contemplate the usefulness of conceptual maps - used as a teaching and/or evaluating strategy

  13. Aplicación de los componentes de la técnica de los mapas mentales en la elaboración de los proyectos pedagógicos de aula

    Directory of Open Access Journals (Sweden)

    Rosario Romero Parra

    2008-01-01

    Full Text Available La investigación se realizó con la finalidad de comprobar los efectos de la aplicación de los componentes de la técnica de los Mapas Mentales en la elaboración de los Proyectos Pedagógicos de Aula (PPA de la I y II etapa de Educación Básica. El estudio se basa en una metodología experimental de carácter explicativo. La población estuvo constituida por veinticuatro docentes. Se aplicó una guía de observación. Con los resultados, se corrobora la hipótesis de investigación: con la aplicación de los componentes de la técnica de los Mapas Mentales se logra un efecto positivo en la elaboración de los PPA.

  14. Mapa de índices de erodabilidad en la cuenca alta del río Bogotá utilizando el sistema de información geográfica ARC-INFO™

    Directory of Open Access Journals (Sweden)

    Lucio Andrés Santos Acuña

    1999-05-01

    Full Text Available Se presentan los mapas de zonas de erodabilidad para los suelos de la cuenca alta del río Bogotá, usando como criterios de interpretación los propuestos por USDA (1962 y con base en el mapa de asociaciones de suelo del estudio general de suelos con fines agrícolas para la cuenca alta del río Bogotá. El factor de erodabilidad, K, se calculó por los métodos indirectos de Wischmeier (1978 y Paulet (1973, sobre un total de 96 perfiles de suelos representativos, tomados de ocho estudios de suelos generales, semi detallados y detallados que incluían alguna zona de la cuenca alta del río Bogotá.

  15. Representación y comunicación del conocimiento con mapas conceptuales en la formación del profesorado de ciencia y tecnología

    Directory of Open Access Journals (Sweden)

    Alfonso Pontes Pedrajas

    2012-01-01

    Full Text Available En este trabajo se muestra el desarrollo de una innovación educativa que se ha llevado a cabo en el contexto de la formación inicial del profesorado de enseñanza secundaria, del área científico-tecnológica. En la experiencia formativa se han utilizado recursos informáticos y mapas conceptuales como instrumentos de desarrollo de competencias docentes relacionadas con la representación del conocimiento, la comunicación oral, el trabajo en equipo y el uso práctico de las TIC en el aula. Los primeros resultados indican que los futuros profesores y profesoras valoran de forma positiva el uso de mapas conceptuales y de recursos informáticos como instrumentos útiles para la formación docente.

  16. Mapas temáticos de isolíneas de sequía Meteorológica para el municipio Florencia (Ciego de Ávila, Cuba)

    OpenAIRE

    Yurisbel Gallardo Ballat; Oscar Brown Manrique; Lizander Martínez Santos

    2015-01-01

    Se presentan los resultados de un estudio desarrollado en el municipio Florencia de la provincia Ciego de Ávila en el período comprendido desde el año 1970 al 2010, a partir de la elaboración de mapas temáticos de isolíneas de sequías meteorológicas, con la utilización de 11 equipos pluviométricos distribuidos dentro del área de estudio y en zonas adyacentes. Se demuestra que es posible la elaboración de mapas de ocurrencia de sequías con la utilización del índice de Déficit de Precipitación ...

  17. Alterations in ubiquitin ligase Siah-2 and its corepressor N-CoR after P-MAPA immunotherapy and anti-androgen therapy: new therapeutic opportunities for non-muscle invasive bladder cancer.

    Science.gov (United States)

    Garcia, Patrick Vianna; Apolinário, Letícia Montanholi; Böckelmann, Petra Karla; da Silva Nunes, Iseu; Duran, Nelson; Fávaro, Wagner José

    2015-01-01

    The present study describes the role of the ubiquitin ligase Siah-2 and corepressor N-CoR in controlling androgen receptor (AR) and estrogen receptors (ERα and ERβ) signaling in an appropriate animal model (Fischer 344 female rats) of non-muscle invasive bladder cancer (NMIBC), especially under conditions of anti-androgen therapy with flutamide. Furthermore, this study describes the mechanisms of a promising therapeutic alternative for NMIBC based on Protein aggregate magnesium-ammonium phospholinoleate-palmitoleate anhydride (P-MAPA) intravesical immunotherapy combined with flutamide, involving the interaction among steroid hormone receptors, their regulators and Toll-like receptors (TLRs). Our results demonstrated that increased Siah-2 and AR protein levels and decreased N-CoR, cytochrome P450 (CYP450) and estrogen receptors levels played a critical role in the urothelial carcinogenesis, probably leading to escape of urothelial cancer cells from immune system attack. P-MAPA immunotherapy led to distinct activation of innate immune system TLRs 2 and 4-mediated, resulting in increase of interferon signaling pathway, which was more effective in recovering the immunosuppressive tumor immune microenvironment and in recovering the bladder histology features than BCG (Bacillus Calmette-Guerin) treatments. The AR blockade therapy was important in the modulating of downstream molecules of TLR2 and TLR4 signaling pathway, decreasing the inflammatory cytokines signaling and enhancing the interferon signaling pathway when associated with P-MAPA. Taken together, the data obtained suggest that interferon signaling pathway activation and targeting AR and Siah-2 signals by P-MAPA intravesical immunotherapy alone and/ or in combination with AR blockade may provide novel therapeutic approaches for NMIBC.

  18. El mapa conceptual. Un instrumento educativo polivalente para las ciencias de la salud: Su aplicación en histología Concept maps as a polyvalent educational tool for health sciences: Their application to histology

    Directory of Open Access Journals (Sweden)

    María del Carmen Sánchez-Quevedo

    2006-06-01

    Full Text Available En el presente artículo se analiza el mapa conceptual como instrumento de estrategia educativa aplicada a las ciencias de la salud y, especialmente, al ámbito de la histología. Tras considerar los elementos constitutivos y los tipos de mapas conceptuales y el fundamento epistemológico de los mismos para estimular el aprendizaje significativo, se examina la aplicación de los mapas al desarrollo curricular, la evaluación, el diseño pedagógico por parte del profesor y el autoaprendizaje por parte del alumno en el contexto del proceso de Bolonia. En el ámbito de la histología se analiza la utilización de los distintos tipos de mapas para la definición y jerarquización de sus contenidos, su relación con el resto de las disciplinas y su nuevo paradigma vinculado a la Ingeniería tisular.This article analyzes the concept map as a tool for educational strategy applied to health sciences, particularly in the area of histology. After considering the elements that make up these maps, the different types of concept maps and the epistemological basis of maps as instruments to enhance significant learning, the article examines how maps can be used for curriculum development, evaluation, pedagogic design by teachers, and self-learning by students within the context of the Bologna process. UIT reference to histology, we analyze how different types of maps are used to define and rank concepts, examine the relationship between disciplines and to understand the new paradigm of histology related to tissue engineering.

  19. O cywilizacyjny awans Polski Roman Dmowski wobec idei modernizacji Polski 1918–1939

    Directory of Open Access Journals (Sweden)

    Wojciech Kapica

    2014-07-01

    Full Text Available For a civilizational development of Poland.  Roman Dmowski in the face of the idea of modernization of Poland 1918–1939The Roman Dmowski’s propositions of modernization of interwar Poland (1918–1939 can not be considered in terms of theories of modernization created after 1945 as a coherent, logic systems. For Dmowski the modern (modernized Poland would be a „efficient” state with capitalist economy, free market and the respect for private property, with reduced social legislation, with developed industry and agriculture, with a strong middle class, with restricted bureaucratic machine; a national state with restricting the rights of national minorities, with low number of Jews, with the limiting the powers of the legislature and a strong executive, with association polishness with catholicism and strong emphasis on the presence of catholic religion in social life. Some ideas of Dmowski were not bad (e.g. save money and reduction of excessively developed bureaucratic machine, the development of industry and agriculture, the fight against speculation, however, the proposals were often too vague or unclear or were remarkably oriented to the free market and for this reason had no chance of implementation and popularity in the atmosphere of the 20s and 30s in interwar Poland (e.g. proposal of reduction excessively developed social legislation, some of proposals were expressly anti-Semitic. Similarly, in the area of the Polish political system and political life Dmowski offered „positive” solutions (recovery and moralisation of Polish political life, raising the niveau of political culture of the Polish political elites and Polish society, strengthening of executive power and „negative” proposals (association polishness with catholicism and his instrumental use, desire to make Poland a national state, desire to move away from the rule of parliamentary, postulate of removing the excess of the Jewish population in Poland. The least controversial were proposals in the sphere of social and mental modernization of the Polish society (attachment to the rule of law, the cultural and civilizational raising of lower strata and classes, care for a family – according to Dmowski important institution for society, increasing hard work / diligence of the Polish population, learning of positive competition or skills competition, development of the awareness of the Polish population concerning social and economic problems, emphasis on its own – Polish creativity. It is impossible unambiguously assess all Dmowski’s proposals of Poland’s modernization – they were characterized by – similar to entire creative achievements of Dmowski – some „duality” – controversional ideas were mixed with interesting concepts, sometimes original.

  20. Mapas temáticos de isolíneas de sequía Meteorológica para el municipio Florencia (Ciego de Ávila, Cuba

    Directory of Open Access Journals (Sweden)

    Yurisbel Gallardo Ballat

    2015-03-01

    Full Text Available Se presentan los resultados de un estudio desarrollado en el municipio Florencia de la provincia Ciego de Ávila en el período comprendido desde el año 1970 al 2010, a partir de la elaboración de mapas temáticos de isolíneas de sequías meteorológicas, con la utilización de 11 equipos pluviométricos distribuidos dentro del área de estudio y en zonas adyacentes. Se demuestra que es posible la elaboración de mapas de ocurrencia de sequías con la utilización del índice de Déficit de Precipitación Normalizado (DPN a partir de los cuales se pueden determinar áreas proclives a soportar de forma frecuente este peligro de origen natural. Los mapas elaborados brindan a los usuarios agrícolas facilidades para la toma de decisiones con vista al desarrollo más seguro de los cultivos en sistemas agrícolas de secano.

  1. A utilização de mapas conceituais como recurso didático para a construção e inter-relação de conceitos

    Directory of Open Access Journals (Sweden)

    Valter Carabetta Júnior

    Full Text Available Os mapas conceituais, criados por Novak com base na teoria de Ausubel, podem constituir para os alunos uma estratégia pedagógica de grande relevância para a construção de conceitos científicos, ajudando-os a integrar e relacionar informações e atribuir significado ao que estão estudando. Este artigo descreve o trabalho realizado com alunos de um curso de Medicina usando mapas conceituais, tomando por base os "temas geradores" criados na disciplina de Atenção Básica em Saúde a partir da constatação dos principais problemas de saúde da região em que está localizada a escola médica. A utilização dos mapas constituiu um recurso metodológico relevante por se alinhar a uma formação teórica adequada às necessárias intervenções na realidade estudada e por facilitar a apropriação de conceitos científicos pelos alunos.

  2. Número de amostras na análise geoestatística e na krigagem de mapas de atributos do solo

    Directory of Open Access Journals (Sweden)

    Zigomar Menezes de Souza

    2014-02-01

    Full Text Available O objetivo deste trabalho foi analisar diferentes intensidades de amostragem do solo com relação à precisão na análise geoestatística e interpolação de mapas, para fins de agricultura de precisão em área de cana-de-açúcar. O solo foi coletado em duas grades regulares na profundidade de 0,00-0,20m para análise granulométrica (área 1 e da fertilidade do solo (área 2. Foram comparadas intensidades de amostragem do solo: 208, 105, 58 e 24 pontos na área 1 e 206, 102 e 53 pontos na área 2. Os dados foram submetidos à análise descritiva e geoestatística. Os variogramas construídos com 105 pontos não diferem dos variogramas com 208 pontos, fato que não ocorre para 58 e 24 pontos. O aumento do intervalo de amostragem e a redução do número de pontos promovem o maior erro na estimativa por krigagem. As amostragens com mais de 100 pontos por área não resultaram em melhorias significativas no erro da estimativa por krigagem, nem diferiram na quantidade de insumos aplicados em campo.

  3. Identificación de patrones espaciales del borde urbano mediante mapas Auto-Organizados de la centralidad de la red viaria.

    Directory of Open Access Journals (Sweden)

    Francisco Javier Abarca-Alvarez

    2017-11-01

    Full Text Available La caracterización morfológica del borde urbano es un ejercicio que reviste un interés especial porque, por una parte, ayuda a entender los crecimientos urbanos que tienen lugar en las zonas periféricas y, por otra, permite descifrar las claves de las relaciones de continuidad o discontinuidad que existen entre la ciudad y su entorno. En este contexto, son muchos los enfoques desde el análisis. En este artículo, se exploran en concreto las posibilidades que ofrece la utilización de mapas auto-organizados, elaborados a partir de los resultados de la aplicación de medidas de centralidad de la red viaria mixta que forman los sistemas de calles, los viarios metropolitanos y los caminos agrarios. La aplicación de diferentes medidas de centralidad en una red viaria mixta, supone en sí un ejercicio innovador, ya que, normalmente, los análisis de centralidad se aplican en el ámbito más puramente intraurbanos. La base espacial de los perfiles obtenidos en las series se puede comparar con la naturaleza del propio borde. La Metodología propuesta se ha testeado en la ciudad de Granada (España, específicamente, sobre el borde de contacto de la ciudad con el entorno de la Vega de Granada, un paisaje agrario singular ligado al Río Genil.

  4. Propuesta de Ciclo de Vida y Mapa de Actividades para Proyectos de Explotación de Información

    Directory of Open Access Journals (Sweden)

    Hernán Arboleya

    2013-03-01

    Full Text Available La Explotación de la Información es una sub-disciplina informática que le aporta herramientas a la Inteligencia del Negocio [18] para poder transformar la información en conocimiento [15] que sirva de base para llevar a cabo la toma de decisiones dentro de las organizaciones. Dado que este tipo de proyectos se diferencian a los proyectos convencionales de construcción de software y que la metodologías existente para Proyectos de Explotación de Información no contemplan ni tiene en cuenta los riesgos que dentro de los mismos pueden ocurrir, en esta investigación se propone el diseño de un Modelo de Ciclo de Vida especifico que tenga un análisis de los riesgos. Posteriormente se plantea la construcción de un Mapa de Actividades teniendo en cuenta el Modelo de Ciclo de Vida desarrollado y los procesos del Modelo de Procesos seleccionado.

  5. METODOLOGÍA DE ELABORACIÓN DE MAPAS ACÚSTICOS COMO HERRAMIENTA DE GESTIÓN DEL RUIDO URBANO - CASO MEDELLÍN

    Directory of Open Access Journals (Sweden)

    DORA L. YEPES

    2009-01-01

    Full Text Available Dada la naturaleza de la variable ruido y su variabilidad espacio - temporal, se tomó como base fundamental la aplicación de la metodología Geoestadística para la predicción y valoración de la distribución del ruido en las zonas de estudio del proyecto "Elaboración del Mapa Acústico para el Municipio de Medellín", realizado en el año 2006, mediante Convenio 680 de 2005, entre el Área Metropolitana del Valle de Aburrá y el Politécnico Colombiano Jaime Isaza Cadavid, con la participación de la Universidad Nacional de Colombia, Sede Medellín. Con base en esta metodología se concluyó que Medellín presenta un nivel de ruidodiurno global de 73dB(A, indicando que su zona urbana tiene niveles de ruido apropiados solo para sectores industriales. De igual manera en la noche, se presenta un nivel de ruido global de 68 dB(A, apropiado solo para el mismo tipo de sector.

  6. Mapa de redes personales. Una herramienta para el estudio de las remesas económicas y sociales con EgoNet

    Directory of Open Access Journals (Sweden)

    Javier Ávila

    2011-12-01

    Full Text Available El análisis integral de las remesas requiere repensar su unidad de análisis “clásica”: el hogar. En sentido amplio, las remesas no circulan en el vacío social sino a través de las redes transnacionales del hogar transnacional del inmigrante, las cuales constituyen su micro-estructura. Con la globalización estas redes se vuelven más complejas y requieren de nuevas metodologías de análisis, que permitan identificar, analizar y representar esta complejidad. ¿Cómo estudiar las remesas en la nueva complejidad de las redes transnacionales? En este artículo proponemos utilizar el análisis de redes personales como herramienta para identificar las características de las redes de los inmigrantes emisores de remesas y construir las principales coordenadas de los mapas de sus comunidades personales, dentro de los cuales se desarrollan los microcircuitos de las redes de remesas.

  7. El nuevo mapa universitario de los estudios de Comunicación y de Documentación en España

    Directory of Open Access Journals (Sweden)

    Miguel Túñez López

    2013-10-01

    Full Text Available La adaptación de la oferta formativa en Biblioteconomía, Comunicación Audiovisual, Documentación, Periodismo, Publicidad y Relaciones Públicas en la Universidad española ha experimentado una profunda transformación como resultado del proceso de adaptación de los planes de estudio al Espacio Europeo de Educación Superior. Esta investigación revisa las claves del nuevo mapa de la comunicación en las universidades de España caracterizado por una multiplicación del número de grados y de la especificidad de los perfiles que se ofertan, una tendencia alcista en las cifras de alumnos matriculados, un panorama laboral en un contexto global de crisis que en 2012 refleja aumentos interanuales de desempleo en torno al 25% y unos índices de adecuación de los contratos a la formación recibida, que se caracteriza por la atomización de propuestas y la inestabilidad contractual.

  8. APLICACIÓN DE MAPAS DE KOHONEN PARA LA PRIORIZACIÓN DE ZONAS DE MERCADO: UNA APROXIMACIÓN PRÁCTICA

    Directory of Open Access Journals (Sweden)

    Harol Mauricio Gámez Albán

    Full Text Available Este artículo presenta una metodología basada en redes neuronales para realizar priorización de zonas de mercado visto desde un enfoque empresarial. En esta investigación se intenta dar solución a la incertidumbre que existe en la mayoría de las organizaciones en torno a la prioridad que tiene una zona de mercado; para ello se hace una búsqueda de los criterios más relevantes que las empresas tienen en cuenta para asignar prioridades a ciertos clientes. La problemática se sustenta por la ausencia de herramientas que permitan determinar la prioridad de una zona de mercado y la falta de una interrelación efectiva entre los departamentos de logística y mercadeo. Para ello se ocupan los mapas de Kohonen que son un tipo de red neuronal que facilita el agrupamiento de clientes y permiten determinar cuáles de ellos son los que impactan con mayor frecuencia los criterios de priorización previamente establecidos. Finalmente, se presentan tres escenarios con fin de validar la propuesta formulada y ver qué comportamiento tienen las redes neuronales en temas de priorización de zonas de mercado.

  9. Planificación y desarrollo de un mapa de habilidades TIC en Orientación Planning and Development of an ICT-skills Map in Guidance

    Directory of Open Access Journals (Sweden)

    Luis Martín Sobrado Fernández

    2010-10-01

    Full Text Available El propósito del presente artículo se centra en identificar determinadas competencias TIC, concretamente las relacionadas con las páginas web y el correo electrónico, de utilidad en la implementación de funciones y tareas de Orientación. Para ello, se diseñó un mapa de competencias en el que se entrecruzan las de carácter tecnológico y orientador, y se elaboró asimismo una matriz integrada por siete áreas de Orientación seleccionadas por la AIOEP: valoración, orientación educativa, desarrollo de la carrera, asesoramiento, gestión de la información, Investigación y evaluación y colocación. También se consideraron tres tipos de enfoques en lo referente al empleo de las TIC en Orientación (como recurso, medio y desarrollo de materiales orientadores y dos herramientas (páginas web y correo electrónico. La integración y empleo eficaz de las TIC, por los orientadores, se halla en función de las competencias de éstos en ellas. Esta herramienta (mapa, de carácter abierto y flexible, exige una continua actualización con el propósito de ser útil en la puesta en práctica de actividades orientadoras; en la autoevaluación de competencias por parte de los profesionales del ámbito; en el diagnóstico de déficits formativos y en el diseño, planificación y desarrollo de acciones de formación y/u orientación. Se trata de un instrumento de gran relevancia para que los Orientadores exploren sus necesidades formativas y asesoras, el perfil ocupacional y motiven su desarrollo profesional.The main purpose of this article focuses on identifying specific Information and Communication Technologies skills, particularly those related to web pages and e-mail, useful in the implementation of Guidance functions and tasks. To this end, it was designed a competence map overlaid on those of a technological and coach and also produces a matrix that considered seven areas of focus grouped by International Association Educational and

  10. Los Cynipidae (Hymenoptera de la Comunidad de Madrid: lista anotada, mapas de distribución, riqueza y estatus de conservación

    Directory of Open Access Journals (Sweden)

    Nieves-Aldrey, J. L.

    2006-05-01

    Full Text Available Acheck list of the Cynipidae from Comunidad de Madrid (Spain is presented for the first time. The data base contains 2189 records of samplings carried out from 1982 to the present in 103 sites in Madrid and 19 in nearby adjacent provinces. The list of 127 cynipid species from Madrid represents 73% of total Cynipidae species from the Iberian Peninsula. A distribution map in Madrid for each cynipid species is presented, showing the sampling sites where it has been found together with the potential distribution area of the species within the territory. Several aspects on the richness and distribution of the Cynipidae from Madrid are commented: potentially present and absent Iberian species, individual and rare species, and areas of high species richness. The area of highest richness for the Cynipidae of Madrid follows a strip of Cretacic and Tertiary soils along the Guadalix-Venturada-Torrelaguna axis, which also shows a high diversity of cynipid host plants, especially Quercus species. Other areas in SE Madrid deserving protection with regard to cynipids are also shown. These areas, some rich in rare and singular Aylacini species, other relictic areas with Quercus petraea in the Northeast and also some small areas with the presence of Quercus suber in parts of the territory of Madrid, deserve maximum protection concerning Cynipid conservation.

    Se presenta por primera vez la lista anotada de especies y los mapas de distribución de los Cynipidae de la Comunidad de Madrid. Los datos corresponden a 2189 registros pertenecientes a muestreos y colectas efectuados desde 1982 hasta la actualidad, en 103 localidades de Madrid y en otras 19 cercanas de provincias adyacentes. Se relacionan 107 especies de cinípidos que representan el 73 % del total de especies ibéricas. Cada especie se acompaña de su correspondiente mapa de distribución en la Comunidad de Madrid, reflejando los puntos de las localidades de muestreo en los que

  11. Mapas cognitivos difusos para la selección de proyectos de tecnologías de la información

    Directory of Open Access Journals (Sweden)

    Maikel Y. Leyva Vázquez

    2013-01-01

    Full Text Available En el campo de la informática administrativa resulta de gran importancia evaluar los sistemas de información que le darán soporte a los procesos y las metas. Para lograr la alineación de estos sistemas, que formarán parte del portafolio de proyectos de tecnologías de la información de la organización con estrategias, es necesario modelar y analizar los procesos y las metas a los que se les darán soporte. En este artículo se presenta un modelo para la selección de proyectos de tecnologías de la información basado en el análisis de la arquitectura empresarial a partir del modelado empresarial, el cual se apoya en el modelado de las relaciones causales existentes entre los distintos elementos de la organización empleando mapas cognitivos difusos. Este enfoque facilita la evaluación y selección de proyectos con vistas a alcanzar el estado objetivo de la arquitectura empresarial. El modelo propuesto brinda una alternativa o complemento a los métodos existentes de evaluación de proyectos de tecnologías de la información; para ejemplificar lo anterior se muestra un caso de estudio que describe la aplicación del modelo a una organización de servicios profesionales para planificar la trasformación de la arquitectura empresarial de la organización.

  12. Mapa de erosión de los suelos de México y posibles implicaciones en el almacenamiento de carbono orgánico del suelo

    Directory of Open Access Journals (Sweden)

    Martín A. Bolaños González

    2016-07-01

    Full Text Available Debido a la poca disponibilidad de información a nivel mundial y de manera acentuada en México del fenómeno de erosión de suelos; en este trabajo se presenta el Mapa Nacional de Erosión escala 1:50 000, el cual consolida un esfuerzo realizado por varios años en los que fue necesario conjuntar diversas fuentes de información para que mediante técnicas de fotointerpretación de imágenes de satélite de alta resolución, cartografía especializada e información de campo se concretara este producto, mismo que representa la información básica requerida para que, en el futuro, sea posible estimar de manera general las pérdidas de carbono orgánico del suelo debidas a éste fenómeno, dado que es uno de los componentes menos estudiados y, por consiguiente, menos cuantificados en el balance general de este elemento. Así, este primer resultado muestra que el 76% de la superficie nacional tiene algún grado de afectación por erosión hídrica, que corresponde a 6.79% con un grado de erosión extrema, el 5.79% fuerte, 26.37% moderada y 37.06% leve. Los estados más afectados por erosión apreciable (superficie relativa son: Distrito Federal, Tlaxcala, Estado de México y Michoacán y, por el contrario, los menos afectados: Tabasco, Quintana Roo y Campeche.

  13. La enseñanza de nociones especiales a través de mapas y planos en educación infantil: una propuesta de intervención

    OpenAIRE

    Clérigo García, Natalia

    2014-01-01

    El presente trabajo pretende poner de manifiesto la importancia de la enseñanza de nociones espaciales en el segundo ciclo de educación infantil. Por ello, se ha llevado a cabo una propuesta de intervención educativa puesta en práctica en un aula de infantil, basada en la enseñanza de nociones espaciales a través de mapas y planos, de una forma amena, lúdica, activa y participativa, con experiencias enriquecedoras a través de actividades vividas por ellos mismos y en continuo contacto con la ...

  14. Interseccionalidad e Intertextualidad en la subjetivación de la masculinidad de hombres jóvenes en el norte de Chile Una aproximación semiótico-material desde el modelo de mapas corporales

    OpenAIRE

    Espinoza-Tapia, Ricardo; Universitat Autònoma de Barcelona. Departament de Psicologia Social

    2015-01-01

    El presente trabajo de investigación doctoral lleva por título "Interseccionalidad e intertextualidad en la subjetivación de la masculinidad de hombres jóvenes en el norte de Chile: una aproximación semiótico-material desde el modelo de mapas corporales". Este trabajo ha sido presentado en formato de "compendio de artículos", los cuales fueron publicados entre diciembre del año 2014 y Marzo del año 2015. El ámbito temático de la tesis consiste en el estudio de las masculinidades. En ese senti...

  15. Un mapa Geológico inédito de la Sierra de Albarracín (C. Ibérica) de Santiago Rodríguez (1824-1876)

    OpenAIRE

    Puche Riart, Octavio; Boixereu Vila, E.; López Olmedo, F.

    2015-01-01

    En la biblioteca del IGME, se encuentra un ejemplar de un mapa titulado Plano geognóstico de una parte de las provincias de Teruel y Guadalajara firmado por Santiago Rodríguez. Se trata de un documento inédito no fechado, por lo que, hasta ahora, no se había tenido en cuenta en la historiografía geológica española. Santiago Rodríguez (1824-1876) fue un ingeniero de minas nacido en Zaragoza, que cursó sus estudios en la Escuela de Minas de Madrid. Desarrolló toda su carrera profesional e...

  16. Riesgos en el proceso de importación ordinaria: identificación del mapa de riesgos de la importación de bienes de capital en Colombia

    OpenAIRE

    Gallón Perdomo, Sara María; Torres Muskus, Carlos Henrique

    2014-01-01

    En Colombia, durante el proceso de importación se presentan diversos riesgos, que pueden implicar desde sobrecostos hasta la pérdida de la mercancía -- Considerando que las importaciones son necesarias en las empresas, en la presente investigación se elabora un mapa de riesgos del proceso de importación ordinaria de bienes de capital en el país, con el fin de identificarlos, de tal manera que los importadores estén informados y puedan aplicar los métodos de control pertinentes para la adm...

  17. Formulación del Mapa de Riesgos Operativos del Sistema Metroplús para el Municipio de Medellín como su patrocinador. ¿Qué se debe mejorar?

    OpenAIRE

    Úsuga Tamayo, Gladys

    2016-01-01

    Este trabajo de grado presenta la aplicación de la metodología Risicar para la elaboración del mapa de riesgos operativos a los cuales el Municipio de Medellín se enfrenta debido a la implementación del sistema de transporte masivo de pasajeros Metroplús, con el fin de identificarlos y valorarlos, para de esta manera garantizar que la municipalidad esté informada y pueda aplicar los métodos de control pertinentes para la administración de dichos riesgos -- Al tiempo se pretende que este docum...

  18. Análisis del impacto de las decisiones en el ámbito de la dependencia mediante mapas cognitivos borrosos

    Directory of Open Access Journals (Sweden)

    Ester Gutiérrez Moya

    2012-01-01

    Full Text Available El Sistema para la Autonomía y Atención a la Dependencia (SAAD fue creado con el fin de proporcionar un marco de protección a las personas en situación de dependencia. La prioridad de las prestaciones en servicios frente a las económicas, según la Ley, y la gestión eficiente de los recursos públicos destinados al SAAD hacían prever retornos económicos, como la generación de empleo. Las variables que influyen en la implantación del SAAD son extremadamente complejas y dinámicas, existiendo múltiples relaciones entre las mismas. El objetivo de este trabajo es analizar la problemática de satisfacer una demanda creciente de protección al mínimo coste y aprovechar los retornos económicos mediante la lógica borrosa (mapa cognitivo borroso. Esta técnica se configura como una herramienta para la toma de decisiones en este ámbito, porque permite analizar la evolución de las variables causales hasta un estado de equilibrio. Para ello, se han ideado 4 escenarios (E1:Envejecimiento, E2: Envejecimiento y prestaciones en servicios, E3: Envejecimiento y prestaciones económicas, E4: Envejecimiento y prestación económica para cuidados en el entorno familiar, con el fin de analizar la evolución de las variables, especialmente el gasto público y el empleo. Entre los principales resultados obtenidos destacan: el envejecimiento es determinante en el incremento del gasto en todos los escenarios, pero solamente en E1 y E2 se genera empleo. La prestación residencial no se altera, ni siquiera en E2. La teleasistencia aumenta en todos los escenarios y la prestación económica por asistente personal aumenta en E1 y E2.

  19. ONGs, indios y petroléo: El caso U'wa a través de los mapas del territorio en disputa

    Directory of Open Access Journals (Sweden)

    2003-01-01

    notions, opinions et intentions que les acteurs n'expriment pas de façon explicite, c’est-à-dire de l’inconscient politique de chaque ligne d’argumentation. L’analyse critique de la cartographie nous montre comment, paradoxalement, l’“ agenda ” des ONGs écologiques ressemble à celle des agents du développement pétrolier en s’appuyant sur le même type de catégories et de notions. Il nous montre aussi les dispositifs à travers lesquels la cosmologie indigène est rendue statique et essentielle, devenant en même temps invisible et sans légitimité. El presente artículo hace un análisis del caso U'wa, una confrontación que debe su celebridad a la amenaza de suicidio de un pueblo indígena frente a un proyecto petrolero adelantado por dos grandes compañías (la OXY y la SHELL asociadas con el Estado colombiano. El relato de una “tribu” dispuesta a suicidarse a nombre de lo que ella considera sagrado ha llamado la atención no sólo de los medios en el mundo, sino de numerosas organizaciones no gubernamentales ambientalistas e indigenistas, las que han intervenido de manera activa en esta disputa que se desarrolla en medio del conflicto armado colombiano. El propósito de este artículo es el de adelantar una reflexión sobre el conjunto de relatos, imágenes y representaciones que han guiado las prácticas de los diferentes actores en la confrontación. Todas las partes han preparado e incluso publicado mapas en algún punto de la controversia con el fin de sustentar, resaltar e ilustrar su argumentación. Todos ellos muestran el mismo conjunto de zonas: las del área de explotación petrolera y los territorios indígenas tanto reconocidos por la ley como los reclamados por los indígenas. Cada uno muestra, sin embargo, estas zonas y la relación entre ellas de manera particular y pone en relieve ciertos elementos. Estos mapas se pueden considerar como verdaderos textos culturales y constituyen así un corpus para aproximarnos a la confrontaci

  20. Sentido de coherencia y mapa de activos para la salud en jóvenes presos de la Comunidad Valenciana en España.

    Science.gov (United States)

    Vera-Remartínez, Enrique J; Paredes-Carbonell, Joan J; Aviñó Juan-Ulpiano, Dory; Jiménez-Pérez, Mercedes; Araujo Pérez, Rosa; Agulló-Cantos, José M; Mora Notario, Almudena

    2017-09-01

    Estudio realizado desde el enfoque de la salutogénesis que pretende determinar el sentido de coherencia (SOC) en jóvenes presos de la Comunidad Valenciana en España y elaborar un mapa de activos para la salud dirigido a promover la salud en esta población. Se utilizó el test "SOC-13" y un cuestionario de preguntas abiertas elaborado ad hoc, el cual autocompletaron los internos de 18 a 22 años de edad, de los tres centros penitenciarios de la región. Participaron 124 jóvenes varones (ya que no había ninguna mujer) y se recogieron variables sociodemográficas y penitenciarias. En el análisis cuantitativo, las variables categóricas se expresaron como frecuencias absolutas y relativas; y las cuantitativas, mediante medias con intervalos de confianza (IC) al 95%. Se realizó un estudio comparativo bivariante, utilizando las siguientes pruebas: Student t-test, análisis de variación (ANOVA), Wilcoxon y Ji-cuadrado. Del cuestionario de preguntas abiertas, se realizó un análisis cualitativo descriptivo temático de los activos identificados, clasificándolos en: internos (recursos personales, en relación con los demás y capacidad para realizar comportamientos saludables) y externos (personas, grupos, instituciones y espacios físicos, situados tanto dentro como fuera de prisión). La edad media fue de 21,1 años (IC 95%: 20,8-21,3); y el SOC de 52,4 (IC 95%: 50,5-54,3), de entre un valor mínimo de 13 y máximo de 91 para la prueba. Los internos del centro penitenciario que ofrecía más actividades escolares y deportivas obtuvieron una puntuación mayor en la dimensión de significatividad del SOC ( p = 0,024), y los internos inmigrantes presentaron un SOC superior ( p = 0,037) a los españoles, en los tres centros. Los jóvenes identificaron los activos internos que cualitativamente se vinculan con las dimensiones de comprensibilidad, manejabilidad y significatividad del SOC; y los activos externos, sobre todo los amigos, familiares y espacios

  1. REPUTAÇÃO CORPORATIVA: MENSURAÇÃO E ANÁLISE DE MAPAS PERCEPTUAIS – UM ESTUDO EMPÍRICO NA INDÚSTRIA AUTOMOBILÍSTICA BRASILEIRA

    Directory of Open Access Journals (Sweden)

    Miguel Maurício Isoni

    2004-12-01

    Full Text Available Este artigo procura mostrar a pertinência de parâmetros e atributos de gestão reputacional percebidos pelos consumidores das marcas Fiat e Volks da indústria automobilística brasileira, através de quatro dimensões: (1 imagem, reputação e credibilidade; (2 relação com a comunidade; (3 ética e sustentabilidade; (4 decisão de compra ou recompra. Reputação corporativa tem sido tema mundialmente estudado e de grande importância para empresas e para a academia. Visando a mensurar a reputação corporativa, este estudo desenvolve uma escala de reputação baseada em Fombrun, Gardberg e Sever (2001 e King (2000. Com uma amostra de 316 respondentes de dois Estados brasileiros, buscando verificar a reputação da indústria automobilística, foi verificada a confiabilidade da escala, bem como traçados mapas perceptuais para análise dos resultados. Assim, este trabalho contribui para o desenvolvimento de uma escala brasileira de reputação corporativa e para a utilização de mapas perceptuais como instrumento gerencial e analítico.

  2. Análise do conhecimento e das concepções sobre saúde oral de alunos de odontologia: avaliação por meio de mapas conceituais

    Directory of Open Access Journals (Sweden)

    Miriam Struchiner

    1999-01-01

    Full Text Available O objetivo inicial deste trabalho foi apreender a estrutura cognitiva de alunos do último ano (sétimo período do curso de graduação em odontologia da UFRJ em relação à temática do esmalte. Essa temática é de fundamental importância para a compreensão da saúde oral, na medida em que oferece conceitos científicos importantes e fundamentais para o exercício da prática clínica e preventiva, bem como por ser objeto de estudo em várias disciplinas ao longo do curso de Odontologia. Para a análise da estrutura cognitiva, utilizou-se a estratégia de mapas conceituais proposta por Novak e fundamentou-se na teoria da Aprendizagem Significativa, de Ausubel. A análise dos mapas elaborados pelos estudantes possibilitou um estudo não só sobre a estrutura cognitiva e as concepções sobre saúde oral dos alunos, como também permitiu um diagnóstico do conhecimento em diversos aspectos relevantes à formação científica e profissional, apontando para a necessidade de se repensar o processo ensino-aprendizagem nos cursos de Odontologia.

  3. Mapas de riesgo para Hantavirus en el Parque Nacional Conguillío, sur de Chile Hantavirus risk maps for Conguillío National Park, southern Chile

    Directory of Open Access Journals (Sweden)

    ANDRÉS MUÑOZ-PEDREROS

    2007-09-01

    Full Text Available El riesgo de infección con Hantavirus depende de factores, que determinan una probabilidad de contagio con los reservorios, tales como: (a la estructura vegetacional y el uso del suelo como un escenario primario, donde los factores específicos de composición, estructura y densidad de la vegetación detallan elementos relacionados con el habitat de los reservorios. (b La existencia de poblaciones de roedores reservorio. (c Establecimientos humanos, como disponibilidad y densidad de caminos, áreas habitadas o de presencia humana (e.g., casas, bodegas. Estos tres factores, habitat (probabilidad de ocurrencia del reservorio, roedores seropositivos (peligro de contagio y humanos (población expuesta, conjugados, proporcionan los elementos de juicio necesarios para establecer el riesgo. Es importante considerar que estos factores tienen una dinámica de cambio estacional durante el año y modificaciones ambientales naturales y antrópicas. Así, buscamos comprender el riesgo a que está sometido el ser humano en el espacio rural. Los modelos espaciales corresponden a representaciones de la realidad observada en un área determinada y condicionada a diversos factores geográficos, topográficos, biológicos, climáticos, etc. El objetivo de este estudio fue establecer sectores potenciales de riesgo al hantavirus en un parque nacional de la IX Región de Chile empleando cartas temáticas de variables ambientales en un Sistema de Información Geográfica para analizar fotografías aéreas mediante fotointerpretación, transferencia, digitalización y manejo de base de datos gráfica y alfanumérica, validada en terreno. La capa vectorial fue "rasterizada" con un tamaño de pixel de 50 m. El mapa de riesgo se construyó utilizando un modelo aditivo de capas mediante el uso del software Model Builder 1.0, extensión de Arc View 3.2. La base del procedimiento fue el proceso de "overlay" aritmético, que sobrepone las capas adicionando los términos de

  4. A sixteenth century Portuguese report concerning an early Javanese world map Relatório português do século XVI descreve mapa-múndi antigo de origem javanesa

    Directory of Open Access Journals (Sweden)

    Benjamin B. Olshin

    1996-02-01

    Full Text Available In the sixteenth century, there were numerous voyages of discovery in the oceans of the world, expanding European understanding and influence. These explorations, and in particular the knowledge they created, have tended to overshadow other ventures into the unknown. Not just the Europeans, but other cultures as well, navigated the seas and accumulated geographical information, putting together their own ideas about the distribution of the lands and seas around the globe. Arab and Asian seafarers plied the oceans in trade and exploration, and created maps and geographical texts. These maps and texts, however, are not as numerous as a scholar might wish. The Asian maps, particularly early ones, are few in number, and these are virtually all Chinese and Korean creations, world maps based on traditional religious concepts of a circular landmass. There are few maps based on actual navigation. But an early sixteenth-century Portuguese document gives a brief description of a Javanese map, which apparently showed much of the world. It also depicted the routes of the navigations of the Chinese and other Pacific peoples. The map itself has been lost, but we read of it in a letter from the Portuguese admiral Afonso de Albuquerque to his king, Dom Manuel, dated 1 April 1512.No século XVI, várias viagens de descobrimento expandiram a influência e o reconhecimento europeus. Essas expedições marítimas, e em particular o conhecimento que geraram, ofuscaram outras aventuras pelo desconhecido. Outros povos navegaram pelos oceanos, acumularam informações e organizaram suas próprias idéias sobre a distribuição de terras e mares. Navegadores árabes e asiáticos criaram mapas, cartas náuticas e textos geográficos expondo suas descobertas. Esses mapas, no entanto, não são tão numerosos. Os asiáticos, particularmente os mais antigos, são poucos e quase todos originários da China e Coréia, e baseavam-se em conceitos religiosos tradicionais e na id

  5. Mapa de Vulnerabilidad en Honduras

    Science.gov (United States)

    Sánchez, A. A.

    2013-05-01

    Dado que Honduras geográficamente se encuentra en una zona que esta expuesta a diferentes fenómenos sísmicos y climatológicos. Investigamos cuales son las zonas mas propensas a desastres naturales, la vulnerabilidad y el factor de resiliencia de la población de acuerdo a diferentes parámetros de estudio.

  6. Mapa de cuidados para pacientes sometidos a procedimientos en servicios de medicina nuclear Care map for patients under nuclear medicine procedures

    Directory of Open Access Journals (Sweden)

    Cayetano Fernández Sola

    2009-03-01

    Full Text Available Objetivo: desarrollar un instrumento que facilite la sistematización, registro y continuidad del cuidado en servicios de medicina nuclear. Metodología: investigación desarrollada durante 2004 en el servicio de Medicina Nuclear en un Hospital de Almería, España. A partir de la revisión bibliográfica y de la práctica clínica, se realizó búsqueda de problemas de enfermería y de colaboración y se procedió a la estandarización y codificación del lenguaje según taxonomías NANDA, NOC y NIC. Luego de la valoración inicial, focalizada por necesidades básicas, se formularon diagnósticos de enfermería y de complicaciones; y las intervenciones asociadas a los diagnósticos y a problemas de colaboración. Finalmente se realizó seguimiento, evaluación e informe de continuidad de cuidados. Resultados: los diagnósticos de enfermería prevalentes fueron: conocimientos deficientes, temor, interrupción de la lactancia materna y riesgo de lesión. Los resultados esperados, expresados según taxonomía NOC, fueron: Conocimientos del procedimiento, Autocontrol del miedo Lactancia materna: Destete y Control del riesgo; y las Intervenciones de enfermería: Enseñanza del procedimiento, Disminución de la ansiedad, Supresión de la lactancia, Manejo ambiental de seguridad e Intervenciones asociadas a problemas de colaboración. Conclusión: el mapa de cuidados facilita el trabajo, utiliza el proceso de enfermería y ayuda a registrar las intervenciones practicadas en pacientes sometidos a procedimientos en servicios de medicina nuclear.Objective: the development of a tool that provides the systematic, registration and care continuity in the nuclear medicine services. Methodology: this research was developed during 2004 as a result of the creation of the Nuclear Medicine Service in the Torrecárdenas Hospital, in Almeria, Spain. A nursing problem review was undertaken from the data that captured in the bibliography review and clinical practice

  7. Novo Mapa das Religiões (New Map of Religions - DOI: 10.5752/P.2175-5841.2011v9n23p637

    Directory of Open Access Journals (Sweden)

    Marcelo Cortes Neri

    2011-12-01

    Full Text Available O Brasil é o país com a maior população católica. A evolução de variáveis socioeconômicas na década de 1990, aí incluindo casamentos, fertilidade, renda, moradia entre outras, revelam que nenhuma mudou tanto quanto a composição religiosa da população brasileira. O Censo é a base de dados mais usada nos estudos no tema, porém, as estatísticas estão hoje paradas no Censo 2000. A Pesquisa de Orçamentos Familiares 2009 – POF/IBGE permite medir a religiosidade brasileira recente detalhando subgrupos religiosos com classificação comparável a do Censo e possibilidade de cruzamentos com uma gama maior de variáveis. Este estudo processa microdados da POF de 2003 e 2009, quando o contexto econômico difere das décadas anteriores, permitindo estudar as relações entre economia e religiosidade num contexto de expansão. Mostramos que: i há velocidade de queda do catolicismo dez vezes mais rápida do que a observada entre 1872 e 1980, mas similar à dos anos 1990, embora as novas filiações sejam  não apenas nos grupos evangélicos pentecostais, mas mais nos protestantes tradicionais; ii ao contrário dos países europeus mais católicos que vivem contração econômica (PIIGS, as localidades brasileiras mais católicas vivem expansão mais forte que as demais; iii os brasileiros se mostram na mediana de frequência a cultos religiosos em 150 países; iv as mulheres, embora mais religiosas que os homens, tornaram-se menos católicas; v os jovens mostram uma fuga mais acelerada do catolicismo.Palavras-chave: Religião. Economia. Max Weber. Mapa das Religiões no Brasil.AbstractBrazil is the country with the biggest Catholic population in the world. The evolution of socio-economic variables during the 1990s such as marriage, fertility, incomes, housing among others, revealed that no other variable changed as much as the religious composition of Brazilian population. Demographic Census is the mostly widely used survey in

  8. Desenvolvimento de um programa para geração de mapas de curvas residuais e aplicação a processos de destilação azeotropica e extrativa

    OpenAIRE

    Miria Hespanhol Miranda Reis

    2002-01-01

    Resumo: Apesar da descoberta de inovadores processos de separação, a operação unitária que ainda predomina nas indústrias químicas é a destilação, especialmente, para separação de misturas não-ideais em larga escala. Muitos artigos têm dedicado atenção especial para o estudo de misturas azeotrópicas, procurando desenvolver ferramentas que auxiliem no projeto e na síntese de processos. Mapas de curvas residuais têm um papel importante na interpretação do comportamento e da vi...

  9. Evolución histórica de la cartografía geológica en España, desde sus orígenes hasta los mapas de Verneuil y Collomb (1864) y Maestre (1865)

    OpenAIRE

    Boixereu Vila, Ester

    2016-01-01

    La presente Tesis muestra una visión en conjunto de la evolución de la cartografía geológica en España desde sus orígenes hasta el año 1864, cuando aparecieron, de forma simultánea, los dos mapas geológicos completos de España. El estudio se divide en doce capítulos. El primero es una introducción, con los objetivos y metodología del trabajo, así como en los antecedentes de estos trabajos. El segundo capítulo aborda la representación temprana del paisaje y de los elementos geológicos, desde l...

  10. Estudio del impacto en el nivel de comprensión lectora en inglés a través del uso de mapas conceptuales en estudiantes de 5to grado de primaria

    OpenAIRE

    Vega Bello, Ana Lilia

    2015-01-01

    Con la posibilidad de tener transversalidad en el trabajo de los docentes del idioma inglés con los docentes frente a grupo y debido a la inserción de dicho idioma en primarias públicas, es que surge el cuestionamiento ¿Existe modificación en la comprensión lectora en idioma inglés al usar mapas conceptuales en la materia de Ciencias Naturales de 5to año de primaria? La presente investigación se aplicó a 60 estudiantes de 5to grado de primaria de una escuela pública en el Distrito Federal. Co...

  11. Modelo auto-regresivo aplicado a la eliminación de ruidos de los mapas de anomalías de resistividad en fosfatos asociadas a bolsones estériles

    OpenAIRE

    Saad Bakkali

    2008-01-01

    Actualmente se emplean varios métodos para perfeccionar los bordes y contornos de mapas geofísicos. En Marruecos se realizó una prospección de fosfatos empleando el método eléctrico de resistividad; para ello se utilizó un dispositivo Schlumberger, cubriendo una superficie de 50 hectáreas, con el objetivo de detectar anomalías asociadas a bolsones estériles en los depósitos de fosfatos. Para la eliminación del ruido blanco se empleó un método basado en un modelo auto-regresivo (ARM, siglas en...

  12. Mapa perceptual de marcas próprias: uma investigação das principais marcas de grandes redes supermercadistas no Brasil Private label perceptual maps: an investigation of important brands in large brazilian supermarket chains

    Directory of Open Access Journals (Sweden)

    Geraldo Luciano Toledo

    2007-12-01

    Full Text Available No atual ambiente competitivo, um dos principais desafios das grandes organizações varejistas e atacadistas é criar diferenciais competitivos por meio de marcas próprias que lhes permitam uma proposta de posicionamento ímpar, destacando-as dos concorrentes. Nesse contexto, o presente artigo tem por objetivo investigar como os consumidores percebem o posicionamento de marcas próprias. A pesquisa empírica que complementa o trabalho está voltada para a percepção de uma amostra de clientes sobre o posicionamento de marcas próprias, envolvendo importantes cadeias de lojas varejistas do Estado de São Paulo, algumas delas operando nacionalmente. Para a análise dos dados, foi aplicada a técnica MDS, visando a construção de um mapa perceptual. Verificou-se que as marcas objeto da pesquisa empírica ocupam espaços, ou representam conceitos próprios, nas mentes dos consumidores, os quais foram interpretados em um mapa com duas dimensões: qualidade e variedade em um eixo e preço em outro.A major challenge now faced by large wholesalers and retailers is to create competitive advantages. Private brand labels can be useful for a unique positioning proposition that distinguishes these enterprises from competitors. Empirical research investigated consumer perception of the positioning of private labels in important retail chains operating in Sao Paulo state and to some extent throughout Brazil. The MDS technique was used for data analysis to create a perceptual map. Brands were found to occupy positions or correspond to concepts in the mind of consumers. These were interpreted on a map with quality and variety on one axis and price on the other.

  13. El mapa mental, un organizador gráfico como estrategia didáctica para la construcción del conocimiento (Mental Mapping: Graphic Organization as Didactical Strategy for the Construction of Knowledge (La carte mentale, un organisateur graphique en tant que stratégie didactique pour la construction de la connaissance (O mapa mental, um organizador gráfico como estratégia didática para a construção do conhecimento

    Directory of Open Access Journals (Sweden)

    Juan Manuel Muñoz-González

    2011-06-01

    Full Text Available ResumenEn este trabajo, buscamos registrar el impacto de los mapas mentales como organizadores gráficos en la construcción del conocimiento. Realizamos la investi- gación con 140 estudiantes universitarios de segundo curso de la Titulación de Magisterio, en la especiali- dad de Educación Primaria. Optamos por el modelo cualitativo de investigación, al aplicar un cuestionario autorreflexivo al alumnado; para el procesamiento de los datos, utilizamos el programa Atlas.ti. Señalamos, como síntesis, que el mapa mental, además de contri- buir al desarrollo total de la persona, conecta con el enfoque multisensorial y constituye un “organizador gráfico” para la construcción del pensamiento.AbstractIn this paper, we seek to register the impact of mental maps and graphic organizers in the construction of knowledge. Research conducted with 140 university students from the sec- ond year of the Education Degree, majoring in Elementary Education. We chose the qualitative research model, applying a self-reflective questionnaire to the students. For data process- ing, we used the program Atlas.ti. In conclusion, we put forward that the mental map, apart from contributing to the overall development of the per- son, connects to the multisensory ap- proach and works as a “graphic orga- nizer” for the construction of thought.RésuméDans ce travail, on cherche registrer l'impact des cartes mentales en tant qu'organisateur graphique dans la construction de la connaissance. On a réalisé la recherche avec cent qua- rante (140 étudiants universitaires de seconde cours de nomination du Ma- gistère, dans la spécialité d'éducation primaire. D'abord, on a choisit le modèle qualitatif de recherche, dans l'application d'un questionnaire auto- réflexif aux élèves. Ensuite, pour traiter les données, on a utilisé le program- me Atlas.ti. Puis, on a indiqué en tant que synthèse, que la carte mentale en plus de contribuer au d

  14. Czechoznawstwo polskie – charakter i sens jednego kierunku badawczego

    Czech Academy of Sciences Publication Activity Database

    Pánek, Jaroslav

    2017-01-01

    Roč. 7, č. 1 (2017), s. 99-113 ISSN 2084-1213 Institutional support: RVO:67985963 Keywords : Czech Studies * Poland * Humanities Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  15. Język polski na Białorusi

    Directory of Open Access Journals (Sweden)

    Teresa Kryszyń

    2015-07-01

    Full Text Available Polish language in the Republic of Belarus  The situation of the Polish minority in Belarus was always difficult because the politics of Belarusian authorities was focused on destruction of anything connected with Polish culture or possessing Polish roots: intelligentsia, school, theatres, press. The reestablishing of Polish education in late 80-ties of the last century started from scratch therefore and the biggest amount of learners studied Polish in late 90-ties of the XX century. Recently the amount of students has decreased which is explained by the current demographical and political situation. The most significant influence on forming national consciousness is possesses by family. Unfortunately nowadays it is being observed that most of Polish families has not performed that function anymore and using of Polish language by members of Polish families is decreasing. The leading role of Polish language in a Catholic liturgy is changing as well: the word “Catholic” does not mean “Pole”. According to surveys 66% of Catholics would prefer Polish as the language of liturgy, 20% – Belarusian, 10% – Russian and Polish, 4% – another language. This situation creates the possibility of disappearing of Polish language from liturgy and catechism. Consequently the role of Polish schools and organizations in education of children and teenagers has increased. Language acquisition begins in kindergartens during extra lessons or within Polish groups. The forms of language acquisition at school vary a lot. Most of the students learn Polish languages after-hours, some of them attends required Polish classes at school. Moreover there are two Polish schools of Grodno region. There is an opportunity of studying Polish language in high educational establishments in Belarus, e.g. in Grodno State University Polish language department has existed since 1989 and it prepares its students to teaching Polish language. Farther development of Polish education in Belarus depends on both factors the Poles attitude and current political situation in the country.   Польский язык в Республике Беларусь Положение польского национального меньшинства в РБ всегда была трудной, так как политика властей была направлена на уничтожение всего, что имело польские корни и было связано с польской культурой: интеллигенции, школ, театров, газет. В связи с этим возрождение образования на польском языке в конце 80-тых годов прошлого столетия начиналось с нулевого уровня и наибольшее количество учащихся изучало польский язык в конце 90-тых годов XX века. В последние годы наблюдается уменьшение количества учащихся, что объясняется демографической и современной политической ситуацией. На формирование национального самосознания наиболее значительное влияние оказывает cемья. К сожалению, большинство современных польских семей не выполняет эту функцию, использование польского языка как языка внутрисемейных отношений уменьшается. Польский язык в костеле также выходит из употребления, понятие “католик” сегодня уже не означает “поляк”. Как видно из исследований, 66% католиков хотели бы, чтобы литургия в костелах была на польском языке, 20% – на белорусском, 10% – на польском и русском, 4% – ином языке. Такая ситуация создает опасность исчезновения польского языка из литургии и катехизиса. В связи с вышесказанным усиливается роль польских школ и польских общественных объединений в воспитании и обучении детей и молодежи. Oбучение и воспитание детей польскому языку начинается уже в детском саду в кружках либо в специальных группах с обучением и воспитанием на польском языке. В школах обучение польскому языку ведется в разных формах. Наибольшее количество желающих учится во внеурочное время, определенная часть – в классах с обязательным изучением польского языка. Помимо этого в Гродненской области существуют две школы с обучением на польском языке. В высших учебных заведениях Беларуси также изучается польский язык, а в Гродненском госуниверситете с 1989 г. cуществует кафедра полонистики, занимающаяся подготовкой учителей польского языка. Дальнейшее развитие польскоязычного образования в РБ зависит как от позиции поляков, так и от современной политической ситуации в нашей стране.

  16. En los albores del catastro parcelario territorial en España: los mapas topográficos de Granada y su área metropolitana (1819-1820

    Directory of Open Access Journals (Sweden)

    García-Pulido, Luis José

    2016-06-01

    Full Text Available The Topographic map of the city of Granada and its municipal district was accomplished in 1819 with accuracy and graphical quality as a pioneering work in the area of the land registries maps in Spain. It was conducted by Francisco Dalmau (1766-1824, illustrate mathematic who accomplished numerous titles ending with Headmaster of the Statistics of the Province of Granada. One year later he directed 18 maps more, corresponding to some towns and villages in Granada district. These documents are previous in some decades to other similar works done in Spanish cities. This article gives a general layout of the agrarian land of the surroundings of Granada from the global analysis of these cartographic documents and their geographic data that, in spite of have been promoted out of the military scope, are preserved in the Army’s Geographic Centre.En 1819 se elaboró con notable precisión y calidad gráfica el Mapa topográfico de la ciudad de Granada y su término, obra pionera en el ámbito de los planos catastrales parcelarios españoles. Su autor fue Francisco Dalmau (1766-1824, matemático ilustrado que acaparó numerosos títulos, culminados con el de director de la Estadística de la Provincia de Granada. Un año más tarde dirigió la elaboración de 18 mapas más, correspondientes a los términos municipales de los lugares y villas del partido granadino. Con esta iniciativa se adelantaría en varias décadas a los trabajos de similares características realizados en otras poblaciones españolas. En este artículo se ofrece una completa visión del uso del suelo agrario en el entorno de la capital granadina a partir del análisis conjunto de los datos geográficos contenidos en estas cartografías que, pese a que fueron promovidas fuera del ámbito militar, se han conservado en el Centro Geográfico del Ejército.

  17. DESARROLLO DE UN PENETRÓMETRO INTEGRADO CON TECNOLOGÍA GPS-RTK PARA LA GENERACIÓN DE MAPAS DE RESISTENCIA A LA PENETRACIÓN DEL SUELO

    Directory of Open Access Journals (Sweden)

    Santos Gabriel Campos Magaña

    2015-04-01

    Full Text Available La agricultura de precisión requiere información precisa acerca de las propiedades del suelo para optimizar la aplicación de insumos y satisfacer necesidades específicas de los cultivos. En particular, la resistencia a la penetración (RP que es un factor que mide la compactación del suelo, la cual limita el crecimiento de las raíces y el rendimiento del cultivo, lo cual requiere ubicar y cuantificar el valor de RP. El presente trabajo describe el desarrollo de un penetrómetro integrado con dos sensores (resistencia y profundidad aplicados junto con tecnología de Posicionamiento Cinemátio en Tiempo Real-Sistema de Posicionamiento Global para Agricultura (RTK-AgGPS para la generación de mapas de diagnóstico de capas compactadas. El primer sensor fue desarrollado para la medición de la RP utilizando un transductor de anillo simple con capacidad de hasta 9 MPa, con una sensibilidad de 13.5 Nm V-1 y un coeficiente de correlación de 99.6% entre la fuerza aplicada y el voltaje de salida. El segundo sensor, se adecuó para determinar la profundidad de RP con un desplazamiento de trabajo máximo de 0.60 m, con una sensibilidad de 258.5 mm V-1 y un coeficiente de correlación de 100% entre la profundidad de penetración y voltaje de salida. Para la evaluación en campo, se construyó un carro porta-sensores acoplado al enganche del tractor para el accionamiento del actuador hidráulico del penetrómetro. Se realizó un muestreo sistemático de 30 puntos utilizando la tecnología RTK-GPS obteniendo los valores y localización geo referenciada de RP con una precisión de 0.025 m en una profundidad de trabajo hasta de 0.40 m, esto permitió la generación de mapas de diagnóstico de la RP empleando un Sistema de Información Geográfica para tres profundidades diferentes de 0.20, 0.30 y 0.40 m.

  18. Utilidad del mapa de riesgo laboral en el diagnóstico de salud de las empresas Usefulness of labor risk map in health diagnosis of health condition in companies

    Directory of Open Access Journals (Sweden)

    Guillermo López Espinosa

    2004-04-01

    Full Text Available En la mina-planta de zeolita de Tasajeras, perteneciente al municipio de Ranchuelo, provincia de Villa Clara, se realizó un estudio observacional de tipo descriptivo en el año 2002, con el objetivo de valorar la utilidad del mapa de riesgo laboral en el diagnóstico de salud de los trabajadores de la empresa. Identificados y clasificados los riesgos presentes en el ámbito laboral y conocido su indicador negativo de control, se procedió a calcular el grado de peligrosidad, y se halló que el ruido industrial y el polvo mineral fueron los de mayor gravedad (1 000 puntos. La temperatura extrema y la exposición al plomo obtuvieron una menor peligrosidad (150 puntos. Se confeccionó un esquema del centro y se localizaron los indicadores de los factores de riesgos, basados en su prioridad; se establecieron los planes de prevención y control. El mapa de riesgo proporcionó una información básica para el análisis de la salud laboral y para la elaboración de planes preventivos, por lo que recomendamos su uso por los Equipos de Salud ubicados en los centros de trabajo.In zeolite production plant and mine located in Tasajeras, Ranchuelo´s municipality in Villa Clara province, an observational descriptive-type study was performed in 2002 to assess the benefits of the labor risk map in the diagnosis of health condition of workers in this company. Once the risks in the labor context were identified and classified and their negative control index was known, the dangerousness level was estimated. It eas found that industrial noise and mineral powder were the most serious risks (1 000 points. Very high temperatures and exposure to lead recorded lower dangerousness rate (150 points. A center drawing was prepared and the risk factors indicators were located on the basis of their priority; also prevention control programs were put into practice. The labor risk map may provide basic information for the analysis of labor health and working-out of

  19. Análisis de la percepción de los estudiantes sobre las áreas de intervención del futuro educador y trabajador social a través de una didáctica digital con mapas conceptuales multimedia

    Directory of Open Access Journals (Sweden)

    Eloy López Meneses

    2014-01-01

    Full Text Available El presente estudio diacrónico describe una experiencia innovadora universitaria basada en el desarrollo de mapas conceptuales multimedia con el objetivo de analizar la percepción de los estudiantes sobre las principales áreas de intervención del futuro educador y trabajador social. Estos mapas fueron elaborados por los estudiantes que cursaban la asignatura de Tecnologías de la Información y la Comunicación en la titulación de Grado de Educación Social y Doble Grado de Educación Social y Trabajo Social durante tres cursos académicoscomprendidos entre 2010-13 en la Universidad Pablo de Olavide de Sevilla. A través de una metodología de corte cualitativo y descriptivo, se revisaron las 213 aportaciones realizadas por los estudiantes y entre las conclusiones cabe resaltar que los mapas digitales multimedia son un valioso recurso especialmente en su aplicación a estudios con un enfoque social. Los estudiantes fueron capaces de identificar, debatir y proponer las siguientes áreas de intervención intercultural y comunitaria: tercera edad (67%, infancia –adolescencia, junto a drogodependencia (63%, personas con discapacidad (50%, adultos (38%, salud mental (31%, atención sociocomunitaria (24% e inmigrantes (21%.

  20. El Pràcticum al grau de Pedagogia de la Universitat de Barcelona: el mapa de la professió, la pràctica simulada i la immersió en una organització

    Directory of Open Access Journals (Sweden)

    Ruth Vilà Baños

    2014-01-01

    Full Text Available Es presenta el treball innovador que l’equip de coordinació del Pràcticum del grau de Pedagogia de la Universitat de Barcelona ha elaborat per organitzar les assignatures vinculades a la pràctica dels professionals de la pedagogia. Amb la finalitat de preparar els futurs professionals en els aspectes més pràctics de la seva formació, s’estructuren tres assignatures: Professionalització i Sortides Laborals, Pràctiques d’Iniciació Professional i Pràctiques Externes. En aquestes assignatures es treballa de forma innovadora el perfil del pedagog i el mapa de la professió, a primer curs del grau; la pràctica simulada a través de casos, a tercer, i la immersió en una organització, com a pràctica externa, acompanyada dels seminaris de pràctica reflexiva.

  1. O ensino-aprendizagem da anatomia humana: avaliação do desempenho dos alunos após a utilização de mapas conceituais como uma estratégia pedagógica

    Directory of Open Access Journals (Sweden)

    Janice Henriques da Silva

    Full Text Available Resumo O objetivo deste estudo foi implementar e avaliar o impacto da elaboração de Mapas Conceituais (MC como estratégia pedagógica no ensino-aprendizagem da Anatomia Humana, uma das disciplinas do curso de Fisioterapia da Universidade Federal de Minas Gerais. Participaram do estudo 298 alunos regularmente matriculados, ao longo de seis semestres. A análise das médias das notas finais dos alunos, anteriores à ampliação do projeto dos MC, demonstrou decréscimo dessas médias ao longo dos semestres, o que foi revertido quando o projeto de ensino de MC foi implementado sistematicamente. A implementação dos MC também foi capaz de promover uma redução significativa no índice de reprovação. Assim, concluímos que o uso de MC parece ter contribuído para melhorar o desempenho dos alunos e também o índice de aprovação na disciplina de Anatomia Humana, principalmente após a sistematização do seu uso através do Projeto de Ensino apoiado pela Pró-Reitoria de Graduação da Instituição.

  2. Modelo auto-regresivo aplicado a la eliminación de ruidos de los mapas de anomalías de resistividad en fosfatos asociadas a bolsones estériles

    Directory of Open Access Journals (Sweden)

    Saad Bakkali

    2008-03-01

    Full Text Available Actualmente se emplean varios métodos para perfeccionar los bordes y contornos de mapas geofísicos. En Marruecos se realizó una prospección de fosfatos empleando el método eléctrico de resistividad; para ello se utilizó un dispositivo Schlumberger, cubriendo una superficie de 50 hectáreas, con el objetivo de detectar anomalías asociadas a bolsones estériles en los depósitos de fosfatos. Para la eliminación del ruido blanco se empleó un método basado en un modelo auto-regresivo (ARM, siglas en inglés; este se implementó por medio del algoritmo AutoSignal; el resultado muestra que el método ARM es efectivo para el filtrado, atenúa considerablemente el ruido producido por bolsones dispersos y de pequeño tamaño, además brinda una reducción considerable de la distorsión de la forma de la señal de resistividad original.

  3. Análisis comparativo de la competitividad y productividad de la empresa Hukk Makilla, basada en la metodología del Mapa de Competitividad Promperú, 2014

    Directory of Open Access Journals (Sweden)

    Víctor Quintana Palacios

    2014-12-01

    Full Text Available Objetivos: Describir el nivel de competitividad y productividad de la empresa Hukk Makilla del sector textil del distrito de Huayucachi, Huancayo. Métodos: Fue una investigación aplicada, de diseño preexperimental. La recolección de datos se realizó a través de la aplicación del mapa de competitividad empresarial, que permitió obtener información del nivel de competitividad y productividad de la empresa. La muestra fue la empresa textil Hukk Makilla que participó en el Programa de Training en Gestión Exportadora promovida por Promperú. Las mediciones, siguiendo el diseño, fueron al inicio y al final, para luego determinar los respectivos diagnósticos de competitividad de la empresa. Resultados: La empresa aumentó la competitividad en un 28 %, de 45 % a 73 %. El crecimiento general de competitividad por áreas fue de 83 % en planeamiento estratégico, 79 % en contabilidad y finanzas, 77 % en sistemas de información, 74 % en gestión ambiental, 73 % en producción y operaciones, 69 % en comercialización, 65 % en recursos humanos y 62 % en aseguramiento de la calidad. Conclusiones: La gestión empresarial permite a las empresas aumentar su competitividad y productividad como en este caso al implementarse medidas innovadoras en diversas áreas de la empresa ha permitido obtener mejoras.

  4. Una introducción a la problemática de la alfabetización cartográfica en la Geografía Escolar. La lectura y escritura de mapas desde las TIC/TAC

    Directory of Open Access Journals (Sweden)

    Andrea Fleitas

    2012-06-01

    Full Text Available El presente trabajo examina los problemas relativos a la enseñanza de la Geografía Escolar, específicamente los relacionados con la alfabetización cartografica desde las Tecnologías de la información y comunicación (TIC y las Tecnologías del aprendizaje y del conocimiento (TAC, en el aula del Ciclo Superior de la Educación Secundaria en Tandil. El mapa es una herramienta básica para el aprendizaje de la geografía y, paradojalmente, la mayor dificultad en la enseñanza. Se utiliza apenas para localizar, desconociendo que desde secuencias pedagógicas innovadoras que introducen el uso de TIC/TAC se puede construir en los alumnos una visión más amplia sobre sus innumerables posibilidades de trabajo, como medio de comunicación que lleva a formar significados y autonomías intelectuales que permitan la construcción de ciudadanos críticos y reflexivos. Se pretende poner en discusión la problemática señalada desde el análisis del trabajo de campo realizado a partir de la formulación de encuestas a docentes de geografía.

  5. La utilización de mapas conceptuales en las asignatura de matemáticas para la economía en el marco del espacio europeo de enseñanza superior 3.la utilización de mapas conceptuales en las asignatura de matemáticas para la economía en el marco del espacio europeo de enseñanza superior

    Directory of Open Access Journals (Sweden)

    Pérez Gladish, B.

    2006-01-01

    Full Text Available La integración de las universidades españolas en el Espacio Europeo de Educación Superior (EEES supone un proceso de transformación educativa que inexorablemente conduce a la búsqueda de modelos que supongan un aprendizaje centrado en el alumno. Los mapas conceptuales pueden llegar a jugar un papel importante en los procesos de aprendizaje al estar su construcción centrada en el alumno y no en el profesor; atiende al desarrollo de destrezas y no a la mera memorización de conceptos y pretende un desarrollo armónico de todas las dimensiones formativas del alumno, no sólo de las intelectuales. Todas estas características hacen que esta herramienta de asociación, interrelación, discriminación y descripción, con alto poder de visualización pueda ser utilizada con éxito en las asignaturas de Matemáticas en el EEES.

  6. ¿Quién se opone a la prevención?: Un mapa de los actores pro tabaco en España Who is against prevention?: A map of policy actors favoring smoking in Spain

    Directory of Open Access Journals (Sweden)

    Lluís Granero

    2004-10-01

    Full Text Available Objetivos: Para poder realizar un abordaje integral de las políticas referidas al tabaquismo hay que conocer el mapa de los actores relacionados con el tabaco y sus vínculos políticos. En este trabajo se pretende presentar una primera aproximación en España. Métodos: Análisis de la prensa, publicaciones de la industria y entrevistas con personas clave. Se identifican los actores pro tabaco activos en España, que se han podido clasificar según su naturaleza, la esfera en que se mueven y su ámbito territorial preferente. Resultados: Se identifican las empresas tabaqueras, entre las que destacan Altadis y Philip Morris por su dominio del mercado, las organizaciones del comercio minorista (estanqueros, las organizaciones «pantalla» creadas por la industria (Club de Fumadores por la Tolerancia, las de cultivadores y las empresas de transformación. La distribución está dominada por Logista, filial de Altadis. Hay que tener en cuenta también las empresas de vending y de productos complementarios (mecheros, fósforos y papel. Se identifican los vínculos de estos actores con la Administración pública, donde destaca el papel que desempeña el Comisionado para el Mercado de Tabacos, así como los Ministerios de Agricultura, Hacienda y Economía. Se identifican también las relaciones con la patronal, algunos partidos políticos y sindicatos, así como con otros sectores empresariales con gran influencia social, como los medios de comunicación y la publicidad. Conclusiones: El mapa de los actores pro tabaco en España es complejo y supera los límites de la estricta industria tabaquera. La comprensión de este entramado es fundamental para poder plantear políticas integrales de prevención.Objectives: For a comprehensive approach to policies on smoking, the map of actors related to tobacco and their political ties needs to be identified. The present article constitutes the first attempt at this task in Spain. Methodology: Analysis of

  7. Mapas conceituais e aprendizagem no ciberespaço: uma reflexão sobre didática e partituras musicais/Conceptual maps and learning in the cyberspace: a reflection on didacticism and musical scores

    Directory of Open Access Journals (Sweden)

    Eloiza da Silva Gomes de Oliveira

    2006-01-01

    Full Text Available Este artigo trata da importância dos mapas conceituais como estratégia didática, nas aprendizagens realizadas em ambientes virtuais. Conceitua a interação, suas peculiaridades e desafios, buscando alguns conceitos em Piaget, Vygotsky, Primo e Cassol. Na analogia que criamos – turmas e orquestras, didática e partituras musicais – a interação garante a harmonia do conjunto, a produtividade e a significância da aprendizagem, coletivamente construída. O processo de ensino, que tem como peculiaridade a intencionalidade, faz com que surjam procedimentos didáticos. Este processo gera um corpo de conhecimentos sobre o ensino: a Didática. Os processos de ensino e aprendizagem realizados a distância demandam a criação de uma didática específica. Apontamos os mapas conceituais, criados por Novak e fundamentados na teoria de Ausubel, como uma excelente opção metodológica. Eles são uma ferramenta gráfica utilizada para representação da estrutura conceitual de um determinado conhecimento. Formam uma estrutura que vai dos conceitos mais abrangentes até os menos inclusivos. São utilizados para ordenar e seqüenciar hierarquizadamente os conteúdos de ensino, oferecendo estímulos adequados ao aluno. Tornam mais significativa e prazerosa a aprendizagem do aluno, que transforma o conhecimento sistematizado em conteúdo curricular, estabelecendo ligações do conhecimento com os conceitos relevantes que ele já possui. This article approaches the importance of the conceptual maps as didactic strategy, in the learning accomplished in virtual atmospheres. We considered the interaction, their peculiarities and challenges, looking for some concepts in Piaget, Vygotsky, Primo and Cassol. In the analogy that we created - groups and orchestras, didacticism and musical scores - the interaction guarantees the harmony of the group, the productivity and the importance of the learning collectively built. The teaching process, that has as

  8. Promoción turística y cartografía. La Argentina turística en los mapas de la Secretaría de Turismo de la Nación (1996-2004

    Directory of Open Access Journals (Sweden)

    Analía Almirón

    2012-02-01

    Full Text Available Las imágenes, representaciones e ideas presentes en los textos de promoción turística funcionan como “esqueletos” del imaginario turístico en tanto organizan las expectativas del potencial turista a partir del consumo anticipado de atractivos y destinos. Este trabajo tiene como objetivo general interpretar qué tipo de imágenes presenta la Secretaría de Turismo de la Nación para promocionar el turismo en la Argentina a partir del análisis de las cartografías turísticas que dicha Secretaría publicó entre 1996 y 2004. El punto de partida es que los mapas de la Secretaría de Turismo, junto con otros textos turísticos, participan en los procesos de promoción de ciertos atractivos y destinos turísticos del país. El análisis de las fuentes cartográficas permitió reconocer que existe en la cartografía turística de los últimos años, una forma de pensar e imaginar a la Argentina como un país dotado de múltiples atractivos turísticos diseminados sobre el territorio estatal, capaces de responder a las expectativas de todo tipo de turista. Así, esta cartografía oficial apuesta no sólo a la respuesta de consumo inmediato de los turistas, sino también a la construcción de un imaginario turístico que va sedimentando progresivamente en los procesos de interpretación y valoración turística de atractivos y destinos.

  9. El arte de describir el territorio: mapas y planos históricos en torno al puente de Alcántara (Cáceres, España

    Directory of Open Access Journals (Sweden)

    Chias, P.

    2012-12-01

    Full Text Available The study of the construction of the territory and the landscape at different scales has been traditionally based on written documentary sources, and to a lesser extent on the graphic ones. The cartographic sources, as well as paintings, drawings, and photographs have been often relegated to a secondary role, and thus undervalued. This fact is due to the difficulties of interpretation of the cartographic documents, but also to the obstacles to find their location, and even to access to them. This article considers the territory under the scope of the cultural heritage, and collects many historical and unpublished data about the Roman Alcantara Bridge through the analysis of historical maps and plans.

    El estudio de la construcción del territorio y del paisaje a diferentes escalas se ha basado tradicionalmente en fuentes documentales escritas, y en menor medida en las gráficas. Las fuentes cartográficas, junto a los cuadros, los dibujos, las fotografías y otras fuentes no verbales han sido frecuentemente relegadas o consideradas de una categoría inferior, muchas veces a causa de las dificultades de interpretación que pueden plantear, y a esto hay que añadir las dificultades inherentes a la localización y acceso a los fondos. El trabajo reivindica el territorio como patrimonio al mismo tiempo que aporta datos inéditos para la historia del puente de Alcántara mediante el análisis de mapas y planos históricos.

  10. Influência da distância entre passadas de colhedora equipada com monitor de colheita na precisão dos mapas de produtividade na cultura do milho Influence of distance between combines equipped with yield monitors on the precision of yield maps for corn crops

    Directory of Open Access Journals (Sweden)

    Cláudio L. Bazzi

    2008-06-01

    Full Text Available Um dos entraves para a maior expansão da agricultura de precisão está, principalmente, no elevado custo dos equipamentos a serem utilizados. A geração de mapas de produtividade é a fase de mais fácil execução na agricultura de precisão. Entretanto, quando várias colhedoras operam simultaneamente em uma determinada área, nem sempre é possível dispor de monitores de colheita em todas as máquinas. Assim, neste trabalho, foi avaliado o decréscimo da precisão em mapas de produtividade obtidos a partir de áreas onde se utilizaram colhedoras não-equipadas com monitor de colheita associadas a colhedoras monitoradas. Também foram comparados os métodos de interpolação "inverso da distância ao quadrado" e "krigagem". Inicialmente, a interpolação do mapa com todos os pontos de amostragem (original foi gerada e, a partir dessa, foi feita a eliminação de passadas de modo a obter os mapas simulados. Na comparação entre os mapas simulados e o original, foi utilizado o coeficiente de desvio relativo - CDR, e o índice kappa. O número de passadas eliminadas diminuiu a precisão dos mapas em ambos os métodos de interpolação. Sendo assim, a quantidade mínima necessária de monitores em um conjunto de colhedoras depende da precisão desejada. Portanto, as máquinas devem ser intercaladas de maneira que as amostras sejam coletadas uniformemente por toda a área a ser colhida.One of the main obstacles to the larger expansion of precision agriculture is the high cost of the equipments to be used. The generation of yield maps is the easiest step in the sequence of the precision agriculture process. Nevertheless, the availability of yield monitors for all the machines is not always possible when several combines are concomitantly harvesting in a given area. Within this context, this research was carried out aiming to evaluate the decrease of precision of yield maps obtained from data collected in areas where combines not equipped with

  11. Mapa del proteoma de parásitos de Leishmania Viannia a partir de electroforesis de geles de poliacramida en dos dimensiones y otras técnicas asociadas

    Directory of Open Access Journals (Sweden)

    Rafael Góngora

    2003-06-01

    Full Text Available En este estudio demostramos el potencial de la electroforesis en dos dimensiones (2DE como herramienta para la caracterización del proteoma de Leishmania (expresión proteica complementaria del genoma. Los proteomas por 2DE en el rango neutro (pH 5-7 de extractos solubles de promastigotes de Leishmania (Viannia guyanensis y Leishmania (Viannia panamensis fueron reproducibles usando tampón de lisis de urea y nonidet P-40. Con la tinción de azul de Coomassie y nitrato de plata se detectaron, con buena resolución, 800 y 1.500 puntos de proteínas, respectivamente. Entre las proteínas de referencia comunes, aisladas de los proteomas de las cepas estudiadas, se identificaron por medio de espectrometría de masa de péptidos (LC-ES-MS/MS y métodos bioinformáticos, proteínas de choque térmico, proteína ribosomal S12, proteína de membrana del cinetoplasto 11 y una proteína hipotética específica de Leishmania de 13 kDa con función desconocida. Por inmunoblot y utilizando un anticuerpo monoclonal, se detectaron específicamente las proteínas paraflagelar 1 y 2 de 81,4 kDa y 77,5 kDa, respectivamente. La expresión proteica diferencial encontrada en los distintos clones de parásitos fueron reproducibles al ser comparados por medio de un programa analizador de imágenes. Estos datos demuestran el poder de resolución del análisis de proteomas por 2DE. La producción y caracterización de mapas proteicos básicos de Leishmania con buena calidad constituye un paso esencial en los estudios proteómicos comparativos orientados a la identificación de factores moleculares involucrados en la resistencia a drogas, virulencia de parásitos y el descubrimiento de blancos para nuevas drogas y vacunas.

  12. Aplicación de los mapas de procesado en la optimización de los parámetros de un proceso de conformado en caliente. I parte. Revisión teórica

    Directory of Open Access Journals (Sweden)

    Al Omar, A.

    1997-04-01

    Full Text Available The hot working processes constitute an important step in the manufacture of components for engineering applications. In the past, the mechanical processing have been used to impart a shape to the engineering materials. More recently, however, the hot working processes are used not only to achieve the required shape but also to impart desirable mechanical and microstructural characteristics by an adequate design of the thermomechanical process. The aim of the present paper is to summarize the general characteristics of the Dynamic Materials Model. In this model, the workpiece material under hot working conditions is considered to be a dissipater of power. Also, the extreme principles of irreversible thermodynamics applied to large plastic flow are described to develop a continuum criterion capable to predict the metallurgical instabilities in a hot worked material.

    Los procesos de conformado en caliente de materiales constituyen un paso muy importante en la fabricación de los componentes mecánicos. Durante siglos estos procesos fueron utilizados para dar a los metales la forma deseada. Hoy en día, sin embargo, la deformación en caliente no sólo proporciona la geometría deseada sino las características mecánicas y microestructurales necesarias mediante un adecuado diseño del proceso de termoconformado. En el presente trabajo se presentan, a modo de revisión, las características generales del llamado "modelo dinámico de materiales" mediante el cual se optimizan los parámetros de conformación de un material usando los mapas de disipación de energía. En este modelo, la pieza conformada a alta temperatura se considera como la única parte de todo el sistema del proceso capaz de disipar energía. Se describe, también, la termodinámica irreversible aplicada a la mecánica continua de la fluencia plástica en las grandes deformaciones para desarrollar un criterio capaz de predecir las inestabilidades metalúrgicas en un material

  13. Eficacia de la utilización de estilos de aprendizaje en conjunto con mapas conceptuales y aprendizaje basado en la resolución de problemas para el aprendizaje de neuroanatomía

    Directory of Open Access Journals (Sweden)

    J.O. Ayala-Pimentel

    Full Text Available Introducción. La utilización combinada de estilos de aprendizaje en conjunto con mapas conceptuales y el empleo de aprendizaje basado en la resolución de problemas (EMCRP es una nueva estrategia educativa. Objetivo. Evaluar la eficacia de la utilización del método EMCRP en la adquisición de aprendizaje significativo de neuroanatomía, comparado con el método usual de aprendizaje en estudiantes de fisioterapia, que cursaron la asignatura morfofisiología general en la Universidad Industrial de Santander (UIS entre los años 2004 y 2007. Sujetos y métodos. Se utilizó un diseño experimental con participantes aleatorizados asignados a dos grupos con una relación 1 a 1. En el grupo intervenido se empleó el método EMCRP y en el control el método tradicional de enseñanza. Después de un año se evaluó la adquisición de aprendizaje significativo para determinar el rendimiento del método EMCRP. Resultados. Se estudiaron 55 estudiantes. La edad media fue de 23 años y la razón mujer-hombre fue de 3 a 1. Al evaluar a los estudiantes después de un año de la intervención, 15 del grupo intervenido reprobaron el examen frente a 26 del grupo control (55 frente a 92%; p = 0,002. Se determinó una reducción del riesgo absoluto de 0,37 (intervalo de confianza al 95% = 0,16-0,56 y número necesario para tratar de 2,7 (intervalo de confianza al 95% = 1,7-6,3. Conclusión. La adquisición de un aprendizaje significativo fue mayor en el grupo intervenido, evidenciado por una menor proporción de suspendidos importante en comparación con el grupo control, con un número de estudiantes bajo a intervenir para que se produzcan resultados favorables.

  14. Análise da aceitação de aguardentes de cana por testes afetivos e mapa de preferência interno Acceptance evaluation of sugar cane brandy by sensorial affective tests and internal preference map

    Directory of Open Access Journals (Sweden)

    Helena Maria André Bolini CARDELLO

    2000-04-01

    Full Text Available A aceitação de 11 amostras de aguardentes de cana envelhecidas e não envelhecidas foi avaliada por testes sensoriais afetivos e análises estatísticas uni e multivariada. As aguardentes estudadas compreenderam seis amostras comerciais de diferentes marcas, (sendo três não envelhecidas e três envelhecidas e ainda outras cinco amostras correspondentes a zero, 12, 24, 36 e 48 meses de envelhecimento em um tonel de carvalho de 200L. As amostras foram avaliadas por 100 provadores consumidores do produto, recrutados por questionário de avaliação quanto à afetividade. Para os testes afetivos foi utilizada escala hedônica não estruturada de 9cm, sendo os dados obtidos avaliados por dois métodos estatísticos distintos: o Mapa de Preferência Interno (MDPREF e a análise de variância univariada (ANOVA com comparação de médias pelo teste de Tukey e análise de correlação. As amostras de aguardente envelhecidas por 12, 36 e 48 meses obtiveram maior aceitação, com médias ao redor de 7,0 na escala hedônica. A amostra com menor aceitação foi a correspondente ao tempo zero de envelhecimento (controle. As demais amostras obtiveram aceitação intermediária. A análise por MDPREF gerou em espaço multidimensional (onde as variações com relação aos dados de preferência foram extraídas em eixos ortogonais e para cada dimensão de preferência, coordenadas relativas aos produtos, que foram geradas em função da resposta dos consumidores. Os dados de aceitação de cada provador foram utilizados para o desenvolvimento de vetores individuais de preferência, resultando na construção de um mapa mutidimensional das amostras, em função dos dados de aceitação. No presente estudo o MDPREF foi gerado pelas primeira e segunda dimensões de preferência, as quais explicaram em conjunto 89,83% das variações observadas entre as amostras com relação à aceitação. O MDPREF confirmou os resultados da ANOVA, indicando uma maior prefer

  15. Kohonenova samoorganizační mapa

    OpenAIRE

    Žáček, Viktor

    2012-01-01

    Práce se zabývá samoorganizačními mapami zejména pak Kohonenovou samoorganizační mapou, tvorbou aplikace realizující tvorbu a proces učení Kohonenovy mapy a využitím samoorganizační mapy pro sebelokalizaci robota. Work deal about self-organizing maps, especially about Kohonen self-organizing map. About creating of aplication, which realize creating and learning of self-organizing map. And about usage of self-organizing map for self-localization of robot. A

  16. MAPA DE LOS CONFLICTOS DE ASIA

    Directory of Open Access Journals (Sweden)

    Javier Gil Pérez

    2011-01-01

    Full Text Available El autor muestra los principales focos de conflicto y tensión en una región, Asia-Pacífico, que está llamada a liderar políticamente y económicamente el mundo. Este presente siglo es el siglo de Asia y por ello los conflictos mostrados son el principal obstáculo para que Asia ostente el poder hegemónico en el futuro. La situación de inestabilidad en Pakistán y su vecina Afganistán y la evolución económica de China y su relación con sus vecinos regionales determinará la evolución de esta región estratégica.

  17. Mapa de riesgo de temperaturas extremas frías para el sur de la provincia de Buenos Aires usando datos satelitales y de superficie Frost risk map for the south of Buenos Aires province using satellite and surface data

    Directory of Open Access Journals (Sweden)

    Roberto De Ruyver

    2012-06-01

    Full Text Available Cerca del 40 % del área sembrada con trigo en Argentina se concentra en el sur de la provincia de Buenos Aires. Los eventos frecuentes de temperaturas extremas frías en la segunda quincena de octubre, coincidentes con un momento fenológico sensible del trigo, provocan daños de importancia en el cultivo. El presente trabajo tiene como objetivo proveer mapas de riesgo de temperaturas extremas frías para el período sensible del cultivo de trigo en esa región. Se utilizó información de los canales 3, 4 y 5 del satélite NOAA de 1,09 km² de resolución espacial, obtenidas en el Instituto de Clima y Agua del INTA-Castelar entre 2005 y 2008, y datos diarios de temperaturas mínimas del período 1961-2008 de 13 estaciones de superficie del Servicio Meteorológico Nacional (SMN y del Instituto Nacional de Tecnología Agropecuaria (INTA. Los resultados muestran que las áreas de mayor riesgo son aquellas que combinan menor altura sobre el nivel del mar y al mismo tiempo mayor distancia al mismo. Esta metodología puede ser extendida a otros cultivos y a otras regiones. Este tipo de análisis constituye una herramienta que puede ser útil en tareas de planificación tanto a nivel estatal como privado.Cold temperature can cause severe damage in crops when a cold front irruption occurs. This is especially true in some specific periods on the growing crops mainly during spring. This work presents frost risk maps for wheat. The region selected was the south of Buenos Aires province in Argentina. Wheat covers almost 2,2 million ha in south Buenos Aires area which represents 40% of the total wheat cultivated in Argentina At the same time, south Buenos Aires area suffers the biggest damage on wheat because of frost during spring time. The study was carried out based on channels 3, 4 and 5 of NOAA satellite images (1,09 km² spatial resolution. Images from 2005 to 2008 were available. Minimum daily temperatures from "Servicio Meteorológico Nacional

  18. Recopilación de la información biogeográfica, análisis de patrones ecológicos, conservación y mapa potencial de Graellsia isabelae (Graells, 1849 (Lepidoptera, Saturniidae en la provincia de Cuenca, España

    Directory of Open Access Journals (Sweden)

    de Arce Crespo, J. I.

    2010-06-01

    Full Text Available In the present paper, we update the distributional information of the endangered moth Graellsia isabelae (Graells, 1849 in Cuenca (Castilla-La Mancha and provide relevant ecological information. The species is present in 14 localities corresponding to 14 10x10 km UTM squares; 8 of them are published for the first time in this study. We corroborate the presence of the species in all the Protected Areas in Cuenca. Using the known occurrence data and a set of digital environmental variables such as current vegetation, climate, geology and elevation, we found that the distribution of the species seems to be mainly determined by the presence of Scots pine (P. sylvestris and Austrian pine (Pinus nigra subsp. salzmanii forests. Finally, a potential distribution map for the moth in Cuenca suggests that the species could inhabit other areas where it is presently unknown.Se ha realizado un estudio sobre la mariposa nocturna Graellsia isabelae (Graells, 1849 en la provincia de Cuenca, la cual se encuentra protegida en la región de Castilla-La Mancha. Se ha elaborado un mapa de distribución biogeográfica, ampliándose su presencia en un total de 8 cuadrículas UTM de 10x10 km. Además, se ha analizado la distribución de la especie con respecto a los espacios naturales protegidos de la provincia observando que está presente en la mayoría de los mismos. Así mismo, se ha realizado un cruce de datos de distribución en cuadrículas UTM 1x1 km con diferentes capas de sistemas de información geográfica (mapa forestal español, modelo digital del terreno, geología y caracterización climática de Allué-Andrade, obteniendo preferencias de patrones ecológicos, tales como la vegetación actual, caracterización climática, geología y distribución altitudinal. El hábitat principal de G. isabelae son zonas ocupadas por pino laricio (Pinus nigra subsp. salzmanii y pino albar (P. sylvestris. Por último, se ha realizado un mapa de distribución potencial

  19. Cartes des goûts, cartes du monde Mapas dos gostos, mapas do mundo

    Directory of Open Access Journals (Sweden)

    Clarisse Didelon

    2009-06-01

    Full Text Available L’alimentation est affaire de milieu naturel, mais aussi de culture. Dans une perspective mondiale, la cartographie de la production de denrées alimentaires (céréales, viandes, produits tropicaux, boissons alcoolisées et de leur consommation permet de mettre en évidence certains phénomènes à l’œuvre dans la mondialisation, tels que la tension entre la convergence culturelle et l’affirmation des particularités locales, mais aussi les rapports entre le nord et le sud.A alimentação é ligada ao meio ambiente, mas também à cultura. Numa perspectiva mundial, a cartografia da produção de géneros alimentícios (grāos, carnes, produtos tropicais, bebidas alcoólicas e do seu consumo permite destacar certos fenómenos derivados da globalização, como a tensão entre a convergência cultural e a afirmação das particularidades locais, mas também as relações entre o norte e o Sul.Food is in relation with the natural environment, but also with culture. In a world perspective, the cartography of the production of foodstuffs (grains, meats, tropical goods, alcoholic drinks and of their consumption allows to highlight certain phenomena that play a role in the globalization, for example, the tension between cultural convergence and local particularities claims, but also the relations between northern and southern countries.

  20. The radiological vulnerability of the soil as a tool in the local preparation for postaccident recovery. National maps update; La vulnerabilidad radiológica del suelo como herramienta en la preparación local para la recuperación posaccidente. Actualización de los mapas nacionales

    Energy Technology Data Exchange (ETDEWEB)

    Trueba, C.; García, B.; Montero, M.

    2015-07-01

    The accident at the Fukushima-Daichii, NPP occurred in March 2011, has shown that an adequate protection of the population requires, along with a quick and effective action in the emergency phase, a proper planning of the possible recovery strategies, adapted to the local specificity, to be applied on the contaminated areas. In relation to recovery strategies, CIEMAT developed a methodology, based on soil properties, to estimate the relative and qualitative aptitude of Spanish soils to transfer 137Cs and 90Sr. This aptitude was defined as radiological vulnerability and its results, represented as maps, allow the identification of priority areas where recovery strategies are to be applied. In the current context, and in order to make this methodology useful in decision making during the intermediate and long term stages after an accident, an update of the maps is presented taking advantage from the improvements in the representation of European soils and of the geospatial technologies of Geographic Information Systems (GIS). The appropriateness of using other methodologies of representation as well as the applicability of the maps around the NPP and future ATC, is also discussed. [Spanish] El accidente de la central nuclear de Fukushima-Daichii, ocurrido en marzo de 2011, ha puesto de manifiesto que para una adecuada protección de la población, además de una rápida y eficaz actuación en la fase de emergencia, es importante disponer de una adecuada planificación, adaptada a la especificidad local, para establecer las posibles estrategias de recuperación de la zona contaminada. En el ámbito de las estrategias de recuperación, el Ciemat desarrolló una metodología, basada en las propiedades edáficas, para estimar, relativa y cualitativamente, la aptitud de los suelos españoles a transferir la contaminación debida a 137Cs y 90Sr. Esta se definió como vulnerabilidad radiológica y sus resultados, representados en forma de mapas, permiten identificar las

  1. Genetic linkage maps of chicken chromosomes 6, 7, 8, 11 and 13 from a Brazilian resource population Mapas de ligação dos cromossomos 6, 7, 8, 11 e 13 de uma população brasileira de galinha

    Directory of Open Access Journals (Sweden)

    Marcel Ambo

    2008-01-01

    Full Text Available A linkage map is essential not only for quantitative trait loci (QTL mapping, but also for the organization and location of genes along the chromosomes. The present study is part of a project whose major objective is, besides from construction the linkage maps, the whole genome scan for mapping QTL for performance traits in the Brazilian experimental chicken population. Linkage maps of chicken chromosomes 6 to 8, 11 and 13 were constructed based on this population. The population was developed from two generations of crossbreeding between a broiler and a layer line. Fifty-one microsatellite markers were tested, from which 28 were informative: 4, 8, 7, 4 and 5 for chromosomes 6, 7, 8, 11 and 13, respectively. A SNP located in the leptin receptor gene was included for chromosome 8. Ten parental, 8 F1 and 459 F2 chickens from five full-sib families were genotyped with these markers. The number of total informative meioses per locus varied from 232 to 862, and the number of phase-known informative meioses from 0 to 764. Marker orders in the chromosomes coincided with those of the chicken consensus map, except for markers ADL0147 and MCW0213, on chromosome 13, which were inverted. The reduced number of phase-known informative meioses for ADL0147 (150 may be pointed out as a possible cause for this inversion, apart from the relative short distance between the two markers involved in the inversion (10.5 cM.O mapa de ligação além de ser fundamental no mapeamento de locos de características quantitativas (QTLs é importante na organização e localização de genes distribuídos ao longo dos cromossomos. O presente estudo é parte de um trabalho cujo objetivo maior, é a análise de mapeamento de QTLs para características de desempenho no genoma de uma população experimental desenvolvida no Brasil. Com base nesta população foram construídos os mapas de ligação dos cromossomos 6 a 8, 11 e 13 da galinha. A população foi desenvolvida a partir

  2. Análise do conhecimento e das concepções sobre saúde oral de alunos de odontologia: avaliação por meio de mapas conceituais Analysis of dental students' knowledge and concepts in oral health: evaluation by concept maps

    Directory of Open Access Journals (Sweden)

    Miriam Struchiner

    1999-01-01

    Full Text Available O objetivo inicial deste trabalho foi apreender a estrutura cognitiva de alunos do último ano (sétimo período do curso de graduação em odontologia da UFRJ em relação à temática do esmalte. Essa temática é de fundamental importância para a compreensão da saúde oral, na medida em que oferece conceitos científicos importantes e fundamentais para o exercício da prática clínica e preventiva, bem como por ser objeto de estudo em várias disciplinas ao longo do curso de Odontologia. Para a análise da estrutura cognitiva, utilizou-se a estratégia de mapas conceituais proposta por Novak e fundamentou-se na teoria da Aprendizagem Significativa, de Ausubel. A análise dos mapas elaborados pelos estudantes possibilitou um estudo não só sobre a estrutura cognitiva e as concepções sobre saúde oral dos alunos, como também permitiu um diagnóstico do conhecimento em diversos aspectos relevantes à formação científica e profissional, apontando para a necessidade de se repensar o processo ensino-aprendizagem nos cursos de Odontologia.This study sought to analyze senior dental students' cognitive structure concerning the topic of "enamel", which is fundamentally important for understanding oral health, since it offers basic scientific concepts for clinical and preventive practices and is the main subject of several courses during dentistry training. The strategy used to analyze students' cognitive structures was Novak's Concept Maps, based on Ausubel's Meaningful Learning theory. Analysis of students' maps allowed for a study of students' cognitive structure and concepts concerning oral health. It also fostered a diagnosis of students' knowledge in several important aspects of scientific and professional training. The results highlighted the need for rethinking the teaching/ learning process in dentistry training.

  3. Elaboração e implantação do mapa de riscos ambientais para prevenção de acidentes do trabalho em uma unidade de terapia intensiva de um hospital universitário Implementación del mapa de riesgos ambientales para prevención de accidentes de trabajo en una unidad de terapia intensiva de un hospital universitario Elaboration and implementation of environmental risk map for prevention of work related accidents in an intensive care unit of a university hospital

    Directory of Open Access Journals (Sweden)

    Maria Cecília Cardoso Benatti

    2000-10-01

    Full Text Available O objetivo deste trabalho é trazer para o âmbito da saúde do trabalhador questionamentos relativos aos riscos ambientais a que estão expostos os trabalhadores de uma Unidade de Terapia Intensiva de um Hospital Universitário. Para tanto, elaborou-se um instrumento em que os trabalhadores envolvidos descreviam os riscos ambientais da Unidade de Terapia Intensiva. Como resultado comprovou-se no ambiente a existência de riscos biológicos, físicos, químicos, ergonômicos e riscos de acidentes do trabalho. Implantou-se a seguir o mapa de risco da UTI.El objetivo de este trabajo es traer para el ámbito de la salud del trabajador cuestionamientos relativos a los riesgos ambientales a que están expuestos los trabajadores de la Unidad de Terapia Intensiva. Para esto, se elaboró un instrumento, en el que dichos trabajadores describen los riesgos ambientales de su Unidad. Como resultado se comprobó en el ambiente la existencia de riesgos biológicos, físicos, químicos, ergonómicos y riesgo de accidentes de trabajo.This study has the objective to discuss some questions related to occupational risks that health professionals are exposed to in the Intensive Care Unit environment. A questionnaire was used, asking the health care workers to describe the occupational risks they know about. As a result, the participants indicated risks related to biological, physical, chemical, ergonomic and occupational risks.

  4. Criação de mapa de fontes de informação e conhecimento do processo judicial: o caso do Serviço de Documentação do Tribunal do Trabalho da 4ª Região

    Directory of Open Access Journals (Sweden)

    Adriana Godoy da Silveira Sarmento

    2017-12-01

    Full Text Available O propósito desta pesquisa foi mapear as fontes de informação e conhecimento necessárias aos juízes do Tribunal Regional do Trabalho da 4ª Região para tomada de decisões nos processos judiciais, como instrumento gerencial a ser utlizado pelo Serviço de Documentação (SDOC no desenvolvimento de produtos e serviços. Trata-se de uma pesquisa exploratória, descritiva de cunho qualitativo, fazendo-se uso do procedimento “estudo de caso”. A partir dos resultados, conclui-se que o mapa de fontes de informação e conhecimento é um instrumento que permite conhecer as reais necessidades da clientela do SDOC do TRT4 e adequado para dar suporte aos processos de seleção, organização e criação de produtos e serviços.

  5. Características de rede de suporte social masculina e feminina no quadrante família do Mapa Mínimo de Relações Sociais do Idoso-MMRI, de estudantes frequentadores de Universidade Aberta à Terceira Idade

    Directory of Open Access Journals (Sweden)

    Maria Juliana Torres

    2013-05-01

    Full Text Available Objetivou-se comparar as características das redes de suporte social de homens e mulheres quanto ao tamanho de rede, frequência de contatos e funções desempenhadas pela família. Trata-se de estudo prospectivo, de caráter sociométrico com 243 idosos de Universidade a Universidade Aberta à Terceira Idade. Utilizou-se o Mapa Mínimo de Relações do Idoso. Houve semelhança entre os sexos nas médias do quadrante da família, total de registros na maioria das funções, exceto no auxílio às atividades domésticas, índices de suporte social. O tamanho de rede social foi similar nas redes pequenas, médias e grandes. No quadrante família, quase todas as funções apresentaram os mesmos valores. Para esta população, ambos possuem aspectos da rede de suporte social semelhantes, não apresentando diferenças significativas.

  6. Directory of Polish Officials: A Reference Aid

    Science.gov (United States)

    1989-04-01

    Jan 86 Deputy Director Mondalski, Janusz Aug 83 Polish Steamship Company (Polski Zegluga Morska ) (PZM) Director Andruczyk, Mieczyslaw Jan...2<> Polski Kosciol Chrzescijan Baptystow 12° Polski Linie Oceaniczne ’"- Polski Towarzystwo Ekonomiczne ’’° Polski Zegluga Morska 102 Polski

  7. Polityka integracyjna Norwegii wobec nowej emigracji zarobkowej z Polski w latach 2004-2009

    Directory of Open Access Journals (Sweden)

    Alicja Kiełbasiewicz

    2010-12-01

    Full Text Available Norway’s policy on integration towards new economic emigration from Poland 2004-2009The aim of this article is to presentthe main assumptions of Norway’s integra­tion policy towards Polish labour emigrants after the access of Poland to the European Union in 2004. Norway, as a member ofthe European Economic Area, participates in the European Union’s single market that among others ensures free movement of people and services. As a result, more than one hundred thousand Polish citizens have taken up employment in this Nordic country during last 5 years. At present, they constitute the largest national minority in Norway.Even though Norway introduced transitional period to protect their market against cheap manpower, many Norwegian as well as Polish companies found their way to employ specialists from previous Eastern Bloc with remuneration below the minimum accepted in particular branches. Therefore, many labour emigrants found themselves on the periphery of Norwegian society along with bad living conditions, unregulated working time and devoid of any rights to welfare. This situation was defined by Norwegian government as a social dumping and since 2006 new regulations have been introduced in order to limit this unfair competition. However, the biggest emphasis has only been put on exacerbation of labour law and popularization of collective wage agreements. Norwegian authorities decided to exclude labour emigrants from fuli participation in the integration policy that includes among others free courses in Norwegian language or recognition of education.Moreover, the article tries to depictthe outline of history of labour migration in Norway, reasons for current migration, mechanisms of recruitment, working and living conditions of Polish emigrants, and the generał conceptions for futurę import of workforce to Norway. All these issues are to give a wider picture of the main challenges connected with the modern phenomenon of free movement of people between countries with different standards of living and regulations within Central and West­ern Europe.

  8. Warunki termiczne a zanieczyszczenie powietrza w wybranych miastach Polski w sezonie zimowym 2016/2017

    Directory of Open Access Journals (Sweden)

    Małgorzata Czarnecka

    2017-12-01

    Full Text Available W pracy przedstawiono statystyczną ocenę wpływu temperatury powietrza oraz inwersji termicznych (dolnych i górnych na stężenia pyłu zawieszonego PM10 i PM2,5 oraz dwutlenku siarki w Gdańsku, Wrocławiu i Warszawie w okresie kalendarzowej zimy XII-II w 2016/17 r. Wykazano, że w analizowanym sezonie zimowym temperatura powietrza w przygruntowej warstwie powietrza (do 200 cm wywierała silny wpływ na zmienność stężeń dwutlenku siarki i pyłu zawieszonego obu frakcji w każdym mieście, zwłaszcza w porze nocnej (19.00-6.00. Niekorzystny wpływ na wielkość analizowanych zanieczyszczeń miała przede wszystkim miąższość dolnych warstw inwersyjnych, podczas gdy zjawiskiem jednoznacznie korzystnym dla dyspersji zanieczyszczeń, była duża miąższość dziennej warstwy mieszania, uwarunkowana wysokim zaleganiem podstawy inwersji górnych.

  9. Kinematografia niepamięci. Polskie filmy dokumentalne o Litzmannstadt Getto

    Directory of Open Access Journals (Sweden)

    Ewa Ciszewska

    2016-05-01

    Filme über das Ghetto Litzmannstadt (in Łódź haben bei Weitem noch nicht die gleiche mediale Anerkennung erfahren wie Produktionen über das Warschauer Ghetto; meist wird das Warschauer Ghetto als zentrales Motiv verwendet, wenn in der polnischen Filmkunst das Thema der Juden behandelt  wird. Durch das generelle   Fehlen von Darstellungen der Tragödie um das Ghetto Litzmannstadt in Form von Denkmälern sowohl in der Stadt Łódź als auch in Polen allgemein, wird diese Sachlage in ein anderes Licht gerückt. Das Andenken an das Ghetto Litzmannstadt ist unterrepräsentiert und wird durch jener Art von Gedenken unterdrückt, die die Geschichten der Überlebenden und derjenigen, die Juden das Leben gerettet haben, erzählen, nicht jedoch derer, die ihr Leben verloren haben. Polnische Dokumentarfilme über das Ghetto Litzmannstadt zeichnen sich meist durch gestalterische Schlichtheit und geringe Verbreitung in den Kinos  aus – mit Ausnahme von Likwidacji 08.1944 / Liquidation 08.1944 von Michał Bukojemski und Marcin Miller, dem ersten polnischen Dokumentarfilm in 3D. Wollte man solche Produktionen anhand der besprochenen Thematik klassifizieren, so wären unter den am häufigsten wiederkehrenden Themen folgende zu finden: Das Ghetto, die sog. “Gehsperre”, biografische Filme sowie das Motiv der Rückkehr in das Ghetto nach dem Krieg. Letzteres wird durch die Geschichten tschechischer Überlebender, die nach Łódź zurückkehren, dargestellt, zu finden in Dokumentationen von Borys Lankosz und Pavel Štingl. Bis in die 90er Jahre waren Dokumentarfilme häufig von Erzählungen aus dem Off geprägt, welche das Bild beherrschten. Ab den 1990ern ist der Überlebende selbst als Zeuge und Kommentator in Erscheinung getreten und seine Gegenwart wird mit einer realitätsnahen Darstellungsart aufgezeichnet, die  die Identifikation mit jüdischen Figuren erleichtert. Filmmaterial, das deutsche Teams 1940 im Ghetto aufgenommen haben, taucht in polnischen Dokumentarfilmen nicht auf. Jedoch  werden regelmäßig Fotografien verwendet, die von Walter Genewein, Mandel Gross und Henryk Ross zu Zeiten des Ghettos aufgenommen wurden.

  10. Identyfikacja wielokryterialnego modelu istotności pompowni melioracyjnych na terenie Polski

    OpenAIRE

    Wojciech Sałabun; Michał Napierała; Jerzy Bykowski

    2015-01-01

    Niniejsza praca omawia istotny problem związany z klasyfikacją i właściwym zdefiniowaniem wielkości pompowni melioracyjnych. Podstawowa definicja wielkości jest bardzo szeroka, zatem ze względu na liczbę objaśniających ją parametrów wymaga precyzyjnego uściślenia. W dotychczasowych ocenach rozmiarów pompowni melioracyjnych posługiwano się na ogół wrażeniami osobistymi opartymi na subiektywnym odczuciu, które z kolei jest oparte na nieznanej liczbie parametrów. Pojawiające się przy...

  11. Identyfikacja wielokryterialnego modelu istotności pompowni melioracyjnych na terenie Polski

    Directory of Open Access Journals (Sweden)

    Wojciech Sałabun

    2015-09-01

    Full Text Available Niniejsza praca omawia istotny problem związany z klasyfikacją i właściwym zdefiniowaniem wielkości pompowni melioracyjnych. Podstawowa definicja wielkości jest bardzo szeroka, zatem ze względu na liczbę objaśniających ją parametrów wymaga precyzyjnego uściślenia. W dotychczasowych ocenach rozmiarów pompowni melioracyjnych posługiwano się na ogół wrażeniami osobistymi opartymi na subiektywnym odczuciu, które z kolei jest oparte na nieznanej liczbie parametrów. Pojawiające się przy tym trudności z określeniem przynależności obiektów do danej grupy wielkości wynikały głównie z luk informacyjnych dotyczących właściwej granicy podziału pomiędzy poszczególnymi grupami. W niniejszej pracy, do klasyfikacji i podziału pompowni według ich wielkości zastosowano takie ich parametry jak: moc nominalna pompowni P w kW, wydajność całkowita Q w m3 · s oraz zasięg oddziaływania pompowni Fp w ha, dla 270 losowo wybranych obiektów melioracyjnych w Polsce. Do rozwiązania problemu wykorzystano jedną z wielokryterialnych metod podejmowania decyzji (MCDM, opartą na mechanizmach logiki rozmytej, noszącą nazwę metody obiektów charakterystycznych (COMET.

  12. Język polski na Uniwersytecie Łotewskim w Rydze

    Directory of Open Access Journals (Sweden)

    Renāte Miseviča-Trilliča

    2015-07-01

    Full Text Available The Polish language at the Latvian University in Riga The history of teaching of Polish language in the University of Latvia (LU starts soon after its establishment in 1919. In the 1930s thanks to such famous scientists as Julian Krzyżanowski and Stanisław Kolbuszewski, the number of subjects connected with the Polish culture has increased at the Faculty of Philology and Philosophy and the Latvian society was introduced to the numerous works of these professors, published in different publications in Latvia. After the Second World War, Polish language has been taught within Russian philology with the aim of comparison Eastern and Western Slavic language groups. At the same time scientific works on the state of Polish language of local Poles started to appear. Since the 1990s students of Russian Philology of the LU study Polish language as the foreign language by acquiring not only the structure of it for comparative purposes, but also by acquiring communicative skills. Due to the intensive cooperation with the Polish institutions, exchange programmes and the interest of the students, Polish language as the foreign language occupies a stable place among the courses of Bachelor programme of Russian philology in the LU.

  13. Zavojevanije Moskvõ i polski projekt / Elmo Nüganen ; interv. Boris Tuch

    Index Scriptorium Estoniae

    Nüganen, Elmo, 1962-

    2004-01-01

    28. jaan. esietendus Moskvas Lenkomi teatris Tallinna Linnateatri peanäitejuhi E. Nüganeni lavastuses Y. Jamiaque'i "Härra Amilcar" (pealkirjaga "Kõik on makstud"). Lavastaja räägib oma tööst Moskva Lenkomi teatris ja eelseisvast W. Gombrowiczi näidendi "Laulatus" lavastamisest Poolas Toruni teatris

  14. Kierunki badań nad historią Polski XVI—XVIII w.

    OpenAIRE

    Baranowski, Bohdan

    1988-01-01

    Zadanie pt. „Digitalizacja i udostępnienie w Cyfrowym Repozytorium Uniwersytetu Łódzkiego kolekcji czasopism naukowych wydawanych przez Uniwersytet Łódzki” nr 885/P-DUN/2014 zostało dofinansowane ze środków MNiSW w ramach działalności upowszechniającej naukę.

  15. Kierunki badań nad historią Polski XX w.

    OpenAIRE

    Nartonowicz-Kot, Maria

    1988-01-01

    Zadanie pt. „Digitalizacja i udostępnienie w Cyfrowym Repozytorium Uniwersytetu Łódzkiego kolekcji czasopism naukowych wydawanych przez Uniwersytet Łódzki” nr 885/P-DUN/2014 zostało dofinansowane ze środków MNiSW w ramach działalności upowszechniającej naukę.

  16. Kierunki badań nad historią Polski XIX w.

    OpenAIRE

    Śmiałowski, Józef

    1988-01-01

    Zadanie pt. „Digitalizacja i udostępnienie w Cyfrowym Repozytorium Uniwersytetu Łódzkiego kolekcji czasopism naukowych wydawanych przez Uniwersytet Łódzki” nr 885/P-DUN/2014 zostało dofinansowane ze środków MNiSW w ramach działalności upowszechniającej naukę.

  17. Polskie czasopisma komputerowe. Cz. 3, Magazyny współczesne

    OpenAIRE

    Kolasa, Władysław Marek

    1999-01-01

    [Polish computer magazines. Part 3, Contemporary Magazines] Outline of development of Polish periodicals on science. Part 3, Contemporary Magazines. Attached bibliography - 151 item (journal and magazines).

  18. Polskie biblioteki i problemy polskiego bibliotekarstwa w niemieckim piśmiennictwie fachowym

    Directory of Open Access Journals (Sweden)

    Wolfgang Kessler

    2014-01-01

    Full Text Available Czasopisma bibliotekoznawcze nie odgrywają znaczącej roli w niemieckim bibliotekarstwie, jednak dość wiernie odzwierciedlają najważniejsze zagadnienia współczesnego bibliotekarstwa niemieckiego. Wybór tematów, jakie pojawiają się w ogólnokrajowych czasopismach fachowych, jest bardzo bogaty i wewnętrznie zróżnicowany: budownictwo i technika biblioteczna, katalogowanie, przetwarzanie danych, automatyzacja, szeroki dostęp do wszechstronnej informacji, a obok tego – przyjazne podejście do użytkowników, wszechstronne zaspokajanie ich potrzeb, kształcenie i doskonalenie umiejętności bibliotekarzy. Marginalnie i niesystematycznie ukazują się teksty dotyczące problemów współczesnego bibliotekarstwa zagranicznego, nie wyłączając bibliotekarstwa polskiego. Znajdziemy natomiast w piśmiennictwie niemieckim informacje na temat dziejów polskiej książki i bibliotek, zwłaszcza gdy chodzi o wczesne lata nowożytne. Dla niemieckich germanistów szczególnie interesujące są historyczne księgozbiory niemieckie w Europie Środkowo-Wschodniej.

  19. Uwagi o badaniu minerałów ciężkich w lessach Polski

    Science.gov (United States)

    Racinowski, Roman

    2010-01-01

    Research on loess' heavy minerals had been carried out in Poland since the 30's of the 20th century. The research was intensified in the 2nd half of the 20th century as helpful in answer to the problem relating to loess' genesis and age. Since the size of heavy minerals in loess is grouped in the range of 20-100 μm, therefore their determination was proceeded on grains fraction 0.25-0.01 mm or 0.06-0.01 mm. These days determination is carried out on the material with diameter 0.10-0.06 mm. Heavy minerals dominating in the Polish loess are: garnets, zircon, rutile, the supporting ones are: amphiboles, biotite, epidotes, and tourmalines. Qualitatively similar heavy minerals appear in each loess fraction. However, their percentage fractions are variable in neighbouring profiles and cross-sections. Mineral content allows to draw preliminary conclusions on the source material of loess silts and on transport characteristics, as well as on the course of deposition process. In the case of the Polish loess stored material originates from blown away pre-Quaternary rock-mantle (rich in zircon, rutile, and partly in garnets), Pleistocene lacustrine-flooding muds and glacial tills (rich in amphibole, biotite, epidotes, and garnets). Comparing the spectrum of heavy minerals in the Polish loess one can state that in particular regions neighbouring profiles do not show significant similarity with regard to quantitative content of heavy minerals. Therefore, it is not possible in a universal manner to apply those results to unique lithostratigraphic inference. On the basis of research made on contemporarily developed loess soil levels, as well as appearing there levels of fossil soils, it is not possible to differentiate without any doubt the content of minerals with various resistance to destruction as a result of pedological processes.

  20. Zdeněk Hájek – czeski (morawski) historyk dziejów Polski

    Czech Academy of Sciences Publication Activity Database

    Baron, Roman

    2013-01-01

    Roč. 140, č. 4 (2013), s. 333-347 ISSN 0083-4351 Institutional support: RVO:67985963 Keywords : Czech-Polish Relations * Masaryk University * Czech Historiography * Zdeněk Hájek Subject RIV: AB - History

  1. Skrajnie niskie i wysokie przepływy rzek Polski w dwudziestoleciu 1986-2005

    Science.gov (United States)

    Sobolewski, Wojciech

    2008-01-01

    The objective of this study was to determine the parameters of extreme high and low flows of selected Polish rivers in the two decades 1986-2005. These parameters were used to elaborate river basin characteristics and to perform a series of maps. Subsequently, on the base of maps analysis of spatial diversity of extreme high or extremely low flows of particular rivers was performed. The analysis shows characters of extreme high flow events (in particular their size and progress), which are changing from South to North. It indicates a strong connection between hypsometric parameters of catchment area and infiltration. Different situation can be seen in case of the extremely low flows. The spatial diversity of their properties has not so apparent tendency. In southern and central part of Poland change from SW to NE was observed. However, the northern basins are no longer subject to this rule and form a separate group. Such a distribution of characteristics is probably associated with a stronger impact of other than catchment hypsometry environmental factors.

  2. Polski emigracyjny ruch wydawniczo-księgarski w Lipsku w latach 1830–1918

    Directory of Open Access Journals (Sweden)

    Agnieszka Łukomska-Kryger

    2013-01-01

    Full Text Available This article attempts to summarize and systematize available data on Polish emigre publishing, printing and book trade in Leipzig. The chronological span covers the years 1830–1918, i.e., shortly before the outbreak of the November insurrection, the following years of the emigration of political elites from Poland (the socalled Great Emigration until the times when Poland regained its independence in 1918.

  3. Gestão pública através de mapas estratégicos do Balanced Scorecard: um estudo de caso do Festival Floripa Teatro Isnard Azevedo = Public management through the Balanced Scorecard strategy maps : a case study of The Theatre Floripa Festival Isnard Azevedo

    Directory of Open Access Journals (Sweden)

    Sérgio Murilo Petri

    2014-12-01

    Full Text Available A melhoria na gestão é assunto iminente no Serviço Público, remetendo, aos gestores, a busca por novas formas de gerir, com vistas a atingir o objetivo final do Estado - atender às necessidades da população. A adequação das diretrizes estratégicas com os processos organizacionais permite a identificação, compreensão e coordenação dos processos administrativos de maneira eficiente, proporcionando o cumprimento dos princípios constitucionais da Administração Pública. Com o objetivo de contribuir para esta discussão, o presente artigo propõe a utilização do Mapa Estratégico do Balanced Scorecard para melhoria e aperfeiçoamento da gestão estratégica e orçamentária dos entes públicos. Quanto aos aspectos metodológicos, o estudo apresenta caráter científico, exploratório, com abordagem qualitativa e é classificado como um estudo de caso. Os instrumentos de pesquisa foram: a análise documental; a aplicação de questionário com a direção da Fundação Cultural de Florianópolis Franklin Cascaes (FCFFC e coordenação do Festival Floripa Teatro Isnard Azevedo; e a observação, mediante visitas técnicas à entidade e à 18ª edição do evento, ocorrida em 2011. Ao longo do estudo ficam evidenciadas as vantagens da adaptação do Balanced Scorecard na esfera pública por meio da construção do Mapa Estratégico do festival, permitindo a interação entre as quatro perspectivas - financeira, clientes, processos internos e aprendizado e crescimento e a missão da FCFFC, bem como da percepção do papel da ferramenta como norteador das decisões estratégicas e orçamentárias do evento e da entidade.The improvement in the management issue is imminent in the Public Service, making managers search for new ways of management in order to achieve the ultimate goal of the state – attend on the needs of the population. The adequacy of the strategic guidelines with organizational processes allows the identification, the

  4. Aceitação de sobremesas lácteas dietéticas e formuladas com açúcar: teste afetivo e mapa de preferência interno Acceptability of sweetened and low calorie dairy desserts: affective tests and internal preference mapping

    Directory of Open Access Journals (Sweden)

    Ana Paula Vital de Oliveira

    2004-12-01

    Full Text Available A aceitação de sobremesas lácteas de chocolate (três pudins com açúcar, cinco pudins dietéticos e dois flans comerciais foi avaliada por 56 consumidores utilizando delineamento de blocos completos balanceados e empregando-se uma escala hedônica estruturada de nove pontos. Os provadores foram caracterizados através de um questionário para coleta de informações pessoais e hábitos de consumo de produtos dietéticos e pudins. Os dados de aceitação foram analisados por ANOVA e teste de médias. Empregou-se, também, a metodologia de Mapa de Preferência Interno utilizando diferentes técnicas estatísticas (Análise de Componentes Principais e Escala Multidimensional associadas à Análise de Agrupamentos, para segmentação dos consumidores. Considerando-se as notas médias, observou-se que os pudins dietéticos se destacaram pela boa aceitação. O emprego da técnica de Escala Multidimensional proporcionou uma avaliação mais abrangente do comportamento dos provadores do que a Análise de Componentes Principais, permitindo identificar dois grandes grupos de consumidores: os que preferiam os produtos (pudins e flan de uma determinada marca e os que preferiam os pudins dietéticos. Os resultados demonstram a eficiência do emprego do mapa na identificação e caracterização de preferências e de grupos de consumidores.The acceptance of commercial chocolate dairy desserts (three regular puddings, five dietetic puddings and two regular flans was evaluated by 56 consumers in a balanced-block design, using a nine-point structured hedonic scale. Panelists were characterized using a questionnaire asking for personal information and consumer's behavior towards dietary products and puddings consumption. The acceptance data were analyzed by ANOVA with means comparison and using the technique of Internal Preference Mapping (MDPREF applying different statistical methods (Principal Components Analysis and Muldimensional Scale associated to

  5. Comparação dos algoritmos delineação rápida em cadeia e seriação, para a construção de mapas genéticos Comparison of algorithms rapid chain delineation and seriation, for the construction of genetic linkage maps

    Directory of Open Access Journals (Sweden)

    Marcelo Mollinari

    2008-04-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência, na construção de mapas genéticos, dos algoritmos seriação e delineação rápida em cadeia, além dos critérios para avaliação de ordens: produto mínimo das frações de recombinação adjacentes, soma mínima das frações de recombinação adjacentes e soma máxima dos LOD Scores adjacentes, quando usados com o algoritmo de verificação de erros " ripple" . Foi simulado um mapa com 24 marcadores, posicionados aleatoriamente a distâncias variadas, com média 10 cM. Por meio do método Monte Carlo, foram obtidas 1.000 populações de retrocruzamento e 1.000 populações F2, com 200 indivíduos cada, e diferentes combinações de marcadores dominantes e co-dominantes (100% co-dominantes, 100% dominantes e mistura com 50% co-dominantes e 50% dominantes. Foi, também, simulada a perda de 25, 50 e 75% dos dados. Observou-se que os dois algoritmos avaliados tiveram desempenho semelhante e foram sensíveis à presença de dados perdidos e à presença de marcadores dominantes; esta última dificultou a obtenção de estimativas com boa acurácia, tanto da ordem quanto da distância. Além disso, observou-se que o algoritmo " ripple" geralmente aumenta o número de ordens corretas e pode ser combinado com os critérios soma mínima das frações de recombinação adjacentes e produto mínimo das frações de recombinação adjacentes.The objective of this work was to evaluate the efficiency for the construction of genetic linkage maps of the algorithms seriation and rapid chain delineation, as well as the criteria: product of adjacent recombination fractions, sum of adjacent recombination fractions, and sum of adjacent LOD Scores, used with the ripple algorithm. A genetic linkage map was simulated containing 24 markers with random distances between them, with an average of 10 cM. Using the Monte Carlo method, 1,000 backcross populations and 1,000 F2 populations were simulated. The

  6. Mapa de zonificación de amenazas por inundación del casco urbano del municipio de Quibdó (Chocó. Estudio basado en la interpretación de imágenes de radar, de satélite y fotografías aéreas

    Directory of Open Access Journals (Sweden)

    Zamir Maturana Córdoba

    2007-09-01

    Full Text Available Se elaboró del casco urbano del municipio de Quibdó (Chocó un mapa de zonificación de áreas inundables causadas por las crecientes del río Atrato y sus afluentes (Cabí, caño El Caraño y Quebrada La Yesca, con el objetivo de que sea utilizado por las autoridades de socorro y del municipio de Quibdó como un instrumento de planeación y control. En esta investigación se contó con el apoyo y asesoría del Centro Interamericano de Fotointerpretación, CIAF, adscrito al Instituto Geográfico Agustín Codazzi, quien proporcionó sus instalaciones y el material geográfico empleado. Inicialmente el trabajo se basó en la visualización de zonas inundables a través de interpretación de imágenes de radar (Intera, de satélite (Landsat y fotografías aéreas, todo esto apo-yado por la comprobación en terreno de los datos interpretados. Como información adicional necesaria para el planteamiento de conclusiones en un trabajo como este, se requirió estudiar otras variables como fueron las condiciones climáticas, geológicas, de temperatura, topográficas, series y ocurrencias históricas hidrológicas e hidrográficas en la región. Las imágenes que brindaron mayor confianza por muchas razones, entre las que sobresalieron las escalas, la cantidad y calidad de las mismas y la fecha de toma, fueron las fotografías aéreas. Las de radar (Intera por ser producidas por un sensor activo de rango de las microondas por su esencia de eliminación completa de obstáculos climáticos, fueron también importantes a la hora de analizar visualmente la topografía del sector. Al contrario, las imágenes del satélite (Landsat tuvieron un papel secundario producto del gran porcentaje de nubes que dificultaban cualquier tipo de análisis. Como complemento a los resultados obtenidos, se elaboró con datos multianuales de series históricas de caudales y niveles máximos del río Atrato registrados en la estación hidrográfica Quibdó y con el área de la

  7. LA MUJER INDÍGENA CAMPESINA EN BOLIVIA Y SU OBJETIVO DE IGUALDAD. PROPUESTA DE APLICACIÓN DE UN MAPA ESTRATÉGICO BASADO EN VALORES COOPERATIVOS / THE INDIGENOUS RURAL WOMAN IN BOLIVIA AND THE EQUALITY AIM. A STRATEGIC MAP APPLICATION BASED ON COOPERATIVE VALUES

    Directory of Open Access Journals (Sweden)

    Antonio Manuel CIRUELA LORENZO

    2012-01-01

    Full Text Available Los condicionantes económicos y sociales presentes en el entorno rural de Bolivia han relegado a la mujer a un papel secundario y, en muchas ocasiones, injusto. El movimiento cooperativo y, concretamente su filosofía basada en una serie de valores, se presenta como una alternativa muy viable para cambiar la situación anteriormente comentada y conseguir que la mujer campesina indígena sea considerada en términos de igualdad en los contextos familiares y comunales. Sin embargo, necesitamos para ello una herramienta de aplicación, la cual ha consistido en una adaptación personal e innovadora del tradicional mapa estratégico propuesto por Kaplan y Norton (1992, a través del cual, la interrelación entre los objetivos correspondientes a diferentes perspectivas, contribuyen al alcance de la visión planteada / The present economic and social conditions in rural areas of Bolivia have relegated women to a secondary role and, in many cases, unfair. The cooperative movement, and specifically its philosophy based on a set of values, is presented as a very viable alternative to change the situation discussed above and to make indigenous rural women to be considered in terms of equality in family and community contexts. However, we need to apply a tool, which has consisted of a personal and innovative adaptation of the traditional strategy map proposed by Kaplan and Norton (1992, through which the interrelationships between objectives from different perspectives, contribute the achievement of the outlined vision.

  8. Fatores preditivos de hipertensão gestacional em adolescentes primíparas: análise do pré-natal, da MAPA e da microalbuminúria Predictive factors for pregnancy hypertension in primiparous adolescents: analysis of prenatal care, ABPM and microalbuminuria

    Directory of Open Access Journals (Sweden)

    Regina Coeli Marques de Carvalho

    2006-10-01

    Full Text Available OBJETIVO: Quantificar a prevalência de HG em adolescentes primíparas; definir fatores de preditividade para a ocorrência de HG e sua repercussão nos recém-nascidos. MÉTODOS: Foram acompanhadas 29 adolescentes primíparas durante o pré-natal até a 12ª semana de puerpério, com idade média de dezesseis anos, do ambulatório do Serviço de Adolescentes da Maternidade Escola Assis Chateaubriand (MEAC da Universidade Federal do Ceará (Fortaleza. As gestantes foram dividas em dois grupos; ou seja, nas que permaneceram normotensas (Grupo I e naquelas que desenvolveram hipertensão gestacional -HG - (Grupo II. As variáveis investigadas na avaliação de valor de preditividade no desenvolvimento de HG foram valores antropométricos, aspectos socioeconômicos, o hábito de fumar, a hereditariedade para HAS (pai/mãe, os exames do pré-natal solicitados na primeira consulta do pré-natal e a microalbuminúria e a monitorização ambulatorial da pressão arterial (MAPA na 28ª semana de gestação. As gestantes foram acompanhadas no parto e no puerpério tardio (12ª semana de puerpério. Os recém-nascidos das mães do nosso estudo foram avaliados ao nascer pelos índices de APGAR e de Capurro, peso, estatura e pela presença de hipóxia perinatal. RESULTADOS: A prevalência de HG foi de 51,7% . A hereditariedade para HAS apresentou-se com o maior valor de preditividade para HG com odds ratio de 10,99. A pressão arterial diastólica maior ou igual a 70 mmHg, na idade média gestacional de 35 semanas, apresentou significância estatística como valor de preditividade para HG. Na MAPA encontramos valor de preditividade para HG: carga pressórica diastólica em vigília, carga pressórica sistólica e diastólica no sono noturno, variabilidade pressórica e pressão máxima diastólica no sono. Especificamente a pressão arterial diastólica (PAD máxima na MAPA no período do sono noturno ³64 mmHg apresentou odds ratio de 6 para HG com

  9. Vigilância de doenças endêmicas em áreas urbanas: a interface entre mapas de setores censitários e indicadores de morbidade Surveillance of endemic diseases in urban areas: the interface between census tract maps and morbidity data

    Directory of Open Access Journals (Sweden)

    Ricardo Arraes de Alencar Ximenes

    1999-01-01

    Full Text Available Neste artigo, discute-se o eixo metodológico utilizado na construção de modelo de vigilância de endemias em áreas urbanas, orientado por uma análise de situações de risco e por indicadores epidemiológicos espaciais. São apresentadas as premissas básicas do modelo, os critérios de seleção de variáveis sócio-econômicas e as etapas metodológicas necessárias na construção do indicador sintético de risco. Comenta-se, também, como algumas questões operacionais relativas à construção de mapas digitais de setores censitários e vinculação de bancos de dados foram equacionadas. Essa abordagem, incorporando o componente da organização do espaço na vigilância de doenças endêmicas, tendo como exemplo a hanseníase e a tuberculose, privilegia o uso integrado de sistemas de informação já existentes, na perspectiva de estratificar áreas urbanas diferenciadas que permite discriminar riscos desiguais para ocorrência de endemias. Essa é uma ferramenta para o planejamento e o gerenciamento das ações voltadas para o controle das endemias nas cidades.In this article we discuss the methodological issues associated with the creation of a surveillance system for endemic diseases in urban areas based on analysis of populations at risk and on spatially referenced epidemiological indicators. We comment on the system's basic requirements, selection criteria for socioeconomic variables, and methodological steps to combine these variables so as to construct a census-based deprivation index. We also present the ways we solved some operational problems related to generation of digitized census tracts maps and linkage of morbidity data from different sources. This approach, spatial organization into account in surveillance of endemic diseases, exemplified here by tuberculosis and leprosy, allows for the interaction of several official data sets from census and health services in order to geographically discriminate inner-city risk

  10. O Mapa das Cortes: perspectivas cartográficas

    Directory of Open Access Journals (Sweden)

    Jorge Pimentel Cintra

    2009-01-01

    Full Text Available In this paper, we present a thorough analysis of the Map of the Courts based on criteria used in cartography, particularly mathematical cartography. As such, it takes into account the following elements: author, scale, projection, the prime meridian, colors, conventions, symbology, and other. After a qualitative morphological analysis, we move on to a quantitative examination by comparing the said map with a quite accurate present-day chart, using a digital cartography software application and spreadsheet to match the geographic coordinates (latitude and longitude of over 430 points. The systematic and detailed quantification of errors in various areas, from the Atlantic coast to the Amazon region, revealed surprising aspects as to how skillfully the Map of the Courts was constructed. This analysis enabled us to quantify the distortions more accurately and thus identify the locations where they were introduced as well their unquestionable intentional character.

  11. Historia del Desarrollo del Mapa de la Mente

    Directory of Open Access Journals (Sweden)

    Jorge González Hernández

    2007-08-01

    Full Text Available Aunque el desarrollo de la neurología y psicología se remonta cientos de años, la investigación en neurociencias a gran escala es un logro del siglo XX. En estos últimos 100 años, se ha generado gran parte del cuerpo de conocimientos que sustenta nuestra visión general del sistema nervioso. Numerosas características bioquímicas, fisiológicas, farmacológicas y estructurales del cerebro han sido descritas, primero en invertebrados y luego en vertebrados. En los últimos años, esfuerzos importantes han sido destinados también a definir las bases de las funciones de percepción, emoción, memoria, atención y cognición. Por último, tanto los métodos experimentales como la observación de individuos (a menudo pacientes con lesiones definidas nos han permitido asociar ciertas funciones a regiones neuroanatómicas específicas. Como resultado, hoy tenemos un campo de estudio del cerebro y las ciencias cognitivas (mente tan bullente en información como en incógnitas de compleja solución. El misterio de la relación mente/cerebro es un viaje apasionante a través de un laberinto de información, hipótesis y teorías, que captura tanto al estudioso de la biología como al matemático o al filósofo. De hecho, solo parece razonable enfrentar tamaña tarea desde las trincheras de la interdisciplinariedad, dada la multiplicidad de los componentes y su naturaleza que solo emerge desde un todo coherente.

  12. Mapa do Conhecimento em Nanotecnologia no Setor Agroalimentar.

    Directory of Open Access Journals (Sweden)

    Sibelly Resch

    2015-06-01

    Full Text Available A nanotecnologia é considerada por muitos autores como a base para a próxima revolução industrial. O prefixo “nano” equivale a 10-9m. A manipulação na escala nanométrica pode modificar propriedades como cor, condutividade, reatividade, ponto de fusão, entre outras, criando novas aplicações para os materiais. É considera como uma ciência multidisciplinar com aplicações em distintos setores, tais como física, química, biologia, materiais, informação, entre outros. No Brasil, as políticas de apoio às nanotecnologias iniciaram em 2001 e a partir de 2007, a nanotecnologia foi identificada como área estratégica para o governo brasileiro por seu potencial de inovação, crescimento de mercado e benefícios associados à sua utilização. O setor agroalimentar, objeto desse estudo, é uma das áreas que pode se beneficiar com a utilização das nanotecnologias. Considerando a importância do setor para a economia brasileira, esse trabalho tem como objetivo identificar e descrever as pesquisas que envolvem a nanotecnologia no setor agroalimentar. Para isso, realizou-se uma aplicação com o software VOSviewer a partir de trabalhos publicados na base SCOPUS. Para identificar como as pesquisas evoluíram ao longo do tempo, dividiu-se a busca em três períodos: 2001-2005; 2006-2009; 2010-2013. Os resultados apontam quatro tendências: a uso dos biosensores, especialmente para detecção de contaminação; b uso de embalagens ativas, biodegradáveis e indicadoras de deterioração ou contaminação; c encapsulamento para entrega de nutrientes; e d riscos e benefícios, marcos regulatórios. Os resultados podem subsidiar a elaboração de políticas de apoio e fomento à nanotecnologia para o setor agroalimentar bem como sugerem temas de pesquisa para identificação do estágio atual dessas tecnologias no Brasil. A prospecção realizada também contribui para a identificação de oportunidades de negócios para os empresários brasileiros.

  13. Historical rock collection of the Commission for the Geological Map of Spainpreserved in the Madrid School of Civil Engineering; La colección histórica de rocas de la Comisión del Mapa Geológico de España conservada en la Escuela Especial de Ingenieros de Caminos de Madrid

    Energy Technology Data Exchange (ETDEWEB)

    Sanz Pérez, E.; Pérez Ruy-Díaz, J.A.; Menéndez-Pidal de Navascués, I.; Sanz Ojeda, P.; Pascual-Arribas, C.

    2017-09-01

    The collection of 200 rocks prepared by the Commission for the Geological Map of Spain for the Madrid School of Civil Engineering, without known author and dated between 1898 and 1907, is one of the collections sent by the Commission to meet the specific needs of engineering institutes, and in which have survived 200 explanatory index cards accompanying each of the specimens. The collection is national in scope and is designed with a clear teaching purpose focused on civil engineering students. Its main feature is to teach the historical geology of Spain summarized in a collection of representative rocks from the Spanish territory classified by geological periods. So that, by knowing the most common rocks that appear in the synthetic stratigraphic column of Spain, this could provide for uses for coeval type of rocks, such as building materials or as foundations. Petrologic classifications and the division of geological periods are used according to these times. The index cards, where many observations about uses of civil engineering rocks are made, endeavor to identify rocks as samples with one’s own eyes and at scale of outcrop in the field, within the regional stratigraphic context. [Spanish] La colección de 200 rocas preparada por la Comisión del Mapa Geológico de España para la Escuela Especial de Ingenieros de Caminos de Madrid, sin autor conocido y datada entre 1898 y 1907, constituye una de las colecciones enviadas por dicha comisión para atender las necesidades concretas de centros oficiales de enseñanza, y en la que se han conservado las 200 fichas explicativas que acompañaban a cada uno de los ejemplares. La colección es de ámbito nacional y ha sido diseñada con una finalidad docente claramente enfocada hacia los alumnos de ingeniería civil. Su principal característica es enseñar la geología histórica de España resumida en una colección de rocas representativas del territorio español clasificadas por periodos geológicos, de tal manera

  14. Eficacia de la utilización de estilos de aprendizaje en conjunto con mapas conceptuales y aprendizaje basado en la resolución de problemas para el aprendizaje de neuroanatomía Effectiveness of using learning styles in conjunction with conceptual maps based learning and problem solving for teaching neuroanatomy

    Directory of Open Access Journals (Sweden)

    J.O. Ayala-Pimentel

    2009-03-01

    Full Text Available Introducción. La utilización combinada de estilos de aprendizaje en conjunto con mapas conceptuales y el empleo de aprendizaje basado en la resolución de problemas (EMCRP es una nueva estrategia educativa. Objetivo. Evaluar la eficacia de la utilización del método EMCRP en la adquisición de aprendizaje significativo de neuroanatomía, comparado con el método usual de aprendizaje en estudiantes de fisioterapia, que cursaron la asignatura morfofisiología general en la Universidad Industrial de Santander (UIS entre los años 2004 y 2007. Sujetos y métodos. Se utilizó un diseño experimental con participantes aleatorizados asignados a dos grupos con una relación 1 a 1. En el grupo intervenido se empleó el método EMCRP y en el control el método tradicional de enseñanza. Después de un año se evaluó la adquisición de aprendizaje significativo para determinar el rendimiento del método EMCRP. Resultados. Se estudiaron 55 estudiantes. La edad media fue de 23 años y la razón mujer-hombre fue de 3 a 1. Al evaluar a los estudiantes después de un año de la intervención, 15 del grupo intervenido reprobaron el examen frente a 26 del grupo control (55 frente a 92%; p = 0,002. Se determinó una reducción del riesgo absoluto de 0,37 (intervalo de confianza al 95% = 0,16-0,56 y número necesario para tratar de 2,7 (intervalo de confianza al 95% = 1,7-6,3. Conclusión. La adquisición de un aprendizaje significativo fue mayor en el grupo intervenido, evidenciado por una menor proporción de suspendidos importante en comparación con el grupo control, con un número de estudiantes bajo a intervenir para que se produzcan resultados favorables.Introduction. The use of learning styles combined with concept maps and the use of learning based on the resolution of problems (LSCMLRP are a new educational strategy. Aim. To evaluate the effectiveness of the method LSCMLRP in the acquisition of significant learning of neuroanatomy, compared with the

  15. Eficacia del Orbscan II y Pentacam en la evaluación de los mapas de elevación en candidatos a cirugía refractiva mediante un análisis de repetibilidad Efficacy of Orbscan II® and Pentacam® topographers by a repeatability analysis when assessing elevation maps in candidates to refractive surgery

    Directory of Open Access Journals (Sweden)

    Claudia Blanco

    2009-09-01

    Full Text Available

    Introducción. La elevación posterior es una de las medidas usadas para detectar pacientes con sospecha de queratocono.
    Objetivo. Determinar la eficacia del Orbscan II y Pentacam en la evaluación de los mapas de elevación.
    Materiales y métodos. Se evaluaron 68 ojos con Orbscan II y Pentacam. Con parámetros del British Standard Institution, se midieron el coeficiente de repetibilidad mediante un análisis de concordancia con el método de Bland-Altman y el coeficiente de correlación de concordancia de Lin. Se midió la concordancia entre ambos equipos.

    Resultados. El coeficiente de repetibilidad del punto de máxima elevación anterior en Orbscan fue de 68,29% y de 24,20% en Pentacam. El coeficiente de correlación de concordancia fue de 0,64 (IC95% 0,48-0,76 en Orbscan y en Pentacam fue de 0,94 (IC95% 0,91-0,96. El coeficiente de repetibilidad del punto de máxima elevación posterior en Orbscan fue de 38,69% y en Pentacam fue 68,03%. El coeficiente de correlación de concordancia en Orbscan fue de 0,69 (IC95% 0,55-0,80 con una precisión de 0,71 y una exactitud de 0,97, y en Pentacam fue de 0,24 (IC95% 0,00-0,45 con una precisión de 0,24 y una exactitud de 0,99.

    Conclusiones. La eficacia de Orbscan II y Pentacam en la evaluación del punto de máxima elevación posterior resulta afectada por la imprecisión de la medida y es peor en el Pentacam. Este error aleatorio se puede manejar usando la media de tres mediciones y nos orienta a la búsqueda de equipos en los que el error relativo absoluto sea el menor posible en todas las medidas que ofrezca.

    Introduction: Anterior and posterior corneal elevations are measurements used to detect keratoconus suspects.
    Purpose: To determine the efficacy of Orbscan II® and Pentacam® when assessing their elevation maps.
    Materials and methods: The efficacy of the Orbscan II and Pentacam measuring the anterior and posterior corneal elevations were evaluated in a

  16. International conference, future of coal in the economy of the world and Poland; Miedzynarodowa konferencja. Przyszlosc wegla w gospodarce swiata i Polski Miedzynarodowa konferencja. Przyszlosc wegla w gospodarce swiata i Polski

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    The conference was held in three sessions entitled: coal as an important element of sustained development of the world energy development; problems of hard and brown coal mining development; and hard and brown coal reserves, their utilization and environmental protection. A total of seventeen papers were presented and are contained in the proceedings. Each has been abstracted separately for the Coal Abstracts database.

  17. Transatlantyckie związki Polski i Czech w systemie bezpieczeństwa Europy Środkowej

    Directory of Open Access Journals (Sweden)

    Natalia Kryvoruchko

    2017-12-01

    Full Text Available The safety of Central European countries after the “cold war” was considered an essential part of the Transatlantic security system. The Polish and Czech accession to NATO (1999 and EU integration (2004 became the fundament of strong relations between them and the USA on the strategic level. Despite the asymmetry of military potential, for both states the cooperation with Washington was an integral element of security and defense strategy. This states that the alliance with the global leader helps to strengthen the position of regional powers (such as Poland and small states (like the Czech Republic in the region (Central Europe. The article provides an overview and assesses the security aspects of Central Europe in the context of relations of this region with the United States – the global leader. In addition to that, the thesis elucidates the impact that cooperation with the USA had on the transformation of the security systems of both states.

  18. Kilka uwag o różnicach kulturowych w komunikacji medialnej na przykładzie Polski i Czech

    Directory of Open Access Journals (Sweden)

    Renata Rusin Dybalska

    2012-01-01

    Full Text Available This article aims to reconstruct and compare certain aspects of two reflections of the world that appear in the Polish and Czech mass media. This reflection will be limited to some religious aspects. The analysis is based on selected items of press news from Polish and Czech newspapers. They are divided into two parts. The first shows how cultural differences influence the way of giving and creating the same information. The second concentrates on various ways in which the themes analysed are presented by the media in both countries.

  19. Materials of conference: Hydrogeological Problems of South-West Poland; Materialy konferencji: Problemy Hydrogeologiczne Poludniowo-Zachodniej Polski

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-12-31

    Hydrogeological problems of South-west Poland is the collection of conference papers held in Szklarska Poreba on 20-22 June 1996. The materials have been gathered in three topical groups: water quality problems in hydrological cycle, regional hydrogeology of South-west Poland, theoretical problems and research methods in hydrogeology. More of performed articles have a interdisciplinary character taking into account the precipitation and surface water quality and their influence on ground water features.

  20. Comparativo entre certificadoras de rastreabilidade credenciadas para o SISBOV-MAPA A comparative among certificators of traceability credenced by SISBOV-MAPA

    Directory of Open Access Journals (Sweden)

    Francisco Juraci Rolim

    2005-10-01

    Full Text Available Com este trabalho avaliou-se o que está sendo oferecido pelas empresas operadoras de rastreabilidade credenciadas pelo Ministério da Agricultura, Pecuária e Abastecimento. A pesquisa foi dividida em duas etapas distintas, a primeira consistiu em avaliar a forma como a empresa se apresenta na Internet, considerando os seguintes quesitos: Tempo de Carga, Aparência, Estrutura e Navegação, Usabilidade, Conteúdo e Específicas para a Pesquisa. A segunda etapa, consistiu em submeter as duas empresas que obtiveram os melhores desempenhos no Questionário de Avaliação de Web Site (primeira etapa a uma avaliação do Software por elas utilizados para fazer a certificação. Tal avaliação verificou se o software é de fácil operação, se os relatórios fornecidos são claros e eficientes, se a documentação é suficiente para o usuário, se constam as formas de suporte oferecido ao usuário e se o software permite comunicação com outros equipamentos.The purpose of this work was to realize an evaluation of what has been offered in terms of performing services by the operating companies of traceability credenced by the Agriculture Ministery, Pecuary and Supplying. The research was divided into two different parts where the first one consisted of making an evaluation of the way that the company appears on the Internet, considering the following aspects: Time of Load, Appearance, Structure, Navigation, Usability, Content and Specifics for the Research. The second one consisted in submitting the two companies that got the best performance in the evaluation questionnaire of Web Site (the first stage in an evaluation of the Software used by them in order to make a certification. Such evaluation consisted of checking if it is easy to operate the Software, if the supplied reports are clear and efficient, if the documentation is sufficient for the user, if the ways of support offered to the user are mentioned and if the software permits communication with other equipment.

  1. Solar Radiation Maps derived from Geostationary Satellites: Maps of Spain; Generacion de Mapas de Radiacion Solar a partir de Satelites Geoestacionarios: Mapas de Espana

    Energy Technology Data Exchange (ETDEWEB)

    Polo, J.

    2012-09-19

    A study on the comparison and evaluation of 4 miniaturized extraction methods for the determination of selected PAHs in clear waters is presented. Four types of liquid-liquid extraction were used for chromatographic analysis by HPLC/ FD. The main objective was the optimization and development of simple, rapid and low cost methods, minimizing the use of extracting solvent volume. The work also includes a study on the scope of the methods developed at low and high levels of concentration. (Author) 26 refs.

  2. Análisis de mapas causales de impactos del turismo residencial

    Directory of Open Access Journals (Sweden)

    ANTONIO ALEDO

    2010-01-01

    El caso de estudio es el municipio de Dénia, situado en el norte de la provincia de Alicante. Los resultados muestran que las causas profundas de los impactos negativos inducidos por el turismo residencial están conectados con el déficit democrático en el proceso de gestión municipal del desarrollo turístico-residencial.

  3. Mapas imaginários sobre Porto Alegre: a cidade midiática

    Directory of Open Access Journals (Sweden)

    Nilda Jacks

    2010-12-01

    Full Text Available Entre julho e agosto de 2007, os principais meios de comunicação de Porto Alegre foram observados por uma equipe de professores e alunos da Faculdade de Biblioteconomia e Comunicação da Universidade Federal do Rio Grande do Sul (UFRGS para identificar que cidade eles ajudam a construir no imaginário do cidadão. Esta pesquisa faz parte de uma mais ampla para conhecer os imaginários urbanos da América Latina, com extensão a algumas urbes européias. Seguindo a metodologia de Silva, a pesquisa foi divida em três eixos que se entrecruzam: dados oficiais e históricos sobre o município, enquete para verificar as percepções dos cidadãos sobre a cidade e análise das representações construídas pelos diferentes meios de comunicação, este último é foco deste texto.

  4. Acid Deposition Maps in Spain; Mapas de Deposito Acido en Espana

    Energy Technology Data Exchange (ETDEWEB)

    Artinano, B; Cabal, H; Garcia, C

    1998-07-01

    Animal and monthly deposition velocity and total sulfur deposition maps have been performed for the peninsular Spain for 1992 by using the inferential method. To do this, updated databases with high space and time resolution, for land uses (CORINE) and meteorological information from analysis modelling for the same year, have been utilized. The final result are deposition maps in a 5x5 Km{sup 2} grid which allow to assess the methodology used in Europe to obtain the maps of excedances over the critical loads of pollutants. (Author) 32 refs.

  5. MAPA DE LOS TIPOS DEL PAISAJE NATURAL DE POLONIA A ESCALA 1:500.000

    Directory of Open Access Journals (Sweden)

    Andrzej Richling

    1988-12-01

    Full Text Available La noción del paisaje se viene usando por varias ramas de la ciencia. Se utiliza en bilogía y geografía, pero también en arquitectura y muchas disciplinas cinetíficas más. Es un término de múltiples acepciones. No obstante su significado definido en el lenguaje de la ciencia, el término de paisaje está presente en el idioma cotidiano como sinónimo de una vista o un panorama.

  6. Functional magnetic resonance maps obtained by personal computer; Mapas de resonancia magnetica funcional obtenidos con PC

    Energy Technology Data Exchange (ETDEWEB)

    Gomez, F. j.; Manjon, J. V.; Robles, M. [Universidad Politecnica de Valencia (Spain); Marti-Bonmati, L.; Dosda, R. [Cinica Quiron. Valencia (Spain); Molla, E. [Universidad de Valencia (Spain)

    2001-07-01

    Functional magnetic resonance (fMR) is of special relevance in the analysis of certain types of brain activation. The present report describes the development of a simple software program for use with personal computers (PCs) that analyzes these images and provides functional activation maps. Activation maps are based on the temporal differences in oxyhemoglobin in tomographic images. To detect these differences, intensities registered repeatedly during brain control and activation are compared. The experiments were performed with a 1.5-Tesla MR unit. To verify the reliability of the program fMR studies were carried out in 4 healthy individuals (12 contiguous slices, 80 images per slice every 3.1 seconds for a total of 960 images). All the images were transferred to a PC and were processed pixel by pixel within each sequence to obtain an intensity/time curve. The statistical study of the results (Student's test and cross correlation analysis) made it possible to establish the activation of each pixel. The images were prepared using spatial filtering, temporal filtering, baseline correction, normalization and segmentation of the parenchyma. The postprocessing of the results involved the elimination of single pixels, superposition of an anatomical image of greater spatial resolution and anti-aliasing. The application (Xfun 1.0, Valencia, Spain) was developed in Microsoft Visual C++5.0 Developer Studio for Windows NT Workstation. As a representative example, the program took 8.2 seconds to calculate and present the results of the entire study (12 functional maps). In the motor and visual activation experiments, the activation corresponding to regions proximal to the central sulcus of the hemisphere contralateral to the hand that moved and in the occipital cortex were observed. While programs that calculate activation maps are available, the development of software for PCs running Microsoft Windows ensures several key features for its use on a daily basis: it is easy to employ and has powerful computing capabilities. The program described here is capable of differentiating between the regions of the brain that are activated in response to a stimulus and those that remain unaltered. (Author) 19 refs.

  7. Desarrollo de conocimiento geométrico euclidiano y uso de mapas

    Directory of Open Access Journals (Sweden)

    Silvana Cortés Arboleda

    2013-12-01

    Full Text Available We run an experiment in order to examine 60 Colombian children’s performance on a task that evaluates the use of ‘pure’ geometric maps for locating objects in a 3D space; the task was adapted from Spelke, Gilmore & McCarthy (2011. The experiment aimed to investigate whether or not the children were able to use geometric maps depicted in 2D as representations of real 3D spaces. The experiment also aimed to explore possible changes in the sensitivity to and the use of the Euclidean geometric properties represented on the maps –length, angle and direction-, among three groups of age: four, six and eight-year olds. We aimed at establishing whether there are intergroup differences in the way the three age groups use the three Euclidian properties to locate objects in space, and whether there are differences within the properties. Findings indicated an effect of the age on the children’s performance; the sensitivity to the three properties showed a statistically significant change between the four and the six-year old. Although sensitivity to properties was improved between the six and the eight-year old, we did not find significant changes between these groups of age. We did not find an effect of the type of property on the performance; neither an interaction of property by age. Findings also indicated within-group changes for each property: For the four year-old children the sensitivity to the length was influenced by the condition ‘equal’ or ‘unequal’, the sensitivity to the angle changed depending on the condition ‘acute’, ‘obtuse’ or rectangle’, and being sensitive to the ‘above-below’ sense was significantly different that being sensitive to the ‘left-right’ sense. We established distinctions with previous findings and outlined some implications for education.

  8. Mapas conceptuales y aprendizaje cooperativo. Experiencias en la enseñanza del Derecho

    OpenAIRE

    Cobas Cobiella, María Elena; Montes Rodríguez, María Pilar; Alventosa del Río, Josefina; Guillén Catalán, Raquel; Ortega Giménez, Alfonso; Meco Tébar, Fabiola; Chaparro Matamoros, Pedro; Valero Llorca, Javier; Company Alcañiz, Mireia; Cano Donate, Asunción

    2014-01-01

    En la elaboración de este libro también participaron los siguientes estudiantes: Carlota Ramírez Pérez / Jose Gil García / Jose Manuel Aznar Cerdán / Teresa Pérez Huertas / Jorge Alarcón Fernández / Rodrigo Climent Pedrosa / Clara Beltrán Segarra / José Luis Mayordomo Lledó / Carlos Mingote Hernández / Miguel Castillo Ortega / Juan Martínez Leal / Daniel Martínez Rojano / Rocío Grondona Vives / Rubén Pons Solanes / Álvar Garay Pingarrón / Ioana Alexandra Neacsu / Carlos Lerma Poveda / Begoña ...

  9. SISTEMA ESPECIALISTA PARA GERAÇÃO DE MAPAS TEMÁTICOS

    Directory of Open Access Journals (Sweden)

    Claudia Robbi Sluter

    2001-12-01

    Full Text Available This paper presents a prototype of the thematic mapping module of a software system for Municipal Master Plan design. Because this system is designed for permitting urban planners, system's users, to develop every task in a Municipal Master Plan, the users can produce thematic maps. Since the users are not cartographers and, consequently, may not know the fundamentals of map design, the system has to provide them with tools for making maps in accordance with the principles of thematic map design. Providing users with these kind of tools demands that a level of knowledge about map design be embedded in the software. A level of knowledge means to automate some of the thematic mapping decisions. Then, the thematic mapping module has characteristics of an expert system. The level of knowledge was accomplished by interfaces design and conceptual model, and it was implemented in the module prototype. The system development was based on software engineering concepts, and object oriented methodology. The results of the interfaces design and the prototype implementation for the thematic mapping module are described in this paper. The prototype was implemented using Visual C++ software in a PC environment, with a configuration of Pentium 200MHz, 32 MB RAM and 2,1 GB hard disk.

  10. REALISMO E TRANSCENDÊNCIA: O MAPA DAS MINAS DO GRANDE SERTAO

    Directory of Open Access Journals (Sweden)

    Francis Utéza

    1998-10-01

    Full Text Available Guimarães Rosa insistiu sempre sobre o valor metafísico e religioso de seus escritos. Com base nas chaves que Rosa daria no seu discursode posse na Academia - o Hermetismo da tradição ocidental e o Taoísmo da tradição oriemal, pretende-se analisar o percurso do protagonista de Grande sertão: veredas em função dos três grandes rios de Minas: o São Francisco, o Rio das Velhas e Urucuia. Para além da geografia"realista", decripta-se o substrato transcendental.

  11. Acid Deposition Maps in Spain; Mapas de Deposito Acido en Espana

    Energy Technology Data Exchange (ETDEWEB)

    Artinano, B.; Cabal, H.; Garcia, C. [CIEMAT. Madrid (Spain)

    1998-12-31

    Annual and monthly deposition velocity and total sulfur deposition maps have been performed for the peninsular Spain for 1992 by using the inferential method. To de this, updated database with high space and time resolution, for land uses (CORINE) and meteorological information from analysis modelling for the same year, have been utilized. The final result are deposition maps in a 5 x 5 km``2 grid which allow to assess the methodology used in Europe to obtain the maps of excedance over the critical loads of pollutants. (Author) 32 refs.

  12. LOD map--A visual interface for navigating multiresolution volume visualization.

    Science.gov (United States)

    Wang, Chaoli; Shen, Han-Wei

    2006-01-01

    In multiresolution volume visualization, a visual representation of level-of-detail (LOD) quality is important for us to examine, compare, and validate different LOD selection algorithms. While traditional methods rely on ultimate images for quality measurement, we introduce the LOD map--an alternative representation of LOD quality and a visual interface for navigating multiresolution data exploration. Our measure for LOD quality is based on the formulation of entropy from information theory. The measure takes into account the distortion and contribution of multiresolution data blocks. A LOD map is generated through the mapping of key LOD ingredients to a treemap representation. The ordered treemap layout is used for relative stable update of the LOD map when the view or LOD changes. This visual interface not only indicates the quality of LODs in an intuitive way, but also provides immediate suggestions for possible LOD improvement through visually-striking features. It also allows us to compare different views and perform rendering budget control. A set of interactive techniques is proposed to make the LOD adjustment a simple and easy task. We demonstrate the effectiveness and efficiency of our approach on large scientific and medical data sets.

  13. Environmental sensibility maps of pipelines rows; Mapas de sensibilidade ambiental para faixas de dutos terrestres

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Wilson J. de [PETROBRAS Engenharia, Rio de Janeiro, RJ (Brazil). Engenharia de Avaliacao Ambiental IEGEN/EGE/EAMB; Ferreira Filho, Aluisio Teles; Ferreira, Vanderlei Cardoso [TRANSPETRO - PETROBRAS Transporte S.A., Rio de Janeiro, RJ (Brazil). SMS - Seguranca, Meio Ambiente e Saude; Braun, Oscar P.G.; Pereira, Junior, Edson Rodrigues [Geodatum, Rio de Janeiro, RJ (Brazil)

    2003-07-01

    To subsidize its contingency plans for oil leaks, TRANSPETRO, subsidiary of PETROBRAS, set up an internal program with a big extension to obtain Environmental Sensibility Maps over a strip of twenty kilometers of width along more than five thousand kilometers of pipelines. Due to the pioneer characteristic of these natural survey (thematic cartography) it was opted a first approach for integration of this information in 1:50.000 scale. Based on a Geographical Information System (GIS), it was opted the supervised geo processing resources, compiling, firstly, the elevation, soil and geological maps for generation of the physical environment vulnerability units. Using a combination by weight average, ten vulnerability units were generated and were improved through aggregation in five units to decrease the complexity of the representation in map. These classes represent the combinations of variables of the physical environment that can be recognized by theirs corresponding landscapes. Based on interpretation of orbital LANDSAT TM images, aided by verifications in aerial photograph and a systematic survey of notable points of environmental observation (PVAs) along the pipelines, it was elaborated a general map of soil use and vegetable coverage. The classes of this theme were combined with the classes of physical vulnerability environment to generate five classes of Environmental Sensibility (Environmental Sensibility Maps). Over this theme, were attributed the representations of the main types of vegetable coverage and occupation of the soil, as well as the fauna and the other social-economics aspects, obtaining therefore a map with all the essential controller information of the environmental protection measures. (author)

  14. Desigualdades de género: esbozo por un mapa proteórico

    Directory of Open Access Journals (Sweden)

    Manuel Carlos Silva

    2008-12-01

    factores: recursos y recompensas, participación en el proceso productivo, presencia de un ordenamiento jerárquico de los roles sexuales en la division del trabajo, lugar ocupado en la organización/institución, lugar en la reproducción de la esfera familiar y en las interacciones y negociaciones de papeles. Despite the relative advance, in legal and political terms, of the defence of egalitarian principles within the relation between men and women, recent (international studies confirm the persisting social borders and inequalities of gender in many contexts (work, daily interactions, values and symbolic regulations, institutional frames. In this paper, after a revisitation, in a synthetic and critical way, of some theoretical paradigms that look to explain these inequalities (vg socio-biological, psychological conceptions, the structural-functional, the Marxist model, the neo-Weberian we propose an articulation between the concepts of gender and class. This implies a convergence of the Marxist model with the feminist one and, indirectly, a fruitful crossing between (neoMarxism and Weberianism, being this one also articulated with symbolic interactionism. This is followed by a brief historical retrospective and correlative deconstruction of the essentialist, reifying and legitimating forms of the statu quo. Finally, with a brief illustration of some of the gender inequalities in Portugal, we outline a hypothesis that states that, beyond the inherent interests to the mechanisms of macro-economic and institutional domination, the control of the feminine labour force and subsequent phenomena of labour segregation and wage discrimination are whether reproduced or countered at different levels: socio-structural, organizational/institutional and interactive. At the micro and meso-social levels, the power of the woman differs in function of variable factors such as: available resources and rewards; participation in the productive process; presence of an hierarchical ranking of sexual roles in the division of labour; place occupied in the organization of the corporation or institution; place in the (reproductive sphere of the family unit; place in the interactions and negotiations of roles.

  15. MAPA distinguishes genotype-specific variability of highly similar regulatory protein isoforms in potato tuber.

    Science.gov (United States)

    Hoehenwarter, Wolfgang; Larhlimi, Abdelhalim; Hummel, Jan; Egelhofer, Volker; Selbig, Joachim; van Dongen, Joost T; Wienkoop, Stefanie; Weckwerth, Wolfram

    2011-07-01

    Mass Accuracy Precursor Alignment is a fast and flexible method for comparative proteome analysis that allows the comparison of unprecedented numbers of shotgun proteomics analyses on a personal computer in a matter of hours. We compared 183 LC-MS analyses and more than 2 million MS/MS spectra and could define and separate the proteomic phenotypes of field grown tubers of 12 tetraploid cultivars of the crop plant Solanum tuberosum. Protein isoforms of patatin as well as other major gene families such as lipoxygenase and cysteine protease inhibitor that regulate tuber development were found to be the primary source of variability between the cultivars. This suggests that differentially expressed protein isoforms modulate genotype specific tuber development and the plant phenotype. We properly assigned the measured abundance of tryptic peptides to different protein isoforms that share extensive stretches of primary structure and thus inferred their abundance. Peptides unique to different protein isoforms were used to classify the remaining peptides assigned to the entire subset of isoforms based on a common abundance profile using multivariate statistical procedures. We identified nearly 4000 proteins which we used for quantitative functional annotation making this the most extensive study of the tuber proteome to date.

  16. Farnost Odolena Voda roku 1736. Obrazová mapa jako zástupný symbol

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Robert

    2017-01-01

    Roč. 35, č. 1 (2017), s. 10-34 ISSN 0862-2043 R&D Projects: GA ČR(CZ) GBP410/12/G113 Institutional support: RVO:67985963 Keywords : Odolena Voda * Kuben Jan * church * symbol * baroque era Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  17. Trzy powieści – trzy odmienne spojrzenia autorów górnołużyckich na sprawy polskie

    Czech Academy of Sciences Publication Activity Database

    Derlatka, Tomasz

    2014-01-01

    Roč. 13, č. 1 (2014), s. 24-57 ISSN 1643-1391 Institutional support: RVO:68378017 Keywords : Upper Sorbian Novel * Polish issues * Völke, P. * Brězan, J. * Nawka, A. Subject RIV: AJ - Letters, Mass-media, Audiovision

  18. Władze polskie wobec problemu roszczeń finansowych w stosunkach z Włochami w latach 1945–1956

    OpenAIRE

    Jarosz, Dariusz; Pasztor, Maria

    2013-01-01

    The sketch is an attempt to present the main financial problems in the Polish-Italian relations from 1945 to 1956. It is based primarily on sources stored in Central Archives of Modern Records and Archives of the Ministry of Foreign Affairs in Warsaw. The study showed that the main purpose of the Polish authorities was to avoid having to pay the pre-war debts to Italy, and compensation resulting from the adoption of the law on nationalization of industry, from 3 January 1946. F...

  19. Family stories with a moral: Polish scripted television documentaries [Rodzinne opowieści z morałem: polskie telewizyjne seriale paradokumentalne

    Directory of Open Access Journals (Sweden)

    Jacek GULANOWSKI

    2017-11-01

    Full Text Available Scripted documentaries are a specific kind of television productions: they are low budget television series resembling documentaries, usually starring amateur actors, who are playing allegedly real characters, and the portrayed events are real life stories. They are gaining wide appreciation, especially among television producers, due to their low costs of production. The most popular theme of these stories are problems connected with family life. The content of these stories is filled with internal contradictions and it is actually a homage to the human vitality and its justification

  20. ANALIZA ZMIAN MIKROSTRUKTURY ZAPRAW W MURACH Z CEGŁY KLINKIEROWEJ PO DŁUGOTRWAŁEJ EKSPOZYCJI NA POLSKIE WARUNKI KLIMATYCZNE

    Directory of Open Access Journals (Sweden)

    Maria WESOŁOWSKA

    2016-07-01

    Full Text Available Mury licowe podlegają ciągłym wpływom czynników pochodzących z otaczającego środowiska. Oddziaływania te  przyczyniają się do destrukcji materiału, obniżając ich trwałość użytkową. Zaprawy należą do grupy materiałów aktywnych chemicznie, podlegającym korozji zewnętrznej i wewnętrznej. Do korozji zewnętrznej zalicza się wszystkie te przypadki, w których zaprawa narażona jest na niekorzystne czynniki zewnętrzne (gazowy CO2, kwaśne deszcze, zmienne temperatury przekraczające często punkt 0̊C, roztwory rozpuszczalnych soli mineralnych pochodzących z otaczających elementów. Przyczyną korozji wewnętrznej są same składniki zapraw. Wymienione czynniki istotnie wpływają na zmiany mikrostruktury zapraw. Proces ten jest rozłożony w czasie. Analizę przeprowadzono na stanowisku poligonowym zlokalizowanym na terenie Uniwersytetu Technologiczno – Przyrodniczego w Bydgoszczy. Do analizy wytypowano 3 mury licowe na różnych zaprawach. W kolejnych latach funkcjonowania murów obserwowano pojawianie się wykwitów o różnym zakresie i nasileniu. Zebrane informacje pozwoliły na ustalenie obszaru o najwyższej intensywności wykwitów. Po dziesięciu latach, dla każdego muru, z wytypowanego miejsca pobrano próbki zapraw, dla których zbadano mikrostrukturę metodą porozymetrii rtęciowej. Uzyskane wyniki posłużyły do oceny zmian udziału mezo- i makro-porów w badanych zaprawach powstałych w wyniku oddziaływania środowiska zewnętrznego.

  1. Historia Polski i kultury polskiej dla cudzoziemców na średnim poziomie językowym (autorski program audiowizualny)

    OpenAIRE

    Jelonkiewicz, Mirosław

    1998-01-01

    Zadanie pt. Digitalizacja i udostępnienie w Cyfrowym Repozytorium Uniwersytetu Łódzkiego kolekcji czasopism naukowych wydawanych przez Uniwersytet Łódzki nr 885/P-DUN/2014 zostało dofinansowane ze środków MNiSW w ramach działalności upowszechniającej naukę.

  2. Istota finansowania na zasadach project finance i jego zastosowanie w rozwoju gospodarczym Polski w perspektywie przystąpienia do Unii Europejskiej

    OpenAIRE

    Bujnowicz, Iwona

    2004-01-01

    Project finance has been used for decades in Western countries to found major resource and infrastructure projects in a manner which is satisfactory and beneficial to the sponsors and financiers alike. Central and Eastern Europe represents the next frontier for successful project finance transactions. Project finance refers to the financing of long-term infrastructure, industrial projects and public services based upon a non-recourse or limited recourse financial structure where project debt ...

  3. Praca jako obowiązek a praca jako źródło satysfakcji. Studium historyczne roli i znaczenia pracy w dziejach Polski (po 1945 roku)

    OpenAIRE

    Kamosiński, Sławomir

    2016-01-01

    The paper presents an analysis of the ethical, political and economic aspects of human work within two Polish historical periods – the years of the People’s Republic of Poland and after 1989. The starting point for the analysis was the assumption that every time period, each age, leaves a mark on man’s work. Analysis of the People's Republic of Poland period gives an opportunity to consider human work understood as a duty and right of every human guaranteed by the Constituti...

  4. O przekładach powieści Górnołużyczan na język polski

    Czech Academy of Sciences Publication Activity Database

    Derlatka, Tomasz

    2014-01-01

    Roč. 83, č. 4 (2014), s. 410-422 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Upper Sorbian Novel * Polish reception * translation Subject RIV: AJ - Letters, Mass-media, Audiovision

  5. Znaczenie analizy minerałów ciężkich w badaniach osadów czwartorzędowych Polski

    Science.gov (United States)

    Racinowski, Roman

    2008-01-01

    In most regions of Poland the composition of heavy minerals assemblage permits to distinguish the Quaternary deposits from the older ones. The pre-Quaternary deposits are characterized by high content of glauconite, carbonate-ferruginous-manganese concretions, muscovite and chlorites. In their transparent heavy minerals spectrum the following minerals predominate: zircon, tourmaline, rutile, staurolite, disthene. However, the Tertiary deposits in the Carpathians and their foreland contain a significant amount of garnet, and sometimes also amphiboles, pyroxenes and biotite. Pyroxenes and sillimanite are found in the Sudetes foreland. In many Tertiary deposits of the northwestern and western Poland there are rather high contents of amphiboles, biotite, pyroxenes, garnets, rutile. In all Quaternary deposits in Poland the qualitative composition of heavy minerals assemblage is similar but the contents of particular minerals are different depending on the examined grain fraction. In tills (Table 1) and glaciofluvial deposits (Table 2), with the decreasing grain diameter the contents of zircon, rutile, and partly epidote increase, and those of amphiboles and garnets decrease. In rubble of coastal zone in the Polish Baltic Sea, with the decreasing grain diameter the contents of zircon, rutile and epidote increase, and those of amphibole, biotite and pyroxenes decrease (Tables 3-7). In Poland, glacial, glaciofluvial and glaciolacustrine deposits are characterized by quantitatively similar composition of heavy minerals assemblage. Amphiboles, biotite, epidotes, garnets and pyroxenes are typical transparent minerals (Tables 8 and 9). Young Pleistocene and Holocene sands of river terraces and dune fields in the upland zone of Poland differ from glacial deposits in low contents of amphiboles, biotite and pyroxenes, and higher contents of garnets and epidotes (Tables 8 and 9). Fossil river and lacustrine deposits of Polish Lowlands have very similar assemblage of heavy minerals to that found in glacial deposits. Both glacial and glaciofluvial deposits have similar composition of heavy minerals assemblage irrespective of their age (Tables 10, 11 and 12). This principle concerns also loesses (Table 13a, b) but the youngest ones are characterized by higher contents of amphiboles and epidotes. The composition of heavy minerals assemblage is useful for determining the source of material forming the Quaternary deposits. In the case of glacial deposits, the enrichment in glauconite, chlorites, and even zircon, rutile, tourmaline, staurolite indicates that material from local older substratum was supplied to the Quaternary deposits. Heavy minerals spectrum of non-glacial deposits can directly indicate the source material that formed a deposit. Conversely, it is difficult to draw the conclusions about fossil and modern weathering-soil horizons in loesses from the composition of heavy minerals assemblage (Tables 14 and 15). The results of heavy minerals analysis are useful for lithodynamic and lithofacial interpretation of flowing water environments, e.g. river (Table 16), glaciofluvial (Table 17) and sea coastal (Table 18).

  6. Strategy of global European atmosphere protection, Polish contribution within European project of Eureka; Strategia globalnej ochrony atmosfery nad Europa, wklad Polski poprzez udzial w europejskim programie Eureki

    Energy Technology Data Exchange (ETDEWEB)

    Pasiuk-Bronikowska, W.; Bronikowski, T.; Ujejczyk, M. [Polska Akademia Nauk, Warsaw (Poland). Inst. Chemii Fizycznej

    1996-12-31

    Related to general topics of the project EUROTRAC (set up within initiative of the European Research Coordination Agency EUREKA), main objectives of the subproject HALIPP bound with chemistry leading to `acid rains` are discussed. Exemplary results of the kinetic-mechanistic study of sulfur pollutants transformations in troposphere are shown as the Polish contribution to this project. (author). 7 refs, 3 figs.

  7. Consequences of Chernobyl accident for Poland: Retrospective assessment after 10 years; Skutki katastrofy w Czarnobylu dla Polski: Ocena retrospektywna po 10 latach

    Energy Technology Data Exchange (ETDEWEB)

    Jaskowski, J. [Akademia Medyczna, Gdansk (Poland)

    1996-12-31

    The regional contamination in Poland after Chernobyl accident has been presented. On this base the biological and medical consequences have been discussed. The neonatal mortality as well as cancer frequency for selected regional population in Poland have been analysed during the last decade. 10 figs, 20 tabs.

  8. Los Mapas Contables de Gestión de las Empresas Cotizadas Chilenas: Análisis Cualitativo

    OpenAIRE

    Pérez-Benedito, Miguel A; Porcuna-Enguix, Luis; Porcuna-Enguix, Rubén

    2017-01-01

    El artículo analiza las clases de gestión realizadas por las empresas cotizadas chilenas localizadas en los espacios administrativos de Chile. La orientación del análisis realizado considera que el factor cultural de la región donde están localizadas las empresas chilenas condiciona la clase de gestión desarrollada por dichas empresas. El desarrollo de esta hipótesis se realiza aplicando la metodología contable de los gráficos radiales. Las tensiones existentes entre los periodos medios de ma...

  9. VIAJE, CIENCIA FICCIÓN, ARQUITECTURA. MAPAS, ESTACIONES Y ESPEJOS / Travel, science fiction, architecture. Maps, stations and mirrors

    Directory of Open Access Journals (Sweden)

    Juan Antonio Cabezas Garrido

    2010-11-01

    Full Text Available RESUMEN El viaje es y ha sido un tema recurrente en la ciencia ficción desde sus comienzos. El viaje como proyecto, como trayecto y como límite conforman escenarios en los que la arquitectura se hace presente definiendo el carácter, la forma y el entorno del futuro. La representación de ese entorno y la vocación prospectiva que contiene la ciencia ficción, producen innumerables ejemplos distintos que imaginan diversidad de escenarios posibles en futuros lejanos y próximos. La mezcla de elementos habitables que produce el viaje, donde la ciudad, el edificio y el transporte en ocasiones son la misma cosa, se añade al reflejo de la realidad que el cineasta superpone a su propia y personal visión del porvenir. El tren llegando a la ciudad, símbolo del primer espectáculo cinematográfico, y la visión de las estrellas del pasajero de un transbordador espacial son metáforas de la fascinación del hombre por su propio descubrimiento y del deseo constante de avanzar hacia la materialización de su imaginación. SUMMARY Travel is and has been a recurrent theme in science fiction since its inception. The planning, the route and the destination of the journey shape scenarios in which architecture is present, defining the character, the form and the surroundings of the future. The representation of those surroundings, and the foresight contained in science fiction, produces innumerable different examples that imagine the diversity of possible scenarios in futures far and near. The mixture of inhabitable elements along the journey, where city, buildings and transport are sometimes indistinguishable, is added to the film director's superimposed reflection of reality and personal vision of the future. The train arriving at the city, a symbol of the first film screening, and the vision of stars seen by the space shuttle passenger, are metaphors for the fascination of humankind for their own discovery, and of the constant desire to advance towards the fulfilment of their imagination.

  10. Mapas de complementaridade dos potenciais solar e eólico no estado do Rio Grande do Sul

    OpenAIRE

    Gilberto Pianezzola

    2006-01-01

    A energia solar e a energia eólica são fontes de energias renováveis com potencial inesgotável e que não liberam contaminantes ao meio ambiente. O uso destas energias em conjunto, explorando a sua complementaridade, pode viabilizar economicamente e permitir um uso confiável deste sistema, denominado sistema híbrido fotovoltaico-eólico, podendo ser um sistema autônomo de geração de energia elétrica. Dependendo das aplicações, o sistema híbrido fotovoltaico-eólico pode apresentar vantagens em c...

  11. Problemas de Educación Corporal: Coordenadas de un mapa presente y desafíos a futuro

    Directory of Open Access Journals (Sweden)

    Emiliano Matías Gambarotta

    2011-11-01

    Full Text Available Los paradigmas, las técnicas y las prácticas producto de tradiciones regulan las formas de transmisión del saber, estableciendo las concepciones de sujeto, así como las nociones de cuerpo, de prácticas corporales y, sobre todo, de cómo se educa lo "corporal". Sobre este telón de fondo, la mesa "Problemas de Educación Corporal" generó un espacio de discusión acerca de la educación corporal trabajando aspectos teórico-conceptuales de la problemática noción de cuerpo, su articulación con la noción de sujeto, los diversos significantes que el cuerpo adquiere en los discursos educativos, y lo que ello implica en la transmisión del saber

  12. Mapas imaginários sobre Porto Alegre: as representações da cidade no cinema

    Directory of Open Access Journals (Sweden)

    Miriam de Souza Rossini

    2010-12-01

    Full Text Available Este artigo apresenta os procedimentos de pesquisa e os resultados obtidos no subgrupo Cinema da pesquisa Porto Alegre imaginada: representações dos cidadãos sobre a cidade. Ao longo de 2007 e 2008, foram mapeados os filmes produzidos e exibidos em Porto Alegre, em diferentes formatos e suportes, e após foi feita a análise do corpus conforme as categorias propostas no projeto geral da pesquisa. O objetivo era compreender como a cidade era percebida e representada nas imagens audiovisuais cinematográficas. Na análise, observamos a estética visual e sonora, a estrutura narrativa e as principais temáticas. A cidade que surge nas telas de cinema com certeza é muito diferente do imaginário que existe sobre a cidade real. Ao invés de uma grande metrópole moderna, o que se percebe é uma cidade que mal consegue sair dos seus limites oitocentistas.

  13. Obtención de mapas de curvas residuales para la síntesis de acetato de butilo

    Directory of Open Access Journals (Sweden)

    Álvaro Orjuela Londoño

    2006-09-01

    Full Text Available Es este trabajo se adelantó un estudio en la escala de laboratorio de la síntesis acetato de n-butilo en fase líquida (P atm = 560 mmHg, en operación simultánea de reacción y destilación (destilación reactiva batch, utilizando una resina de intercambio catiónico (Lewatit K-2431 como catalizador. Por medio de la construcción experimental de curvas residuales, utilizando diferentes cargas de catalizador, se determinaron las condiciones para las cuales la operación esta limitada por el equilibrio químico de la reacción (régimen de equilibrio y no por efectos cinéticos (régimen cinético. Finalmente, se estableció la factibilidad de implementación del proceso de esterificación a través de un arreglo de reacción-separación simultanea. En dicho proceso se podrIa obtener el acetato de n-butilo puro como producto de fondos de una columna de destilación reactiva, sobrepasando las limitantes de conversión del sistema reactivo.

  14. UNA APROXIMACIÓN AL CONOCIMIENTO DE UNA PROFESORA UNIVERSITARIA, AGENTE DE BUENAS PRÁCTICAS DOCENTES, UTILIZANDO MAPAS CONCEPTUALES

    Directory of Open Access Journals (Sweden)

    Fermín González García

    2010-01-01

    Full Text Available Se muestra en este trabajo un modelo de conocimiento construido sobre buenas prácticas docentes de una profesora universitaria, responsable de la asignatura "Circuitos y Sistemas I", correspondiente al primer curso (y primer cuatrimestre de la titulación de Ingeniería Técnica de Telecomunicación: Sonido e Imagen. El modelo fue realizado en el marco de una investigación que se ha llevado a cabo por 6 universidades españolas. El trabajo identifica, analiza, explicita y representa con la ayuda del programa informático CMap Tools el pensamiento pedagógico y la práctica docente de un profesor universitario caracterizado por su buena práctica, a partir de entrevistas en profundidad. El modelo de conocimiento construido de las buenas prácticas de este profesor, fácilmente accesible a través de Internet, constituye un excelente ejemplo que puede orientar tanto al profesor novel como a profesores experimentados que quieran mejorar la calidad de la docencia que imparten.

  15. Seventh Graders' Academic Achievement, Creativity, and Ability to Construct a Cross-Domain Concept Map--A Brain Function Perspective

    Science.gov (United States)

    Yeh, Yu-Chu

    2004-01-01

    This study proposes an interactive model of "cross-domain" concept mapping with an emphasis on brain functions, and it further investigates the relationships between academic achievement, creative thinking, and cross-domain concept mapping. Sixty-nine seventh graders participated in this study which employed two 50-minute instructional…

  16. Kenneth Kraft, Budismo solidario. Un nuevo mapa del sendero, Editorial Maitri, Santiago de Chile, 2001, 106 p.

    OpenAIRE

    Gottlieb, Teresa

    2012-01-01

    El budismo actual presenta dos grandes ramas. La más antigua es la hinayana, el “pequeño vehículo”, representado actualmente por la escuela Theravada, arraigada fundamentalmente en Birmania, Laos, Tailandia, Camboya, Sri Lanka y Malasia. La otra, es el budismo mahayánico, el “gran vehículo”, surgido en el siglo segundo antes de nuestra era, y característico de China, Mongolia, Corea,  Tíbet y Japón, y de la cual el budismo zen es una de su principales expresiones. La escuela Theravada tiene c...

  17. Paisaje y Pintura en Tres Mapas del Corpus de las Relaciones Geográficas 1579-1586

    Directory of Open Access Journals (Sweden)

    Enrique Delgado López

    2011-08-01

    Full Text Available Las Relaciones Geográficas del siglo XVI (1579-1586 fue un proyecto científico que buscó reconocer la realidad del Nuevo Mundo; fue la culminación de una serie intentos emprendidos por España por reconocer sistemáticamente su imperio y que iniciaron desde los viajes colombinos para continuar a lo largo del periodo virreinal. Este proyecto en particular aplicó un cuestionario que abrigaba temas geográficos, cartógraficos, históricos y antropolgicos,teniendo como protagonistas a los propios residentes de los lugares que fueron descritos; de ahí su enorme valor históriografico. Además, estas descripciones conjugan conocimientos orales y tradicionales con los propios de la cultura hispánica.

  18. Los mapas como abstraccion y espacio imaginativo : representando el urbanismo informal = Maps as abstraction and imaginative space : representing informal urbanism

    OpenAIRE

    Lueder, Christoph

    2014-01-01

    Quotidian mobility and urban connectivity become explicit in diagrams of circulation patterns, narrative tracing of trajectories, or choreographic notation of kinetic routines. However, they are also powerfully implicit in architectural floor plans, which, extended to urban scale in the Rossi Plan of Zürich, conjure imaginative space for suppositional wanderings through the city. An ongoing research project by the author brings such imaginative capacities to bear on diagrammatic exploration o...

  19. Servicio de Mapas en Internet para la Salud Ambiental en la Region Fronteriza Entre los Estados Unidos y Mexico

    Science.gov (United States)

    Buckler, Denny; Stefanov, Jim

    2004-01-01

    La region fronteriza de los Estados Unidos y Mexico abarca una gran diversidad de ambientes fisicos y habitaciones, entre los cuales estan los humedales, desiertos, pastos, montanas, y bosques. Estos a su vez son unicos en cuanto a su diversidad de recursos acuaticos minerales, y biologicos. La region se interconecta economica, politica, y socialmente debido a su herencia binacional. En 1995, cerca de 11 millones de habitantes vivian en la zona adyacente a la frontera. Un estudio sugiere que esa poblacion podria doblarse antes del ano 2020.

  20. La nueva directiva europea sobre los medios audiovisuales remueve el mapa de la televisión.

    Directory of Open Access Journals (Sweden)

    Francisco Campos Freire

    2012-04-01

    Full Text Available La Directiva Europea de la Televisión sin Fronteras, que desde 1989 marca el rumbo de lapolítica comunitaria de la libre competencia, ha sido reemplazada por un nuevo concepto regulador más amplio, que trasciende también al ámbito convergente de los medios y servicios audiovisuales.Sigue siendo uno de sus ejes centrales el principio de la libre competencia, junto a la invocación a la diversidad y pluralidad, aunque en términos no sólo de la lógica económica sino también de la democracia es necesario mayor desarrollo y profundidad. Así, en la UE se abren nuevos debates sobre el pluralismo en los medios de comunicación y la alfabetización digital. Se mantiene el principio de control del país de origen pero la nueva Directiva Europea de Medios Audiovisuales sin Fronteras empuja a los Estados a reformar sus respectivas legislaciones. Una buena ocasión en España para armonizar el compendio de más de un centener de normas, leyes y decretos actualmente vigentes. Y para que, de una vez, salgan adelante las dos leyes generales del Audiovisual y del Consejo Estatal de Medios Audiovisuales junto a la reforma de las respectivas competencias autonómicas.

  1. Obtención de mapas de curvas residuales para la síntesis de acetato de butilo

    OpenAIRE

    Orjuela Londoño, Álvaro; Leiva Lenis, Fernando; Boyacá Mendivelso, Luis Alejandro; Rodríguez Niño, Gerardo; Carballo Suárez, Luis María

    2010-01-01

    Es este trabajo se adelantó un estudio en la escala de laboratorio de la síntesis acetato de n-butilo en fase líquida (P atm = 560 mmHg), en operación simultánea de reacción y destilación (destilación reactiva batch), utilizando una resina de intercambio catiónico (Lewatit K-2431) como catalizador. Por medio de la construcción experimental de curvas residuales, utilizando diferentes cargas de catalizador, se determinaron las condiciones para las cuales la operación esta limita...

  2. Development of a map of environmental radiation in Aragon; Elaboracion de un mapa de radiacion ambiental en Aragon

    Energy Technology Data Exchange (ETDEWEB)

    Calvete, H. I.; Carrion, J. A.; Gale, C.; Garcia, B.; Nunez-Lagos, R.; Perez, C.; Puimedon, J.; Rodriguez, S.; Sanchez, P.; Sarsa, M. L.; Villar, J. A.; Virto, A.

    2013-06-01

    This paper presents the results of the measurements of the environmental radioactivity levels obtained in selected locations of the 33 administrative divisions of the Autonomous Region of Aragon (Spain). The ambient dose levels have been recorded by using thermoluminescent dosimeters (TLD) during a period of four years (2008-2012). the average ambient dose equivalent H (10) level in Aragon is 0.82 mSv/year. This research has been supported by the Aragon Government and the Obra Social de la Caixa under the grants GA-LC-014/2008 and GA-LC-035/2010. (Author) 6 refs.

  3. Macrolides for KCNJ5-mutated aldosterone-producing adenoma (MAPA): design of a study for personalized diagnosis of primary aldosteronism.

    Science.gov (United States)

    Maiolino, Giuseppe; Ceolotto, Giulio; Battistel, Michele; Barbiero, Giulio; Cesari, Maurizio; Amar, Laurence; Caroccia, Brasilina; Padrini, Roberto; Azizi, Michel; Rossi, Gian Paolo

    2018-02-06

    Aldosterone-producing adenoma (APA) is the main curable cause of endocrine hypertension cause of primary aldosteronism (PA) and it is in up to 66% of all cases investigated with adrenal vein sampling (AVS). Mutations in the KCNJ5 potassium channel involve up to 70% of APA and cause the most florid PA phenotypes. The recent finding that macrolide antibiotics specifically inhibit in vitro the altered function of mutated KCNJ5 channels has opened new horizons for the diagnosis and treatment of APA with KCNJ5 mutations in that it can allow identification and target treatment of PA patients harbouring a mutated APA. Thus, we aimed at investigating if clarithromycin and roxithromycin, two macrolides that potently blunt mutated Kir3.4 channel function in vitro, affect plasma aldosterone concentration in adrenal vein blood during AVS and in peripheral blood, respectively, in PA patients with a mutated APA. We designed two proof of concept studies. In study A: consecutive patients with an unambiguous biochemical evidence of PA will be exposed to a single dose of 250 mg clarithromycin during AVS, to assess its effect on the relative aldosterone secretion index in adrenal vein blood from the gland with and without APA. In study B: consecutive hypertensive patients submitted to the work-up for hypertension will receive a single oral dose of 150 mg roxithromycin. The experimental endpoints will be the change induced by roxithromycin of plasma aldosterone concentration and other steroids, direct active renin concentration, serum K + , systolic and diastolic blood pressure. We expect to prove that: (i) clarithromycin allows identification of mutated APA before adrenalectomy and sequencing of tumour DNA; (ii) the acute changes of plasma aldosterone concentration, direct active renin concentration, and blood pressure in peripheral venous blood after roxithromycin can be a proxy for the presence of an APA with somatic mutations.

  4. Arquitectura y Documentos. Mapa documental para el estudio de la arquitectura y las obras de Carlos Arniches

    Directory of Open Access Journals (Sweden)

    Concha Diez-Pastor

    2017-10-01

    dels fets. Investigacions prèvies sobre aquests arquitectes van posar de manifest la rellevància de l’autoria a l’hora d’analitzar les obres d’arquitectura, suggerint la conveniència d’aprofundir en aquella via d’investigació que, finalment, va abastar gairebé la totalitat de la seva obra. Abans de 1936, Arncihes i Domínguez havien treballat en algunes obres com a socis. No obstant això, com demostren les proves i documents d’arxiu, no totes les seves obres van ser conjuntes, i les que ho bvan ser no sempre es van atribuir degudament al seu autor real, com es dedueix dels documents. El context, clau per entendre el material documental i d’arxiu recaptat, i la exhaustiva avaluació que inclou els punts de vista històric i cultural, desvetllen l’autoria real, permetent assentar els fets i preservar els seus valors i el seu abast històric..

  5. Possible directions for the agricultural trade liberalisation under Doha Round and the European Union's stand. Conclusions for Poland Możliwe kierunki liberalizacji handlu rolnego w ramach Rundy Doha a stanowisko Unii Europejskiej. Wnioski dla Polski

    Directory of Open Access Journals (Sweden)

    Elżbieta Daszkowska

    2007-12-01

    Full Text Available This article aims at presenting the agricultural aspect of ongoing negotiations in the scoupe of the Doha Round. In this paper are set out interests and positions of the most important groups of countries in WTO and key pillars of agriculture negotiations.

  6. Język polski w Rosji Radzieckiej w okresie międzywojennym a polszczyzna na Białorusi radzieckiej (na materiale wybranych zagadnień fleksji rzeczowej

    Directory of Open Access Journals (Sweden)

    Tamara Graczykowska

    2015-07-01

    Full Text Available The Polish language in Soviet Russia in the interwar period and the Polish language in Soviet Belarus (based on selected features of noun inflexion In this present paper the author makes an attempt to compare several specific features of noun inflexion excerpted from “Trybuna Radziecka” with the adequate material from the Belarussian press published in the interwar period too. “Trybuna Radziecka” was the Polish newspaper published in Moscow from 1927 to 1938 and edited by Polish Communists, living as political émigrés in the post-revolution Soviet Russia. The Polish language (including the language of the Polish press in Soviet Russia was subject to two powerful mechanisms: communist propaganda and totalitarianism. The language of the Polish press is characteristic of numerous divergences in relation to general Polish especially in vocabulary (the lexical level is dominated by the Russicisms and Sovietic elements. Comaparative analysis shows that the deviations from the general Polish occurred in both sources, but the specific inflexion features are not numerous. The flexion level is arisen under the influence of foreign language system (Belarussian and Russian. All the regional features still function in the postwar Northern Borderland Polish.   Польский язык в советской России в период между первой и второй мировой войнами и польский язык в советской Белоруссии (на избранных примерах флексии имени существительного В статье сопоставлен язык газеты „Trybuna Radziecka”, издаваемой польскими коммунистами в Москве в межвоенный период, с языком польской прессы, публикуемой в советской Белоруссии в то же веремя. Анализ ведётся на избранных примерах флексии имени существительного. Большинство явлений отмечено в обоих источниках. Следует подчеркнуть, что почти все представленные особенности флексии существительного появились вследствие восточнославянского воздействия, прежде всего русского. Некоторые отклонения представляют собой общепольские тенденции того времени (напр. колебания -i (-y // -owie в именительном падеже существительных м.р. типа liberali или колебания ø // -i в родительном падеже мн.ч. существительных ж.р. типа czytelń. Как показало исследование, все указанные явления в области флексии зафиксированы также в послевоенной вильнюсской прессе. Автор подчёркивает, что ком мунистическая пропаганда и тоталитаризм оставили на польском языке (включая язык польской прессы в советской России в межвоенный период сильный отпечаток (особенно в лексике.

  7. Kontekst stratygraficzny zastosowania różnych odmian metody termoluminescencyjnej w datowaniu lessów z terenu Polski południowo-wschodniej i Ukrainy północno-zachodniej

    Science.gov (United States)

    Kusiak, Jarosław

    2008-01-01

    Loess profiles contain a complex but usually incomplete sequence of deposits. In order to chronologically organize deposit layers accessible in different exposures it is necessary to use absolute dating methods. The 14C, TL and OSL methods are widely used for dating of the Upper Pleistocene deposits whereas to older Pleistocene deposits only luminescence methods are applied. Some attempts are made to use the OSL method for dating of the deposits older than the Upper Pleistocene. However, the OSL ages seem to be consistently lower than the TL ages, and also considerably underestimated with reference to stratigraphic interpretation. This fact indicates that the TL method should be used above all. The possibility of TL dating of loesses is connected with their aeolian origin. The obtained TL age should correspond to geological time when mineral grains constituting deposit were exposed to sunlight before deposition. Such exactly condition is met in case of loess deposits. There are many variants of thermoluminescence method because different measuring procedures can be used. Depending on the used procedure, the TL ages obtained for the same sample can be considerably different. The manner of equivalent dose determination is decisive for the obtained TL ages. The factors influencing the value of equivalent dose are presented in this paper. The equivalent dose is determined by comparison of thermoluminescence measured for a given sample with thermoluminescence of the same sample after irradiation in laboratory with known doses of ionizing radiation. The following criteria should be taken into account: size of mineral grains, relation between thermoluminescence and heating temperature, way of reduction of unstable thermoluminescence, and the results of plateau test. The variant of thermoluminescence method used in the TL Laboratory of the Department of Physical Geography and Palaeogeography, Maria Curie-Skłodowska University in Lublin is as follows. The dose rate is determined by gamma spectrometry. The equivalent dose is determined by the total-bleach technique for the 45-63 μm fraction. Blue light obtained using the BG-28 filter is applied. Samples are preheated at 160°C for 3 hours before measurement. Light sum is read as the maximum height of glow curve. The application of such measurement procedure allows reliable dating of climatic episodes recorded in loess deposits not only related to the last glacial but also in older ones.

  8. Caracterización de los nacimientos de fuentes hídricas para el corregimiento de Pance

    OpenAIRE

    Unidad Municipal de Asistencia Técnica Agropecuaria

    2007-01-01

    Base de datos con información de nacimientos caracterizados y monitoreados del corregimiento de Pance. -- Mapa base del Municipio de Santiago de Cali. -- Mapa de Nacimientos del corregimiento de Pance. Contiene: fotografías, mapas.

  9. ORF Alignment: NC_002932 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available nterchange ... protein, thioredoxin family [Chlorobium tepidum TLS] ... Length = 139 ... Query: 41 ... MAPA...FTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCREELPGMVALQKKYAKQGFTFVG 100 ... MAPA...FTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCREELPGMVALQKKYAKQGFTFVG Sbjct: 1 ... MAPAFTLKTLEGKELNSSQLAGRPYIVNFFASWCPPCR

  10. Map of regions - zones and sub-zones with coal in Colombia; Mapa de regiones, zonas y subzonas con carbon en Colombia

    Energy Technology Data Exchange (ETDEWEB)

    Pulido Gonzalez, Orlando; Mejia Umana, Luis Jorge

    1999-07-01

    This map has as objective to show and to categorize the distribution of the Colombian coal for regions, zones and sub-zones, the map has the different locations in possible mining projects that could be developed to supply international markets or for national, regional or local consumption; for this reason the current knowledge in quality like in the potential of the resource, it is useful to establish priorities in the mining development, in the exploration and evaluation especially in those regions of low geologic knowledge and to obtain this way a better use in function of the community and the industry. In the description that accompanies the map and in the summary, some geologic parameters and physical-chemical settle down; as well as of reserves measures and indicates and hypothetical resources that summarize the characteristics of the coal of the country.

  11. Self-organizing maps applied to two-phase flow on natural circulation loop study; Aplicacao de mapas auto-organizaveis na classificacao de padroes de escoamento bifasico

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Leonardo Ferreira

    2016-11-01

    Two-phase flow of liquid and gas is found in many closed circuits using natural circulation for cooling purposes. Natural circulation phenomenon is important on recent nuclear power plant projects for decay heat removal. The Natural Circulation Facility (Circuito de Circulacao Natural CCN) installed at Instituto de Pesquisas Energeticas e Nucleares, IPEN/CNEN, is an experimental circuit designed to provide thermal hydraulic data related to single and two-phase flow under natural circulation conditions. This periodic flow oscillation behavior can be observed thoroughly in this facility due its glass-made tubes transparency. The heat transfer estimation has been improved based on models that require precise prediction of pattern transitions of flow. This work presents experiments realized at CCN to visualize natural circulation cycles in order to classify two-phase flow patterns associated with phase transients and static instabilities of flow. Images are compared and clustered using Kohonen Self-organizing Maps (SOM's) applied on different digital image features. The Full Frame Discret Cosine Transform (FFDCT) coefficients were used as input for the classification task, enabling good results. FFDCT prototypes obtained can be associated to each flow pattern, enabling a better comprehension of each observed instability. A systematic test methodology was used to verify classifier robustness.

  12. Solución de controversias en los tratados bilaterales de inversión: mapa de situación en América del Sur

    Directory of Open Access Journals (Sweden)

    Magdalena Bas Vilizzio

    2015-03-01

    Full Text Available Este trabajo analiza las características particulares del sistema legal internacional de solución de controversias inversor-Estado, con especial foco en los tratados bilaterales de inversión (TBI en vigor en América del Sur, salvo excepciones. En este marco, aplicando la teoría de los regímenes internacionales (Krasner, 1983, se examinan las tres posiciones de los Estados de la región en torno al tema: 1 no ratificar TBI ni ser miembro del Centro Internacional de Arreglo de Diferencias relativas a Inversiones (CIADI (Brasil; 2 denunciar los TBI en vigor y abandonar el CIADI (Bolivia, Ecuador y Venezuela; 3 mantener los TBI en vigor y permanecer en los foros de solución de controversias actuales (Argentina, Chile, Colombia, Guyana, Paraguay, Perú, Surinam y Uruguay.

  13. Evaluación del Nivel de Ruido Ambiental y Elaboración de Mapa de Ruidos del Distrito de Sachaca - Arequipa 2016

    OpenAIRE

    López Ramos, Diego Rodrigo

    2017-01-01

    En las últimas décadas el factor de contaminación sonora está siendo considerado por la mayoría de la población y países como un factor medioambiental muy importante, que incide de forma principal en la calidad de vida de la población y con consecuencias importantes en la salud y bienestar de la población de las ciudades principalmente urbanas. La actividad humana es la principal causa de contaminación sonora mediante el transporte, construcción, industria, comercio, etc. Y está comprobado qu...

  14. Reproduction of the flow-power map of the Laguna Verde power plant; Reproduccion del mapa flujo-potencia de la Central Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Amador G, R; Gonzalez M, V M [Comision Nacional de Seguridad Nuclear y Salvaguardias, 03000 Mexico D.F. (Mexico)

    1993-07-01

    The National Commission of Nuclear Safety and Safeguards (CNSNS) requires to have calculation tools which allows it to make analysis independent of the behavior of the reactor core of Laguna Verde nuclear power plant (CNLV) with the purpose to support the evaluation and discharge activities of the fuel recharges licensing. The software package Fms (Fuel Management System) allows to carry out an analysis of the core of the BWR type reactors along the operation cycle to detect possible anomalies and/or helping in the fuel management. In this work it is reproduced the flow-power for the CNLV using the Presto code of the Fms software package. The comparison of results with the map used by the operators of CNLV shows good agreement between them. Another exercise carried out was the changes study that the axial and radial power outlines undergo as well as the thermohydraulic parameters (LHGR, APLHGR, CPR) when moving a control rod. The obtained results show that is had the experience to effect analysis of the reactor behavior using the Presto-Fms code therefore the study of the rest of the software package for the obtention of nuclear parameters used in this code is recommended. (Author)

  15. Todas as criaturas do mundo: a arte dos mapas como elemento de orientação geográfica

    Directory of Open Access Journals (Sweden)

    Dante Martins Teixeira

    2009-01-01

    rather independent element. In fact, allegories, compositions with a variety of mythological figures, and historical representations were often used to underscore the power of certain political agents.

  16. Estimation solar irradiance maps in Extremadura (Spain) by means of meteorological parameters; Mapas de radiacion solar de Extremadura estimada a partir de otros parametros meteorologicos

    Energy Technology Data Exchange (ETDEWEB)

    Ramiro, A.; Nunez, M.; Reyes, J. J.; Gonzalez, J. F.; Sabio, E.; Gonzalez-Garcia, C. M.; Ganan, J.; Roman, S.

    2004-07-01

    In a previous work, we have found correlation expressions that permit to estimate the mean monthly values of daily diffuse and direct solar irradiation on a horizontal surface in function of some weather parameters. In this work, the incident radiation on a horizontal surface has been estimated in thirty zones of Extremadura by means of weather data from existing stations located in these zones and its orography. The weather data used have been the monthly average values of the highest temperatures and the sunshine fraction. These monthly average values have been obtained from measurements carried out in the weather stations during the period 1985-2002. The results are presented as interactive maps in Arc view language, associated to a conventional data base. (Author)

  17. Nota explicativa del Mapa geológico de la parte N.O. de la provincia de la Coruña

    NARCIS (Netherlands)

    Parga-Pondal, Don Isidro

    1956-01-01

    Explanation of the geological map (Northwestern part) of the province of La Coruña, Galicia, N.W. Spain Main rock groups We distinguish five main groups of rocks which probably differ in age. Whether this age difference applies only to the time of their intrusion or metamorphism or also to their

  18. Raciocínio geográfico e mapas mentais: a leitura espacial do cotidiano por alunos do Ensino Médio

    OpenAIRE

    Richter, Denis [UNESP

    2010-01-01

    A Educação Básica é responsável pela formação escolar do indivíduo durante onze anos, no mínimo. Ao longo desse processo, o estudante tem contato com o conhecimento científico provindo das diversas disciplinas que fazem parte do currículo da escola. Cada uma dessas disciplinas possui seus objetivos e contribuições para a aprendizagem do aluno e que o ajudam a compreender os contextos que interferem na organização da realidade, seja na perspectiva das relações sociais, culturais, políticas, am...

  19. Realizar mapa de competencias de los representantes técnicos, como herramienta de evaluación de desempeño

    OpenAIRE

    Nasute Molina, Osvaldo Victor

    2015-01-01

    I. RESUMEN - II. MARCO TEORICO - II. METODOLOGIA - IV. OBJETIVOS DEL TRABAJO - V. LIMITES O ALCANCES DEL TRABAJO - VI. INTRODUCCION - VII. CAPITULO 1 – ADMINISTRACIÓN DE LOS RECURSOS HUMANOS - 1.1 ¿QUÉ ES LA ADMINISTRACIÓN DE LOS RECURSOS HUMANOS? - 1.2 PROPÓSITO DE LA ADMINISTRACIÓN DE LOS RECURSOS HUMANOS - 1.3 LA NUEVA VISIÓN DEL RECURSO HUMANO - VIII. CAPITULO 2 - CARACTERÍSTICAS Y TIPOS DE COMPETENCIAS - 2.1 ¿QUÉ SON LAS COMPETENCIAS? - 2.2 CLASIFICACIÓN DE COMPETENCIAS - 2.3 TIPOS DE ...

  20. Atlas of the Colombian coal, Potential map and rank: Map 5-09; Atlas de los carbones colombianos. Mapa de potencial y rango: Plancha 5-09

    Energy Technology Data Exchange (ETDEWEB)

    Pulido Gonzalez, Orlando

    1999-07-01

    With the presentation of the Atlas of Coal to scale 1:500.000, it is sought to show to big features the location of the different areas with coal in Colombia, associating with the geologic units, the potential and the range. In the Map 5-09, the formations that include the coal are defined as Umir, Guaduas, Limbo, (Los Cuervos), San Fernando, (Carbonera), defined as Kst, Ksgt and Pgt. For the potential an arbitrary scale settled down, in the following way: in the first place bigger to 1000 million tons; between 1000 and 100; between 100 and 10 and lastly smaller to 10 million tons. These figures are represented in the map by triangles with colors that they are equal before to the figures mentioned. Keeping in mind the scale, it was opted to report the potential in the category of the hypothetical resources; when the resources or reserves are established, they are also reported. As for the range, in the map it is indicated by means of symbols that should be taken as a domain or tendency of the coal in each area in general. The the coal rank understood as the transformation that has reached along the geologic evolution is what is mentioned as anthracitic coal, semi-anthracitic, bituminous low in volatile, bituminous middle in volatile, bituminous high in volatile A, B and C, sub-bituminous and lastly the lignite. For each map are mentioned that there are determined.

  1. Cambios en el mapa mediático del ecuador: los medios públicos que tenemos y los medios que queremos

    Directory of Open Access Journals (Sweden)

    Ma. Isabel Punín

    2014-09-01

    Full Text Available El sistema de medios públicos en Ecuador está compuesto por 22 medios de diferente origen y estructura, constituyéndose un poder nuevo y sin límites claros, que intenta competir con medios privados y tradicionales del país, cuya administración es de carácter familiar y monopólico. Los medios públicos en Ecuador distan de las características universales planteadas para este tipo de medios, básicamente por la cercanía con los organismos del Estado, en general. La competencia entre medios públicos y privados es desigual, situación que modifica la agenda mediática nacional, dejando a la luz algunas debilidades y limitaciones del ejercicio periodístico y del manejo de la empresa periodística, en particular. El presente artículo se fundamenta en un análisis descriptivo de los medios de comunicación en Ecuador y el juego de poderes que ha desatado la presencia de medios públicos en esta última década. Analizan también el rol del periodismo y su posición frente a los temas vitales para el país, evidenciando la ausencia de una política integral a favor del ciudadano y debilidades en la profesión periodística. Concluye con recomendaciones para mejorar el papel de los medios en Ecuador.

  2. POSTERS AND CONCEPTUAL MAPS AS RESOURCES FOR TEACHING SCIENCES / PÓSTERS Y MAPAS CONCEPTUALES COMO RECURSOS PARA LA ENSEÑANZA DE LAS CIENCIAS

    Directory of Open Access Journals (Sweden)

    Ana María Jalil

    2010-01-01

    Full Text Available The posters and conceptual maps constitute resources used in different ways in teaching and didactic investigation: in the diagnosis to reveal previous ideas or for contrasting the obtained results by different groups of students. In a less frequent usage: in the evaluation of learning. Hence, its usage accounts for a great interest in the evaluation of global understanding of a topic, even in university level. In this work, the results gotten are shown during seven years: a posters, in the diagnosis stage and metalearning, b conceptual maps in groups and in partial and final evaluation, in both cases during the dictation of a university subject.

  3. Arquitectura y Pedagogía: la disolución del aula: mapa de espacios arquitectónicos para un territorio pedagógico

    OpenAIRE

    Pozo Bernal, Melina

    2014-01-01

    Ponencia presentada a Session 2: La infancia en el medio ambiente urbano / The urban child La necesidad de repensar el espacio educativo adaptándolo a los requerimientos actuales de la sociedad del conocimiento, sostiene la reflexión sobre el soporte arquitectónico docente desde un punto de vista integrador entre disciplinas: Arquitectura y Pedagogía. Lejos de establecer más especialización y segregación, la transversalidad se hace indispensable. La sociedad evoluciona al mistificar,...

  4. Mapas cognitivos difusos para la selección de proyectos de tecnologías de la información

    OpenAIRE

    Leyva Vázquez Maikel Y.; Pérez Teruel Karina; Febles Estrada Ailyn; Gulín González Jorge

    2013-01-01

    En el campo de la informática administrativa resulta de gran importancia evaluar los sistemas de información que le darán soporte a los procesos y las metas. Para lograr la alineación de estos sistemas, que formarán parte del portafolio de proyectos de tecnologías de la información de la organización con estrategias, es necesario modelar y analizar los procesos y las metas a los que se les darán soporte. En este artículo se presenta un modelo para la selección de proyectos de tecnologías de l...

  5. Historia y cine: un mapa de posibles líneas de análisis en el eje realidad / representación

    Directory of Open Access Journals (Sweden)

    Emilce Fabricio

    2016-04-01

    Full Text Available El artículo rastrea algunas posibles líneas de análisis abiertas para historiadores e historiadoras en el campo de intersecciones de los estudios cinematográficos y de la sociedad. Comienza planteando los orígenes del mismo, para adentrarse en las consideraciones del cine como fuente para la historia y de la historia en el cine. Finalmente se considera el caso particular del cine documental y se problematiza la dualidad realidad/representación.

  6. Especificaciones del servicio de medición y control de la presión arterial mediante MAFC, AMPA y MAPA

    Directory of Open Access Journals (Sweden)

    SEFAC-Comisión-Servicios-Profesionales-Farmacéuticos.

    2016-06-01

    Full Text Available En abril de 2013, la Sociedad Española de Farmacia Familiar y Comunitaria ­(SEFAC presentó su propuesta sobre servicios profesionales farmacéuticos (SPF cuyo fin es cubrir las necesidades relacionadas tanto con la atención de los pacientes que utilizan medicamentos, como con la salud pública. Esta propuesta ofrece un planteamiento sobre la implantación y desarrollo de los SPF con el objetivo de impulsar su prestación por las farmacias comunitarias en los próximos años. De acuerdo con dicha propuesta todos los SPF que constituyen el catálogo de servicios contarán con un documento de especificaciones. El objeto de este documento de especificaciones es definir y caracterizar el servicio de medición y control de la presión arterial con un doble objeto: • Ayudar al farmacéutico comunitario y a sus representantes en el ofrecimiento, prestación, difusión, financiación y concertación de este servicio. • Servir de guía a los farmacéuticos comunitarios que desean implantar este servicio en la farmacia o elaborar un procedimiento normalizado de trabajo para su realización. Este documento se complementa con la Guía de actuación para el farmacéutico comunitario en pacientes con HTA y riesgo cardiovascular (RCV. Documento de consenso GIAF-UGR, SEFAC y SEH-LELHA y con el programa impacHta: formación de SEFAC y SEH-LELHA en hipertensión y riesgo vascular.

  7. Los barrios parque y de fin de semana en el mapa de la expansión metropolitana: Buenos Aires, 1910-1950

    Directory of Open Access Journals (Sweden)

    Ana Gómez

    2015-01-01

    Full Text Available En el marco del interés que suscitan los recientes procesos de suburbanización protagonizados por los sectores medios y medios altos, surge la necesidad de identificar núcleos y emprendimientos suburbanos surgidos durante la primera mitad del siglo XX, pensándolos como antecedentes de los fenómenos actuales y partícipes en la formación del territorio metropolitano de Buenos Aires. Desde una perspectiva histórica, nos preguntamos cómo contribuyeron los barrios de fin de semana a producir una nueva configuración del Gran Buenos Aires (GBA. Del corpus de casos seleccionados surge que, más allá de los matices y del rol limitado que en términos materiales tuvieron los barrios de fin de semana en la expansión metropolitana, su relevancia radicó en su capacidad para consolidar los ejes de crecimiento y configurar en su irradiación formas particulares de la expansión.

  8. Větrná mapa České republiky pro výšku 100 m nad zemským povrchem

    Czech Academy of Sciences Publication Activity Database

    Hanslian, David; Hošek, Jiří; Chládová, Zuzana; Pop, Lukáš

    2014-01-01

    Roč. 67, č. 4 (2014), s. 97-105 ISSN 0026-1173 Institutional support: RVO:68378289 Keywords : wind map * average wind speed * boundary layer model * PIAP model * VAS/WAsP model * WAsP model * Czech Republic Subject RIV: DG - Athmosphere Sciences, Meteorology http://www.chmi.cz/files/portal/docs/reditel/SIS/casmz/2014_4.pdf

  9. Mapa cualitativo para el análisis de riesgo por BTEX por proximidad con gasolineras en la ciudad de Ensenada, Baja California, México

    Directory of Open Access Journals (Sweden)

    Marco Antonio Garcia Zarate

    2015-05-01

    Full Text Available La exposición a compuestos orgánicos volátiles (COV presentes en la gasolina, como el benceno, tolueno, etilbenceno y xileno (BTEX, por su capacidad cancerígena se ha asociado con el aumento del riesgo a desarrollar cáncer en las personas que viven o trabajan en las proximidades de las estaciones de servicio. En este trabajo se propone una aproximación metodológica para estudiar la problemática que representan los COV en los individuos expuestos a los hidrocarburos. Los datos obtenidos indican que existe mayor presencia de COV en las zonas ubicadas en la cercanía de las fuentes puntuales de emisión y por ende con mayor exposición a factores tóxicos. Con este trabajo se plantea un procedimiento sencillo para establecer las zonas vulnerables a riesgos tecnológicos dentro del área urbana por presencia de BTEX, utilizando para ello la tecnología SIG que permite realizar un análisis espacial de las emisiones de benceno a la atmósfera. Estos resultados quedarán al servicio de los organismos involucrados en la toma de decisiones. En México no existe una legislación clara que proteja a los habitantes de las cercanías de las estaciones de servicio, por lo tanto se deben desarrollar programas para disminuir el impacto en la población a nivel ambiental, sanitario y social.

  10. Cambios en el mapa mediático del ecuador: los medios públicos que tenemos y los medios que queremos

    Directory of Open Access Journals (Sweden)

    Isabel Punín

    2014-01-01

    Full Text Available El sistema de medios públicos en Ecuador está compuesto por 22 medios de diferente origen y estructura, constituyéndose un poder nuevo y sin límites claros, que in ten ta competir con me dios privados y tradicionales del país, cuya administración es de carácter familiar y monopólico. Los medios públicos en Ecuador distan de las características universales planteadas para este tipo de me dios,básicamente por la cercanía con los organismos del Estado, en general. La competencia entre me dios públicos y privados es desigual, situación que modifica la agenda mediática nacional, dejando a la luz algunas debilidades y limitaciones del ejercicio periodístico y del manejo de la empresa periodística, en particular. El presente artículo se fundamenta en un análisis descriptivo de los me dios de comunicación en Ecuador y el juego de poderes que ha desatado la presencia de me dios públicos en esta última década. Analizan también el rol del periodismo y su posición frente a los te mas vi ta les para el país, evidencian do la ausencia de una política integral a favor del ciudadano y debilidades en la profesión periodística. Concluye con recomendaciones para mejorar el papel de los medios en Ecuador.

  11. O Nordeste e o Mercado Nacional de Fragrâncias: notas para um mapa da produção/consumo de perfumes no Brasil

    Directory of Open Access Journals (Sweden)

    Maria Salete de Souza Nery

    2017-01-01

    Full Text Available From the symbolic embracing of the Boticário Group’s Distribution Center by the São Gonçalo community members (State of Bahia, at the interstate highway BR-101, this study seeks to understand fragrance market in Brazil and, specifically, the role the Northeast Region plays in it. Lastly, the study sought to understand the recent fluctuations shown in the national map of production and consumption of perfume, specifically between 2010 and 2016. It is assumed that fragrances relate to the symbolic realm and, therefore, are a cultural product full of meanings and traversed by capitalist interests.

  12. Correspondência eficiente de descritores SIFT para construção de mapas densos de pontos homólogos em imagens de sensoriamento remoto

    Directory of Open Access Journals (Sweden)

    Marcelo Teixeira Silveira

    Full Text Available Métodos automáticos de localização de pontos homólogos em imagens digitais baseados em área, combinados com técnicas de crescimento de região, são capazes de produzir uma malha densa e exata de pontos homólogos. Entretanto, o processo de crescimento de região pode ser interrompido em regiões da imagem, cuja paralaxe no eixo horizontal apresenta variação abrupta. Essa situação geralmente é causada por uma descontinuidade na superfície ou espaço-objeto imageado, tal como um prédio numa cena urbana ou um paredão de exploração de uma mina a céu aberto. Nesses casos, novos pares de pontos homólogos (sementes devem ser introduzidos, normalmente por um operador humano, a partir dos quais o processo é reiniciado. Dependendo do tipo da imagem utilizada e da estrutura 3D da região mapeada, a intervenção humana pode ser considerável. Uma alternativa totalmente automatizada em que se combinam as técnicas SIFT (Scale Invariant Feature Transform, pareamento por mínimos quadrados e crescimento de região foi proposta anteriormente pelos autores. O presente trabalho apresenta uma extensão a essa técnica. Basicamente, propõem-se alterações na etapa de correspondência do SIFT, que exploram características de estereogramas produzidos por sensores aéreos e orbitais. Avaliações experimentais demonstram que as modificações propostas trazem dois tipos de benefícios. Em primeiro lugar, obtém-se um aumento do número de pontos homólogos encontrados, sem aumento correspondente na proporção de falsas correspondências. Em segundo lugar, a carga computacional é reduzida substancialmente.

  13. O projeto museográfico da exposição Cartografia de uma história - São Paulo colonial: mapas e relatos

    Directory of Open Access Journals (Sweden)

    Ricardo Nogueira Bogus

    2009-01-01

    Full Text Available This article presents the museum set design project for Cartography of a history, an exhibition opened at Museu Paulista/São Paulo University in March 2005. The said project was conceived and developed based on a combination of the research team´s ideas and the profile of visitors to the Museum. It is therefore an integrated pursuit whose purpose was to approach the process of discovery in a playful manner.

  14. Surgimiento de la Escuela de Obstetricia en el mapa social de Costa Rica: finales del siglo XIX y principios del XX

    Directory of Open Access Journals (Sweden)

    Daniel Martínez Esquivel

    2015-01-01

    Full Text Available Introducción. El presente artículo muestra los resultados preliminares que forman parte de la investigación “Funciones sociales de la Enfermería en los diversos procesos históricos desde la construcción de la Salud Pública en la Costa Rica contemporánea”,  cuyo propósito es analizar los hechos sociales e históricos que favorecieron la profesionalización de la Enfermería, en un primer momento, con la fundación de la Escuela de Obstetricia en 1897.Materiales y método: Este artículo responde a una investigación histórica basada en tres pasos: la revisión de fuentes primarias como la Gaceta Médica y los informes de la Junta de Caridad, y fuentes secundarias; la evaluación crítica de los datos; y la interpretación y conclusiones de los hechos.Resultados: Los hechos que favorecieron la fundación de la Escuela de Obstetricia se relacionaron con la creciente tasa de mortalidad infantil, la necesidad de institucionalizar las prácticas sanitarias e higienizar a la población para construir un Estado fuerte que promoviera el desarrollo económico, así como con la lucha que emprendió la institución médica contra las prácticas populares de atención de salud.Conclusión. Se concluye que la represión de la curandería y la partería estuvo relacionada con el poder patriarcal. Además, la fundación de la Escuela de Obstetricia se relacionó a las condiciones sociales, políticas y económicas de la época basadas en la línea de desarrollo que estaba teniendo el país

  15. Mapa de apoio à gestão de dívida técnica no processo de teste de software

    OpenAIRE

    SOUSA, Cleydiane Lima de

    2016-01-01

    Dívida Técnica (DT) está relacionada a tarefas que devem ser executadas e são acumuladas ao longo de um projeto para serem realizadas posteriormente. A falta de planejamento de tempo e recursos em um projeto, dentre outros problemas, propiciam seu surgimento. DTs não solucionadas tendem a criar dependências e aumentar o grau de complexidade para correção, resultando em maior esforço, custo e retrabalho em um projeto. A sua identificação e gerenciamento ao longo de um projeto é essencial para ...

  16. Entre el mapa y el croquis: problematizando la segregación espacial de los migrantes paraguayos en la Ciudad de Buenos Aires

    Directory of Open Access Journals (Sweden)

    Gabriela Mera

    2017-12-01

    Full Text Available En el marco de la pregunta por la segregación espacial de los inmigrantes en las ciudades, el presente artículo se propone estudiar cómo se distribuyen los paraguayos en la Ciudad de Buenos Aires, indagando en cómo se articula la concentración de este colectivo en determinadas zonas del espacio urbano con las interacciones cotidianas que desarrollan. Partiendo de una mirada crítica respecto de la noción de segregación espacial entendida como sinónimo de distribución desigual, se trabaja desde una articulación de métodos cuantitativos y cualitativos, buscando brindar elementos conceptuales, metodológicos y empíricos para problematizar la relación entre distancias físicas y distancias sociales; entre la concentración espacial de los paraguayos en la ciudad y la construcción de fronteras sociales y simbólicas, en cuyo marco las diferencias y distancias se construyen como tales.

  17. RELIEVE: A FORTRAN 77 program for numerical and graphical processing of digital topographic maps; RELIEVE: Un programa FORTRAN para procesamiento numerico y grafico de mapas topograficos digitalizados

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, J.J.; Gorostiza, C.

    1995-12-01

    The RELIEVE program was developed in order to its integration with the expert system SIRENAS, in the frame of the Industrial Risks Programme, within the CIEMAT center. For accomplishing this mentioned system, arose the necessity of an additional component unable for analyzing the topography (relieve) of the territory in which the focused site is located. That one is just the mission of the RELIEVE program. Basically RELIEVE analyses the digitalized data points of a determined topographic area, around a location of interest. The program allows us estimation by numerical techniques, using IMSL library, of the deep width, and other geometrical characteristics of the valley that are involved in. Optionally RELIEVE produces also graphical outputs concerning 3D representation of topographical map, level curves, sections of interest considered in the valley, etc., by means of the DISSPLA II library, running in the IBM system of the CIEMAT. (Author)

  18. RELIEVE: A FORTRAN 77 program for numerical and graphical processing of digital topographic maps; RELIEVE: Un programa FORTRAN para procesamiento numerico y grafico de mapas topograficos digitalizados

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, J.J.; Gorostiza, C.

    1995-07-01

    The RELIEVE program was developed in order to its integration with the expert system SIRENAS, in the frame of the Industrial Risks Programme, within the CIEMAT center. For accomplishing this mentioned system, arose the necessity of an additional component enabled for analyzing the topography (relieve) of the territory in which the focused site is located. That is just the mission of the RELIEVE program. Basically RELIEVE analyses the digitalized data points of a determinate topographic area, around a location of interest. The program allows us estimation by numerical techniques, using IMSL library, of the deep width, and other geometrical characteristics of the valley that is involved in. Optionally RELIEVE produces also graphical outputs concerning 3D representation of topographical map, level curves, sections of interest considered in the valley, etc., by means of the DISSPLA II library, running in the IBM system of the CIEMAT. (Author) 5 refs.

  19. Utiliza????o do mapa pedol??gico na caracteriza????o geot??cnica da Aris Mestre D`Armas em Planaltina ??? DF

    OpenAIRE

    Paranhos, Haroldo; Farias, Rideci; Silva, Joyce Maria Lucas; Pereira, Paulo Sergio

    2016-01-01

    O presente trabalho apresenta os resultados dos estudos geot??cnicos realizados na ARIS Metre D???Armas em Planaltina ??? DF, com vistas ?? caracteriza????o geot??cnica dos solos e risco geot??cnico, por meio de levantamento de campo, sondagens SPT, sondagens com penetr??metro de anel e sondagens ?? trado, com coleta de amostras, ensaios de permeabilidade em furos de sondagens e ensaios de caracteriza????o dos solos em laborat??rio. Como ferramenta auxiliar na espacializa????o e defi...

  20. Poder-saber-querer: os terrenos disciplinares da alma e do autogoverno no primeiro mapa das ciências da educação (1879-1911

    Directory of Open Access Journals (Sweden)

    Jorge Ramos do Ó

    2012-02-01

    Full Text Available Este artigo procura mostrar que a sedimentação histórica de um discurso coerente, quer sobre o estatuto científico da pedagogia, quer sobre os fins do ato educativo moderno, pode ser igualmente discutida no quadro geral da secularização da moral e da expansão do princípio político do self-government. Para tanto nele se defende que uma formação discursiva de caráter pedagógico assumiu em finais do século XIX a centralidade do material ético, assimilando-o ao axioma do poder iluminista-humanista em que o comportamento cívico do cidadão deve decorrer dos compromissos e decisões da esfera privada da sua consciência. Como é analisada aqui, a psicopedagogia moderna foi estruturada historicamente como mais um regime do eu.

  1. A tertiary approach to improving equity in health: quantitative analysis of the M?ori and Pacific Admission Scheme (MAPAS) process, 2008?2012

    OpenAIRE

    Curtis, Elana; Wikaire, Erena; Jiang, Yannan; McMillan, Louise; Loto, Rob; Airini,; Reid, Papaarangi

    2015-01-01

    Introduction Achieving health equity for indigenous and ethnic minority populations requires the development of an ethnically diverse health workforce. This study explores a tertiary admission programme targeting M?ori and Pacific applicants to nursing, pharmacy and health sciences (a precursor to medicine) at the University of Auckland (UoA), Aotearoa New Zealand (NZ). Application of cognitive and non-cognitive selection tools, including a Multiple Mini Interview (MMI), are examined. Methods...

  2. Nová mapa extrémních nárazů větru v České republice

    Czech Academy of Sciences Publication Activity Database

    Pop, Lukáš; Sokol, Zbyněk

    2016-01-01

    Roč. 69, č. 3 (2016), s. 90-95 ISSN 0026-1173 Institutional support: RVO:68378289 Keywords : extreme value analysis * Gumbel distribution * wind measurements * wind gusts * Czech Republic Subject RIV: DG - Athmosphere Sciences, Meteorology

  3. Mapa Sociolinguistico. Analisis demolinguistico de la Comunidad Autonoma Vasca derivado del padron de 1986 (Sociolinguistic Map. Demolinguistic analysis of the Autonomous Basque Community derived from the 1986 Census).

    Science.gov (United States)

    Basque Autonomous Community, Vitoria (Spain). General Secretariat of Linguistic Policy.

    Sociolinguistic data are presented in the form of sophisticated maps and tables in this pioneering study on the status of the Basque language. Based on information collected from the 1986 census, the major demographic characteristics of Basque are examined in order to ascertain the factors and processes that have contributed to its current status.…

  4. A Educação Médica entre mapas e âncoras: a aprendizagem significativa de David Ausubel, em busca da Arca Perdida

    Directory of Open Access Journals (Sweden)

    Andréia Patrícia Gomes

    Full Text Available O processo de aprendizagem tem motivado, desde a Antigüidade, intensos debates. Dentre as diferentes teorias propostas tem ganho relevância, nos séculos XX e XXI, a concepção cognitivista de David Ausubel, na qual se assume que os mecanismos do aprender são mais eficientes em situações nas quais o estudante consegue, utilizando conhecimentos prévios, agregar e incorporar significado aos novos conteúdos, evitando-se, assim, que esse conhecimento recém-incorporado seja armazenado, por meio de associações ineptas, à estrutura cognitiva. No âmbito da educação médica, diante das imperiosas mudanças necessárias para a formação de um profissional que aprenda a aprender, a aprendizagem significativa permite uma genuína contextualização dos conhecimentos necessários à prática médica, facultando, portanto, um aprendizado mais efetivo e permitindo a atuação em um contexto complexo e interdisciplinar. Em conformidade com o exposto, o presente manuscrito objetiva apresentar a teoria da aprendizagem significativa, discutindo elementos da incorporação deste conceito à educação médica.

  5. Otra educación es posible: rutinas de pensamiento, PBL, mapas mentales, evaluación por rúbricas

    OpenAIRE

    Casado, Carlos

    2016-01-01

    Introducción de la cultura del pensamiento con aplicación de rutinas y destrezas de pensamiento en el aula para desarrollo del pensamiento. Enfoque del pensamiento visible “Visible Thinking” en Project Zero. Pasos y estrategias fundamentales para aplicar el aprendizaje basado en problemas y proyectos de manera efectiva en el aula, descripción de herramientas TIC y técnicas de trabajo cooperativo. Nuevas herramientas y estrategias ...

  6. 2008 Post-Election Survey of Department of State Voting Assistance Officers: Administration, Datasets, and Codebook

    Science.gov (United States)

    2009-08-01

    denominators. *************************************************************/ array mapa (*) VISFVAPA VISFVAPB VISFVAPC VISFVAPD VISFVAPE...VISFVAPDR VISFVAPER VISFVAPFR VISFVAPGR VISFVAPHR VISFVAPIR VISFVAPJR VISFVAPKR VISFVAPLR; do I = 1 to dim( mapa ); mapb(i)= mapa (i); end...VISFVAPJ VISFVAPK VISFVAPL) > 0 then do; do i = 1 to dim( mapa ); if mapb(i)=. then mapb(i)=1; /**No**/ end; end; Drop i

  7. Mapa das juventudes de Santo André, SP: instrumento de leitura das desigualdades sociais Mapa de las juventudes de Santo André, Sureste de Brasil: instrumento de lectura de las desigualdades sociales Youth map of the city of Santo André, Southeastern Brazil: an instrument to read social inequalities

    Directory of Open Access Journals (Sweden)

    Tatiana Yonekura

    2010-02-01

    Full Text Available OBJETIVO: Analisar as desigualdades sociais de jovens moradores em área urbana pelo mapeamento de dados sociodemográficos e econômicos. MÉTODOS: Utilizando-se dados do Censo Demográfico 2000, 57 variáveis sociodemográficas e econômicas de jovens de 15 a 24 anos do município de Santo André, SP, foram distribuídas por 43 regiões de dados estatísticos que correspondem a um recorte do território em distritos menores. Os dados foram coletados no Departamento de Indicadores Sociais e Econômicos da Prefeitura Municipal de Santo André, referentes ao ano 2000. Por meio de análise fatorial, 13 variáveis foram agrupadas em dois fatores - condições de trabalho e condições de vida, que discriminaram estatisticamente regiões semelhantes entre si. Foi realizada análise por agrupamento das regiões, resultando em quatro grupos sociais. RESULTADOS: O espaço que concentrava os jovens com mais acesso à riqueza foi classificado como central e aqueles com menos acesso, como periférico. Duas gradações intermediárias puderam ser identificadas, uma mais próxima ao extremo do acesso ("quase central" e outra mais próxima à privação ("quase periférica". As variáveis discriminantes estavam relacionadas ao trabalho, à migração, escolaridade, fecundidade, posição do jovem no domicílio, presença de cônjuge ou companheiro, condição de moradia e posse de bens. CONCLUSÕES: As diferenças entre os grupos sociais expressaram desigualdades importantes entre os jovens que vivem, estudam e/ou trabalham na cidade, o que contribuirá para o planejamento de políticas sociais públicas dirigidas a esses grupos.OBJETIVO: Analizar las desigualdades sociales de jóvenes moradores en área urbana por el mapeo de datos sociodemográficos y económicos. MÉTODOS: Utilizándose datos del Censo Demográfico 2000, 57 variables sociodemográficas y económicas de jóvenes de 15 a 24 años del municipio de Santo André, Sureste de Brasil, fueron distribuidas por 43 regiones de datos estadísticos que corresponden a un recorte del territorio en distritos menores. Los datos fueron colectados en el Departamento de Indicadores Sociales y Económicos de la Prefectura Municipal de Santo André, referentes al año 2000. Por medio de análisis factorial, 13 variables fueron agrupadas en dos factores – condiciones de trabajo y condiciones de vida, que discriminaron estadísticamente regiones semejantes entre sí. Fue realizado análisis por agrupamiento de las regiones, resultando en cuatro grupos sociales. RESULTADOS: El espacio que concentraba los jóvenes con más acceso a la riqueza fue clasificado como central y aquellos con menos acceso, como periférico. Dos gradaciones intermediarias pudieron ser identificadas, una más próxima al extremo del acceso ("quase central" y otra más próxima a la privación ("quase periférica". Las variables discriminantes estaban relacionadas al trabajo, a la migración, escolaridad, fecundidad, posición del joven en el domicilio, presencia de conyugue o compañero, condición de vivienda y pose de bienes. CONCLUSIONES: Las diferencias entre los grupos sociales expresaron desigualdades importantes entre los jóvenes que viven, estudian y/o trabajan en la ciudad, o que contribuirá para la planificación de políticas sociales públicas dirigidas a esos grupos.OBJECTIVE: To analyze social inequalities in young adults living in an urban area by mapping sociodemographic and economic data. METHODS: Using data from the 2000 Demographic Census, 57 sociodemographic and economic variables of young adults aged from 15 to 24 years, living in the city of Santo André, Southeastern Brazil, were distributed among 43 areas of statistical data, corresponding to a division of the region into smaller districts. Data from the year 2000 were collected from the Santo André City Hall Department of Socioeconomic Indicators. Using factorial analysis, 13 variables were grouped in two factors - working conditions and life conditions, which distinguished areas that were similar to one another statistically. Cluster analysis of areas was performed, resulting in four social groups. RESULTS: The area that concentrated young adults with higher access to wealth was classified as central and that including individuals with lower access to wealth was classified as peripheral. Two intermediate areas could be identified, one closer to the highest access to wealth ("almost central" and another close to the lowest access to wealth ("almost peripheral". Discriminating variables were associated with work, migration, level of education, fertility, adolescent's position in the household, presence of spouse or partner, living conditions and assets owned. CONCLUSIONS: Differences among social groups revealed important inequalities among young adults who live, study and/or work in the city, which will contribute to the planning of public social policies aimed at these groups.

  8. Competitiveness in International Trade in Knowledge-Intensive Services – The Case of Poland

    Directory of Open Access Journals (Sweden)

    Wyszkowska-Kuna Joanna

    2014-06-01

    Full Text Available Celem artykułu jest zbadanie konkurencyjności Polski w międzynarodowym handlu usługami nasyconymi wiedzą. Autorka analizuje tendencje w międzynarodowych transakcjach Polski w usługach nasyconych wiedzą i stara się odpowiedzieć na pytanie, czy Polska przesuwa się w kierunku osiągnięcia przewagi komparatywnej w tym obszarze.

  9. The reaction of Polish market to last year's changes on international coke and steel market

    Energy Technology Data Exchange (ETDEWEB)

    Czornik, G.; Gabriel, D. [Polski Koks S.A. (Poland)

    2004-07-01

    The presentation, outlined in 16 slides/overheads, discussed the following: Poland's position in the world market; the Polish coking industry and the world coke and steel industry; the reaction of Polish coke plants; the effect of the increase in coke prices; ownership changes in Poland's coking industry scenarios for the future; the role of Polski Koks in Poland's coking industry; and sales and exports of coke by Polski Koks.

  10. Polish families in the face of challenges and threats posed by the first half of the 20th century (in the light of „Szkoła” [Rodziny polskie wobec wyzwań i zagrożeń pierwszej połowy XX wieku (w świetle „Szkoły”

    Directory of Open Access Journals (Sweden)

    Agnieszka WAŁĘGA

    2016-06-01

    Full Text Available For Polish people and Polish families the first half of the 20th century was a difficult time. It was the final period of the Partitions, with intensified repression, especially Russification and Germanization, the time of World War I, and twenty years of the rebuilding of Polish statehood which ended in another worldwide armed conflict in 1939. The dynamic political changes which led to the outbreak of WWI and WWII and to the regaining of independence by Poland in 1918 were accompanied by significant transformations of social structure and new tendencies in the development of culture and education. The change of women’s social position and their political and educational emancipation forced new models of family relations to appear, and a uniform school system reconstructed after 123 years of bondage, together with the introduction of compulsory school attendance and the development of forms of pre-schooling education were significant challenges for many parents and their children. During the entire period the Polish family played a very important part in educational ideologies binding in Polish lands at that time – national and state education. Because of that it was the subject of interest of many pedagogic magazines. The aim of the paper is to indicate the main areas of tasks given to Polish families in the first half of the 20th century in the light of one of the oldest Polish periodicals of this type – „Szkoła”. Apart from the topics brought up in the pages of this magazine in the second half of the 19th century such as the cooperation of home and school, some new problems appeared then, including: the duties of a family in the difficult war and post-war period, concern for child’s health at home, or the significance of parents’ shaping of characteristics propagated by the supporters of national education.

  11. Freezing Point Depressions of Phase Change CO2 Solvents

    DEFF Research Database (Denmark)

    Arshad, Muhammad Waseem; Fosbøl, Philip Loldrup; von Solms, Nicolas

    2013-01-01

    Freezing point depressions (FPD) in phase change solvents containing 2-(diethylamino)ethanol (DEEA) and 3-(methylamino)propylamine (MAPA) were measured using a modified Beckmann apparatus. The measurements were performed for the binary aqueous DEEA and MAPA solutions, respectively...

  12. Iap, redes y mapas sociales : desde la investigación a la intervención social = Active research action, networks and sopcial maps : from research to social intervention

    OpenAIRE

    Alberich Nistal, Tomás

    2008-01-01

    La sociedad actual está caracterizada por la inestabilidad, el miedo y por algunos de sus síntomas o enfermedades, como son la hiper-especialización, la dependencia, el corporativismo y el localismo, en un contexto de mercados globalizados y del incremento de la desigualdad social. Frente a estas enfermedades está la autonomía y la participación directa de personas y colectivos. Desde las ciencias sociales se han desarrollado, desde hace bastantes años, teorías y metodologías que favorecen es...

  13. Application of genetic algorithm with genetic modification and quality map in production strategy optimization; Aplicacao de algoritmo genetico com modificacao genetica e mapa de qualidade na otimizacao de estrategia de producao

    Energy Technology Data Exchange (ETDEWEB)

    Nakajima, Lincoln; Maschio, Celio; Schiozer, Denis J. [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Faculdade de Engenharia Mecanica. Dept. de Engenharia de Petroleo

    2008-07-01

    The definition of position and number of wells is the most important stage on production strategy selection, since it will affect the reservoir behavior, which influences future decisions. However this process is time-consuming and it is often a trial-and-error approach. Many studies have been made in order to reduce the engineer's effort in this stage, by minimizing the number of simulation runs through proxy models or by automating the whole process, using some optimization algorithm. This work proposes a methodology that integrates genetic algorithm and quality map to automate the production strategy optimization. It is also introduced the concept of genetic modification, which is the procedure to update the quality map according to the wells production of each evaluated strategy. The objective is to improve the evolutionary process, allowing the evaluation of more promising alternatives, improving the chance of obtaining better solutions without a substantial increase in the number of simulations. (author)

  14. Determinación parcial del mapa de restricción del DNA mitocondrial de la nutria gigante de río Pteronura brasiliensis y comparación con otros mustélidos colombianos en cautiverio

    OpenAIRE

    Bernal J.; Hernández J.; Samper M.

    2001-01-01

    La nutria gigante de río Pteronura brasiliensises un mamífero carnívoro de la familia Mustelidae, ala cual pertenecen también las tairas y los hurones. La nutria es considerada por el CITES comouna especie vulnerable y por la IUCN como especie en peligro de extinción. Por esta razón, elCentro de Biología Molecular del Gimnasio Campestre inicio un proyecto de genética conser-vacionista que pretende proveer información utilizable para el análisis, tanto de la especieP. brasiliensiscomo de sus f...

  15. Traçando mapas: a teoria histórico-cultural e as contribuições para a pesquisa com crianças e suas espacialidades

    Directory of Open Access Journals (Sweden)

    Jader Janer Moreira Lopes

    2015-04-01

    Full Text Available Este texto busca fazer uma reflexão sobre as pesquisas sistematizadas no campo da infância, tendo como enfoque principal as estratégias de pesquisas “com crianças”. O recorte ao qual nos dedicamos são as relações que as crianças estabelecem com o meio, tendo como foco principal as suas espacialidades. A partir das contribuições de pesquisas que se aportam em estratégias de natureza qualitativas e fundamentadas nos aportes da teoria históricas cultural, elege-se o conceito de vivência (perejivanie como mote em torno do qual nossos trabalhos são desenvolvidos. Para isso, traça-se, inicialmente, a origem da pesquisa com base em paradigmas positivistas e evidenciam-se alguns caminhos que buscaram romper com essa perspectiva: os postulados etnográficos de Malinovky e Boas; o Interacionismo simbólico, cujo precursor é George Herbert Mead; a Etnometodologia de Harold Garfinkel; as contribuições de Marx e os princípios estabelecidos por Vigotski e seus colaboradores.

  16. Interação social e metodologias de ensino: o caso do laboratório de troca de afetos - lata sob as narrativas de seus participantes através do mapa conceitual

    Directory of Open Access Journals (Sweden)

    Maria Cleide Rodrigues Bernardino

    2014-04-01

    Full Text Available http://dx.doi.org/10.5007/1518-2924.2014v19n39p59 Aborda as metodologias baseadas nas trocas de experiências ilustradas pelo projeto LATA - Laboratório de Troca de Afetos, do Curso de Biblioteconomia da Universidade Federal do Ceará, Campus Cariri. O projeto foi pensado e é executado dentro dos parâmetros das possibilidades de aprendizagem através da troca de experiências, tendo como norte a interação social do aluno com a sociedade, seja em sala de aula ou fora dela. Trata-se de uma pesquisa exploratória, cuja coleta de dados se fez por meio de entrevista narrativa intermediada por questionário no google docs, e o tratamento dos resultados pela análise de conteúdo. O ambiente da investigação se deu no âmbito acadêmico, com 40 alunos que participaram da disciplina Cultura e Mídia, onde o projeto é executado e contemplou três questionamentos: você considera que o aprendizado por meio da troca de experiências tem sido significativo do ponto de vista profissional? O que você sente ao ver outras pessoas contando suas histórias e notar que algumas são comuns às suas experiências? Entre o método convencional, leituras, resenhas, provas escritas, seminários, o que mais tem lhe ajudado a desenvolver um senso crítico e proporcionado maior desenvoltura?  As reflexões oriundas da análise dos dados, além de funcionar como feedback da aceitação da metodologia por parte dos alunos, também contribui para uma avaliação do projeto a fim de corrigir possíveis falhas e contribuir efetivamente para a construção do conhecimento.

  17. De mapas, cartografías y coyunturas sobre la relación entre la cultura y el poder: itinerarios y desafíos de los Estudios Culturales

    Directory of Open Access Journals (Sweden)

    Juan Ricardo Aparicio

    2018-04-01

    Full Text Available This article consists of four conversations which form a sort of map of the questions and problems which have marked the evolution of Cultural Studies, starting with an approach, close to structuralism, which holds that language is the key factor in ordering societies. It then goes on to cultural Marxism, which offers a complex analysis of societies and the notion of determination. It continues with Foucault’s interrogation of the present and how we have been constituted as both subjects and objects of knowledge, and disciplining and regulation. Finally, it addresses affect theory, to highlight the need to integrate everyday life into a complex analysis of power.

  18. Mapa y jerarquía espacial de la pobreza en México. Un nuevo procedimiento para identificar el patrón espacial de los problemas sociales

    Directory of Open Access Journals (Sweden)

    Jesús A. Treviño C.

    2016-01-01

    Full Text Available Esta investigación presenta y aplica un nuevo procedimiento para jerarquizar espa- cialmente la pobreza. El método propuesto combina simultáneamente variables de magnitud e intensidad utilizando técnicas estadísticas recientes (remuestreo y auto - correlación espacial y tradicionales, así como rutinas de superposición espacial de los Sistemas de Información Geográfica. Mientras magnitud e intensidad se refieren a datos absolutos y relativos, respec- tivamente, cada variable puede estar concentrada o aglomerada en el espacio. En este estudio, concentración es la presencia de valores globales altos, independiente- mente de su localización, y aglomeración es la concentración de valores locales altos espacialmente contiguos. Ambas, aglomeración y concentración, son fusionadas mediante un procedimiento de superposición geográfica para crear conglomerados de magnitud o intensidad de pobreza. Los casos al interior de estos conglomerados son clasificados por procedimientos gaussianos (discontinuidades naturales o pa- retianos (puntas y colas para crear una jerarquía espacial. Por primera vez en el estudio de la pobreza, la jerarquía espacial resultante es producto de la combinación simultánea de los procesos de concentración y aglome- ración medidos en términos absolutos y relativos. Los beneficios del procedimiento en una política pública espacialmente orientada son ilustrados abordando la focali- zación espacial de la pobreza en los 2 456 municipios mexicanos en el 2010. La meto- dología propuesta en esta investigación puede adaptarse fácilmente para identificar los patrones espaciales de otros problemas sociales, tales como crimen, industria, enfermedades, contaminación o justicia ambiental en diferentes áreas o países.

  19. Precisión de la aproximación geoide y geoestadística: cómo encontrar un mapa contínuo de datos de gravedad absoluta

    Directory of Open Access Journals (Sweden)

    Hongzhi Song

    2015-10-01

    Full Text Available An accurate geoid model is needed for surveyors and engineers who require orthometric heights on a common datum, and environ- ment scientists who require elevations relative to present sea level. Airborne gravity data has been collected by the National Geodetic Survey (NGS under the Gravity for the Redefinition of the Amer- ican Vertical Datum (GRAV-D project and is available along the coasts of the Gulf of Mexico. For this study we obtained a set of abso- lute gravity data derived from full-field gravity at altitude/elevation. We used the data to derive free-air gravity anomalies to establish gravity on the geoid. For spatial interpolation we used the kriging method to estimate gravity on the geoid in any location and krig- ing of the difference between gravity on the ellipsoid of reference and the geoid. Various kriging methods were used for evaluation of errors calculated in this study. The mean precision of the predicted val- ues is around 1.23 cm, a very good result for coastal regions, which traditionally have sparse gravity data sets.

  20. Mapa bibliométrico de la investigación realizada en atención primaria en España durante el periodo 2008-2012

    Directory of Open Access Journals (Sweden)

    Jesús López-Torres Hidalgo

    2014-12-01

    Conclusiones: En las publicaciones de atención primaria existe gran diversidad tanto en áreas de investigación como en las revistas donde se publican. La mayoría proceden de centros de salud, tratan aspectos clínicos y se publican en revistas españolas. Se observan diferencias en el volumen de producción científica entre comunidades autónomas.

  1. Aplicación de las técnicas de teledetección y SIG a la determinación y análisis de mapas de evapotranspiración

    OpenAIRE

    Reca Cardeña, Juan; Medina, J. L.; Camacho, E. F.; López, R.; Roldán Cañas, José

    1999-01-01

    La estimación de la evapotranspiración es esencial en los sistemas de riego, en el cálculo de pérdidas de agua en embalses, en la estimación de balances hídricos, en las predicciones de escorrentía, así como en estudios climatológicos y meteorológicos. Las nuevas técnicas denominadas teledetección y sistemas de información geográfica (SIG) permiten el cálculo de la distribución espacial de este parámetro. Un nuevo modelo racional, SEBAL (Bastiaanssen, 1995), basado en la ecuación de conservac...

  2. Kulturní krajina Černínů z Chudenic. Obrazová mapa panství Lnáře (1698) a Dietzlerův prospekt Lnář (1725)

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Robert

    2015-01-01

    Roč. 84, č. 1 (2015), s. 410-450 ISSN 0323-004X R&D Projects: GA ČR(CZ) GBP410/12/G113 Institutional support: RVO:67985963 Keywords : historical landscape * prospect of landscape * old maps * vedute * nobility * representation * Černín of Chudenice * Lnáře Subject RIV: AB - History

  3. Elaboración de un mapa que muestre los grados de vulnerabilidad sísmica, para viviendas de uso residencial en la comuna 7 de la ciudad de Cúcuta

    Directory of Open Access Journals (Sweden)

    Adriana Rodríguez-Lizcano

    2010-01-01

    Full Text Available The seismic risk doesn’t depend on the threat or the probability of occurring a seismic event, but also the highest vulnerability that many buildings have, because they haven’t been built with the appropiate regulations, also they don’t have minimun structure conditions, shape, strength which make them more susceptible to damage. The purpose of the research is to develop a map that shows the seismic vulnerability of housing one or two floors of residencial Comuneros, Chapinero and Claret neigborhoods in the comuna 7 of Cúcuta city. We used the Vulnerability index method by (Benedetti and Petrini 1984 we chose a propability sample of 336 houses distributed proportionally according to the neighborhood. The instrument applied in this researh is designed according to the parameters that The Colombian Earthquake Resistent Design and Construction NSR- 98 stablished, the investigation showed that 70% of these houses are into the highest vulnerability seismic level, the 22% is into the intermediate vulnerability seismic level and just the 8% of the tested houses are into the lowest vulnerability seismic level, and the research also conclude that exists a big relation between the level of the seismic vulnerability of these houses and the social level of their habitants.

  4. Mapa del proteoma de parásitos de Leishmania Viannia a partir de electroforesis de geles de poliacramida en dos dimensiones y otras técnicas asociadas

    OpenAIRE

    Rafael Góngora; Nathalie Acestor; Manfredo Quadroni; Nicolas Fasel; Nancy G. Saravia; John Walker

    2003-01-01

    En este estudio demostramos el potencial de la electroforesis en dos dimensiones (2DE) como herramienta para la caracterización del proteoma de Leishmania (expresión proteica complementaria del genoma). Los proteomas por 2DE en el rango neutro (pH 5-7) de extractos solubles de promastigotes de Leishmania (Viannia) guyanensis y Leishmania (Viannia) panamensis fueron reproducibles usando tampón de lisis de urea y nonidet P-40. Con la tinción de azul de Coomassie y nitrato de plata se detectaron...

  5. La evolución del mapa social del Gran San Miguel de Tucumán. Un estudio del periodo 1991 a 2010 a través del análisis factorial

    Directory of Open Access Journals (Sweden)

    Ana Ester Batista Zamora

    2017-12-01

    Full Text Available El aglomerado del Gran San Miguel de Tucumán, capital de la Región Noroeste de la República Argentina, ha experimentado un notable aumento de población desde 1991. Dicha población dista de ser homogénea en lo relativo a sus niveles de instrucción, estructura por edad o características de sus viviendas, entre otras, al tiempo que el aumento del parque habitacional ha tenido lugar entre dos extremos: urbanizaciones cerradas y barrios de habitat popular, en muchas ocasiones con problemas dominiales. En este contexto, y aplicando análisis factoriales de componentes principales a 13 variables censales, correspondientes a los Censos de población de 1991, 2001 y 2010, mostramos cómo las causas subyacentes a la distribución espacial de la población se han mantenido muy estables durante el periodo analizado, al tiempo que su distribución espacial refleja un proceso de progresiva polarización y problemas habitacionales no resueltos.

  6. A new methodology for strategic planning using technological maps and detection of emerging research fronts applied to radiopharmacy; Uma nova metodologia para planejamento estrategico utilizando mapas tecnologicos e deteccao de frentes emergentes de pesquisa aplicada a radiofarmacia

    Energy Technology Data Exchange (ETDEWEB)

    Didio, Robert Joseph

    2011-07-01

    This research aims the development of a new methodology to support the strategic planning, using the process of elaboration of technological maps (TRM - Technological Roadmaps), associated with application of the detection process of emerging fronts of research in databases of scientific publications and patents. The innovation introduced in this research is the customization of the process of TRM to the radiopharmacy and, specifically, its association to the technique of detection of emerging fronts of research, in order to prove results and to establish a new and very useful methodology to the strategic planning of this area of businesses. The business unit DIRF - Diretoria de Radiofarmacia - of IPEN CNEN/SP was used as base of the study and implementation of this methodology presented in this work. (author)

  7. La organización y búsqueda de conocimiento en entornos amplios, dispersos pero limitados. El Mapa de ayudas a la I+D+i del CDTI 63

    Directory of Open Access Journals (Sweden)

    Ponce Martínez, Javier

    2009-09-01

    Full Text Available The arrangement and the search of knowledge within open environments, dispersed but within limits and whose featured information is somewhat structured and contrasted, does not require large and expensive search engines based on endless index files. New light-weight knowledge management systems based upon the use of folksonomies, whose design also caters for better visualization to the uses, provide fast access to the information and potentially the arrangement of results according to the orientation or point of view required by the user. We at the department for the Promotion of Innovation of CDTI have recently launched a such system, through which to provide electronic information services on all of the public aids aimed at business R&D available from local, autonomous communities and central state governments as well as from the European Union.La organización y búsqueda de conocimiento dentro de entornos amplios, dispersos pero limitados y con una información relativamente estructurada y contrastada no necesita de grandes y costosas herramientas de búsqueda con ingentes volúmenes de información indexada. La utilización de ligeros sistemas de gestión del conocimiento haciendo uso de folksonomías y concebidos bajo una buena estrategia de visualización permiten acceder a la información de forma rápida, y con la potencialidad de estructurar el resultado de búsqueda con la orientación o punto de vista deseado por el usuario. Desde el departamento de promoción de la innovación del CDTI hemos puesto en marcha recientemente un sistema de esta naturaleza, a través del cual se presta un servicio electrónico de información sobre el conjunto de ayudas públicas a la I+D+i empresarial que ofrecen las distintas administraciones locales, autonómicas, estatal y europea.

  8. Of the Work to Myths: a new line in the map of the research in Ethnomathematics Do Labor aos Mitos: uma nova linha no mapa das pesquisas em Etnomatemática

    Directory of Open Access Journals (Sweden)

    Wanderleya Nara Gonçalves Costa

    2009-04-01

    Full Text Available In this paper we accentuate the existence of a new line of research in the inside of the Ethnomathematics Program. In its origin, the research in this area had searched to more understand the diversity of the mathematical thought from a careful look for work activities. However, in the last years, we have considered with more attention the affirmation of anthropologists of whom the myths it can be used to understand the questions most basic of the human thought and also specific questions on the society that produced them. With the use of this idea the myths of the different peoples are perceived as informing regarding its Ethnomathematics.Currently, thus together with the activities of work, the myths constitute a support on which we are tracing a line of research. Keywords: Research. Ethnomathematics Program. Myths.Neste artigo, ressaltamos a existência de uma nova linha de pesquisas no interior do Programa Etnomatemática. Na sua origem, as pesquisas nessa área buscaram compreender a diversidade do pensamento matemático, a partir de um olhar mais acurado para atividades de trabalho. Entretanto, nos últimos anos, temos considerado com mais atenção a afirmação de antropólogos de que os mitos servem, tanto como vias para se chegar às questões mais fundamentais do pensamento humano, quanto para compreendermos questões específicas sobre a sociedade que os produziu. É a partir dessa idéia que os mitos fundantes dos diferentes povos passaram a ser vistos como informantes a respeito de suas etnomatemáticas. Assim, atualmente, junto com as atividades laborais, os mitos constituem um suporte sobre o qual estamos traçando uma linha de pesquisa. Palavras-chave: Pesquisa. Programa Etnomatemática. Mitos.

  9. Mapas, dança, desenhos: a cartografia como método de pesquisa em educação Maps, dance, drawings: cartography as a research method in education

    Directory of Open Access Journals (Sweden)

    Thiago Ranniery Moreira de Oliveira

    2012-12-01

    Full Text Available Escutar o universo filosófico de Gilles Deleuze e sua parceria com Félix Guattari e registrar possibilidades da cartografia como método de pesquisa em educação são os objetivos centrais deste artigo. É no trabalho sobre as linhas, no qual estão em jogo as metamorfoses da vida, que a cartografia se faz. A cartografia assume-se implicada na criação e na invenção, ao pensar uma pesquisa das multiplicidades que faz gerar multiplicidades. Traçar linhas, mapear territórios, acompanhar movimentos de desterritorialização, promover rotas de escape são alguns dos procedimentos que este estudo pretende registrar como possibilidades de pesquisar em educação. Discutindo a produtividade dessa coreografia do desassossego, esboçamos quatro movimentos que denominamos: olhares-ciganos, noite de núpcias, pintar um quadro, linhas bailarinas.Listening to Gilles Deleuze's philosophical universe and his partnership with Félix Guattari and recording cartography possibilities as a research method in education are the main aims of this article. It is in the work on the lines, where the metamorphosis of life is at stake, that cartography is done. Cartography is related to creation and invention when thinking of a research on the multiplicities that generate multiplicities. Drawing lines, mapping territories, monitoring movements of desterritorialization, and promoting escape routes are some of the procedures that this study intends to register as research opportunities in education. By discussing the productivity of the choreography of the unrest, we have outlined four movements which we called: gypsy looks, wedding night, paint a picture, lines dancers.

  10. Use of self-organizing maps for classification of defects in the tubes from the steam generator of nuclear power plants; Classificacao de defeitos em tubos de gerador de vapor de plantas nucleares utilizando mapas auto-organizaveis

    Energy Technology Data Exchange (ETDEWEB)

    Mesquita, Roberto Navarro de

    2002-07-01

    This thesis obtains a new classification method for different steam generator tube defects in nuclear power plants using Eddy Current Test signals. The method uses self-organizing maps to compare different signal characteristics efficiency to identify and classify these defects. A multiple inference system is proposed which composes the different extracted characteristic trained maps classification to infer the final defect type. The feature extraction methods used are the Wavelet zero-crossings representation, the linear predictive coding (LPC), and other basic signal representations on time like module and phase. Many characteristic vectors are obtained with combinations of these extracted characteristics. These vectors are tested to classify the defects and the best ones are applied to the multiple inference system. A systematic study of pre-processing, calibration and analysis methods for the steam generator tube defect signals in nuclear power plants is done. The method efficiency is demonstrated and characteristic maps with the main prototypes are obtained for each steam generator tube defect type. (author)

  11. Organización del conocimiento de la asignatura “estructuras de datos y algoritmosâ€� para ingeniería informática basada en mapas conceptuales

    OpenAIRE

    SOLER PELLICER, YOLANDA; LEZCANO BRITO, MATEO GERÓNIMO

    2009-01-01

    Las asignaturas de Programación y Algoritmos deben lograr que los estudiantes escriban algoritmos eficientes. Ese objetivo se ve afectado por el hecho de que los estudiantes no saben escoger y diseñar las estructuras de datos adecuadas para representar la información. Tomando en cuenta este hecho, el Centro de Estudios de Informática Educativa (C EIE ) de la Universidad de Granma y el Centro de Estudios Informáticos (CEI) de la Universidad Central “Marta Abreuâ€� de Las Villas, Cuba, propon...

  12. Patterns identification in supervisory systems of nuclear reactors installations and gas pipelines systems using self-organizing maps; Identificacao de padroes em sistemas supervisorios de instalacoes de reatores nucleares e em sistemas de gasodutos utilizando mapas auto-organizaveis

    Energy Technology Data Exchange (ETDEWEB)

    Doraskevicius Junior, Waldemar

    2005-07-01

    Self-Organizing Maps, SOM, of Kohonen were studied, implemented and tested with the aim of developing, for the energy branch, an effective tool especially for transient identification in nuclear reactors and for gas pipelines networks logistic supervision, by classifying operations and identifying transients or abnormalities. The digital system for the test was developed in Java platform, for the portability and scalability, and for belonging to free development platforms. The system, executed in personal computers, showed satisfactory results to aid in decision taking, by classifying IRIS (International Reactor Innovative and Secure) reactor operation conditions (data from simulator) and by classifying Southeast (owner: TRANSPETRO - Brazil) gas pipeline network. Various adaptations were needed for such business, as new topologies for the output layer of artificial neural network and particular preparation for the input data. (author)

  13. Determinación parcial del mapa de restricción del DNA mitocondrial de la nutria gigante de río Pteronura brasiliensis y comparación con otros mustélidos colombianos en cautiverio

    Directory of Open Access Journals (Sweden)

    M. Samper

    2001-07-01

    Full Text Available La nutria gigante de río Pteronura brasiliensises un mamífero carnívoro de la familia Mustelidae, ala cual pertenecen también las tairas y los hurones. La nutria es considerada por el CITES comouna especie vulnerable y por la IUCN como especie en peligro de extinción. Por esta razón, elCentro de Biología Molecular del Gimnasio Campestre inicio un proyecto de genética conser-vacionista que pretende proveer información utilizable para el análisis, tanto de la especieP. brasiliensiscomo de sus familiares mas cercanos, y de esta forma, proponer planes de manejode la especie y su hábitat previniendo su extinción.

  14. Měření židovské populace: Cenzus, mapa a muzeum v politikách českožidovského hnutí (1876–1900)

    Czech Academy of Sciences Publication Activity Database

    Strobach, Vít

    2013-01-01

    Roč. 14, č. 1 (2013), s. 26-48 ISSN 1211-8109 R&D Projects: GA ČR(CZ) GPP410/12/P671 Institutional support: RVO:67985921 Keywords : nationalism * Czech-Jewish movement * population policy Subject RIV: AB - History

  15. Frequency and determinants of white coat hypertension in mild to moderate hypertension: a primary care-based study. Monitorización Ambulatoria de la Presión Arterial (MAPA)-Area 5 Working Group.

    Science.gov (United States)

    Martínez, M A; García-Puig, J; Martín, J C; Guallar-Castillón, P; Aguirre de Cárcer, A; Torre, A; Armada, E; Nevado, A; Madero, R S

    1999-03-01

    Most of the previous studies on white coat hypertension were performed in hypertension clinics or academic settings and included relatively small series of patients. Consequently, the prevalence of white coat hypertension in primary care settings and the clinical and epidemiologic characteristics of this subgroup of patients are not well known. We performed this study to estimate the frequency of white coat hypertension in a population of mildly to moderately hypertensive subjects attended in a primary care setting and to examine possible epidemiologic and clinical factors that may identify these patients. Patients included in the study underwent clinical interview, measurement of clinic blood pressure (BP) on three visits, determination of serum lipids, glucose, uric acid, and urinary albumin excretion, 24-h ambulatory BP monitoring, and M-mode and Doppler echocardiography. Patients were classified as white coat hypertensives if their daytime ambulatory BP were < 135/85 mm Hg. We studied 345 patients, 136 (39%) of whom were diagnosed with white coat hypertension. The frequency of white coat hypertension was inversely proportional to the severity of clinic BP values. The diagnosis of white coat hypertension was independently associated with female gender and low educational level. Left ventricular mass index and urinary albumin excretion were lower in the white-coat hypertensive group compared with the group with sustained hypertension. Our results show that a high proportion of patients with mild to moderate hypertension attended in a primary care setting have white coat hypertension. Some clinical characteristics may be helpful in the identification of this group of subjects. White coat hypertensives show less target-organ damage than sustained hypertensive patients.

  16. Spatial map dose of nuclear medicine service of the Clinical Hospital of Botucatu, SP, Brazil; Mapa espacial de dose do servico de medicina nuclear do Hospital das Clinicas de Botucatu

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Caio V.; Mendonca, Caroline; Silva, Eduardo T.; Moriguchi, Sonia M.; Koga, Katia H., E-mail: caiov_oliveira@yahoo.com.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Botucatu, SP (Brazil). Faculdade de Medicina

    2013-12-15

    This study was conducted to describe levels of occupational and environmental exposure of the Nuclear Medicine Service of the Clinical Hospital of Botucatu. To this end, measurements were made of the radiometric levels of points strategically defined, in all the environments, for a period of six months, sampling different days and times, during operation normal routine of the sector. The results allow to estimate the expected dose for each environment, comparing them to the dose limitation established by the National Commission of Nuclear Energy (CNEN), allowing better targeting of occupationally exposed individuals, indicating the points where the occupation should be the minimum required, enabling the reduction of risks to potential exposures. (author)

  17. Cartografía abierta en la comunicación administrativa local : diseño de un portal ciudadano abierto para la comunicación municipal a través de mapas

    OpenAIRE

    López García, José María

    2016-01-01

    La cartografía, como representación gráfica de la realidad, se convierte en una herramienta polivalente de manejo cotidiano por ciudadanos de toda condición socio-económica. Anexionada a procesos telemáticos de identificación y gestión provistas por la administración y el acceso global, personificada en la tecnología móvil y el uso de aplicaciones libres, sirve para hacer más comprensible, accesible y transparente la administración y sus procedimientos. Los Geoportales de las entidades l...

  18. Stan wojenny w syntezach dziejów PRL. Próba analizy historiograficznej

    OpenAIRE

    Brzechczyn, Krzysztof

    2008-01-01

    Celem artykułu jest rekonstrukcja obrazu stanu wojennego występującego w następujących syntezach dziejów PRL: A. Czubiński, "Najnowsze dzieje Polski 1944-1983" i "Polska i Polacy po II wojnie światowej", A. Friszke, "Polska. Losy państwa i narodu", A. Paczkowski, "Pół wieku dziejów Polski, 1939-1989", W. Roszkowski, "Najnowsza historia Polski, 1945-2002",t. II-III, A.L. Sowa, "Od Drugiej do Trzeciej Rzeczypospolitej (1945-2001)". Wymienione dzieła analizowane są według następujących kryteri...

  19. Problems Digesting Dairy Products?

    Science.gov (United States)

    ... intolerant. But worse than this discomfort are the dangers of raw milk, which can harbor a host ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  20. Thermogram No Substitute for Mammogram

    Science.gov (United States)

    ... the American Cancer Society . In fact, the greatest danger from thermography is that those who opt for ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  1. Teens and Steroids: A Dangerous Combo

    Science.gov (United States)

    ... Endocrinology Products, warns teens and parents about the dangers of steroid use. Q: What are anabolic steroids ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  2. Benzocaine and Babies: Not a Good Mix

    Science.gov (United States)

    ... of a health care professional. back to top Danger Signs Symptoms of methemoglobinemia include: pale, gray, or ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  3. Food Safety for Moms-to-Be

    Science.gov (United States)

    ... times for foods. Keep foods out of the Danger Zone: The range of temperatures at which bacteria ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  4. Halloween Safety: Costumes, Candy, and Colored Contact Lenses

    Science.gov (United States)

    ... aren’t so long that you’re in danger of tripping. Wear makeup and hats rather than ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  5. Prevent Heartworms in Pets Year-Round

    Science.gov (United States)

    ... testing, you may be putting your pet in danger. The preventive medication can kill so many microfilariae ( ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  6. Are You Taking Medication as Prescribed?

    Science.gov (United States)

    ... finding a legitimate online pharmacy, see The Possible Dangers of Buying Medicine Over the Internet . You can ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  7. How to Dispose of Unused Medicines

    Science.gov (United States)

    ... substances — have instructions for flushing to reduce the danger of overdose from unintentional or illegal use. One ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  8. Allergy Meds Could Affect Your Driving

    Science.gov (United States)

    ... and according to directions, they can pose a danger to your health and safety. Information about whether ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  9. Mixing Medications and Dietary Supplements Can Endanger Your Health

    Science.gov (United States)

    ... supplements? Have you considered whether there is any danger in mixing medications and dietary supplements? There could ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  10. Misuse of Prescription Pain Relievers: The Buzz Takes Your Breath Away. Permanently.

    Science.gov (United States)

    ... have taken prescription pain relievers, here are the danger signs to watch for: Slow breathing (less than ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  11. Pilot-in-the-Loop CFD Method Development

    Science.gov (United States)

    2017-04-20

    separate computers providing Image Generation, interface with the control loading system, cockpit instrument displays, and the math model of the...Dynamics Specialist Naval Air Systems Command Code 4.3.2.1 Applied Aerodynamics & Store Separation Branch susan.polsky@navy.mil 301-342-8575 (Voice

  12. Breastfeeding: Planning Ahead

    Medline Plus

    Full Text Available ... Support for Nursing Moms in the Workplace: Employer Solutions Blog topics Breastfeeding: Natural Doesn’t Mean Easy ... Ayisyen Français Polski Português Italiano Deutsch 日本語 فارسی English A federal government website managed by the Office ...

  13. Overcoming challenges

    Medline Plus

    Full Text Available ... Support for Nursing Moms in the Workplace: Employer Solutions Blog topics Breastfeeding: Natural Doesn’t Mean Easy ... Ayisyen Français Polski Português Italiano Deutsch 日本語 فارسی English A federal government website managed by the Office ...

  14. Suppression of BRCA2 by Mutant Mitochondrial DNA in Prostate Cancer

    Science.gov (United States)

    2014-07-01

    Columbia, Vancouver, British Columbia V6K 2P5, Canada 9Institute of Biomembranes and Bioenergetics, National Research Council (C.N.R.), Bari, Italy ...Jacquotte A, Polsky D, Ferrara J, Perez-Soler R, Cordon-Cardo C, Pagano M and Osman I. Altered expression of p27 and Skp2 proteins in prostate cancer of

  15. Meningococcal Infections - Multiple Languages

    Science.gov (United States)

    ... Pohnpeian (Mahsen en Pohnpei) Polish (polski) Portuguese (português) Punjabi (ਪੰਜਾਬੀ) Russian (Русский) Samoan (Gagana Samoa) Somali ( ... Portuguese) PDF Centers for Disease Control and Prevention Punjabi (ਪੰਜਾਬੀ) Expand Section Vaccine Information Statement (VIS) -- ...

  16. Flu Shot - Multiple Languages

    Science.gov (United States)

    ... Oromoo) Pashto (Pax̌tō / پښتو ) Polish (polski) Portuguese (português) Punjabi (ਪੰਜਾਬੀ) Russian (Русский) Somali (Af-Soomaali ) Spanish ( ... Portuguese) PDF Centers for Disease Control and Prevention Punjabi (ਪੰਜਾਬੀ) Expand Section Vaccine Information Statement (VIS) -- ...

  17. Meningitis - Multiple Languages

    Science.gov (United States)

    ... Pohnpeian (Mahsen en Pohnpei) Polish (polski) Portuguese (português) Punjabi (ਪੰਜਾਬੀ) Russian (Русский) Samoan (Gagana Samoa) Somali ( ... Portuguese) PDF Centers for Disease Control and Prevention Punjabi (ਪੰਜਾਬੀ) Expand Section Vaccine Information Statement (VIS) -- ...

  18. Ideas and Inspirations: Good News about Diabetes Prevention and Management in Indian Country

    Medline Plus

    Full Text Available ... Grant Resources Training for SDPI Grantees SDPI Outcomes System (SOS) Fact Sheets Clinician CME/CE Training and ... Ayisyen Français Polski Português Italiano Deutsch 日本語 فارسی English

  19. 2011 - the Year of Maria Sklodowska-Curie; Resolution of the Sejm of the Republic of Poland

    International Nuclear Information System (INIS)

    2011-01-01

    On 3 rd December 2010, the Sejm of the Republic of Poland adopted a resolution on establishing 2011 the Year of Maria Sklodowska-Curie. Translated from the Monitor Polski no. 96, item 1091, page 5131 (15 December 2010) full text of the resolution is given.

  20. Building Trust and Capacity: Disarmament, Demobilization, and Reintegration to Transition Pro-Government Non-State Armed Groups

    Science.gov (United States)

    2009-05-11

    Desenvolupament, Cambodia, http://www.escolapau.org/img/programas/desarme/ mapa /camboyai.pdf (accessed 19 March 2009). In Ethiopia, follow its war with Eritrea...de Pau. “Cambodia.” Escola de Cultura de Pau, http://www.escolapau.org/img/programas/desarme/ mapa /camboyai.pdf (accessed March 20, 2009). 69...Escola de Cultura de Pau. “Eritrea.” Escola de Cultura de Pau, http://www.escolapau.org/img/programas/desarme/ mapa /eritreai.pdf (accessed March 20

  1. FRAGILIDADE AMBIENTAL DA BACIA DO RIO PEQUENO EM SÃO JOSÉ DOS PINHAIS (PR)

    OpenAIRE

    Soares, Marcia Regina Gomes de Jesus; Universidade Tuiuti do Paraná; Souza, Jorge Luiz Moretti de; Universidade Federal do Paraná; Jerszurki, Daniela

    2013-01-01

    O presente trabalho teve o objetivo de identificar e avaliar a fragilidade ambiental da bacia do rio Pequeno, situada no município de São José dos Pinhais (PR). A fragilidade ambiental foi determinada baseando-se em dados de solo e declividade. O mapa de fragilidade potencial foi gerado pelo cruzamento do mapa de declividade com o de solos, e o mapa de fragilidade emergente foi gerado com o cruzamento do mapa da fragilidade potencial com o de uso atual do solo. As classes de fragilidade “muit...

  2. Receptor-like Molecules on Human Intestinal Epithelial Cells Interact with an Adhesion Factor from Lactobacillus reuteri.

    Science.gov (United States)

    Matsuo, Yosuke; Miyoshi, Yukihiro; Okada, Sanae; Satoh, Eiichi

    2012-01-01

    A surface protein of Lactobacillus reuteri, mucus adhesion-promoting protein (MapA), is considered to be an adhesion factor. MapA is expressed in L. reuteri strains and adheres to piglet gastric mucus, collagen type I, and human intestinal epithelial cells such as Caco-2. The aim of this study was to identify molecules that mediate the attachment of MapA from L. reuteri to the intestinal epithelial cell surface by investigating the adhesion of MapA to receptor-like molecules on Caco-2 cells. MapA-binding receptor-like molecules were detected in Caco-2 cell lysates by 2D-PAGE. Two proteins, annexin A13 (ANXA13) and paralemmin (PALM), were identified by MALDI TOF-MS. The results of a pull-down assay showed that MapA bound directly to ANXA13 and PALM. Fluorescence microscopy studies confirmed that MapA binding to ANXA13 and PALM was colocalized on the Caco-2 cell membrane. To evaluate whether ANXA13 and PALM are important for MapA adhesion, ANXA13 and PALM knockdown cell lines were established. The adhesion of MapA to the abovementioned cell lines was reduced compared with that to wild-type Caco-2 cells. These knockdown experiments established the importance of these receptor-like molecules in MapA adhesion.

  3. Interactive Business Development, Capturing Business Knowledge and Practice: A Case Study

    Science.gov (United States)

    McKelvie, Gregor; Dotsika, Fefie; Patrick, Keith

    2007-01-01

    Purpose: The purpose of this paper is to follow the planning and development of MapaWiki, a Knowledge Management System for Mapa, an independent research company that specialises in competitor benchmarking. Starting with the standard requirements to capture, store and share information and knowledge, a system was sought that would allow growth and…

  4. Entre muitas histórias: comentários ao texto da autora Maria Isabel Barreno

    Directory of Open Access Journals (Sweden)

    Ivete Lara Camargos Walty

    2001-03-01

    Full Text Available O texto da autora Maria Isabel Barreno aqui apresentado é ele próprio um mapa de vários caminhos, ou fragmentos de mapas, nós de um hipertexto, escritura marcada pela subjetividade autoral em suas diversas possibilidades

  5. The Meaningful Activity Participation Assessment: A Measure of Engagement in Personally Valued Activities

    Science.gov (United States)

    Eakman, Aaron M.; Carlson, Mike E.; Clark, Florence A.

    2010-01-01

    The Meaningful Activity Participation Assessment (MAPA), a recently developed 28-item tool designed to measure the meaningfulness of activity, was tested in a sample of 154 older adults. The MAPA evidenced a sufficient level of internal consistency and test-retest reliability and correlated as theoretically predicted with the Life Satisfaction…

  6. Heat of Absorption of CO2 in Phase Change Solvents: 2-(Diethylamino)ethanol and 3-(Methylamino)propylamine

    DEFF Research Database (Denmark)

    Waseem Arshad, Muhammad; Fosbøl, Philip Loldrup; von Solms, Nicolas

    2013-01-01

    Heat of absorption of CO2 in phase change solvents containing 2-(diethylamino)ethanol (DEEA) and 3-(methylamino)propylamine (MAPA) were measured as a function of CO2 loading at different temperatures using a commercially available reaction calorimeter. The tested systems were aqueous single amines...... (5 M DEEA, 2 M MAPA, and 1 M MAPA) and aqueous amine mixtures (5 M DEEA + 2 M MAPA and 5 M DEEA + 1 M MAPA) which give two liquid phases on reacting with CO2. All parallel experiments have shown good repeatability. The measurements were taken isothermally at three different temperatures, (40, 80......, and 120) °C. The measured differential heat of absorption values were converted into integral values by integration. Heats of absorption of CO2 in aqueous single amines were affected by changing the solvent composition (large difference in concentrations) and CO2 feed pressure simultaneously. In addition...

  7. Neural networks and statistical analysis for classification of corneal videokeratography maps based on Zernike coefficients: a quantitative comparison Redes neurais e análise estatística para classificação de mapas topográficos da córnea baseados em coeficientes de Zernike: uma comparação quantitativa

    Directory of Open Access Journals (Sweden)

    Luis Alberto Vieira de Carvalho

    2008-06-01

    Full Text Available PURPOSE: The main goal of this study was to develop and compare two different techniques for classification of specific types of corneal shapes when Zernike coefficients are used as inputs. A feed-forward artificial Neural Network (NN and discriminant analysis (DA techniques were used. METHODS: The inputs both for the NN and DA were the first 15 standard Zernike coefficients for 80 previously classified corneal elevation data files from an Eyesys System 2000 Videokeratograph (VK, installed at the Departamento de Oftalmologia of the Escola Paulista de Medicina, São Paulo. The NN had 5 output neurons which were associated with 5 typical corneal shapes: keratoconus, with-the-rule astigmatism, against-the-rule astigmatism, "regular" or "normal" shape and post-PRK. RESULTS: The NN and DA responses were statistically analyzed in terms of precision ([true positive+true negative]/total number of cases. Mean overall results for all cases for the NN and DA techniques were, respectively, 94% and 84.8%. CONCLUSION: Although we used a relatively small database, results obtained in the present study indicate that Zernike polynomials as descriptors of corneal shape may be a reliable parameter as input data for diagnostic automation of VK maps, using either NN or DA.OBJETIVOS: Nosso principal objetivo neste trabalho foi de desenvolver e comparar duas técnicas diferentes para classificação de superfícies corneanas. Uma rede neural artificial alimentada adiante e análise descriminante foram as técnicas de classificação comparadas neste trabalho. MÉTODOS: As entradas para ambos os métodos de classificação foram os primeiros 15 coeficientes de Zernike para 80 córneas mensuradas anteriormente em um topógrafo Eyesys instalado no Departamento de Oftalmologia da Escola Paulista de Medicina - UNIFESP. A rede neural tem 5 saídas que foram associados aos cinco casos típicos contidos na base de dados: ceratocone, astigmatismo a favor da regra, astigmatismo contra a regra, formato "regular" ou "normal" e pós-PRK. RESULTADOS: Os resultados de ambos os métodos foram estatisticamente analisados em termos de precisão. Os resultados gerais para ambos os métodos de redes neurais e análise discriminante foram 94% e 84,8%, respectivamente. CONCLUSÃO: Embora tenha-se utilizado uma base de dados relativamente pequena, os resultados obtidos aqui indicam que os polinômios de Zernike podem ser um parâmetro de entrada para classificação de diferentes formatos de córnea, tanto para uso com redes neurais ou análise discriminante.

  8. Dalla-Corte Caballe, Gabriela (2012 Mocovíes, franciscanos y colonos de la zona chaqueña de Santa Fe (1850-2011. El liderazgo de la mocoví Dora Salteño en Colonia Dolores, Prohistoria Ediciones, Rosario, 455 p., con mapas, cuadros y fotografías.

    Directory of Open Access Journals (Sweden)

    Romina Belén Zampa

    2014-04-01

    Full Text Available El libro de Gabriela Dalla-Corte Caballero nos introduce en una problemática que, a pesar de haber demostrado importantes y significativos avances en la historiografía de los últimos años, ha sido poco abordada en el caso del espacio chaqueño santafesino. La autora decide reconstruir la historia de los mocovíes de una de las reducciones indígenas de la zona chaqueña santafesina, que a inicios del siglo XX adquirió el nombre de Colonia Dolores, en un período que comprende desde mediados del siglo XIX, cuando se inicia el proceso de sometimiento de los grupos mocovíes asentados en este espacio, hasta las características de la vida actual de esta población, que conduce a una de sus descendientes (Dora Teresa Salteño a asumir como la primera mujer mocoví presidenta de la Comuna. Para dar cuenta de la diversidad de temas que atraviesan todos estos años, la autora apela a un enfoque de larga duración, que involucra como estrategia metodológica la incorporación de distintos archivos de carácter provincial y fuentes eclesiásticas correspondientes a la orden franciscana y, por otra parte, las entrevistas personales para acceder a una realidad más próxima.

  9. Georreferenciamento e cartogrametria dos mapas da Capitania de Minas Gerais elaborados por José Joaquim da Rocha em 1778 e 1793 / Geocoding and cartometric maps in the province of Minas Gerais, drawn by José Joaquim da Rocha in 1778 and 1793

    Directory of Open Access Journals (Sweden)

    José Flávio Morais Castro

    2013-12-01

    Full Text Available The accuracy of historical maps is being evaluated in research Historical Cartography through the use of geospatial technologies. This research aims to apply general techniques geocoding and cartometric maps in the province of Minas Gerais, drawn by José Joaquim da Rocha in 1778 and 1793, especially the overlay layer, the displacement vector and distortions of the grid over the map current.

  10. Análise de mapas de represas publicados na web usando imagens orbitais CCD/CBERS no estado de Minas Gerais Analysis of dams maps published on the web by using orbital CCD/CBERS images in Minas Gerais State, Brazil

    Directory of Open Access Journals (Sweden)

    Elizabeth Ferreira

    2010-02-01

    Full Text Available Neste trabalho, bancos de dados públicos e gratuitos disponíveis na World Wide Web (WEB foram utilizados para avaliar as áreas das superfícies dos espelhos d'água das represas de Furnas e do Funil, no Estado de Minas Gerais. O objetivo foi comparar as informações obtidas nos bancos da WEB com os valores das áreas calculadas a partir de imagens do sensor CCD a bordo dos satélites CBERS2 e CBERS2B. A área da represa de Furnas obtida a partir das imagens CCD/CBERS2B, ano 2008, foi de 1.138 km², mas nos bancos de dados consultados esta área estava entre 1.182 e 1.503 km². A represa do Funil, construída em 2003, com superfície de espelho d'água de 29,37 km² e uma ilha com área de 1,93 km² não aparecem nos bancos Atlas, Geominas, IGAM e IBGE. Os resultados mostraram algumas discrepâncias nos bancos de dados publicados na WEB, tais como diferenças em áreas e supressão ou extrapolação de limites do espelho d'água. Concluiu-se que, até o momento, os responsáveis por algumas publicações de bancos de dados no Estado de Minas Gerais não tiveram rigor suficiente com as atualizações. As imagens CCD/CBERS, que também são dados públicos disponíveis na WEB, mostraram ser produtos adequados para verificar, atualizar e melhorar as informações publicadas.In this work some public databases from the World Wide Web (WEB were used to find the area of the Furnas and Funil Dams in Minas Gerais State. The purpose of this work was to compare the WEB public databases values and the real values obtained from the CCD camera images on board CBERS2 and CBERS2B satellites. The Furnas Dam area obtained from CCD/ CBERS2B images, in 2008, was 1.138 km², but in the consulted databases this area ranged from 1.182 to 1.503 km². The dam of the Funil, built in 2003, with a water surface of 29.37 km² and an island with 1.93 km² area, did not appear in Atlas, Geominas, IGAM and IBGE databases. The results revealed some problems in the WEB public databases like differences in the areas of dams and discrepancies like any non-existing border lines and sometimes extra areas. This suggested that some Brazilian WEB databases publishers have not been so far rigorous and the databases are outdated. The CCD/CBERS images that are WEB public databases showed to be suitable data for determining and updating the published information.

  11. Experiência na utilização do modelo HFACS (Sistema de Análise e Classificação de Fatores Humanos na estruturação de mapas causais de eventos adversos = Experience in use of HFACS (Human Factors Analysis and Classification System model in structuring causal maps of adverse events

    Directory of Open Access Journals (Sweden)

    Souza, Márcia Regina Cordeiro

    2017-01-01

    Full Text Available Trata-se de um relato de experiência, cujo objetivo é descrever a utilização da ferramenta Sistema de Análise e Classificação de Fatores Humanos (HFACS na análise de um evento sentinela, ocorrido em um hospital brasileiro público de médio porte. Buscou-se mapear os fatores humanos e classificar os fatores que contribuíram e levaram a ocorrência do dano. Vale ressaltar que a finalidade é identificar falhas no processo de trabalho, de equipamentos ou outras questões existentes, as quais possibilitam a ocorrência do erro humano, baseando-se no pensamento sistêmico

  12. IDENTIFICACIÓN DE LAS INTERACCIONESENTRE LOS COMPONENTES DEL CONOCIMIENTO DIDÁCTICO DEL CONTENIDO MEDIANTE EL MAPA DE CDC A TRAVÉS DEL DISEÑO DE LA UNIDAD DIDÁCTICA EN PROFESORES EN FORMACIÓN DE LICENCIATURA EN BIOLOGÍA DE LA UNIVERSIDAD DISTRITAL FRANCI

    Directory of Open Access Journals (Sweden)

    Mario Zambrano

    2014-05-01

    Full Text Available Este estudio pretende aportar en la comprensión de como los componentes del conocimiento didáctico del contenido interactúan. Esta investigación se realizo bajo el concepto de biodiversidad y el diseño de la unidad didáctica de dos profesores en formación de licenciatura en biología. Por lo tanto el proyecto se inscribe dentro del paradigma de investigación interpretativo, donde se asumirán los planteamientos de Valbuena (2011 concernientes al análisis del contenido. El análisis de datos indico tres características: a las orientaciones hacia la enseñanza de las ciencias fue central en la integración con los demás componentes; b las orientaciones hacia la enseñanza de las ciencias posibilito la conexión entre el conocimiento del currículo y las estrategias de enseñanza; c la conexión entre el conocimiento de la comprensión de ciencias de los estudiantes y el conocimiento de las estrategias de enseñanza fue limitada. Se espera que los resultados contribuyan en la constitución del CDC como eje estructurador de los programas de formación del profesorado.

  13. [The determination of arterial pressure by the physician or the nurse: its relation to ambulatory pressure and left ventricular mass. The MAPA-Madrid Group. Monitorización Ambulatoria de la Presión Arterial (Ambulatory Monitoring of Arterial Pressure)].

    Science.gov (United States)

    Martínez, M A; Aguirre, A; Sánchez, M; Nevado, A; Laguna, I; Torre, A; Manuel, E; Villar, C; García-Puig, J

    1999-12-11

    In the present study we evaluated the influence of the observer's status--physician or nurse--on blood pressure levels and the relationship among clinic blood pressure measurement with ambulatory blood pressure and left ventricle mass. Cross sectional study performed in seven primary care centers. Participating physicians and nurses were trained for blood pressure measurement prior to the study and subsequently retrained at 3 month intervals during the study. Patients included in the study were 122 subjects with mild to moderate hypertension who underwent the following study protocol: a) measurement of clinic blood pressure by physician and nurse, in an independent fashion, on 3 visits; b) clinic-epidemiologic questionnaire; c) conventional hematological and biochemical study; d) electrocardiogram; e) 24-hour ambulatory blood pressure monitoring, f) M-mode and Doppler echocardiography (only in 58 subjects). Nurse-measured blood pressure levels were higher than those determined by physicians (mean differences: 3.9 [6.7] mmHg in systolic blood pressure and 2.6 [5.4] mmHg in diastolic blood pressure). The blood pressure level differences between the two observers were higher in female patients and subjects with low educational level, independently of the observer's gender. Nurse-measured blood pressure was more closely related to ambulatory blood pressure and left ventricle mass than physician-measured blood pressure. Nurse-measured blood pressure levels are lower than those determined by physicians and more closely related to ambulatory blood pressure and left ventricle mass than physician-measured blood pressure. These data support that nurses, instead of doctors, should routinely measure blood pressure in primary care centers.

  14. Ścieżki rozwoju miast województwa łódzkiego

    OpenAIRE

    Guz, Jagoda

    2016-01-01

    Problematyka badawcza rozprawy doktorskiej koncentruje się na zagadnieniach związanych z geografią osadnictwa, a w szczególności na kwestiach związanych z rozwojem miast i czynnikami ich rozwoju. Rozwój miast w Polsce aż do początków XX w. pozostawał pod wpływem polskiej kultury o charakterze szlachecko-ziemiańskim. Główne ogniwa sieci osadniczej Polski zostały uformowane w okresie średniowiecza. Od II połowy XIII w. polskie miasta kształtowane były na wzór zachodni – miała miejsce lokacj...

  15. Synonimia w polskiej terminologii medycznej przełomu XIX i XX wieku. Rekonesans

    OpenAIRE

    Lucyna Agnieszka Jankowiak

    2015-01-01

    Synonyms in Polish medical terminology at the turn of the 20th century. Reconnaissance The paper concerns the phenomenon of synonyms in the medical terminology. On the basis of Słownik terminologii lekarskiej polskiej (Dictionary of Polish Medical Terminology, 1881) and Słownik lekarski polski (Polish Dictionary of Medicine, 1905) the author examines (in terms of a structure, origin and chronology) 88 series of synonyms (regarding illnesses) present in both dictionaries. From the examinat...

  16. Teda leinavad ka need, kellele ta ei meeldinud / Maciej Wiśniewski ; intervjueerinud Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Wiśniewski, Maciej

    2010-01-01

    10. aprillil juhtus Venemaal lennuõnnetus, mille tagajärjel said surma Poola president Lech Kaczyński, tema abikaasa, keskpanga juht, asevälisminister, mitmed parlamendiliikmed ja paljud teised Poola jaoks tähtsad inimesed, kes olid teel Katõni ohvrite mälestustseremooniale. Polskie Radio ajakirjanik räägib lennuõnnetuse mõjust ühiskonnale ja riigile

  17. Know Concentration Before Giving Acetaminophen to Infants

    Science.gov (United States)

    ... distribution,” says Holquist. Why does this pose a danger? If a pediatrician prescribes a 5 mL dose ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  18. 6 Tip-offs to Rip-offs: Don't Fall for Health Fraud Scams

    Science.gov (United States)

    ... Español Subscribe: FDA Consumer Health Information Bogus product! Danger! Health fraud alert! You’ll never see these ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  19. Special Handling for Ready-to-Eat, Refrigerated Foods: Reducing the Risks of Foodborne Listeria

    Science.gov (United States)

    ... or below. Between 40ºF and 140ºF is the Danger Zone, when bacteria can multiply rapidly. Generally, the ... لعربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | ف ...

  20. The Old Serbian Alexander Romance and the Greek Phyllada

    Directory of Open Access Journals (Sweden)

    Krzysztof Usakiewicz

    2014-12-01

    Full Text Available The paper includes a short introduction and four excerpts from the Old Serbian Alexander Romance translated into Polish by Maciej Falski.   Tekst zawiera krótką prezentację zagadnienia filiacji Opowieści o Aleksandrze w bałkańskiej przestrzeni kulturowej oraz przekład fragmentów tzw. Serbskiej Aleksandreidy na język polski.

  1. Aleja Dębowa w Uluczu, Gmina Dydnia

    Directory of Open Access Journals (Sweden)

    Joanna Renda

    2015-09-01

    Full Text Available Aleje przydrożne są ważnym, kulturowym elementem krajobrazu Polski. Utworzone z długowiecznych gatunków drzew często pozostają świadkami dawnych wydarzeń i zachwycają monumentalnym wyglądem. W artykule przedstawiono rys historycz -ny i inwentaryzację alei dębowej w miejscowości Ulucz, w gminie Dydnia.

  2. A comparative study of the economic effectiveness of Polish manufacturers of mushroom compost

    Directory of Open Access Journals (Sweden)

    Krzysztof Łobos

    2012-09-01

    Full Text Available In this study the results of the economic efficiency of manufacturers of mushroom compost have been presented. The economic efficiency is operationalized in the following research by selected indicators of efficiency, rotation, and synthetic indicator Z. The main purpose of the study is an analysis of the economic efficiency of companies in the branch development prediction context. The study uses data from the Official Journal of the Republic of Poland “Monitor Polski B”.

  3. Autógrafos de Cristobal Colón: Ensayo de Análisis Grafológico de su Escritura

    Directory of Open Access Journals (Sweden)

    Boletín Cultural y Bibliográfico Banco de la República

    1968-02-01

    Full Text Available Absolutamente el único mapa o dibujo topográfico que resta de Colón. De este marino, que toda su vida confeccionó mapas, que de modo seguro tuvo que haber dibujado las derrotas de sus viajes, que se sabe que regaló un gran mapa a Isabel, solo queda este pedazo de papel (hoy en el Archivo de la Casa de Alba, en Madrid, "misteriosamente adquirido por la Duquesa de Alba", según Thacher (I, p. 477, quien lo reproduce en (III, p. 8 9 y dice : "Evidentemente dibujado en enero de 1493.

  4. Thermodynamic modeling of liquid–liquid phase change solvents for CO2 capture

    DEFF Research Database (Denmark)

    Waseem Arshad, Muhammad; von Solms, Nicolas; Thomsen, Kaj

    2016-01-01

    A thermodynamic model based on Extended UNIQUAC framework has been developed in this work for the de-mixing liquid–liquid phase change solvents, DEEA (2-(diethylamino)ethanol) and MAPA (3-(methylamino)propylamine). Parameter estimation was performed for two ternary systems, H2O-DEEA-CO2 and H2O......-MAPA-CO2, and a quaternary system, H2O-DEEA-MAPA-CO2 (phase change system), by using different types of experimental data (equilibrium and thermal) consisting of pure amine vapor pressure, vapor-liquid equilibrium, solid-liquid equilibrium, liquid–liquid equilibrium, excess enthalpy, and heat of absorption...

  5. Mining Specific and General Features in Both Positive and Negative Relevance Feedback. QUT E-Discovery Lab at the TREC󈧍 Relevance Feedback Track

    Science.gov (United States)

    2009-11-01

    relevance feedback algo- rithm. Four methods, εMap [1], MapA , P10A, and StatAP [2], were used in the track to measure the performance of Phase 2 runs...εMap and StatAP were applied to the runs us- ing the testing set of only ClueWeb09 Category-B, whereas MapA and P10A were applied to those using the...whole ClueWeb09 English set. Because our experiments were based on only ClueWeb09 Category-B, measuring our per- formance by MapA and P10A might not

  6. Moraxella catarrhalis Synthesizes an Autotransporter That Is an Acid Phosphatase▿

    OpenAIRE

    Hoopman, Todd C.; Wang, Wei; Brautigam, Chad A.; Sedillo, Jennifer L.; Reilly, Thomas J.; Hansen, Eric J.

    2007-01-01

    Moraxella catarrhalis O35E was shown to synthesize a 105-kDa protein that has similarity to both acid phosphatases and autotransporters. The N-terminal portion of the M. catarrhalis acid phosphatase A (MapA) was most similar (the BLAST probability score was 10−10) to bacterial class A nonspecific acid phosphatases. The central region of the MapA protein had similarity to passenger domains of other autotransporter proteins, whereas the C-terminal portion of MapA resembled the translocation dom...

  7. Concept maps as a polyvalent educational tool for health sciences: Their application to histology

    OpenAIRE

    Sánchez-Quevedo, María del Carmen; Cubero, María Angustias; Alaminos, Miguel; Vicente Crespo, Pascual; Campos, Antonio

    2006-01-01

    En el presente artículo se analiza el mapa conceptual como instrumento de estrategia educativa aplicada a las ciencias de la salud y, especialmente, al ámbito de la histología. Tras considerar los elementos constitutivos y los tipos de mapas conceptuales y el fundamento epistemológico de los mismos para estimular el aprendizaje significativo, se examina la aplicación de los mapas al desarrollo curricular, la evaluación, el diseño pedagógico por parte del profesor y el autoaprendizaje por part...

  8. CRIAÇÃO DE UM WEBSIG DO MUNICÍPIO DE MOSSORÓ, RN, UTILIZANDO A TECNOLOGIA ALOVMAP.

    Directory of Open Access Journals (Sweden)

    Jarbas Nunes Vidal Filho

    2010-11-01

    Full Text Available Este trabalho aborda a divulgação e a publicação de mapas digitais interativos através do software ALOV Map. O ALOV Map é um servidor de mapas gratuito que pode ser usado de duas formas: com uma arquitetura cliente ou uma arquitetura cliente/servidor. Ambas as arquiteturas permitem publicar mapas na Web e a arquitetura cliente permite que sejam produzidas aplicações stand alone. O objetivo principal desse trabalho consiste em desenvolver um WebSIG com dados digitais do município de Mossoró, RN, de forma que seja possível a qualquer pessoa acessar mapas da cidade e obter informações mais detalhadas sobre ela.

  9. Organización y Administración de Empresas I

    OpenAIRE

    López García, Juan José

    2010-01-01

    Objetivos de aprendizaje, mapas conceptuales y esquemas de los diferentes temas de la asignatura Organización y administración de empresas I (código 7270) de primer curso de la Diplomatura de Empresariales.

  10. Confluence reduction for Markov automata (extended version)

    NARCIS (Netherlands)

    Timmer, Mark; van de Pol, Jan Cornelis; Stoelinga, Mariëlle Ida Antoinette

    Markov automata are a novel formalism for specifying systems exhibiting nondeterminism, probabilistic choices and Markovian rates. Recently, the process algebra MAPA was introduced to efficiently model such systems. As always, the state space explosion threatens the analysability of the models

  11. Confluence reduction for Markov automata

    NARCIS (Netherlands)

    Timmer, Mark; van de Pol, Jan Cornelis; Stoelinga, Mariëlle Ida Antoinette

    Markov automata are a novel formalism for specifying systems exhibiting nondeterminism, probabilistic choices and Markovian rates. Recently, the process algebra MAPA was introduced to efficiently model such systems. As always, the state space explosion threatens the analysability of the models

  12. Confluence Reduction for Markov Automata

    NARCIS (Netherlands)

    Timmer, Mark; van de Pol, Jan Cornelis; Stoelinga, Mariëlle Ida Antoinette; Braberman, Victor; Fribourg, Laurent

    Markov automata are a novel formalism for specifying systems exhibiting nondeterminism, probabilistic choices and Markovian rates. Recently, the process algebra MAPA was introduced to efficiently model such systems. As always, the state space explosion threatens the analysability of the models

  13. Densidad de desarrollo alta y baja en Puerto Rico

    Science.gov (United States)

    William A. Gould; Sebastian Martinuzzi; Olga M. Ramos Gonzalez

    2008-01-01

    Este mapa demuestra la distribución de terrenos de alta y baja densidad de desarrollo urbano en Puerto Rico (Martinuzzi et al. 2007). El mapa fue creado mediante el analisis de un mosaico de imagenes de satelite Landsat ETM+ de los años 2000 – 2003. La clasificacion no supervisada ISODATA (“Iterative Self-Organizing Data Analysis Technique”) (ERDAS 2003) fue utilizada...

  14. Nanospines incorporation into the structure of the hydrophobic cryogels via novel cryogelation method: an alternative sorbent for plasmid DNA purification.

    Science.gov (United States)

    Üzek, Recep; Uzun, Lokman; Şenel, Serap; Denizli, Adil

    2013-02-01

    In this study, it was aimed to prepare hydrophobic cryogels for plasmid DNA (pDNA) purification from Escherichia coli lysate. The hydrophobicity was achieved by incorporating a hydrophobic ligand, N-methacryloyl-(L)-phenylalanine (MAPA), into the cryogel backbone. In addition to the conventional cryogelation process, freeze-drying step was included to create nanospines. Three different cryogels {poly(2-hydoxyethyl methacrylate-N-methacryloyl-L-phenylalanine)-freeze dried, [P(HEMA-MAPA)-FD]; poly(2-hydoxyethyl methacrylate-N-methacryloyl-L-phenylalanine, [P(HEMA-MAPA)] and poly(2-hydoxyethyl methacrylate)-freeze dried, [P(HEMA)-FD]} were prepared, characterized, and used for DNA (salmon sperm DNA) adsorption studies from aqueous solution. The specific surface areas of cryogels were determined to be 21.4 m(2)/g for P(HEMA)-FD, 17.65 m(2)/g for P(HEMA-MAPA) and 36.0 m(2)/g for P(HEMA-MAPA)-FD. The parameters affecting adsorption such as temperature, initial DNA concentration, salt type and concentration were examined in continuous mode. The maximum adsorption capacities were observed as 45.31 mg DNA/g, 27.08 mg DNA/g and 1.81 mg DNA/g for P(HEMA-MAPA)-FD, P(HEMA-MAPA) and P(HEMA)-FD, respectively. Desorption process was performed using acetate buffer (pH 5.50) without salt. First, pDNA was isolated from E. coli lysate and the purity of pDNA was then determined by agarose gel electrophoresis. Finally, the chromatographic performance of P(HEMA-MAPA)-FD cryogel for pDNA purification was tested in FPLC. The resolution (R(s)) was 2.84, and the specific selectivity for pDNA was 237.5-folds greater than all impurities. Copyright © 2012 Elsevier B.V. All rights reserved.

  15. Preparation of Er3+:Y3Al5O12/WO3-KNbO3 composite and application in treatment of methamphetamine under ultrasonic irradiation.

    Science.gov (United States)

    Zhang, Hongbo; Huang, Yingying; Li, Guanshu; Wang, Guowei; Fang, Dawei; Song, Youtao; Wang, Jun

    2017-03-01

    Er 3+ :Y 3 Al 5 O 12 /WO 3 -KNbO 3 composite powder as an effective sonocatalyst was prepared via collosol-gelling-hydrothermal and high-temperature calcination methods. The textures of materials were observed by X-ray diffractometer (XRD), scanning electron microscopy (SEM) and X-ray photoelectron spectroscopy (XPS). In order to estimate the sonocatalytic activity of Er 3+ :Y 3 Al 5 O 12 /WO 3 -KNbO 3 composite powder, the sonocatalytic degradation of methamphetamine (MAPA) was performed. Furthermore, the influences of mass ratio of WO 3 and KNbO 3 , ultrasonic irradiation time, catalyst addition amount, initial methamphetamine (MAPA) concentration and used times on the sonocatalytic degradation of methamphetamine (MAPA) caused by Er 3+ :Y 3 Al 5 O 12 /WO 3 -KNbO 3 composite powder were investigated by using gas chromatography. Under optimal conditions of 1.00g/L Er 3+ :Y 3 Al 5 O 12 /WO 3 -KNbO 3 addition amount and 10.00mg/L methamphetamine (MAPA) initial concentration, 68% of methamphetamine (MAPA) could be removed after 150min ultrasonic irradiation. The experimental results showed that the Er 3+ :Y 3 Al 5 O 12 /WO 3 -KNbO 3 as sonocatalyst displayed an excellent sonocatalytic activity in degradation of methamphetamine (MAPA) under ultrasonic irradiation. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. De la antigüedad del hombre en el Plata a la distribución de las antigüedades en el mapa: los criterios de organización de las colecciones antropológicas del Museo de La Plata entre 1897 y 1930 From the antiquity of man in Argentina’s Plata region to the distribution of antiquities across the map: the organization of the Museu de La Plata’s anthropological colletion, 1897-1930

    Directory of Open Access Journals (Sweden)

    Irina Podgorny

    1999-06-01

    Full Text Available En este trabajo se analizan los criterios de organización de las colecciones antropológicas del Museo de La Plata vigentes entre 1897 y 1930. Bajo el nombre de ‘antropológicas’ se incluyen las colecciones correspondientes a las exhibiciones de las salas de antropología, etnografía y arqueología. Aunque el criterio que finalmente imperó fue el ordenamiento por regiones geográficas, según el sistema de Enrique Delachaux, se discutirán además las otras posibilidades de ordenamiento (etnológico, lingüístico y cronológico que aunque conocidas por las autoridades y científicos del Museo de La Plata fueron descartadas.The article analyzes the criteria for arranging and classifying anthropological collections (that is, anthropology, ethnography, and archeology exhibit rooms adopted at the Museo de La Plata during 1897-1930. The criterion ultimately selected was arrangement by geographical regions, using a system devised by Enrique Delachaux. The article examines other rules of classification as well, familiar to the museum’s curators and scientists but rejected by them: ethnological, linguistic, and chronological criteria.

  17. Development of a geographical data base and its utilization in elaboration of maps of environmental sensitivity to the oil spill in the coastal area between Galinhos and Sao Bento do Norte, RN (Brazil); Desenvolvimento de um banco de dados geograficos e sua utilizacao na elaboracao de mapas de sensibilidade ambiental ao derramamento de oleo na area costeira entre Galinhos e Sao Bento do Norte - RN

    Energy Technology Data Exchange (ETDEWEB)

    Castro, Angelica Felix de; Amaro, Venerando Eustaquio; Vital, Helenice; Aloise, Dario Jose [Rio Grande do Norte Univ., Natal, RN (Brazil). Programa de Recursos Humanos da ANP para o Setor Petroleo e Gas, PRH-22. Formacao em Geologia, Geofisica e Informatica

    2003-07-01

    The coastal areas located in the northern coast of the Rio Grande do Norte State, specifically between the districts of Galinhos e Sao Bento do Norte, characterized by constant processes of coastal and eolic transport, causing erosion, alterations in the sediments and modifications in the coast line. Beyond of those natural factors, there is the proximity to Polo Petrolifero of Guamare, the largest terrestrial producer of petroleum of Brazil. The first part of that work consisted of to elaborate and to develop a Geographical Database (BDG), to store all the existent data of the study area, such as geological and geophysical data, hydrodynamic data, products of remote sensing, thematic maps, among others. The second stage of this work aimed to develop starting from the data previously stored in BDG, Oil-Spill Environmental Sensitivity Maps (Maps SAO). Those maps evaluate the reaction of the certain place if to happen an oil spill in her, supplying necessary information to the decision in cleaning and removal of the spilled oil. In that way, Maps SAO of the study area were elaborated in different teams to evaluate if there would be change of the behavior of the coast in the presence of the oil. (author)

  18. Determinacion de periodos fundamentales del suelo mediante vibraciones ambientales en el municipio de Humacao, Puerto Rico

    Science.gov (United States)

    Cintron Aponte, Rommel

    La tecnica de Nakamura ha sido utilizada a nivel mundial para determinar periodos fundamentales del suelo. La tecnica consiste en calcular y graficar cocientes espectrales H/V de vibraciones ambientales registradas sobre el suelo. Mediciones de vibraciones ambientales fueron tomadas en 151 lugares dentro del municipio de Humacao, localizado al este de Puerto Rico. Los datos se procesaron utilizando espectros de Fourier y espectros de potencia. La tecnica fue validada al compararla con los resultados de cocientes espectrales H/V de registros de sismos debiles y tambien con una modelacion numerica realizada con datos de un ensayo "downhole". Las graficas de los cocientes espectrales H/V fueron divididas en casos y grupos, los cuales dependen de la facilidad para identificar el periodo fundamental pico y amplitudes en frecuencias menores de 1 Hz, respectivamente. Los resultados obtenidos con ambos espectros fueron comparados y se concluye que los mismos se complementan para proveer resultados mas confiables. Se crearon mapas de periodos fundamentales, factores de amplitud, isoperiodos y clasificacion sismica de sitio. Los mapas de isoperiodos fueron realizados en las zonas mas pobladas sobre depositos de suelo. El mapa de periodos fundamentales del suelo mostro buena correlacion con la geologia local. El mapa de clasificacion sismica derivado de periodos de sitio fue comparado con el mapa de clasificacion sismica derivado de barrenos geotecnicos. El mapa de clasificacion obtenido de periodos puede sobreestimar un poco algunas clasificaciones del suelo. Sin embargo, este mapa puede proveer un estimado aproximado de la velocidad de onda de corte promedio del suelo hasta una profundidad de 100 pies (30 metros).

  19. Analiza krakowskiego rynku nieruchomości na tle wybranych krajów Unii Europejskiej

    OpenAIRE

    Jasińska, Elżbieta; Preweda, Edward; Ruchel, Jan

    2005-01-01

    Wejście Polski do Unii Europejskiej wywołało ożywienie na rynku obrotu nieruchomościami. Obawy o wykupywanie tanich, polskich ziem przez obcokrajowców i podniesienie stawki VAT w budownictwie to najbardziej charakterystyczne bodźce. W przypadku Krakowa dodatkowym bodźcem stymulującym to ożywienie było ponadto wygaśnięcie dotychczas istniejącego Miejscowego Planu Zagospodarowania Przestrzennego i rozpoczęcie trzech dużych inwestycji: przebudowy ronda Mogilskiego i utworzenia torowiska dla szyb...

  20. Procesy dezindustrializacji w aglomeracji łódzkiej w latach dziewięćdziesiątych

    OpenAIRE

    Marczyńska-Witczak, Ewa; Starzyńska, Wacława

    2002-01-01

    W artykule poddano analizie procesy transformacji gospodarczej zachodzące w Polsce w ciągu ostatnich dziesięciu lat, ich cechy oraz tempo przemian oraz porównano je z analogicznymi procesami występującymi wcześniej w Europie Zachodniej. Badano paradygmat, który stworzył zespół czynników wpływających na rozwój gospodarki świata i Polski. The paper attempts to analyse the processes of economic transformation that took place in Poland in the 1990s. It explores its characteristi...

  1. Działalność Izabeli Czartoryskiej w służbie edukacji i wychowania patriotycznego : powstanie muzeów narodowych

    OpenAIRE

    Pater, Renata

    2015-01-01

    W XXI wieku edukacja muzealna w Polsce rozwija się szczególnie dynamicznie, powstają nowoczesne, interaktywne muzea o atrakcyjnej architekturze i bogatym programie edukacyjnym (Muzeum Powstania Warszawskiego, Muzeum Chopina czy nowo otwarte Muzeum Historii Żydów Polskich POLIN lub będące jeszcze w trakcie budowy Muzeum Historii Polski, Muzeum Marszałka Józefa Piłsudzkiego i wiele innych). Działania edukacyjne skierowane są do zróżnicowanych odbiorców, zarówno grup zorganizowanych np. klas szk...

  2. Changes in sectoral structure of employment in Poland in comparison to the European Union

    OpenAIRE

    Dworak, Edyta; Malarska, Anna

    2010-01-01

    Przedmiotem opracowania jest diagnostyka i ocena przeobrażeń w sektorowej strukturze zatrudnienia w krajach UE w czasie. Na tym tle eksponowane są zmiany w GN Polski w okresie 1997– 2008. Dla zilustrowania i empirycznej weryfikacji teorii trzech sektorów A. Fishera, C. Clarka i J. Fourastie zorientowanej na ocenę procesu modernizacji unijnych gospodarek wykorzystane zostały klasyczne narzędzia analizy statystycznej oraz mało znana w Polsce, a pop...

  3. Overcoming challenges

    Medline Plus

    Full Text Available ... Information Act (FOIA) USA.gov Use Our Content Language Assistance Available Español 繁體中文 Tiếng Việt 한국어 Tagalog Русский العربية Kreyòl Ayisyen Français Polski Português Italiano Deutsch 日本語 فارسی English A federal government website managed by the Office on Women's Health in ...

  4. Breastfeeding: Planning Ahead

    Medline Plus

    Full Text Available ... Information Act (FOIA) USA.gov Use Our Content Language Assistance Available Español 繁體中文 Tiếng Việt 한국어 Tagalog Русский العربية Kreyòl Ayisyen Français Polski Português Italiano Deutsch 日本語 فارسی English A federal government website managed by the Office on Women's Health in ...

  5. "Polnische Patrioten?" Einige Anmerkungen zum frühen Polenbild in Westpreußen um 1700

    OpenAIRE

    Steffen, Frank

    2002-01-01

    Poniższa praca odnosi się głównie do tezy Huberta Orłowskiego, według której „niemiecka dyskusja o Polsce miała legitymujące, nic do pominięcia znaczenie dla wynalezienia niemieckiego narodu”. Wobec rozmiarów i rozdrobnienia społeczno-wyznaniowego Rzeszy Niemieckiej ok. 1700 r. temat ten ograniczony jest do Prus Zachodnich i głównego problemu (teoria państwowości, religia, historia) debaty o przyczynach funkcjonowania powstałego obrazu Polski. Koncentracja na Prusach Zachodnich wy...

  6. Immunologic Intervention in HIV Infection: Anti-Polymerase Responses and Hormonal Regulation.

    Science.gov (United States)

    1992-05-01

    34), has serious physical ad psyhdologic cosequn , including further compromise of irmmu status in AIMS (1). Dr. D. Kotler of Columbia University recently...nutritional factors in the induction of immunologic abnormalities in HIV-positive homosexual men. J. AIDS 2:235, 1989. 2. Kotler D, Nutrition in AIDS...1051, 1990. 14. Korq X-B, Zhu Q-Y, Vidal PM, Watanole AM, Polsky B, Armstrong D, Ostrandz M, lang SA Jr, Rxthors E, Cmaa T-C. Cmparisons of anti-HIV

  7. Rozstrzygnięcia administracyjne w procesie przygotowania i realizacji inwestycji w zakresie dróg publicznych

    OpenAIRE

    Bryś, Wojciech

    2011-01-01

    Prawa i Administracji: Postępowania Administracyjnego W ostatnich latach daje się zauważyć intensywny wzrost liczby inwestycji drogowych realizowanych na terenie kraju. Bezprecedensowa skala tego zjawiska jest wynikiem przystąpienia Polski do Unii Europejskiej i pozyskania dodatkowych środków finansowych na ten cel. Podejmowane w tym zakresie działania faktyczne ukazały jednak wiele słabych punktów prawa. Procedury lokalizacji inwestycji i przymusowego wykupu gruntów na cele publiczne, tak...

  8. Fortify Your Knowledge about Vitamins

    Medline Plus

    Full Text Available ... êµì–´ | Tagalog | Русский | العربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | فارسی | English FDA Accessibility Careers FDA Basics ...

  9. LASIK

    Medline Plus

    Full Text Available ... êµì–´ | Tagalog | Русский | العربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | فارسی | English FDA Accessibility Careers FDA Basics ...

  10. Animation of Antimicrobial Resistance

    Medline Plus

    Full Text Available ... êµì–´ | Tagalog | Русский | العربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | فارسی | English FDA Accessibility Careers FDA Basics ...

  11. Don't Take This with That!

    Medline Plus

    Full Text Available ... êµì–´ | Tagalog | Русский | العربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | فارسی | English FDA Accessibility Careers FDA Basics ...

  12. Barbecue Basics: Tips to Prevent Foodborne Illness

    Medline Plus

    Full Text Available ... êµì–´ | Tagalog | Русский | العربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | فارسی | English FDA Accessibility Careers FDA Basics ...

  13. Women and Diabetes

    Medline Plus

    Full Text Available ... êµì–´ | Tagalog | Русский | العربية | Kreyòl Ayisyen | Français | Polski | Português | Italiano | Deutsch | 日本語 | فارسی | English FDA Accessibility Careers FDA Basics ...

  14. Szanse i problemy nauczania języków obcych na wyższych uczelniach technicznych ze szczególnym uwzględnieniem specyfiki nauczania języka angielskiego

    OpenAIRE

    Gajewska-Skrzypczak, Iwona

    2011-01-01

    Wydział Neofilologii: Instytut Lingwistyki Stosowanej Nauka i nauczanie języków obcych stanowią w obecnych czasach bardzo ważny aspekt kształcenia młodych ludzi w polskim systemie edukacji. Transformacja ustrojowa i wejście Polski do Unii Europejskiej przyspieszyły zmiany programowe w nauce języków obcych w szkolnictwie każdego szczebla. Celem niniejszej dysertacji jest przedstawienie szans i problemów nauczania języków obcych na uczelniach technicznych ze szczególnym uwzględnieniem specyf...

  15. Quantitative analysis of a Māori and Pacific admission process on first-year health study.

    Science.gov (United States)

    Curtis, Elana; Wikaire, Erena; Jiang, Yannan; McMillan, Louise; Loto, Robert; Airini; Reid, Papaarangi

    2015-11-03

    Universities should provide flexible and inclusive selection and admission policies to increase equity in access and outcomes for indigenous and ethnic minority students. This study investigates an equity-targeted admissions process, involving a Multiple Mini Interview and objective testing, advising Māori and Pacific students on their best starting point for academic success towards a career in medicine, nursing, health sciences and pharmacy. All Māori and Pacific Admission Scheme (MAPAS) interviewees enrolled in bridging/foundation or degree-level programmes at the University of Auckland were identified (2009 to 2012). Generalised linear regression models estimated the predicted effects of admission variables (e.g. MAPAS Maths Test; National Certificate in Educational Achievement (NCEA) Rank Score; Any 2 Sciences; Followed MAPAS Advice) on first year academic outcomes (i.e. Grade Point Average (GPA) and Passes All Courses) adjusting for MAPAS interview year, gender, ancestry and school decile. 368 First Year Tertiary (bridging/foundation or degree-level) and 242 First Year Bachelor (degree-level only) students were investigated. NCEA Rank Score (estimate 0.26, CI: 0.18-0.34, pMAPAS Advice Followed (1.26, CI: 0.18-1.34, p = 0.0002); Exposure to Any 2 Sciences (0.651, CI: 0.15-1.15, p = 0.012); and MAPAS Mathematics Test (0.14, CI: 0.02-0.26, p = 0.0186) variables were strongly associated with an increase in First Year Tertiary GPA. The odds of passing all courses in First Year Tertiary study was 5.4 times higher for students who Followed MAPAS Advice (CI: 2.35-12.39; pMAPAS Advice had an average GPA that was 1.1 points higher for all eight (CI: 0.45-1.73; p = 0.0009) and Core 4 courses (CI: 0.60-2.04; p = 0.0004). The MAPAS admissions process was strongly associated with positive academic outcomes in the first year of tertiary study. Universities should invest in a comprehensive admissions process that includes alternative entry pathways for

  16. Estrone specific molecularly imprinted polymeric nanospheres: synthesis, characterization and applications for electrochemical sensor development.

    Science.gov (United States)

    Congur, Gulsah; Senay, Hilal; Turkcan, Ceren; Canavar, Ece; Erdem, Arzum; Akgol, Sinan

    2013-06-28

    The aim of this study is (i) to prepare estrone-imprinted nanospheres (nano-EST-MIPs) and (ii) to integrate them into the electrochemical sensor as a recognition layer. N-methacryloyl-(l)-phenylalanine (MAPA) was chosen as the complexing monomer. Firstly, estrone (EST) was complexed with MAPA and the EST-imprinted poly(2-hyroxyethylmethacrylate-co-N-methacryloyl-(l)-phenylalanine) [EST-imprinted poly(HEMA-MAPA)] nanospheres were synthesized by surfactant- free emulsion polymerization method. The specific surface area of the EST-imprinted poly(HEMA-MAPA) nanospheres was found to be 1275 m2/g with a size of 163.2 nm in diameter. According to the elemental analysis results, the nanospheres contained 95.3 mmole MAPA/g nanosphere. The application of EST specific MIP nanospheres for the development of an electrochemical biosensor was introduced for the first time in our study by using electrochemical impedance spectroscopy (EIS) technique. This nano-MIP based sensor presented a great specificity and selectivity for EST.

  17. Induction of potent NK cell-dependent anti-myeloma cytotoxic T cells in response to combined mapatumumab and bortezomib.

    Science.gov (United States)

    Neeson, Paul J; Hsu, Andy K; Chen, Yin R; Halse, Heloise M; Loh, Joanna; Cordy, Reece; Fielding, Kate; Davis, Joanne; Noske, Josh; Davenport, Alex J; Lindqvist-Gigg, Camilla A; Humphreys, Robin; Tai, Tsin; Prince, H Miles; Trapani, Joseph A; Smyth, Mark J; Ritchie, David S

    2015-09-01

    There is increasing evidence that some cancer therapies can promote tumor immunogenicity to boost the endogenous antitumor immune response. In this study, we used the novel combination of agonistic anti-TRAIL-R1 antibody (mapatumumab, Mapa) with low dose bortezomib (LDB) for this purpose. The combination induced profound myeloma cell apoptosis, greatly enhanced the uptake of myeloma cell apoptotic bodies by dendritic cell (DC) and induced anti-myeloma cytotoxicity by both CD8 + T cells and NK cells. Cytotoxic lymphocyte expansion was detected within 24 h of commencing therapy and was maximized when myeloma-pulsed DC were co-treated with low dose bortezomib and mapatumumab (LDB+Mapa) in the presence of NK cells. This study shows that Mapa has two distinct but connected modes of action against multiple myeloma (MM). First, when combined with LDB, Mapa produced powerful myeloma cell apoptosis; secondly, it promoted DC priming and an NK cell-mediated expansion of anti-myeloma cytotoxic lymphocyte (CTL). Overall, this study indicates that Mapa can be used to drive potent anti-MM immune responses.

  18. Kompleksowe postępowanie fizjoterapeutyczne w skręceniu stawu skokowego

    Directory of Open Access Journals (Sweden)

    Paulina Brzezińska

    2015-09-01

    e-mail: brzezinskapp@gmail.com   Streszczenie Wstęp: Skręcenia stawu skokowego zaliczane są do jednych z najczęściej spotykanych urazów kończyn dolnych. Pomimo częstości występowania, nadal wielokrotnie są one lekceważone, zarówno w aspekcie wczesnej i prawidłowej diagnostyki medycznej jak i zastosowania szybkiego i optymalnego postępowania leczniczego. Cel pracy: Usystematyzowanie wiedzy na temat postępowania terapeutycznego, u osób po urazie stawu skokowego. Wnioski: W postępowaniu terapeutycznym u  osób po urazie stawu skokowego najważniejszą rolę odgrywa diagnostyka radiologiczna oraz kliniczna pozwalająca                    na postawienie właściwej diagnozy oraz na kreślenie celów terapii. Kompleksowe postępowanie fizjoterapeutyczne wpływa istotnie na skrócenie czasu koniecznego                          do przywrócenia możliwego do osiągnięcia poziomu funkcjonalnego pacjentów i zwiększa skuteczność stosowanych terapii.   Summary Introduction: Ankle sprains are classified as one of the most common injuries of the lower extremities.  This type of inquiry is still frequently underestimated, both in terms of early and proper medical diagnosis and the use of fast and optimal therapeutic management. Aim: Systematization of knowledge relating to the treatment of the ankle injuries, and analyze the therapeutic treatment and its effectiveness in the ankle sprains. Conclusions: Radiological and clinical diagnosis plays a key role in a normal therapeutic procedure for a person after ankle injury. It allows for diagnose and sets a objectives hierarchy for the optimized therapy. Comprehensive physiotherapy have a significant impact on the functional state of patients with ankle sprains significantly. increasing effectiveness of therapy.

  19. Postępowanie diagnostyczno-terapeutyczne u pacjenta po skręceniu stawu skokowego – opis przypadku = The diagnosis and therapy in a patient after ankle sprains – case report

    Directory of Open Access Journals (Sweden)

    Jan Paweł Mieszkowski

    2016-08-01

    Streszczenie Wstęp: Skręcenia stawu skokowego zaliczane są do jednych z najczęściej spotykanych urazów kończyn dolnych. Pomimo częstości występowania, nadal wielokrotnie są one lekceważone, zarówno w aspekcie diagnostyki medycznej jak i zastosowania optymalnego postępowania leczniczego. Cel pracy: Usystematyzowanie wiedzy na temat postępowania terapeutycznego, u osoby po urazie stawu skokowego. Celem dodatkowym była analiza postępowania fizjoterapeutycznego oraz jego efektywności u pacjenta po skręceniu stawu skokowego. Metoda: W pracy przedstawiono epikryzę pacjenta z urazem stawu skokowego. Pacjent poddany był dwukrotnie diagnostyce klinicznej. Wykonano analizę chodu, ocenę zakresu ruchu w stawie skokowym, ocenę siły mięśniowej kończyn dolnych przy pomocy skali Lovette’a, testy funkcjonalne stopy (test uciskowy Thompsona, test Simmonda, test szufladki, test dwóch wag. Zastosowano metody zewnętrznej stabilizacji przy pomocy szyny gipsowej, metodę twardych tapów, a także terapię układu limfatycznego z wykorzystaniem metody kinesiology taping i drenażu limfatycznego. Wraz z ustąpieniem zmian obrzękowych, pacjenta poddano kompleksowej terapii fizjoterapeutycznej. Wyniki: Po zakończeniu terapii chód - izochroniczny, izometryczny, izotoniczny, poprawa w zakresie: ruchu w stawie skokowym dla zgięcia grzbietowego, podeszwowego, pronacji, supinacji stopy, wyniku testu dwóch wag oraz siły mięśniowej. Wnioski: W postępowaniu terapeutycznym u osoby po urazie stawu skokowego najważniejszą rolę odegrała diagnostyka radiologiczna i kliniczna, pozwalająca na postawienie wczesnej i właściwej diagnozy. Kompleksowe postępowanie fizjoterapeutyczne wpłynęło na poprawę zakresu ruchu w stawie skokowym, zniesienie dolegliwości bólowych oraz na poprawę stanu funkcjonalnego badanego.

  20. Mindmapping en local i com a servei web

    Directory of Open Access Journals (Sweden)

    Gorka J. Palazio

    2008-12-01

    Full Text Available Con la aparición del uso de mapas conceptuales y mentales como servicio web, este recurso educativo puede tener ahora más uso y éxito en el aula. Los profesores de este artículo han analizado las herramientas de mapas conceptuales y mentales durante el período 2007-08 para indagar cuál es el rumbo que tienen los más de treinta servicios y sistemas que se pueden usar para la creación de mapas conceptuales hoy en día. Los tres mejores han sido testeados para proporcionar datos sobre sus capacidades y usabilidad.