WorldWideScience

Sample records for ra pannus tissue

  1. Matrix metalloproteases and tissue inhibitors of metalloproteinases in medial plica and pannus-like tissue contribute to knee osteoarthritis progression.

    Science.gov (United States)

    Yang, Chih-Chang; Lin, Cheng-Yu; Wang, Hwai-Shi; Lyu, Shaw-Ruey

    2013-01-01

    Osteoarthritis (OA) is characterized by degradation of the cartilage matrix, leading to pathologic changes in the joints. However, the pathogenic effects of synovial tissue inflammation on OA knees are not clear. To investigate whether the inflammation caused by the medial plica is involved in the pathogenesis of osteoarthritis, we examined the expression of matrix metalloproteinases (MMPs), tissue inhibitors of metalloproteinases (TIMPs), interleukin (IL)-1β, and tumor necrosis factor (TNF)-α in the medial plica and pannus-like tissue in the knees of patients with medial compartment OA who underwent either arthroscopic medial release (stage II; 15 knee joints from 15 patients) or total knee replacement (stage IV; 18 knee joints from 18 patients). MMP-2, MMP-3, MMP-9, IL-1β, and TNF-α mRNA and protein levels measured, respectively, by quantitative real-time PCR and Quantibody human MMP arrays, were highly expressed in extracts of medial plica and pannus-like tissue from stage IV knee joints. Immunohistochemical staining also demonstrated high expression of MMP-2, MMP-3, and MMP-9 in plica and pannus-like tissue of stage IV OA knees and not in normal cartilage. Some TIMP/MMP ratios decreased significantly in both medial plica and pannus-like tissue as disease progressed from stage II to stage IV. Furthermore, the migration of cells from the pannus-like tissue was enhanced by IL-1β, while plica cell migration was enhanced by TNF-α. The results suggest that medial plica and pannus-like tissue may be involved in the process of cartilage degradation in medial compartment OA of the knee.

  2. Collagen triple helix repeat containing 1 is a new promigratory marker of arthritic pannus.

    Science.gov (United States)

    Shekhani, Mohammed Talha; Forde, Toni S; Adilbayeva, Altynai; Ramez, Mohamed; Myngbay, Askhat; Bexeitov, Yergali; Lindner, Volkhard; Adarichev, Vyacheslav A

    2016-07-19

    The formation of destructive hypercellular pannus is critical to joint damage in rheumatoid arthritis (RA). The collagen triple helix repeat containing 1 (CTHRC1) protein expressed by activated stromal cells of diverse origin has previously been implicated in tissue remodeling and carcinogenesis. We recently discovered that the synovial Cthrc1 mRNA directly correlates with arthritis severity in mice. This study characterizes the role of CTHRC1 in arthritic pannus formation. Synovial joints of mice with collagen antibody-induced arthritis (CAIA) and human RA-fibroblast-like synoviocytes (FLS) were immunostained for CTHRC1, FLS and macrophage-specific markers. CTHRC1 levels in plasma from patients with RA were measured using sandwich ELISA. The migratory response of fibroblasts was studied with a transwell migration assay and time-lapse microscopy. Velocity and directness of cell migration was analyzed by recording the trajectories of cells treated with rhCTHRC1. Immunohistochemical analysis of normal and inflamed synovium revealed highly inducible expression of CTHRC1 in arthritis (10.9-fold). At the tissue level, CTHRC1-expressing cells occupied the same niche as large fibroblast-like cells positive for α-smooth muscle actin (α-SMA) and cadherin 11 (CDH11). CTHRC1 was produced by activated FLS predominantly located at the synovial intimal lining and at the bone-pannus interface. Cultured RA-FLS expressed CDH11, α-SMA, and CTHRC1. Upon treatment with exogenous rhCTHRC1, embryonic fibroblasts and RA-FLS significantly increased migration velocity, directness, and cell length along the front-tail axis (1.4-fold, p marker of activated synoviocytes in murine experimental arthritis and RA. The pro-migratory effect of CTHRC1 on synoviocytes is considered one of the mechanisms promoting hypercellularity of the arthritic pannus.

  3. Effects of Pannus Formation on the Flow around a Bileaflet Mechanical Heart Valve

    Science.gov (United States)

    Kim, Woojin; Choi, Haecheon; Kweon, Jihoon; Yang, Dong Hyun; Kim, Namkug; Kim, Young-Hak

    2013-11-01

    A pannus, an abnormal layer of fibrovascular tissue observed on a bileaflet mechanical heart valve (BMHV), induces dysfunctions of BMHV such as the time delay and incomplete valve closing. We numerically simulate the flows around an intra-annular type BMHV model with and without pannus formation, respectively, and investigate the flow and bileaflet-movement modifications due to the pannus formation. Simulations are conducted at a physiological condition (mean flow rate of 5 l/min, cycle duration of 866 ms, and the Reynolds number of 7200 based on the inflow peak bulk velocity and inflow diameter). We model the pannus as an annulus with fixed outer radius and vary the inner radius of the pannus. Our preliminary results indicate that the flow field changes significantly and the bileaflet does not close properly due to the pannus formation. The detailed results will be given at the final presentation. Supported by the NRF Programs (NRF-2011-0028032, NRF-2012M2A8A4055647).

  4. Dosimetry of {sup 223}Ra-chloride: dose to normal organs and tissues

    Energy Technology Data Exchange (ETDEWEB)

    Lassmann, Michael [University of Wuerzburg, Department of Nuclear Medicine, Wuerzburg (Germany); Nosske, Dietmar [Federal Office for Radiation Protection (BfS), Department of Radiation and Health, Oberschleissheim (Germany)

    2013-02-15

    {sup 223}Ra-Chloride (also called Alpharadin {sup registered}) targets bone metastases with short range alpha particles. In recent years several clinical trials have been carried out showing, in particular, the safety and efficacy of palliation of painful bone metastases in patients with castration-resistant prostate cancer using {sup 223}Ra-chloride. The purpose of this work was to provide a comprehensive dosimetric calculation of organ doses after intravenous administration of {sup 223}Ra-chloride according to the present International Commission on Radiological Protection (ICRP) model for radium. Absorbed doses were calculated for 25 organs or tissues. Bone endosteum and red bone marrow show the highest dose coefficients followed by liver, colon and intestines. After a treatment schedule of six intravenous injections with 0.05 MBq/kg of {sup 223}Ra-chloride each, corresponding to 21 MBq for a 70 kg patient, the absorbed alpha dose to the bone endosteal cells is about 16 Gy and the corresponding absorbed dose to the red bone marrow is approximately 1.5 Gy. The comprehensive list of dose coefficients presented in this work will assist in comparing and evaluating organ doses from various therapy modalities used in nuclear medicine and will provide a base for further development of patient-specific dosimetry. (orig.)

  5. Inhibition of the all-trans Retinoic Acid (atRA) Hydroxylases CYP26A1 and CYP26B1 Results in Dynamic, Tissue-Specific Changes in Endogenous atRA Signaling.

    Science.gov (United States)

    Stevison, Faith; Hogarth, Cathryn; Tripathy, Sasmita; Kent, Travis; Isoherranen, Nina

    2017-07-01

    All-trans retinoic acid (atRA), the active metabolite of vitamin A, is a ligand for several nuclear receptors and acts as a critical regulator of many physiologic processes. The cytochrome P450 family 26 (CYP26) enzymes are responsible for atRA clearance, and are potential drug targets to increase concentrations of endogenous atRA in a tissue-specific manner. Talarozole is a potent inhibitor of CYP26A1 and CYP26B1, and has shown some success in clinical trials. However, it is not known what magnitude of change is needed in tissue atRA concentrations to promote atRA signaling changes. The aim of this study was to quantify the increase in endogenous atRA concentrations necessary to alter atRA signaling in target organs, and to establish the relationship between CYP26 inhibition and altered atRA concentrations in tissues. Following a single 2.5-mg/kg dose of talarozole to mice, atRA concentrations increased up to 5.7-, 2.7-, and 2.5-fold in serum, liver, and testis, respectively, resulting in induction of Cyp26a1 in the liver and testis and Rar β and Pgc 1β in liver. The increase in atRA concentrations was well predicted from talarozole pharmacokinetics and in vitro data of CYP26 inhibition. After multiple doses of talarozole, a significant increase in atRA concentrations was observed in serum but not in liver or testis. This lack of increase in atRA concentrations correlated with an increase in CYP26A1 expression in the liver. The increased atRA concentrations in serum without a change in liver suggest that CYP26B1 in extrahepatic sites plays a key role in regulating systemic atRA exposure. Copyright © 2017 by The American Society for Pharmacology and Experimental Therapeutics.

  6. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  7. The visualization of pannus in rheumatoid arthritis using NMR imaging. Pannusdarstellung bei rheumatoider Arthritis mittels Kernspintomographie

    Energy Technology Data Exchange (ETDEWEB)

    Schnarkowski, P. (Abt. fuer Roentgendiagnostik, Klinikum der Univ. Ulm (Germany)); Bader, C. (Abt. fuer Roentgendiagnostik, Klinikum der Univ. Ulm (Germany)); Goldmann, A. (Abt. fuer Roentgendiagnostik, Klinikum der Univ. Ulm (Germany)); Friedrich, J.M. (Abt. fuer Roentgendiagnostik, Klinikum der Univ. Ulm (Germany))

    1992-12-01

    The knee joints of 15 patients afflicted with rheumatoid arthritis were investigated using the method of nmr imaging. Parameters of investigation were the spin-echo and fast-field-echo sequences as well as the MR signal behaviour of proliferative synovial changes following intravenous administration of gadolinium dtpa. Pannus having formed on the articular surfaces or beneath the articular cartilages was distinguishable from other changes on the basis of the increased signal intensities to be observed after gadolinium dtpa had been given. (orig./GD)

  8. Clinical Implication of Transaortic Mitral Pannus Removal During Repeat Cardiac Surgery for Patients With Mechanical Mitral Valve.

    Science.gov (United States)

    Park, Byungjoon; Sung, Kiick; Park, Pyo Won

    2018-01-25

    This study aimed to evaluate the safety and feasibility of transaortic mitral pannus removal (TMPR).Methods and Results:Between 2004 and 2016, 34 patients (median age, 57 years; 30 women) with rheumatic disease underwent pannus removal on the ventricular side of a mechanical mitral valve through the aortic valve during reoperation. The median time interval from the previous surgery was 14 years. TMPR was performed after removal of the mechanical aortic valve (n=21) or diseased native aortic valve (n=11). TMPR was performed in 2 patients through a normal aortic valve. The mitral transprosthetic mean pressure gradient (TMPG) was ≥5 mmHg in 11 patients, including 3 with prosthetic valve malfunction. Prophylactic TMPR was performed in 23 patients. There were no early deaths. Concomitant operations included 22 tricuspid valve surgeries (13 replacements, 15 repairs) and 32 aortic valve replacements (24 repeats, 8 primary). The mean gradient in patients who had mitral TMPG ≥5 mmHg was significantly decreased from 6.46±1.1 to 4.37±1.17 mmHg at discharge (Pvalve malfunction was apparent on last echocardiography. TMPR is a safe and effective procedure for patients with malfunction or stenosis of a mechanical mitral valve and may be considered an alternative approach in patients with pannus overgrowth in such valves.

  9. Rosa26-GFP direct repeat (RaDR-GFP mice reveal tissue- and age-dependence of homologous recombination in mammals in vivo.

    Directory of Open Access Journals (Sweden)

    Michelle R Sukup-Jackson

    2014-06-01

    Full Text Available Homologous recombination (HR is critical for the repair of double strand breaks and broken replication forks. Although HR is mostly error free, inherent or environmental conditions that either suppress or induce HR cause genomic instability. Despite its importance in carcinogenesis, due to limitations in our ability to detect HR in vivo, little is known about HR in mammalian tissues. Here, we describe a mouse model in which a direct repeat HR substrate is targeted to the ubiquitously expressed Rosa26 locus. In the Rosa26 Direct Repeat-GFP (RaDR-GFP mice, HR between two truncated EGFP expression cassettes can yield a fluorescent signal. In-house image analysis software provides a rapid method for quantifying recombination events within intact tissues, and the frequency of recombinant cells can be evaluated by flow cytometry. A comparison among 11 tissues shows that the frequency of recombinant cells varies by more than two orders of magnitude among tissues, wherein HR in the brain is the lowest. Additionally, de novo recombination events accumulate with age in the colon, showing that this mouse model can be used to study the impact of chronic exposures on genomic stability. Exposure to N-methyl-N-nitrosourea, an alkylating agent similar to the cancer chemotherapeutic temozolomide, shows that the colon, liver and pancreas are susceptible to DNA damage-induced HR. Finally, histological analysis of the underlying cell types reveals that pancreatic acinar cells and liver hepatocytes undergo HR and also that HR can be specifically detected in colonic somatic stem cells. Taken together, the RaDR-GFP mouse model provides new understanding of how tissue and age impact susceptibility to HR, and enables future studies of genetic, environmental and physiological factors that modulate HR in mammals.

  10. Desenvolvimento do tecido adiposo e muscular em suínos de raça Alentejana Development of adipose and muscular tissues in Alentejano pig breed

    Directory of Open Access Journals (Sweden)

    A. Freitas

    2007-01-01

    Full Text Available O presente trabalho, pretendeu estudar o efeito do peso de abate sobre a evolução do tecido adiposo e muscular de porcos Alentejanos destinados à produção de carne para consumo em fresco. Utilizaram-se 30 suínos de raça alentejana (sexos neutralizados alojados e alimentados individualmente com um alimento composto comercial equilibrado (3100 Kcal ED e 150g de Proteína Bruta por Kg, fornecido a 85% do Ad Libitum. Efectuaram-se abates sucessivos de 5 animais aos 40, 70, 80, 90, 100 e 110 kg de peso vivo. As carcaças foram refrigeradas a 4 ºC durante 24 horas e seguidamente procedeu-se à pesagem da gordura perirenal (banha e à medição da gordura subcutânea dorsal e da área do músculo Longissimus dorsi entre a décima e décima primeira costela, ao nível da última costela e entre a terceira e quarta vértebra lombar. O aumento do peso de abate influenciou significativamente (PTo study the effects of slaughter weight on adipose and muscular tissues development of Alentejano hogs thirty animals were used. With an average live weight of 35 kg, pigs were allocated in individual pens at outdoor and fed a commercial diet (15% CP and 3100 Kcal ED/kg offered at 85% Ad Libitum. Pigs were sequentially slaughtered in groups (n=5 with an average live weight of 40, 70,80, 90, 100 and 110 kg. After carcass chilling at 5º C for 24 h flare fat was weighed and subcutaneous backfat thickness and loin eye area were recorded at 1011 ribs, last rib and 3-4 lombar vertebras. Flare fat increased significantly (P<0,01 with the increase of slaughter weight: 1,26, 2,08, 3,22, 3,36, 3,68 e 4,02 Kg, respectively at 40, 70, 80, 90, 100 e 110 Kg. Subcutaneous back fat thickness also increased strongly with the increase of slaughter weight: 1,56, 3,21, 4,12, 5,10, 5,41 e 5,38 cm, respectively at 40, 70, 80, 90, 100 e 110 Kg. Between 90 and 110 kg averages were similar. The area of Longissimus dorsi increased slightly (15,49 to 20,36 cm² with the increase of

  11. Correlation between the histological features of corneal surface pannus following ocular surface burns and the final outcome of cultivated limbal epithelial transplantation.

    Science.gov (United States)

    Sati, Alok; Basu, Sayan; Sangwan, Virender S; Vemuganti, Geeta K

    2015-04-01

    To report the influence of histological features of corneal surface pannus following ocular surface burn on the outcome of cultivated limbal epithelial transplantation (CLET). On retrospectively reviewing the medical records of the patients who underwent autologous CLET from April 2002 to June 2012 at L V Prasad Eye Institute, Hyderabad, India, we could trace the histological reports in only 90 records. These 90 records, besides clinical parameters, were reviewed for the influence of various histological features on the final outcome of CLET. The histological features include epithelial hyperplasia (21.1%), surface ulceration (2.2%), goblet cells (62.2%), squamous metaplasia (11.1%), active fibrosis (31.1%), severe inflammation (8.9%), multinucleated giant cells (3.3%), stromal calcification (8.9%) and active proliferating vessels (5.6%). Among these histological features, patients with either hyperplasia or calcification in their excised corneal pannus show an unfavourable outcome compared with patients without hyperplasia (p=0.003) or calcification (p=0.018). A similar unfavourable outcome was not seen with other histological features and various clinical parameters. Presence of either calcific deposits or hyperplasia in the excised corneal pannus provides poor prognostication; hence, a proper counselling of such patients is mandatory along with a close follow-up. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  12. Chôra

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2009-01-01

    , for whom "il y a khôra" (there is chôra), Sallis keeps the definite article (the chôra) as an index of certain differentiation in chôra. This article takes as a point of departure Sallis' thesis regarding the manifestation of the chôra, grounded in the manner in which the chôra is apprehended, that is......, as in a dream. Sallis' interpretation opens up the possibility for a new reading of the dialogue, and offers a tool to examine phenomena occurred in the aftermath of the Platonic cosmogony. One of the most fascinating episodes of the afterlife of the Platonic chôra is the Byzantine chôra, presented...

  13. Therapy of canine corneal pannus with strontium-90; Die Behandlung der Keratitis superficialis chronica des Hundes mit Strontium-90

    Energy Technology Data Exchange (ETDEWEB)

    Hoecht, S.; Nausner, M.; Hinkelbein, W. [Universitaetsklinikum Benjamin Franklin, Berlin (Germany). Klinik und Poliklinik fuer Radioonkologie und Strahlentherapie; Gruening, G.; Allgoewer, I.; Brunnberg, L. [Freie Univ. Berlin (Germany). Klinik und Poliklinik fuer Kleine Haustiere

    2002-02-01

    Background: Corneal pannus is a disease which, if untreated, nearly always is progressive and may lead to blindness of the affected dog. A therapeutic standard is yet to be defined. Beta-ray irradiation with Sr-90 is often recommended on a casuistic basis, but systematic studies are sparse. The aim of the present study was to evaluate efficacy and to document side effects of radiotherapy with Sr-90. Material and Methods: 17 animals were treated. 13 of them received treatment of 15 Gy surface dose twice within 2 days with additional medical therapy with ciclosporin and prednisolon. Only the more affected eye was treated with radiation which was applied with an eye-applicator, the other eye served as control. Four animals with already advanced impairment of vision received keratectomy, afterwards radiation was applied on both sides. Results: Medical treatment alone led to deterioration in vascularization and spread of pigmentation in eleven of 13 (85%) of the control-eyes, density of pigmentation increased in eight of 13 (62%). After radiation therapy, almost all animals showed a marked initial improvement. Even if progressive disease occurred later on, further worsening as it happened in the control-eyes could be stopped in nine resp. ten of 13 eyes (69% and 77%). All animals with keratectomy and radiotherapy regained and preserved adequate vision. Besides short-term blepharospasm, no side effects were recorded. Conclusion: Corneal pannus is responsive to radiation therapy with Sr-90 and long-term benefit can be achieved. Side effects are minimal. Optimal sequencing of therapy and dosage still have to be examined. (orig.) [German] Hintergrund: Die Keratitis superficialis chronica des Hundes ist eine unbehandelt fast immer progredient verlaufende Hornhautentzuendung, die zur Erblindung fuehren kann. Eine Standardbehandlung gibt es bisher nicht. Systematische Untersuchungen zur Bestrahlung mit Strontium-(Sr-)90 liegen praktisch nicht vor, die Anwendung wird jedoch

  14. Measuring the radium quartet (228Ra, 226Ra, 224Ra, 223Ra) in seawater samples using gamma spectrometry.

    Science.gov (United States)

    van Beek, P; Souhaut, M; Reyss, J-L

    2010-07-01

    Radium isotopes are widely used in marine studies (eg. to trace water masses, to quantify mixing processes or to study submarine groundwater discharge). While 228Ra and 226Ra are usually measured using gamma spectrometry, short-lived Ra isotopes (224Ra and 223Ra) are usually measured using a Radium Delayed Coincidence Counter (RaDeCC). Here we show that the four radium isotopes can be analyzed using gamma spectrometry. We report 226Ra, 228Ra, 224Ra, 223Ra activities measured using low-background gamma spectrometry in standard samples, in water samples collected in the vicinity of our laboratory (La Palme and Vaccarès lagoons, France) but also in seawater samples collected in the plume of the Amazon river, off French Guyana (AMANDES project). The 223Ra and 224Ra activities determined in these samples using gamma spectrometry were compared to the activities determined using RaDeCC. Activities determined using the two techniques are in good agreement. Uncertainties associated with the 224Ra activities are similar for the two techniques. RaDeCC is more sensitive for the detection of low 223Ra activities. Gamma spectrometry thus constitutes an alternate method for the determination of short-lived Ra isotopes. 2009 Elsevier Ltd. All rights reserved.

  15. ra-nollenergibyggnader

    OpenAIRE

    Allard, Ingrid

    2011-01-01

    Det nya EU-direktivet EPBD2, Energy Performance of Buildings Directive (recast), som antogs 2010, specificerar att alla nya byggnader ska vara så kallade nära-nollenergibyggnader år 2021. En nära-nollenergibyggnad definieras som en byggnad med mycket hög energiprestanda, som till mycket hög grad förses med förnybar energi. Hur detta ska tolkas och var kravnivån ska sättas för energianvändningen är upp till varje land att besluta. I Sverige pågår just nu en debatt om detta och Energimyndighete...

  16. Época de nascimento sobre a composição regional e tecidual da carcaça de cordeiros da raça Texel Birth season on regional and tissue carcass composition in Texel breed lambs

    Directory of Open Access Journals (Sweden)

    Gilson de Mendonça

    2008-06-01

    Full Text Available Foram avaliados os efeitos de épocas alternativas de nascimento sobre a composição regional e tecidual da carcaça em ovinos. Quarenta e nove cordeiros machos não-castrados da raça Texel, nascidos em duas épocas (agosto e novembro, foram mantidos em regime de pastagem e abatidos com média de idade de 129 e 164 dias, respectivamente. Previamente aos abates foi feita a avaliação da produção forrageira do campo pelo método Botanal. Foram verificadas melhores condições forrageiras para os cordeiros nascidos em agosto, que apresentaram maior peso e proporção na maioria dos cortes, assim como menor proporção de músculo na paleta e perna; apresentando maior conteúdo de tecido adiposo na maioria dos cortes da carcaça. Para os cordeiros nascidos em novembro, ocorreu maior relação músculo:gordura e músculo:osso na paleta e na perna, assim como maior relação músculo:gordura no costilhar. As condições nutricionais são responsáveis pelas diferenças nos pesos e rendimentos dos cortes, assim como na composição tecidual da carcaça, em cordeiros mantidos em regime de pasto, viabilizando o uso de época alternativa de nascimentos para incrementar a oferta de animais para o abate.The effect of alternative birth season on regional and tissue carcass composition of sheep was evaluated. Forty nine (49 Texel intact male lambs, born in two seasons (August and November, were kept under grazing and slaughtered with an average age of 129 and 164 days, respectively. Prior to slaughter forage production was measured using Botanal method. Lambs born in August had more favorable forage conditions, showing higher body weight and proportion in the majority of cuts, as well as lower proportion of shoulder and leg muscles showing higher adipose tissue content in the majority of carcass cuts. For lambs born in November, a higher muscle:fat and muscle:bone rate in shoulder and leg, as well as a higher ribcut muscle:fat rate. Nutritional

  17. Rheumatoid Arthritis (RA) associated interstitial lung disease (ILD).

    LENUS (Irish Health Repository)

    O'Dwyer, David N

    2013-10-01

    Rheumatoid Arthritis (RA) is the most common Connective Tissue Disease (CTD) and represents an increasing burden on global health resources. Interstitial lung disease (ILD) has been recognised as a complication of RA but its potential for mortality and morbidity has arguably been under appreciated for decades. New studies have underscored a significant lifetime risk of ILD development in RA. Contemporary work has identified an increased risk of mortality associated with the Usual Interstitial Pneumonia (UIP) pattern which shares similarity with the most devastating of the interstitial pulmonary diseases, namely Idiopathic Pulmonary Fibrosis (IPF). In this paper, we discuss recent studies highlighting the associated increase in mortality in RA-UIP. We explore associations between radiological and histopathological features of RA-ILD and the prognostic implications of same. We emphasise the need for translational research in this area given the growing burden of RA-ILD. We highlight the importance of the respiratory physician as a key stakeholder in the multidisciplinary management of this disorder. RA-ILD focused research offers the opportunity to identify early asymptomatic disease and define the natural history of this extra articular manifestation. This may provide a unique opportunity to define key regulatory fibrotic events driving progressive disease. We also discuss some of the more challenging and novel aspects of therapy for RA-ILD.

  18. Tissue-specific expression of the human laminin alpha5-chain, and mapping of the gene to human chromosome 20q13.2-13.3 and to distal mouse chromosome 2 near the locus for the ragged (Ra) mutation

    DEFF Research Database (Denmark)

    Durkin, M E; Loechel, F; Mattei, M G

    1997-01-01

    , heart, lung, skeletal muscle, kidney, and pancreas. The human laminin alpha5-chain gene (LAMA5) was assigned to chromosome 20q13.2-q13.3 by in situ hybridization, and the mouse gene (Lama5) was mapped by linkage analysis to a syntonic region of distal chromosome 2, close to the locus for the ragged (Ra......) mutation....

  19. Radium isotope ((223)Ra, (224)Ra, (226)Ra and (228)Ra) distribution near Brazil's largest port, Paranaguá Bay, Brazil.

    Science.gov (United States)

    Dias, Thais H; de Oliveira, Joselene; Sanders, Christian J; Carvalho, Franciane; Sanders, Luciana M; Machado, Eunice C; Sá, Fabian

    2016-10-15

    This work investigates the (223)Ra, (224)Ra, (226)Ra and (228)Ra isotope distribution in river, estuarine waters and sediments of the Paranaguá Estuarine Complex (PEC). The stratification of the Ra isotopes along water columns indicate differing natural sources. In sediments, the radium isotope activities was inversely proportional to the particle size. The highest concentrations of (223)Ra, (224)Ra, (226)Ra and (228)Ra in the water column were found in the bottom more saline waters and towards the inner of the estuary. These relatively high concentrations towards the bottom of the estuary may be attributed to the influence of tidally driven groundwater source and desorption from particles at the maximum turbidity zone. The apparent river water ages from the radium isotope ratios, (223)Ra/(224)Ra and (223)Ra/(228)Ra, indicate that the principal rivers that flow into the estuary have residence times from between 6 and 11days. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Understanding Rheumatoid Arthritis (RA): Research

    Science.gov (United States)

    ... this page please turn JavaScript on. Feature: Understanding Rheumatoid Arthritis (RA) Research Past Issues / Summer 2014 Table of ... a project plan to address relevant challenges for rheumatoid arthritis. Read Part 1 on Lupus in MedlinePlus magazine, ...

  1. Determination of Ra-224 and Ra-226 in drinking waters

    Science.gov (United States)

    Semenishchev, V. S.; Betenekov, N. D.; Tomashova, L. A.; Voronina, A. V.

    2017-09-01

    Activity of 224Ra and 226Ra were determined in some types of natural drinking water. An improved method of radiochemical analysis of radium was developed. The method included radium preconcentration by the granulated titanium dioxide and further thin alpha source preparation by radium sorption onto a thin-layer manganese dioxide disk based on cellulose triacetate (MnO2-CTA). It was shown that time of radium sorption on MnO2-CTA should be 1 day; sorption degree of 75 % was achieved. Longer sorption resulted in sorption degree of 85 % but the quality of alpha spectrum was lower due to radium diffusion into the MnO2 film. 22 samples of commercially available mineral waters, 4 samples from springs and 4 samples from wells near Yekaterinburg city were analyzed. The results demonstrated that mineral waters contain more 226Ra (0.4-125 mBq L-1) than fresh underground water (0.5-29 mBq L-1); no samples were found with 226Ra activity exceeding maximum allowable level (490 mBq L-1). Activities of 224Ra in fresh waters were found to be 0.5 to 20 mBq L-1 that was also less than the maximum allowable level.

  2. Tissue-specific expression of the human laminin alpha5-chain, and mapping of the gene to human chromosome 20q13.2-13.3 and to distal mouse chromosome 2 near the locus for the ragged (Ra) mutation

    DEFF Research Database (Denmark)

    Durkin, M E; Loechel, F; Mattei, M G

    1997-01-01

    To investigate the function of the laminin alpha5-chain, previously identified in mice, cDNA clones encoding the 953-amino-acid carboxy terminal G-domain of the human laminin alpha5-chain were characterized. Northern blot analysis showed that the laminin alpha5-chain is expressed in human placenta......, heart, lung, skeletal muscle, kidney, and pancreas. The human laminin alpha5-chain gene (LAMA5) was assigned to chromosome 20q13.2-q13.3 by in situ hybridization, and the mouse gene (Lama5) was mapped by linkage analysis to a syntonic region of distal chromosome 2, close to the locus for the ragged (Ra...

  3. Lightcurve of NEA 1993 RA

    Science.gov (United States)

    Vaduvescu, Ovidiu; Aznar Macias, Amadeo

    2018-01-01

    The near-Earth asteroid (NEA) 1993 RA was observed with the 2.5-m Isaac Newton Telescope (INT) in full Moon conditions for 8h total during three successive nights (2017 Oct 3-6). The composite lightcurve could be fit by a 3-order period P = 5.64 ± 0.01 h with amplitude of 0.13 mag; other solutions are possible.

  4. Compilation of Spectroscopic Data of Radium (Ra I and Ra II)

    NARCIS (Netherlands)

    Dammalapati, U.; Jungmann, K.; Willmann, L.

    2016-01-01

    Energy levels, wavelengths, lifetimes, and hyperfine structure constants for the isotopes of the first and second spectra of radium, Ra I and Ra II, have been compiled. Wavelengths and wavenumbers are tabulated for 226Ra and for other Ra isotopes. Isotope shifts and hyperfine structure constants of

  5. Compilation of spectroscopic data of Radium (Ra I and Ra II)

    CERN Document Server

    Dammalapati, U; Willmann, L

    2016-01-01

    Energy levels, wavelengths, lifetimes and hyperfine structure constants for the isotopes of the first and second spectra of radium, Ra I and Ra II have been compiled. Wavelengths and wave numbers are tabulated for 226Ra and for other Ra isotopes. Isotope shifts and hyperfine structure constants of even and odd-A isotopes of neutral radium atom and singly ionized radium are included. Experimental lifetimes of the states for both neutral and ionic Ra are also added, where available. The information is beneficial for present and future experiments aimed at different physics motivations using neutral Ra and singly ionized Ra.

  6. Compilation of spectroscopic data of Radium (Ra I and Ra II)

    OpenAIRE

    Dammalapati, U.; Jungmann, K.; Willmann, L.

    2016-01-01

    Energy levels, wavelengths, lifetimes and hyperfine structure constants for the isotopes of the first and second spectra of radium, Ra I and Ra II have been compiled. Wavelengths and wave numbers are tabulated for 226Ra and for other Ra isotopes. Isotope shifts and hyperfine structure constants of even and odd-A isotopes of neutral radium atom and singly ionized radium are included. Experimental lifetimes of the states for both neutral and ionic Ra are also added, where available. The informa...

  7. [Clinical features of atypical refractory anemia (RA)].

    Science.gov (United States)

    Matsuda, A; Jinnai, I; Kusumoto, S; Shiramatsu, F; Bessho, M; Saito, M; Hirashima, K

    1991-08-01

    Twenty-three patients with bicytopenia or pancytopenia were retrospectively studied. The patients with underlying disorders, blast count of more than 5% on bone marrow (BM) aspirate, blast count of more than 1% on peripheral blood or ringed sideroblast count of more than 15% on BM aspirate were excluded. According to Yoshida's criteria, 23 patients were classified into 6 subtypes [AA (aplastic anemia)1: typical AA, AA2: atypical AA, MDS (myelodysplastic syndrome)3: typical RA (refractory anemia, MDS4-6: atypical RA], and AA1 7 cases; AA2 2 cases; MDS3 5 cases; MDS4 1 case; MDS5 2 cases; MDS6 6 cases. To clarify the clinical features of atypical RA group (MDS4-6), we investigated ferrokinetics, RBC life span, karyotype, serum Epo (erythropoietin) concentration, response to therapy and prognosis. Results were as follows: 1) all three RA patients who were younger than 30 years old were included in atypical RA group, 2) in ferrokinetics study PID (plasma iron disappearance time) values of MDS4 and MDS6 patients ranged between those of AA1 and those of MDS3 patients (5 of 7 patients), 3) two cases who developed leukemia belonged to typical RA group, 4) patients with atypical RA showed response to therapy and their prognosis were better than those with typical RA. These observations suggest that atypical RA have different clinical features from typical RA.

  8. LCA versus RA - an introduction

    DEFF Research Database (Denmark)

    Olsen, Stig Irving

    2000-01-01

    Risk Assessment (RA) of chemicals is an environmental management tool used to assess the risk of specific chemicals, which are harmful to man or the environment under certain circumstances of use or in certain environmental recipients. Life Cycle Assessment (LCA) or environmental assessment...... of products is another environmental management tool that gains more and more ground, and which is often thought of as universal due to its basic holistic philosophy. As the environmental impacts of one product can only be seen in relation to the impacts of other products providing the same functions, LCA...... is a comparative tool. The primary purpose of this article is to identify harmonies, discrepancies and relations between the two tools, exemplified by the risk assessment principles of the European Commission (EC) as stated in 'Technical Guidance Document' (EC, 1996) and the LCA method 'EDIP' (Environmental Design...

  9. Evaluation of Lama5 as a candidate for the mouse ragged (Ra) mutation

    DEFF Research Database (Denmark)

    Durkin, M E; Albrechtsen, R; Chambers, D M

    1998-01-01

    The laminin alpha5 chain is a component of the basement membranes of many developing and adult tissues. The mouse laminin alpha5 chain gene (Lama5) has been mapped close to the locus of the semidominant ragged (Ra) mutation on distal chromosome 2. The cause of the Ra mutation, which is usually...... lethal in the homozygous state, has not been determined. We have investigated whether a defect in Lama5 is responsible for the ragged mutation, using the RaJ strain. No differences in the level of the laminin alpha5 chain transcript were found in placental RNA from homozygous RaJ mutant embryos compared....... These results exclude Lama5 as a candidate gene for the Ra mutation....

  10. Determination of 226Ra and 224Ra in drinking waters by liquid scintillation counting.

    Science.gov (United States)

    Manjón, G; Vioque, I; Moreno, H; García-Tenorio, R; García-León, M

    1997-04-01

    A method for the determination of Ra-isotopes in water samples has been developed. Ra is coprecipitated with Ba as sulphate. The precipitate is then dissolved with EDTA and counted with a liquid scintillation system after mixing with a scintillation cocktail. The study of the temporal evolution of the separated activity gives the isotopic composition of the sample, i.e. the 224Ra and 226Ra contribution to the total activity. The method has been applied to some Spanish drinking waters.

  11. Sexual dimorphism of RA manifestations: genes, hormones and behavior.

    Science.gov (United States)

    Kovacs, William J; Olsen, Nancy J

    2011-05-01

    Women are more likely than men to develop rheumatoid arthritis (RA), and recent data suggest that they also suffer greater disability than men with this disease. The reasons for these sexually dimorphic patterns of disease incidence and progression are unknown, but investigations into the underlying mechanisms could provide useful insights into RA pathogenesis and may also suggest new treatment approaches. The processes of sexual differentiation involve genetic input, gonadal hormone signaling and responses from target cells and tissues. Layered upon these processes are behavioral characteristics of males and females acquired as a result of their social context. Differences in disease presentation between the sexes could be the result of complex combinations of all these factors. Recent research suggests that the developmental processes of sexual differentiation might render women more susceptible than men to similar levels of immune or inflammatory burden by virtue of sex-specific differences in body composition and structure.

  12. Knock-Down of IL-1Ra in Obese Mice Decreases Liver Inflammation and Improves Insulin Sensitivity

    Science.gov (United States)

    Franck, Niclas; Maris, Michael; Nalbandian, Sarah; Talukdar, Saswata; Schenk, Simon; Hofmann, Hans-Peter; Bullough, David; Osborn, Olivia

    2014-01-01

    Interleukin 1 Receptor antagonist (IL-1Ra) is highly elevated in obesity and is widely recognized as an anti-inflammatory cytokine. While the anti-inflammatory role of IL-1Ra in the pancreas is well established, the role of IL-1Ra in other insulin target tissues and the contribution of systemic IL-1Ra levels to the development of insulin resistance remains to be defined. Using antisense knock down of IL-1Ra in vivo, we show that normalization of IL-1Ra improved insulin sensitivity due to decreased inflammation in the liver and improved hepatic insulin sensitivity and these effects were independent of changes in body weight. A similar effect was observed in IL1-R1 KO mice, suggesting that at high concentrations of IL-1Ra typically observed in obesity, IL-1Ra can contribute to the development of insulin resistance in a mechanism independent of IL-1Ra binding to IL-1R1. These results demonstrate that normalization of plasma IL-1Ra concentration improves insulin sensitivity in diet- induced obese mice. PMID:25244011

  13. Knock-down of IL-1Ra in obese mice decreases liver inflammation and improves insulin sensitivity.

    Directory of Open Access Journals (Sweden)

    Niclas Franck

    Full Text Available Interleukin 1 Receptor antagonist (IL-1Ra is highly elevated in obesity and is widely recognized as an anti-inflammatory cytokine. While the anti-inflammatory role of IL-1Ra in the pancreas is well established, the role of IL-1Ra in other insulin target tissues and the contribution of systemic IL-1Ra levels to the development of insulin resistance remains to be defined. Using antisense knock down of IL-1Ra in vivo, we show that normalization of IL-1Ra improved insulin sensitivity due to decreased inflammation in the liver and improved hepatic insulin sensitivity and these effects were independent of changes in body weight. A similar effect was observed in IL1-R1 KO mice, suggesting that at high concentrations of IL-1Ra typically observed in obesity, IL-1Ra can contribute to the development of insulin resistance in a mechanism independent of IL-1Ra binding to IL-1R1. These results demonstrate that normalization of plasma IL-1Ra concentration improves insulin sensitivity in diet- induced obese mice.

  14. ICMPv6 RA Flooding Vulnerability Research

    National Research Council Canada - National Science Library

    Linas Jočys

    2016-01-01

    .... It is know that ICMPv6 is technologically vulnerable. One of those vulnerabilities is the ICMPv6 RA flooding vulnerability, which can lead to systems in Local Area Network slow down or full stop...

  15. Understanding Rheumatoid Arthritis (RA): Treatment and Causes

    Science.gov (United States)

    ... this page please turn JavaScript on. Feature: Understanding Rheumatoid Arthritis (RA) Treatment and Causes Past Issues / Summer 2014 Table of Contents How Is Rheumatoid Arthritis Treated? Doctors have many ways to treat this ...

  16. RA Construction KC, LLC Information Sheet

    Science.gov (United States)

    RA Construction KC, LLC (the Company) is located in Gladstone, Missouri. The settlement involves renovation activities conducted at a property constructed prior to 1978, located in Kansas City, Missouri.

  17. Napadi na računarske sisteme

    OpenAIRE

    Vuletić V. Dejan

    2012-01-01

    Računarski sistemi su kritični segment ljudskog društva u 21. veku. Ekonomski sektor, odbrana, bezbednost, energetika, telekomunikacije, industrijska proizvodnja, finansije i druge vitalne infrastrukture zavise od računarskih sistema koje rade u lokalnim, nacionalnim ili globalnim razmerama. Poseban problem jeste što se zbog ubrzanog razvoja informaciono-komunikacione tehnologije i nezaustavljivog rasta njene primene u svim sferama ljudskog društva uvećava njegova ranjivost ...

  18. Article sur barrage de Téra

    African Journals Online (AJOL)

    ENI DOSSO

    Situé dans le Liptako nigérien, en zone de socle, où les ressources en eau souterraines sont limitées, le département de Téra et, en particulier, son chef lieu, la ville de Téra, est confrontée à un problème aigu d'approvisionnement en eau potable des populations. Aussi, comme solution à ce manque d'eau qui bloque.

  19. Verjetnostni model računanja:

    OpenAIRE

    Žerovnik, Janez

    1989-01-01

    In article a survey of a probabilistic model of computation is given. Some classes of probabilistic algorithms are defined. Preliminary sections give definition of classical (deterministic) model of computation and introduction to the theory of time complexity of computation. V preglednem članku predstavimo verjetnostni model računanja in podamo definicijo nekaterih razredov časovne zahtevnosti verjetnostnih algoritmov. V začetnih razdelkih vpeljemo klasični (deterministični) model računan...

  20. 228Ra, 226Ra, 224Ra and 223Ra in potential sources and sinks of land-derived material in the German Bight of the North Sea: implications for the use of radium as a tracer

    NARCIS (Netherlands)

    Schmidt, C.; Hanfland, C.; Regnier, P.; Van Cappellen, P.; Schlüter, M.; Knauthe, U.; Stimac, I.; Geibert, W.

    2011-01-01

    Activities of the naturally occurring radium nuclides 228Ra, 226Ra, 224Ra and 223Ra were determined in waters of the open German Bight and adjacent nearshore areas in the North Sea, in order to explore the potential use of radium isotopes as natural tracers of land–ocean interaction in an

  1. ICMPv6 RA Flooding Vulnerability Research

    Directory of Open Access Journals (Sweden)

    Linas Jočys

    2016-06-01

    Full Text Available ICMPv6 is the newest version of internet control message protocol, whose main purpose is to send error message indicating packet processing failure. It is know that ICMPv6 is technologically vulnerable. One of those vulnerabilities is the ICMPv6 RA flooding vulnerability, which can lead to systems in Local Area Network slow down or full stop. This paper will discuss Windows (XP, 7, 8.1 and Linux Ubuntu 14 operating systems resistance to RA flooding attack research and countermeasures to minimize this vulnerability.

  2. Distribution and retention in bone of /sup 226/Ra and comparison with the ICRP 20 model

    Energy Technology Data Exchange (ETDEWEB)

    Holtzman, R.B.; Rundo, J.; Sha, J.Y.; Spaletto, M.I.

    1981-01-01

    Analyses are presented of the ratios of /sup 226/Ra to calcium in over 650 samples of compact and cancellous bone from 66 female and 26 male subjects who had died from less than one to 60 years after first exposure to radium. The /sup 226/Ra/Ca ratios were normalized to the terminal /sup 226/Ra skeletal content. The /sup 226/Ra/Ca ratios for vertebrae were essentialy identical to those for other cancellous bone for a given subject. Comparisons of the data with predictions of the ICRP model of alkaline earth metabolism show that for female cancellous bone the normalized /sup 226/Ra/Ca ratios tended to be greater than predicted, while those for female cortical bone (femoral and tibial shaft) tended to be less. The data for males were fitted better by the model. A modification of the model to reduce the amount of radium deposited in soft tissue fitted the data better in some respects. A straight line linear least squares fit to the data appeared to fit as well as, or better than, the models. A radiation effect was suggested in that the normalized /sup 226/Ra/Ca ratio for vertebrae relative to the ratio expected increased with skeletal absorbed dose for vertebra. However, no such effect was apparent for compact bone or for the cancellous bone as a whole.

  3. A rotating target for Ra production

    NARCIS (Netherlands)

    Sohani, M.; Wilschut, H. W.

    2012-01-01

    A target wheel with pyrolytic graphite targets is designed and constructed at the TRI mu P facility to boost the production rate of Ra isotopes. Simulation, design properties and production results are discussed. (C) 2012 Elsevier B.V. All rights reserved.

  4. Chôra : Creation and Pathology

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2009-01-01

    Plato's dialogue the Timaeus describes not only the making of the cosmos (order), but also the condition of what is not order, neither for the human body nor for the universe. What is disorder in cosmogonic terms it is disease for the human body. Timaeus applies to the concept chôra in discussing...

  5. Nuclear structure of Ra at high spin

    Indian Academy of Sciences (India)

    However, nuclear structure at high spin and excitation energies (∼ 6 MeV) would require a coupling of excited 1p–1h with 208Pb core. The coupling between single- particle orbitals and collective vibrations of core complicates the simple shell model picture. With increasing neutron number, Ra isotopes show an abrupt ...

  6. Rapid Method for Ra-226 and Ra-228 in Water Samples

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, Sherrod, L. III

    2006-02-10

    The measurement of radium isotopes in natural waters is important for oceanographic studies and for public health reasons. Ra-226 (1620 year half-life) is one of the most toxic of the long-lived alpha emitters present in the environment due to its long life and its tendency to concentrate in bones, which increases the internal radiation dose of individuals. The analysis of radium-226 and radium-228 in natural waters can be tedious and time-consuming. Different sample preparation methods are often required to prepare Ra-226 and Ra-228 for separate analyses. A rapid method has been developed at the Savannah River Environmental Laboratory that effectively separates both Ra-226 and Ra-228 (via Ac-228) for assay. This method uses MnO{sub 2} Resin from Eichrom Technologies (Darien, IL, USA) to preconcentrate Ra-226 and Ra-228 rapidly from water samples, along with Ba-133 tracer. DGA Resin{reg_sign} (Eichrom) and Ln-Resin{reg_sign} (Eichrom) are employed in tandem to prepare Ra-226 for assay by alpha spectrometry and to determine Ra-228 via the measurement of Ac-228 by gas proportional counting. After preconcentration, the manganese dioxide is dissolved from the resin and passed through stacked Ln-Resin-DGA Resin cartridges that remove uranium and thorium interferences and retain Ac-228 on DGA Resin. The eluate that passed through this column is evaporated, redissolved in a lower acidity and passed through Ln-Resin again to further remove interferences before performing a barium sulfate microprecipitation. The Ac-228 is stripped from the resin, collected using cerium fluoride microprecipitation and counted by gas proportional counting. By using vacuum box cartridge technology with rapid flow rates, sample preparation time is minimized.

  7. Removal of 226Ra and 228Ra from TENORM sludge waste using surfactants solutions.

    Science.gov (United States)

    Attallah, M F; Hamed, Mostafa M; El Afifi, E M; Aly, H F

    2015-01-01

    The feasibility of using surfactants as extracting agent for the removal of radium species from TENORM sludge produced from petroleum industry is evaluated. In this investigation cationic and nonionic surfactants were used as extracting agents for the removal of radium radionuclides from the sludge waste. Two surfactants namely cetyltrimethylammonium bromide (CTAB) and Triton X-100 (TX100) were investigated as the extracting agents. Different parameters affecting the removal of both (226)Ra and (228)Ra by the two surfactants as well as their admixture were studied by the batch technique. These parameters include effect of shaking time, surfactants concentration and temperature as well as the effect of surfactants admixture. It was found that, higher solution temperature improves the removal efficiency of radium species. Combined extraction of nonionic and cationic surfactants produces synergistic effect in removal both (226)Ra and (228)Ra, where the removals reached 84% and 80% for (226)Ra and (228)Ra, respectively, were obtained using surfactants admixture. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. MRI comes of age in RA clinical trials

    DEFF Research Database (Denmark)

    Peterfy, Charles; Østergaard, Mikkel; Conaghan, Philip G

    2013-01-01

    The success of modern rheumatoid arthritis (RA) therapies and treatment strategies has led to extended placebo phases being unethical in RA randomised controlled trials (RCTs). Modern trials therefore increasingly involve active comparator designs, and this together with some technical issues has...... in support of claims of inhibition of progression of structural damage in RA trials....

  9. Automated measurement of {sup 224}Ra and {sup 226}Ra in water

    Energy Technology Data Exchange (ETDEWEB)

    Dimova, N. [Department of Oceanography, Environmental Radioactivity Measurement Facility, Florida State University, Tallahassee, FL 32306 (United States); Burnett, W.C. [Department of Oceanography, Environmental Radioactivity Measurement Facility, Florida State University, Tallahassee, FL 32306 (United States)]. E-mail: wburnett@mailer.fsu.edu; Horwitz, E.P. [PG Research Foundation, 8205 S. Cass Avenue, Suite III, Darien, IL 60561 (United States); Lane-Smith, D. [Durridge Co., Inc., 7 Railroad Avenue, Suite D, Bedford, MA 01730 (United States)

    2007-04-15

    We present a new simple approach for automated, non-destructive measurement of the alpha-emitting radium isotopes ({sup 223}Ra, {sup 224}Ra, and {sup 226}Ra) in water based on the emanation of their respective radon daughters ({sup 219}Rn, {sup 220}Rn, and {sup 222}Rn). The method combines the high adsorption uptake of MnO{sub 2} Resin for radium (K {sub d}=2.4x10{sup 4} ml/g) over a wide pH range with the simplicity of the activity registration using a commercial radon-in-air analyzer (RAD7, DURRIDGE Company, Inc). Radium is first adsorbed onto the MnO{sub 2} Resin by passing a water sample through the resin packed in a gas-tight glass cartridge. The same cartridge is then connected to the radon analyzer via a simple tubing system to circulate air through the resin and a drying system. The efficiency of the proposed system is determined by running standards prepared in the same manner. Our results indicate that the efficiency for {sup 226}Ra is >22% if both {sup 218}Po and {sup 214}Po counts are collected. This is comparable with typical efficiencies for alpha spectrometry but with much less sample preparation. We estimate that an MDA of 0.8 pCi/L for {sup 226}Ra may be obtained with this new approach using a 1 L water sample and less than 4 h of counting.

  10. Productivity loss due to absenteeism and presenteeism by different instruments in patients with RA and subjects without RA

    NARCIS (Netherlands)

    Braakman-Jansen, Louise Marie Antoinette; Kuper, Ina H.; van de Laar, Mart A F J; Taal, Erik

    2012-01-01

    Objectives. To explore the impact of at-work productivity loss on the total productivity cost by different instruments in patients recently diagnosed with RA and controls without RA. Methods. Cross-sectional data were collected from outpatients with RA between December 2007 and February 2008. The

  11. Document management system "Raštvedyba"

    OpenAIRE

    Fokina, Julija

    2007-01-01

    SUMMARY Document management system “Raštvedyba” Modern people really very rarely think about how important is the electic power nowdays. We understand it’s importance only when we don’t have it because of emergency or something like that. This way we have the evening with “candle”, without radio and television, all home appliences don’t work at all. Although energetic specialists apply the best disaster facilities to avoid the emergency situations, sometimes it doesnt help and people ...

  12. Ra-226 bioaccumulation and growth indices in fish.

    Science.gov (United States)

    Shi, Xiaopei; Smith, Richard; Seymour, Colin; Mothersill, Carmel

    2017-06-01

    To determine the accumulated activity of Ra-226 in fathead minnows fed with environmentally relevant levels of Ra-226 for 5 months in water at 20 °C, and to evaluate the influence of this level of Ra-226 on the growth of fathead minnows. Fathead minnows were fed with fish food containing 10-10,000 mBq/g Ra-226 for 5 months. At the end of the experiment, the fish were sacrificed, flash frozen in liquid nitrogen and kept at -20 °C. Longitudinal sections of 40 μm thickness were cut at the middle of the fish body using a cryostat. The activity of Ra-226 in each section was determined using autoradiography with a nuclear track detector CR-39. According to the weight and the width of the fish, the activity of Ra-226 in the whole fish body could be estimated. In addition, the length and the weight of the fish were measured and the condition factor was calculated to evaluate the growth and fitness of the fish. There is a positive but non-linear relationship between the accumulated activity of Ra-226 in fish body and the concentration of Ra-226 in fish food. The highest activity of Ra-226 accumulated in fish body was found from fish fed with 10,000 mBq/g Ra-226 food. This was calculated as 256.4 ± 49.1 mBq/g, p fish fed with food containing lower concentration of Ra-226 (up to 1000 mBq/g), the bioaccumulation of Ra-226 in the body saturated. The Ra-226 concentration factor (CF) for fish was inversely proportional to the Ra-226 activity in food, and the highest CF value was 2.489, obtained from the lowest dietary Ra-226 activity (10 mBq/g). In addition, condition factors (K) of fish in all Ra-226-treated groups were significantly lower than those of the controls. The results show that the bioaccumulation of Ra-226 in fish is not simply related to the dietary Ra-226 activity, and has a saturation value when the dietary activity is low. In addition, the environmental level of Ra-226 in the fish food has a small adverse effect on the growth and fitness of fathead

  13. Raúl Pepe Verano Montesinos

    OpenAIRE

    José Luis Luque

    2013-01-01

    El 31 de enero de 2005 falleció en Lima el doctor Raúl Verano. Nacido el 12 de julio de 1940 en Cajatambo, realizó sus estudios superiores en la Universidad Nacional Mayor de San Marcos, graduándose en 1971 de bachiller en Educación y en 1972 obtuvo el grado de bachiller en Biología con la tesis Foraminíferos del litoral del departamento de Lima; optando la profesión de Biólogo en 1973. Empezó sus actividades docentes en 1965 como Ayudante de Prácticas en las cá- tedras de zoología y desde 19...

  14. Pregnancy in Rađevina customs

    Directory of Open Access Journals (Sweden)

    Petrović-Savić Mirjana

    2012-01-01

    Full Text Available The paper discusses the representation of pregnancy in the customs and beliefs of a region in Serbia known as Rađevina. The research was aimed at recording and preserving the customs and lexis regarding pregnancy in this part of Serbia. We obtained the lexis through topic guided conversations with the informants. The article is divided into several sections: on pregnancy before pregnancy, prohibitions during pregnancy and consequences if they are not observed, revealing the baby's gender, conclusion and glossary. Rađevina used to have a system of regulations that the pregnant woman had to adhere to. Special attention was paid to the behavior of the pregnant woman herself. It was in larger part regulated by means of numerous prohibitions and limitations. Most of those prohibitions were based on the assumption of a magical relation of the future mother and the fetus in her womb. It is interesting to note that some prohibitions were observed before pregnancy itself, during the wedding ritual. In this period, the community tended to facilitate the bride's conception of a fair, healthy male child. During pregnancy itself the pregnant woman used certain objects to protect herself from evil and negative influences of her surroundings. The largest number of prohibitions during pregnancy were implemented so that a healthy, but also fair child should be born. Apart from that, the prohibitions were intended to influence the child's longevity. The section on pregnancy before pregnancy lists the techniques applied in the wedding ritual which influenced the bride's fertility with imitative magic. We also shed some light on the traditional revealing of the future child's gender, and the paper is ends with a glossary.

  15. Gene expression analysis in RA: towards personalized medicine

    Science.gov (United States)

    Burska, A N; Roget, K; Blits, M; Soto Gomez, L; van de Loo, F; Hazelwood, L D; Verweij, C L; Rowe, A; Goulielmos, G N; van Baarsen, L G M; Ponchel, F

    2014-01-01

    Gene expression has recently been at the forefront of advance in personalized medicine, notably in the field of cancer and transplantation, providing a rational for a similar approach in rheumatoid arthritis (RA). RA is a prototypic inflammatory autoimmune disease with a poorly understood etiopathogenesis. Inflammation is the main feature of RA; however, many biological processes are involved at different stages of the disease. Gene expression signatures offer management tools to meet the current needs for personalization of RA patient's care. This review analyses currently available information with respect to RA diagnostic, prognostic and prediction of response to therapy with a view to highlight the abundance of data, whose comparison is often inconclusive due to the mixed use of material source, experimental methodologies and analysis tools, reinforcing the need for harmonization if gene expression signatures are to become a useful clinical tool in personalized medicine for RA patients. PMID:24589910

  16. IL-1Ra: its role in rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    M. Cutolo

    2011-09-01

    Full Text Available Interleukin-1 (IL-1 is one of the pivotal cytokines in initiating and driving the processes of rheumatoid arthritis (RA, and the body’s natural response, IL-1 receptor antagonist (IL-1Ra, has been shown conclusively to block its effects. IL-1 mediate several clinical symptoms of the inflammatory reaction (i.e. fever, pain, sleep disturbances. IL-1 is considered a key mediator in RA joint damage because of its greater capacity (greater than TNF of increasing matrix degradation by inducing the production of MMPs and PGE2 in synovial cells, as well by its role as mediator of bone and cartilage destruction. In addition, IL-1 decreases the repair process by suppressing matrix synthesis and shows a strong synergism with TNF in inducing many inflammatory genes at both local and systemic level. The induced endogenous production of IL-1Ra, in presence of the RA synovitis, is too low to contrast the high affinity of IL-1 for the cell receptors. Therefore, IL-1Ra presence should result in very effective prevention of IL-1 signal transduction particularly in the inflammatory site. In laboratory and animal studies inhibition of IL-1 by either antibodies to IL-1 or IL-1Ra proved beneficial to the outcome. IL-1Ra is a member of the IL-1 superfamily. The effects of different DMARDs on IL-1Ra levels in RA patients support the important role that selected anticytokine treatments might exert in the pathophysiology of the disease. However, since anti TNFα therapy it is not effective in all RA patients, nor does it fully control the arthritic process in affected joints of good responders and complete TNF suppression should be avoided, the combined treatment with intermediate doses of TNF and IL-1 blockers, reaching synergistic suppression of arthritis, seems warranted in RA.

  17. Posledice kvantnega računalništva

    OpenAIRE

    Malenko, Kokan

    2017-01-01

    Kvantno računalništvo je novo obetavno področje, ki bi lahko prineslo velike izboljšave današnje tehnologije. Vendar pa bi lahko obenem tudi razorožilo nekatere priljubljene kriptografske algoritme. Čeprav uporabnih in stabilnih kvantnih računalnikov še ni, sta njihova potencialna moč in uporabnost spodbudili veliko zanimanje. V tem delu bomo pojasnili osnovne lastnosti kvantnega računalnika, tj. ra-ču-nal-ni-ka, ki izkorišča kvantnomehanske pojave, kot so superpozicija, intefe...

  18. Drugs or disease: evaluating salivary function in RA patients

    Directory of Open Access Journals (Sweden)

    Sandra Regina TORRES

    Full Text Available Abstract Oral complications of RA may include temporomandibular joint disorders, mucosa alterations and symptoms of dry mouth. The aim of this study was to evaluate the salivary gland function of subjects with rheumatoid arthritis (RA comparing it to healthy controls. Subjects with other systemic conditions known to affect salivary functions were excluded. A questionnaire was applied for the evaluation of xerostomia. Resting and chewing-stimulated salivary flow rates (SFR were obtained under standard conditions. There were 145 subjects included of the study (104 RA and 38 controls. About 66.7% of the RA subjects and 2.4% in control group presented xerostomia. The median resting SFR were 0.24 ml/min for RA subjects and 0.40 mL/min for controls (p = 0.04. The median stimulated SFR were 1.31 mL/min for RA subjects and 1.52 ml/min for controls (p = 0.33. No significant differences were found between resting and stimulated SFR of RA subjects not using xerogenic medications and controls. There was significantly higher number of subjects presenting hyposalivation in the RA group than among controls, even when subjects using xerogenic medications were eliminated from the analysis. In conclusion, hyposalivation and xerostomia were more frequent among RA subjects not using xerogenic medication than among controls, although there were no significant differences in the median SFR between groups.

  19. Separation of Ra/Ca by ion exchange; Separacion de Ra/Ca por intercambio ionico

    Energy Technology Data Exchange (ETDEWEB)

    Iturbe, J.L.; Jimenez R, M.; Flores M, J

    1991-04-15

    The radium and the calcium belong to the same group in the periodic classification and as consequence both they present very similar chemical properties, that makes difficult its separation. Both elements are also frequently associate in the nature, the calcium is very abundant, the radium is not it and for that reason it is indispensable its separation to analyze to this last one. The alpha spectroscopy is very appropriate to analyze to the {sup 226} Ra, however to achieve a good resolution of the spectra, the samples should contain small quantities of calcium. The purposes of this work were to know the chromatographic behavior of the alkaline-earthy cations: calcium, barium and radium and to apply these knowledge to the separation of the {sup 226} Ra and its analysis by means of alpha spectroscopy. (Author)

  20. rhIL-1Ra reduces hepatocellular apoptosis in mice with acetaminophen-induced acute liver failure.

    Science.gov (United States)

    Hu, Jianjun; Yan, Dejun; Gao, Jin; Xu, Chuanying; Yuan, Yunsheng; Zhu, Runzhi; Xiang, Di; Weng, Shunyan; Han, Wei; Zang, Guoqing; Yu, Yan

    2010-12-01

    Acute liver failure (ALF) is a life-threatening disease that has proven difficult to cure. In Western countries, acetaminophen (APAP) poisoning is the most common cause of ALF. However, the mode of cell death in APAP-induced ALF cases is controversial. Previous studies have shown that administration of anti-interleukin-1 (anti-IL-1) antibody attenuated APAP-induced liver injury, and that administration of anti-IL-1 receptor antagonist (anti-IL-1Ra) antibody exacerbated organ injury. These results prompted us to investigate the roles of IL-1Ra in APAP-induced ALF mice. Our results show that administration of recombinant human IL-1Ra (rhIL-1Ra) could significantly improve the survival rate of mice with ALF induced by APAP. Furthermore, we found that rhIL-1Ras could dramatically inhibit the activities of alanine aminotransferase and aspartate aminotransferase in serum, reduce the death of hepatocytes and accelerate the proliferation of hepatocytes. In addition, we show that hepatocellular apoptosis rather than necrosis was the major cause of ALF-induced animal death, and that the anti-apoptosis role of rhIL-1Ra was mediated by reducing the release of cytochrome c from the mitochondria, and the activities of caspase-3, caspase-8 and caspase-9 in the liver tissue. In conclusion, these data indicate that rhIL-1Ra is a promising candidate for the treatment of APAP-induced ALF in mice through the reduction of hepatocellular apoptosis.

  1. A Mutation in IL4RA Is Associated with the Degree of Pathology in Human TB Patients.

    Science.gov (United States)

    Hölscher, Christoph; Heitmann, Lisa; Owusu-Dabo, Ellis; Horstmann, Rolf D; Meyer, Christian G; Ehlers, Stefan; Thye, Thorsten

    2016-01-01

    The contribution of interleukin- (IL-) 4 receptor-alpha- (Rα-) dependent events in the pathogenesis of tuberculosis (TB) is controversial. We have recently shown IL-13 overexpression in mice to cause recrudescent Mtb replication and centrally necrotizing granulomas strongly resembling pathology of human TB. A deletion of IL-4Rα completely abrogates TB tissue pathology in these mice. To validate our results in human TB patients, we here determined the association of distinct variants of the IL4, IL13, IL4RA, IL13RA1, and IL13RA2 genes with cavity formation in a large Ghanaian cohort of HIV-negative individuals with newly diagnosed pulmonary TB. In fact, the structural variant of the IL4RA I50V, previously shown to result in enhanced signal transduction, was significantly associated with greater cavity size, and a variant of IL13RA2 was associated with disease in females. To evaluate whether the human-like TB pathology in IL-13-overexpressing mice is specifically mediated through the IL-4Rα subunit, we analyzed IL-13 transgenic mice with a genetic ablation of the IL-4Rα. In these mice, the IL-13-mediated increased susceptibility, human-like pathology of collagen deposition around centrally necrotizing granulomas, and alternative macrophage activation were abolished. Together, our genetic association study in human TB patients further supports the assumption that IL-13/IL-4Rα-dependent mechanisms are involved in mediating tissue pathology of human TB.

  2. 226Ra concentration in the teeth of habitants of areas with high level of natural radioactivity in Ramsar.

    Science.gov (United States)

    Aghamiri, S Mahmoud Reza; Ghorbani, Zahra; Darafsheh, Arash; Torabzadeh, Hasan; Fathivand, Ali Asghar; Minuchehr, Abdulhamid; Jalinoos, Alireza

    2006-01-01

    The level of natural radiation in some regions of Ramsar, a northern coastal city of Iran, is known to be among the highest levels of natural radiation in the world. 226Ra existing in high concentrations in the soil of this region is washed by underground water and transferred to the surface. In this way, 226Ra enters the food chain of residents and substitutes within the hard body tissues of humans. 226Ra is one of the so-called bone seekers as its metabolic processes in the human body are similar to calcium and remains in hard tissues of body because of its long half-life, and being an alpha emitter causes dangerous effects on human health. The purpose of this study is to determine the concentration of 226Ra in the teeth of residents of these high-level natural radiation areas, compared with a control group. Thirteen teeth in five groups were studied as the case group and thirteen teeth in five corresponding control groups were inspected. The mean values of the activity of 226Ra in the case group and in the control group were 0.32 and 0.18mBqg(-1), respectively.

  3. {sup 226}Ra concentration in the teeth of habitants of areas with high level of natural radioactivity in Ramsar

    Energy Technology Data Exchange (ETDEWEB)

    Aghamiri, S. Mahmoud Reza [Department of Radiation Medicine, Shahid Beheshti University, Tehran (Iran, Islamic Republic of); Ghorbani, Zahra [Iranian Center of Dental Research, Faculty of Dentistry, Shahid Beheshti University of Medical Science, Tehran (Iran, Islamic Republic of); Darafsheh, Arash [Department of Radiation Medicine, Shahid Beheshti University, Tehran (Iran, Islamic Republic of)]. E-mail: ardaraf@gmail.com; Torabzadeh, Hasan [Department of Operative Dentistry, Faculty of Dentistry, Shahid Beheshti University of Medical Science, Tehran (Iran, Islamic Republic of); Fathivand, Ali Asghar [National Radiation Protection Department (NRPD), Iranian Nuclear Regulatory Authority, Tehran (Iran, Islamic Republic of); Minuchehr, Abdulhamid [Department of Radiation Medicine, Shahid Beheshti University, Tehran (Iran, Islamic Republic of); Jalinoos, Alireza [Nuclear Immunity and Protection Center, Iranian Atomic Energy Organization, Tehran (Iran, Islamic Republic of)

    2006-07-01

    The level of natural radiation in some regions of Ramsar, a northern coastal city of Iran, is known to be among the highest levels of natural radiation in the world. {sup 226}Ra existing in high concentrations in the soil of this region is washed by underground water and transferred to the surface. In this way, {sup 226}Ra enters the food chain of residents and substitutes within the hard body tissues of humans. {sup 226}Ra is one of the so-called bone seekers as its metabolic processes in the human body are similar to calcium and remains in hard tissues of body because of its long half-life, and being an {alpha} emitter causes dangerous effects on human health. The purpose of this study is to determine the concentration of {sup 226}Ra in the teeth of residents of these high-level natural radiation areas, compared with a control group. Thirteen teeth in five groups were studied as the case group and thirteen teeth in five corresponding control groups were inspected. The mean values of the activity of {sup 226}Ra in the case group and in the control group were 0.32 and 0.18 mBq g{sup -1}, respectively.

  4. A novel IL-1RA-PEP fusion protein alleviates blood-brain barrier disruption after ischemia-reperfusion in male rats.

    Science.gov (United States)

    Zhang, Dong-Dong; Jin, Chen; Zhang, Ya-Tao; Gan, Xiang-Dong; Zou, Min-Ji; Wang, Yuan-Yuan; Fu, Wen-Liang; Xu, Tao; Xing, Wei-Wei; Xia, Wen-Ron; Xu, Dong-Gang

    2018-01-15

    Current options to treat clinical relapse in inflammatory central nervous system (CNS) conditions such as cerebral ischemia-reperfusion injury are limited, and agents that are more effective are required. Disruption of the blood-brain barrier is an early feature of lesion formation that correlates with clinical exacerbation and facilitates the entry of inflammatory medium and inflammatory cells. Interleukin-1 receptor antagonist (IL-1RA) is a naturally occurring anti-inflammatory antagonist of the interleukin-1 (IL-1) family. The broad-spectrum anti-inflammatory effects of IL-1RA have been investigated against various forms of neuroinflammation. However, the effect of IL-1RA on blood-brain barrier disruption following ischemia-reperfusion has not been reported. In this study, we investigated the effects of IL-1RA and a novel protein (IL-1RA-PEP) that was fused to IL-1RA with a cell penetrating peptide, on blood-brain barrier integrity, in male rats subjected to transient middle cerebral artery occlusion. After intravenous administration, IL-1RA-PEP (50 mg/kg) penetrated cerebral tissues more effectively than IL-1RA. Moreover, it preserved blood-brain barrier integrity, attenuated changes in expression and localization of tight junction proteins and matrix metalloproteinases, and enhanced angiogenesis in ischemic brain tissue. Further study suggested that the effects of IL-1RA-PEP on preserving blood-brain barrier integrity might be closely correlated with the p65/NF-κB pathway, as evidenced by the effects of the inhibitor JSH-23. Collectively, our results demonstrated that IL-1RA-PEP could effectively penetrate the brain of rats with middle cerebral artery occlusion and ameliorate blood-brain barrier disruption. This finding might represent its novel therapeutic potential in the treatment of the cerebral ischemia-reperfusion injury.

  5. Raúl Pepe Verano Montesinos

    Directory of Open Access Journals (Sweden)

    José Luis Luque

    2013-05-01

    Full Text Available El 31 de enero de 2005 falleció en Lima el doctor Raúl Verano. Nacido el 12 de julio de 1940 en Cajatambo, realizó sus estudios superiores en la Universidad Nacional Mayor de San Marcos, graduándose en 1971 de bachiller en Educación y en 1972 obtuvo el grado de bachiller en Biología con la tesis Foraminíferos del litoral del departamento de Lima; optando la profesión de Biólogo en 1973. Empezó sus actividades docentes en 1965 como Ayudante de Prácticas en las cá- tedras de zoología y desde 1971 fue Jefe de Prácticas. Ascendiendo a Auxiliar en 1974, para luego ocupar diversos cargos en la administración universitaria, siendo los más destacados el de Director del Instituto de Investigaciones Antonio Raimondi entre 1981 y 1985 y Decano de la Facultad de Ciencias Biológicas de la Universidad Nacional Mayor de San Marcos en el período 1988 a 1991. Sus actividades de investigación estuvieron alrededor de la ictioparasitología, obteniendo el grado de Doctor en Ciencias Biológicas en 1987 con la tesis Kudoa peruviana Mateo, 1972, redescripción y ultraestructura; Kudoa sarmientae sp. n y Kudoa estela sp. n en peces de la costa peruana

  6. Activity concentrations of 224Ra, 226Ra, 228Ra and 40K radionuclides in refinery products and the additional radiation dose originated from oil residues in Turkey.

    Science.gov (United States)

    Parmaksiz, A; Agus, Y; Bulgurlu, F; Bulur, E; Yildiz, Ç; Öncü, T

    2013-10-01

    A total of 56 crude oil, refinery product, waste water, sludge and scale samples collected from three refineries were measured by gamma-ray spectrometry. Except for nine samples, all refinery product samples were found to have activity concentrations below the minimum detectable activity (MDA) values. The maximum (224)Ra, (226)Ra, (228)Ra and (40)K activity concentrations in crude oil and refinery product samples were measured as 11.7 ± 4.5, 14.9 ± 3.5, 11.6 ± 4.5, 248.5 ± 18.5 Bq kg(-1), respectively. The maximum (224)Ra, (226)Ra, (228)Ra and (40)K activity concentrations in scale, sludge and water samples were measured as 343.7 ± 11.8, 809.2 ± 29.0, 302.5 ± 21.6, 623.0 ± 80.9 Bq kg(-1), respectively. Radium equivalent activities of the residue samples were calculated up to 1241.8 ± 42.4 Bq kg(-1). The maximum activity concentration index and the alpha index were found to be 4.2 and 4.0, respectively. The annual effective doses of residue samples were calculated below the permitted dose rate for the public, i.e. 1 mSv y(-1).

  7. Recovery of Ra-223 from natural thorium irradiated by protons

    Energy Technology Data Exchange (ETDEWEB)

    Vasiliev, Aleksandr N.; Ostapenko, Valentina S. [Lomonosov Moscow State Univ. (Russian Federation); Russian Academy of Sciences, Moscow-Troitsk (Russian Federation). Inst. for Nuclear Research; Lapshina, Elena V.; Ermolaev, Stanislav V.; Zhuikov, Boris L. [Russian Academy of Sciences, Moscow-Troitsk (Russian Federation). Inst. for Nuclear Research; Danilov, Sergey S. [Lomonosov Moscow State Univ. (Russian Federation); Kalmykov, Stepan N. [Lomonosov Moscow State Univ. (Russian Federation); National Research Center ' Kurchatov Institute' (NRC ' Kurchatov Institute' ), Moscow (Russian Federation)

    2016-11-01

    Irradiation of natural thorium with medium-energy protons is considered to be a prospective approach to large-scale production of {sup 225}Ac and {sup 223}Ra. In addition to the earlier-developed method of {sup 225}Ac isolation, the present work focuses on the simultaneous recovery of {sup 223}Ra from the same thorium target. Radiochemical procedure is based on liquid-liquid extraction, cation exchange and extraction chromatography. The procedure provides separation of radium from spallation and fission products generated in the thorium target. High chemical yield (85-90%) and radionuclide purity of {sup 223}Ra (> 99.8% except {sup 224}Ra and {sup 225}Ra isotopes) have been achieved.

  8. THE IMMUNOLOGICAL CHARACTERISTIC OF RA PATIENTS WITH ANAEMIA

    Directory of Open Access Journals (Sweden)

    A. E. Sizikov

    2014-07-01

    Full Text Available Abstract. The aim of the investigation was to study the immunological characteristics of RA patients with anaemia. Clinical and laboratory data including the percentage of the main lymphocyte subclasses, phagocyte and DTH-effector activity, serum concentration of immunoglobulins, the percentage of cells producing IFNγ and/or IL-4 and percent of monocytes producing TNF. We revealed some significant clinical, laboratory and immunological differences between RA patients and healthy donors and between patients with and without anaemia. Our data demonstrate RA anemic patients to have more severe disorders than patients without anaemia. We also revealed some significant immunological differences between RA patients and healthy donors and between patients with and without anaemia, including percent of cells producing IFNγ and/or IL-4. Our data permit to conclude that RA patients have many different immunological disturbances, more severe in anaemic patients.

  9. Radium Ra 223 dichloride in castration-resistant prostate cancer.

    Science.gov (United States)

    Joung, J Y; Ha, Y S; Kim, I Y

    2013-08-01

    Radium Ra 223 dichloride (Xofigo®, formerly Alpharadin) is one of the representative α-particle-emitting isotopes that delivers radiation with a higher biological effect to a more localized area. Preclinical studies in mouse, rat and canine models have demonstrated that radium Ra 223 dichloride has a definite skeletal affinity and antitumor effect with a relatively low toxicity on bone marrow. More recently, in a large randomized phase III trial (ALSYMPCA), patients with bone metastasis and castration-resistant prostate cancer (CRPC) received six cycles of 50 kBq/kg of radium Ra 223 dichloride in 4-week intervals. In these men, radium Ra 223 dichloride improved the median overall survival by 3.6 months when compared to the placebo group. Collectively, these results suggest that radium Ra 223 dichloride is a promising candidate for managing bone metastases in patients with CRPC. Copyright 2013 Prous Science, S.A.U. or its licensors. All rights reserved.

  10. Measurement of 224Ra and 226Ra activities in natural waters using a radon-in-air monitor

    Science.gov (United States)

    Kim, G.; Burnett, W.C.; Dulaiova, H.; Swarzenski, P.W.; Moore, W.S.

    2001-01-01

    We report a simple new technique for measuring low-level radium isotopes (224Ra and 226Ra) in natural waters. The radium present in natural waters is first preconcentrated onto MnO2-coated acrylic fiber (Mn fiber) in a column mode. The radon produced from the adsorbed radium is then circulated through a closed air-loop connected to a commercial radon-in-air monitor. The monitor counts alpha decays of radon daughters (polonium isotopes) which are electrostatically collected onto a silicon semiconductor detector. Count data are collected in energy-specific windows, which eliminate interference and maintain very low backgrounds. Radium-224 is measured immediately after sampling via 220Rn (216Po), and 226Ra is measured via 222Rn (218Po) after a few days of ingrowth of 222Rn. This technique is rapid, simple, and accurate for measurements of low-level 224Ra and 226Ra activities without requiring any wet chemistry. Rapid measurements of short-lived 222Rn and 224Ra, along with long-lived 226Ra, may thus be made in natural waters using a single portable system for environmental monitoring of radioactivity as well as tracing of various geochemical and geophysical processes. The technique could be especially useful for the on-site rapid determination of 224Ra which has recently been found to occur at elevated activities in some groundwater wells.

  11. Modeling the Energy Performance of LoRaWAN

    Directory of Open Access Journals (Sweden)

    Lluís Casals

    2017-10-01

    Full Text Available LoRaWAN is a flagship Low-Power Wide Area Network (LPWAN technology that has highly attracted much attention from the community in recent years. Many LoRaWAN end-devices, such as sensors or actuators, are expected not to be powered by the electricity grid; therefore, it is crucial to investigate the energy consumption of LoRaWAN. However, published works have only focused on this topic to a limited extent. In this paper, we present analytical models that allow the characterization of LoRaWAN end-device current consumption, lifetime and energy cost of data delivery. The models, which have been derived based on measurements on a currently prevalent LoRaWAN hardware platform, allow us to quantify the impact of relevant physical and Medium Access Control (MAC layer LoRaWAN parameters and mechanisms, as well as Bit Error Rate (BER and collisions, on energy performance. Among others, evaluation results show that an appropriately configured LoRaWAN end-device platform powered by a battery of 2400 mAh can achieve a 1-year lifetime while sending one message every 5 min, and an asymptotic theoretical lifetime of 6 years for infrequent communication.

  12. Modeling the Energy Performance of LoRaWAN.

    Science.gov (United States)

    Casals, Lluís; Mir, Bernat; Vidal, Rafael; Gomez, Carles

    2017-10-16

    LoRaWAN is a flagship Low-Power Wide Area Network (LPWAN) technology that has highly attracted much attention from the community in recent years. Many LoRaWAN end-devices, such as sensors or actuators, are expected not to be powered by the electricity grid; therefore, it is crucial to investigate the energy consumption of LoRaWAN. However, published works have only focused on this topic to a limited extent. In this paper, we present analytical models that allow the characterization of LoRaWAN end-device current consumption, lifetime and energy cost of data delivery. The models, which have been derived based on measurements on a currently prevalent LoRaWAN hardware platform, allow us to quantify the impact of relevant physical and Medium Access Control (MAC) layer LoRaWAN parameters and mechanisms, as well as Bit Error Rate (BER) and collisions, on energy performance. Among others, evaluation results show that an appropriately configured LoRaWAN end-device platform powered by a battery of 2400 mAh can achieve a 1-year lifetime while sending one message every 5 min, and an asymptotic theoretical lifetime of 6 years for infrequent communication.

  13. Ra: The Sun for Science and Humanity

    Science.gov (United States)

    1996-01-01

    To guide the development of the Ra Strategic Framework, we defined scientific and applications objectives. For our primary areas of scientific interest, we choose the corona, the solar wind, the Sun's effect on the Earth, and solar theory and model development. For secondary areas of scientific interest, we selected sunspots, the solar constant, the Sun's gravitational field, helioseismology and the galactic cosmic rays. We stress the importance of stereoscopic imaging, observations at high spatial, spectral, and temporal resolutions, as well as of long duration measurements. Further exploration of the Sun's polar regions is also important, as shown already by the Ulysses mission. From an applications perspective, we adopted three broad objectives that would derive complementary inputs for the Strategic Framework. These were to identify and investigate: possible application spin-offs from science missions, possible solar-terrestrial missions dedicated to a particular application, and possible future applications that require technology development. The Sun can be viewed as both a source of resources and of threats. Our principal applications focus was that of threat mitigation, by examining ways to improve solar threat monitoring and early warning systems. We compared these objectives to the mission objectives of past, current, and planned international solar missions. Past missions (1962-1980) seem to have been focused on improvement of scientific knowledge, using multiple instrument spacecraft. A ten year gap followed this period, during which the results from previous missions were analyzed and solar study programmes were prepared in international organizations. Current missions (1990-1996) focus on particular topics such as the corona, solar flares, and coronal mass ejections. In planned missions, Sun/Earth interactions and environmental effects of solar activity are becoming more important. The corona is the centre of interest of almost all planned missions

  14. Early vascular alterations in SLE and RA patients--a step towards understanding the associated cardiovascular risk.

    Directory of Open Access Journals (Sweden)

    Maria José Santos

    Full Text Available Accelerated atherosclerosis represents a major problem in both systemic lupus erythematosus (SLE and rheumatoid arthritis (RA patients, and endothelial damage is a key feature of atherogenesis. We aimed to assess early endothelial changes in SLE and RA female patients (127 SLE and 107 RA without previous CV events. Biomarkers of endothelial cell activation (intercellular adhesion molecule-1 (sICAM-1, vascular cell adhesion molecule-1 (sVCAM-1, thrombomodulin (TM, and tissue factor (TF were measured and endothelial function was assessed using peripheral artery tonometry. Reactive hyperemia index (RHI, an indicator of microvascular reactivity, and augmentation index (AIx, a measure of arterial stiffness, were obtained. In addition, traditional CV risk factors, disease activity and medication were determined. Women with SLE displayed higher sICAM-1 and TM and lower TF levels than women with RA (p = 0.001, p<0.001 and p<0.001, respectively. These differences remained significant after controlling for CV risk factors and medication. Serum levels of vascular biomarkers were increased in active disease and a moderate correlation was observed between sVCAM-1 levels and lupus disease activity (rho = 0.246 and between TF levels and RA disease activity (rho = 0.301. Although RHI was similar across the groups, AIx was higher in lupus as compared to RA (p = 0.04. Also in active SLE, a trend towards poorer vasodilation was observed (p = 0.06. In conclusion, women with SLE and RA present with distinct patterns of endothelial cell activation biomarkers not explained by differences in traditional CV risk factors. Early vascular alterations are more pronounced in SLE which is in line with the higher CV risk of these patients.

  15. RA and FGF Signalling Are Required in the Zebrafish Otic Vesicle to Pattern and Maintain Ventral Otic Identities

    Science.gov (United States)

    Maier, Esther C.; Whitfield, Tanya T.

    2014-01-01

    During development of the zebrafish inner ear, regional patterning in the ventral half of the otic vesicle establishes zones of gene expression that correspond to neurogenic, sensory and non-neural cell fates. FGF and Retinoic acid (RA) signalling from surrounding tissues are known to have an early role in otic placode induction and otic axial patterning, but how external signalling cues are translated into intrinsic patterning during otic vesicle (OV) stages is not yet understood. FGF and RA signalling pathway members are expressed in and around the OV, suggesting important roles in later patterning or maintenance events. We have analysed the temporal requirement of FGF and RA signalling for otic development at stages after initial anteroposterior patterning has occurred. We show that high level FGF signalling acts to restrict sensory fates, whereas low levels favour sensory hair cell development; in addition, FGF is both required and sufficient to promote the expression of the non-neural marker otx1b in the OV. RA signalling has opposite roles: it promotes sensory fates, and restricts otx1b expression and the development of non-neural fates. This is surprisingly different from the earlier requirement for RA signalling in specification of non-neural fates via tbx1 expression, and highlights the shift in regulation that takes place between otic placode and vesicle stages in zebrafish. Both FGF and RA signalling are required for the development of the otic neurogenic domain and the generation of otic neuroblasts. In addition, our results indicate that FGF and RA signalling act in a feedback loop in the anterior OV, crucial for pattern refinement. PMID:25473832

  16. Leaching of 226Ra from components of uranium mill tailings

    Science.gov (United States)

    Landa, E.R.

    1991-01-01

    A sequential extraction procedure was used to characterize the geochemical forms of 226Ra retained by mixtures of quartz sand and a variety of fine-grained rock and mineral species. These mixtures had previously been exposed to the sulfuric acid milling liquor of a simulated acid-leach uranium milling circuit. For most test cases, the major fraction of the 226Ra was extracted with 1 mol/1 NH4Cl and was deemed to be exchangeable. However, 226Ra retained by the barite-containing mixture was resistant to both 1 mol/1 NH4Cl and 1 mol/HCHCl extraction. ?? 1991.

  17. Forenzično računovodstvo u poljoprivredi

    OpenAIRE

    Blaženović, Ivan; Ranogajec, Ljubica

    2016-01-01

    Računovodstveni izvještaji predstavlju glavne izvore informacija o posjedovnoj strani i uspješnosti poduzeća. Manipulacije računovodstvenim informacijama rade se s ciljem prikrivanja stvarnog stanja u poduzeću. U procesu otkrivanja prijevara forenzičari se koriste računalnom opremom i posebno dizajniranim programima za pregled i usporedbu podataka poslovnih knjiga poduzeća koje je pod kontrolom. Ukoliko se uoče nepravilnosti, pokreće se istraga nad tim poduzećem s ciljem sprječavanja kriminal...

  18. Pulmonary cryptococcosis in rheumatoid arthritis (RA) patients: Comparison of imaging characteristics among RA, acquired immunodeficiency syndrome, and immunocompetent patients

    Energy Technology Data Exchange (ETDEWEB)

    Yanagawa, Noriyo, E-mail: noriyo_yana@ybb.ne.jp [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Sakai, Fumikazu [Department of Diagnostic Radiology, Saitama Medical University International Medical Center, 1397-1 Yamane, Hidaka-shi, Saitama 350-1298 (Japan); Takemura, Tamiko [Department of Pathology, Japanese Red Cross Medical Center, 4-1-22 Hiroo, Shibuya-ku, Tokyo 150-8935 (Japan); Ishikawa, Satoru [Department of Respiratory Medicine, National Hospital Organization Chiba-East-Hospital, 673 Nitona-cho, Chuo-ku, Chiba-shi, Chiba 260-8712 (Japan); Takaki, Yasunobu [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Hishima, Tsunekazu [Department of Pathology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Kamata, Noriko [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan)

    2013-11-01

    Purpose: The imaging characteristics of cryptococcosis in rheumatoid arthritis (RA) patients were analyzed by comparing them with those of acquired immunodeficiency syndrome (AIDS) and immunocompetent patients, and the imaging findings were correlated with pathological findings. Methods: Two radiologists retrospectively compared the computed tomographic (CT) findings of 35 episodes of pulmonary cryptococcosis in 31 patients with 3 kinds of underlying states (10 RA, 12 AIDS, 13 immunocompetent), focusing on the nature, number, and distribution of lesions. The pathological findings of 18 patients (8 RA, 2 AIDS, 8 immunocompetent) were analyzed by two pathologists, and then correlated with imaging findings. Results: The frequencies of consolidation and ground glass attenuation (GGA) were significantly higher, and the frequency of peripheral distribution was significantly lower in the RA group than in the immunocompetent group. Peripheral distribution was less common and generalized distribution was more frequent in the RA group than in the AIDS group. The pathological findings of the AIDS and immunocompetent groups reflected their immune status: There was lack of a granuloma reaction in the AIDS group, and a complete granuloma reaction in the immunocompetent group, while the findings of the RA group varied, including a complete granuloma reaction, a loose granuloma reaction and a hyper-immune reaction. Cases with the last two pathologic findings were symptomatic and showed generalized or central distribution on CT. Conclusion: Cryptococcosis in the RA group showed characteristic radiological and pathological findings compared with the other 2 groups.

  19. Productivity loss due to absenteeism and presenteeism by different instruments in patients with RA and subjects without RA.

    Science.gov (United States)

    Braakman-Jansen, Louise M A; Taal, Erik; Kuper, Ina H; van de Laar, Mart A F J

    2012-02-01

    To explore the impact of at-work productivity loss on the total productivity cost by different instruments in patients recently diagnosed with RA and controls without RA. Cross-sectional data were collected from outpatients with RA between December 2007 and February 2008. The control group was formed by subjects without RA matched on age and gender. Absenteeism and presenteeism were estimated by the Quantity and Quality (QQ) Questionnaire, Work Productivity and Activity Impairment Questionnaire General Health V2.0 (WPAI-GH) and Health and Labor Questionnaire (HLQ) questionnaires. Differences between groups were tested by Mann-Whitney U-test. Costs were valued by the human capital approach. Data were available from 62 patients with a paid job and 61 controls. QQ- and WPAI-GH scores of presenteeism were moderately correlated (r = 0.61) while the HLQ presenteeism score correlated poorly with the other instruments (r = 0.34). The contribution of presenteeism on total productivity costs was estimated at ∼70% in the RA group. The mean costs per person per week due to presenteeism varied between €79 and €318 per week in the RA group, dependent on the instrument used. The costs due to presenteeism were about two to four times higher in the RA group compared with the control group. This study indicates that the impact of presenteeism on the total productivity costs in patients with RA is high. However, work productivity in individuals without RA was not optimal either, which implies a risk of overestimation of cost when a normal score is not taken into account. Finally, different presenteeism instruments lead to different results.

  20. Giver lave Ra-værdier bedre hygiejne?

    DEFF Research Database (Denmark)

    Gram, Lone; Bagge-Ravn, Dorthe; Kold, John

    2004-01-01

    Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm.......Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm....

  1. Impossible cartographies: approaching Raúl Ruiz’s cinema

    National Research Council Canada - National Science Library

    Michael Goddard

    2013-01-01

    Raúl Ruiz (1931-2011), while considered one of the world’s most significant filmmakers by several film critics, is yet to be the subject of any thorough academic engagement with his work in English...

  2. LoRA: A Loudspeaker-Based Room Auralization System

    DEFF Research Database (Denmark)

    Favrot, Sylvain Emmanuel; Buchholz, Jörg

    2010-01-01

    that the involved signal processing preserves the temporal, spectral and spatial properties of the room impulse response captured by these parameters. This flexible research platform will be useful for studying auditory processing and perception in normal-hearing and hearing-impaired listeners in fully controlled......In order to study basic human perception in reverberant environments, a novel loudspeaker-based room auralization (LoRA) system is proposed in this paper. The LoRA system efficiently combines modern room acoustic models with high-order Ambisonic auralization. An objective evaluation has been...... carried out demonstrating the applicability of the LoRA system. Room acoustic parameters (reverberation time, clarity, speech transmission index and inter-aural cross correlation coefficients) of room impulse responses were compared at the input and the simulated output of the LoRA system. Results show...

  3. O pensamento desenvolvimentista de Raúl Prebisch Raúl Prebisch's thought on development

    Directory of Open Access Journals (Sweden)

    Joaquim Miguel Couto

    2007-04-01

    Full Text Available As idéias do economista argentino Raúl Prebisch (1901-1986 sempre estiveram voltadas para a ação. As dificuldades encontradas diante de problemas concretos (durante a crise dos anos 1930, tornaram Prebisch um homem prático. Assim, suas teorias sobre a substituição de importações, o sistema centro-periferia e a criação de um mercado comum latino-americano, possuíam um grande sentido de influenciar a realidade. A única exceção coube a sua "Teoria da Transformação", construída no último decênio de sua vida. Nesta, Prebisch se afasta da realidade e teoriza sobre a criação de um novo sistema econômico, através de uma síntese entre socialismo e liberalismo.The Argentinean economist Raúl Prebisch’s (1901-1986 ideas were always gone back to the action. Difficulties facing concrete problems made him a pragmatic man. Thus, his theories about import substitution, core-periphery system and the creation of a common Latin-American market, were embodied in a great purpose of influencing the reality. The only exception was the "Theory of Transformation", which was built in the last decade of this life. There, Prebisch moves off practical matters and speculates about the creation of a new economic system, through a synthesis of socialism and liberalism.

  4. A Brief History of IL-1 and IL-1 Ra in Rheumatology

    Directory of Open Access Journals (Sweden)

    Jean-Michel Dayer

    2017-05-01

    Full Text Available The history of what, in 1979, was called interleukin-1 (IL-1, orchestrator of leukocyte inter-communication, began many years before then, initially by the observation of fever induction via the endogenous pyrogen (EP (1974 and then in rheumatology on the role in tissue destruction in rheumatoid diseases via the induction of collagenase and PGE2 in human synovial cells by a mononuclear cell factor (MCF (1977. Since then, the family has exploded to presently 11 members as well as many membrane-bound and soluble receptor forms. The discovery of a natural Interleukin-1 receptor antagonist (IL-1Ra in human biological fluids has highlighted the importance of IL-1 and IL-1Ra in human diseases. Evidence delineating its role in autoinflammatory syndromes and the elucidation of the macromolecular complex referred to as “inflammasome” have been instrumental to our understanding of the link with IL-1. At present, the IL-1blockade as therapeutic approach is crucial for many hereditary autoinflammatory diseases, as well as for adult-onset Still’s disease, crystal-induced arthropathies, certain skin diseases including neutrophil-triggered skin diseases, Behçet’s disease and deficiency of IL-1Ra and other rare fever syndromes. Its role is only marginally important in rheumatoid arthritis and is still under debate with regard to osteoarthritis, type 2 diabetes mellitus, cardiovascular diseases and cancer. This brief historical review focuses on some aspects of IL-1, mainly IL-1β and IL-Ra, in rheumatology. There are many excellent reviews focusing on the IL-1 family in general or with regard to specific diseases or biological discoveries.

  5. Investigation of $\\alpha$-decay rates of $^{221}$Fr, $^{224}$Ra and $^{226}$Ra in different environments

    CERN Multimedia

    2007-01-01

    It has recently been suggested, and indicated experimentally, that $\\alpha$- decay half-lives are modified by solid state effects in the surrounding environment. We propose here to measure with high accuracy the $\\alpha$-decay half-life of $^{221}$Fr, $^{224}$Ra and $^{226}$Ra in insulators and metals. Furthermore we plan to investigate the temperature dependency of the half-life in these materials (room temperature, 4 K and 10 mK).

  6. Efeito do nível de energia metabolizável na composição dos tecidos da carcaça de cordeiros da raça Santa Inês Effect of metabolizable energy level on the carcass tissues composition of Santa Ines lambs

    Directory of Open Access Journals (Sweden)

    T.R.V. Almeida

    2009-12-01

    Full Text Available Estudou-se a influência da energia metabolizável (EM, pela inclusão de percentuais crescentes de fibra em detergente neutro (FDNf, proveniente de forragem, sobre a composição dos tecidos da carcaça de 64 cordeiros Santa Inês. Os tratamentos (dietas foram: dieta A - com 8,7% de FDNf; dieta B - com 17,3%; dieta C - com 26,0% e dieta D - com 34,7% de FDNf na dieta. Quatro animais de cada tratamento foram abatidos aos 43, 83, 123 e 173 dias. Os cordeiros que receberam as dietas A e B apresentaram maiores pesos dos tecidos ósseo (TO, muscular (TM, adiposo (TA e outros (OT na carcaça fria, a partir dos 83 dias de idade. O rendimento de TO na carcaça fria dos animais que receberam as dietas A e B foi menor, enquanto as proporções de TA foram maiores a partir dos 83 dias de idade. A regressão de cada variável, em função do consumo de EM total (Mcal, para cada tratamento, mostrou que a deposição de TA em cordeiros alimentados com a dieta A foi mais intensa.The effect of metabolizable energy level (ME, due to increasing levels of forage nitrogen detergent fiber (fNGF, on the carcass tecidual composition of 64 Santa Inês lambs was evaluated. Four treatments (diets were: diet A- fNDF; diet B- 17.3%; of fNDF; diet C- 26.0% of fNDF; and diet D- 34.7% of 8.7% fNDF in the diet. Four animals of each treatment were slaughtered at 43, 83, 123, and 173 days. Lambs fed diets A and B, showed higher weight of bonne tissue (BT, muscular tissue (MT, fatty tissue (FT, and other tissues (OT in cold carcass at 83 days of age. The percentage of BT in cold carcass of the lambs fed diets A and B was lower, and percentage of FT was higher, after 83 days of age. The regression of each variable on ME total intake (Mcal, for each treatment, suggested higher intensity of deposition of FT for lambs fed diet A.

  7. Early recognition improves prognosis in elderly onset RA. .

    Science.gov (United States)

    Negoescu, Andra; Ostör, Andrew J K

    2014-01-01

    Although commonly diagnosed in the third to fifth decades of life, the incidence and prevalence of RA continue to increase up to the ninth decade. Age at onset is particularly relevant as the presentation may differ in elderly onset RA (EORA) compared with young onset RA (YORA). Patients with EORA frequently report a more acute presentation, especially if positive for rheumatoid factor (RF). Fever, fatigue and weight loss appear to be more common in EORA. Although small joints are most frequently involved in the RA population overall, there is common involvement of large joints in EORA and these proximal symptoms may mimic polymyalgia rheumatica (PMR). In YORA, approximately 80% of patients are seropositive for RF however a lower frequency has been reported in EORA. Anti-CCP antibodies have been detected in over 70% of patients with RA and are highly specific for RA. The value of anti-CCP antibodies is even higher in patients with an atypical presentation (e.g. PMR-like symptoms), or those who are RF negative. X-rays of the hands and feet should always be performed in patients with a suspected inflammatory arthritis. Baseline joint erosions are present in a similar proportion in patients with YORA and EORA. In the elderly, the differential diagnosis of RA is extensive as many conditions present in a similar way e.g. PMR, osteoarthritis, polyarticular gout, pseudogout and malignancy. Anti-CCP antibodies are very useful for identifying EORA patients with a polymyalgic onset. Ultrasonography or MRI can also be helpful in differentiating PMR from EORA.

  8. Radium isotopes ((226)Ra and (228)Ra) in Na-Cl type groundwaters from Tohoku District (Aomori, Akita and Yamagata Prefectures) in Japan.

    Science.gov (United States)

    Tomita, Jumpei; Zhang, Jing; Yamamoto, Masayoshi

    2014-11-01

    A total of 28 Na-Cl type groundwater samples were collected from Aomori, Akita and Yamagata Prefectures, in the Tohoku District of Japan, and their radium isotope ((226)Ra and (228)Ra) concentrations were measured along with their chemical components and stable isotope ratios (δ(2)H and δ(18)Os). The (226)Ra concentrations in groundwater samples varied widely, ranging from 8.8 to 1587 mBq kg(-1). These concentrations showed an increasing tendency with the increase of the total dissolved solid (TDS) contents. The (228)Ra/(226)Ra activity ratios were in the range from 0.3 to 4.2, with most data being around 0.5-2. These ratios were within those of (232)Th/(238)U found in granitic and related rocks and so on in Japan, indicating that Ra isotopes mainly ejected into the groundwater by the alpha-recoil process. The relationship between (226)Ra and other parameters suggested that Ra isotopes in groundwater samples in this study were mainly constrained by adsorption-desorption reactions depending on salinity with wide variation. Clear correlation between (226)Ra-Ca, (226)Ra-Sr, (226)Ra-Ba and (226)Ra-TDS observed in sulfate-free groundwater samples indicated that Ra isotopes of them were constrained by adsorption-desorption reactions depending on salinity under reducing condition. In contrast, relationship of (226)Ra-Ca, (226)Ra-Sr, (226)Ra-Ba and (226)Ra-TDS in sulfate-containing groundwater samples varied widely, and then, removal or enhanced mobility of Ra isotopes of them were observed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Hidratação de tecidos de raízes de mandioca (Manihot esculenta Crantz. e gelatinização do amido durante a cocção Hydration of cassava tissues and starch gelatinization during the cooking process

    Directory of Open Access Journals (Sweden)

    Soraya S. Butarelo

    2004-09-01

    Full Text Available Durante a cocção da mandioca ocorrem modificações físicas e químicas nos tecidos e a textura final é importante para a aceitabilidade e o consumo de mandiocas. A cocção a 80° e em água em ebulição de duas cultivares, aos 12 e 25 meses após o plantio, foi acompanhada determinando-se o ganho de peso (hidratação e o grau de gelatinização das amostras. Gelatinização foi determinada por colorimetria com iodo após dissolução em álcali das amostras cozidas por diferentes períodos de tempo. A 80°C a hidratação e a gelatinização não se completaram, o que ocorreu com a cocção em água em ebulição. O grau de hidratação foi diferente entre cultivares e entre amostras de 12 e 25 meses de plantio e pode ser descrito matematicamente por modelo de ordem zero. Amostras colhidas 12 meses após ao plantio hidrataram mais rápido que aos 25 meses e a cultivar IAPAR-19 Pioneira hidratou mais rápido que a cultivar Catarina Amarela. Quanto mais rápida a hidratação mais rápido o cozimento e quanto maior a hidratação maior o rendimento em produto cozido.Cooking of cassava root tissues causes both physical and chemical modifications and the final texture of the product is important for the acceptability and consumption of the food. Cooking tissue samples at 80° and in boiling water from two cultivars, harvested 12 and 25 months after planting date, was accompanied by determinig weight gain and starch gelatinization of the samples. Starch gelatinization was determined by colorimetry with iodine after solubilization in alkali of samples cooked for different period of times. At 80°C neither hydration or gelatinization were complete, which occurred at in boiling water. Hydration was different between cultivars and harvesting ages and could be described by a zero order mathematical model. Samples harvested 12 months after planting date hydrated faster than the ones harvested after 25 months and IAPAR-19 Pioneira hydrated faster

  10. Studies of transport pathways of Th, U, rare earths, Ra-228, and Ra-226 from soil to plants and farm animals: Final progress report, 1983-1988

    Energy Technology Data Exchange (ETDEWEB)

    Linsalata, P

    1988-07-01

    This report consists of three parts. Part 1 discusses a field study conducted in an area of enhanced, natural radioactivity to assess the soil to edible vegetable concentration ratios (CR = concentration in dry vegetable/concentration in dry soil) of Th-232, Th-230, Ra-226, Ra-228, and the light rare earth elements (REE's), La, Ce, and Nd. Twenty-eight soil, and approximately 42 vegetable samples consisting of relatively equal numbers of seven varieties, were obtained from 11 farms on the Pocos de Caldas Plateau in the state of Minas Gerais, Brazil. This region is the site of a major natural analogue study to assess the mobilization and retardation processes affecting thorium and the REE's at the Morro do Ferro ore body, and uranium series radionuclides at the Osamu Utsumi open pit uranium mine. Thorium (IV) serves as a chemical analogue for quadrivalent plutonium, the light REE's (III) as chemical analogues for trivalent americium and curium, and uranium (VI) as an analogue for transuranics with stable oxidation states above IV, e.g., Pu(VI). Part 2 includes our final measurement results for naturally occurring light rare earth elements (REE's include La, Ce, Nd, and SM), U-series and Th-series radionuclides in adult farm animal tissues, feeds and soils. Our findings on soil-to-tissue concentration ratios (CR's) and the comparative behavior of these elements in farm animals raised under natural conditions by local farmers are presented. Part 3 summarizes our findings to date on the distribution and mobilization of Th-232, light rare earth elements (LREE), U-238 and Ra-228 in the MF basin. Estimates of first order, present day, mobilization rate constants resulting from ground water solubilization and seepage/stream transport are calculated using revised inventory estimates for the occurrence of these elements in the ore body and annual flux estimates for the transport of these elements away from the ore body. 151 refs., 20 figs., 40 tabs.

  11. RA – beskeden genetisk disposition - resultater fra nyt dansk tvillingstudie

    DEFF Research Database (Denmark)

    Svendsen, Anders Jørgen

    2010-01-01

    undersøgelse af RA hos danske tvillinger underbygger vores tidligere observationer, der indikerer, at den genetiske disposition til den gruppe af polyartritter, der samles under betegnelsen reumatoid arthrit, er beskeden. De senere års forskning tyder på, at sygdommen i klinisk, behandlingsmæssig, men også i...

  12. Nuclear structure of 216 Ra at high spin

    Indian Academy of Sciences (India)

    Bi(10B, 3n) reaction at an incident beam energy of 55 MeV and 209Bi(11B, 4n) reaction at incident beam energies ranging from 65 to 78 MeV. Based on coincidence data, the level scheme for 216Ra has been considerably extended up to ...

  13. Kui ei taha, ära õpi? / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2003-01-01

    Autor leiab, et viimase 10 aasta jooksul levinud arusaam - kui ei taha, ära õpi - on tegelikult väga negatiivsete tagajärgedega seisukoht. Haridus ei ole vaid individuaalne hüve ja selle puudumine individuaalne õnnetus, see on kogu ühiskonna probleem

  14. Respuesta a Raúl Martínez Santos

    Directory of Open Access Journals (Sweden)

    Natàlia Balagué Serre

    2014-12-01

    Full Text Available Las autoras del trabajo titulado “Unificar las cièncias del deporte” (núm. 114, julio-sep. 2013, responden a la réplica enviada por el Prof. Raúl Martínez Santos titulada “Reflexiones y condiciones para una unificación de las ciencias del deporte” .

  15. Determination of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb in mushroom from a naturally high radioactive region

    Energy Technology Data Exchange (ETDEWEB)

    Rosa, Mychelle M.L.; Custodio, Luis Gustavo; Cheberle, Luan T.V.; Taddei, Maria Helena T., E-mail: mychelle@cnen.gov.br, E-mail: lgcustodio@hotmail.com, E-mail: lt.cheberle@bol.com.br, E-mail: mhtaddei@cnen.gov.br [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas; Maihara, Vera A., E-mail: vmaihara@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (CNEN/IPEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Many studies have shown that mushrooms are organisms which efficiently accumulate radionuclides and can be used as indicators of environmental contamination and ecosystem quality. The Pocos de Caldas plateau, in Minas Gerais, is a region that has elevated natural radioactivity due to the presence of radiological anomalies of volcanic origin. Seventy areas of radioactive anomalies have been identified in this region. From the radiological point of view the determination of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb is relevant because they are decay products of the natural series of {sup 238}U and {sup 232}Th, mainly responsible for natural radioactive exposures of man. The present paper is part of a broader study conducted in the Pocos de Caldas plateau, in which the concentration activities of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb in mushroom samples were determined. The mushrooms were collected at different points of the plateau under the influence of radioactive anomalies and away from the influence of anomalies. From statistical studies a correlation between the accumulation of radionuclides in mushrooms and anomalies was established and it was possible to confirm the efficiency that the mushrooms present as environmental contamination indicators. (author)

  16. Inventory of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in marine sediments cores of Southwest Atlantic Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Alice M.R.; Oliveira, Joselene de, E-mail: alice.costa@usp.br, E-mail: jolivei@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Gerencia de Metrologia das Radiacoes. Lab. de Radiometria Ambiental; Figueira, Rubens C.L.; Mahiques, Michel M.; Sousa, Silvia H.M., E-mail: rfigueira@usp.br, E-mail: mahiques@usp.br, E-mail: smsousa@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Instituto Oceanografico

    2015-07-01

    {sup 210}Pb (22.3 y) is a radioactive isotope successfully applied as tracer of sediment dating of the last 100-150 years. The application of {sup 226}Ra and {sup 228}Ra as paleoceanographic tracers (half-lives of 1,600 y and 5.7 y, respectively) also gives some information of ocean's role in past climate change. In this work, it was analyzed 2 sediment cores collect at Southwest Atlantic Ocean. The sediments samples were freeze-dried and acid digested in microwave. It was carried out a radiochemical separation of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb and performed a gross alpha and gross beta measurement of both precipitates Ba(Ra)SO{sub 4} and PbCrO{sub 4} in a low background gas-flow proportional counter. Activity concentrations of {sup 226}Ra ranged from 45 Bq kg{sup -1} to 70 Bq kg{sup -1} in NAP-62 and from 57 Bq kg{sup -1} to 82 Bq kg{sup -1} in NAP-63 samples. The concentration of {sup 228}Ra varied between 37 Bq kg{sup -1} and 150 Bq kg{sup -1} in NAP-62 and between 23 Bq kg{sup -1} and 111 Bq kg{sup -1} in NAP-63 samples. The concentration of total {sup 210}Pb ranged from 126 Bq kg{sup -1} to 256 Bq kg{sup -1} in NAP-62 and from 63 Bq kg{sup -1} to 945 Bq kg{sup -1} in NAP-63 samples. Results of {sup 210}Pb{sub uns} varied from 68 Bq kg{sup -1} to 192 Bq kg{sup -1} for NAP-62, while varied from <4.9 Bq kg{sup -1} to 870 Bq kg{sup -1} in NAP-63 profile. Increased values of {sup 210}Pb{sub uns} were found on the top of both NAP-62 and NAP- 63 sediment profile. (author)

  17. Study of the specific concentrations of {sup 40}K, {sup 224}Ra, {sup 226}Ra and {sup 228}Ra in some seasonings marketed in Rio de Janeiro City

    Energy Technology Data Exchange (ETDEWEB)

    Garcêz, Ricardo W.D.; Lopes, José M.; Silva, Leandro B.; Silva, Ademir X. da [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (PEN/COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Lima, Marco A.F., E-mail: rgarcez@nuclear.ufrj.br [Universidade Federal Fluminense (UFF), Niterói, RJ (Brazil). Instituto de Biologia

    2017-07-01

    The seasoning are vegetables substances used in foods to enhance their flavor, aroma and color. This work presents an investigation of the activity concentration of Naturally Occurring Radioactive Materials (NORMs) in 28 samples of seasoning utilized by brazilian population. The seasoning samples were measured using gamma spectroscopy technique with a high-purity germanium (HPGe) detector, a non-destructive nuclear method and with the LabSOCS software for the calculation of the efficiency curve. The analysis shows that the activity concentration of {sup 40}K was measured in all samples and ranges from 21.0 Bq/kg to 1288 Bq/kg. The highest concentration activity of {sup 40}K was measured to 'cheiro verde', a local seasoning made of chives (Allium Schoenoprasum) and parsley (Petroselinum Crispum), while annatto, made with the fruit of Bixa Orelhana, had the lowest activity concentration. Brazil nut (Bertholletia Excelsa) presented the highest concentrations for {sup 226}Ra and {sup 228}Ra with 24 Bq/kg and 25.7 Bq/kg, respectively and black pepper (Piper Nigrum) presented the highest concentration for {sup 224}Ra with 33.9 Bq/kg. The highest effective dose for members of the public due to ingestion was 23.5 μSv/y due to Brazil nut and the lowest effective dose was found for annatto: 0.13 μSv/y. The syrian seasoning sample present specific concentration of 6.1±1.1 Bq/kg for {sup 137}Cs and 0.08 μSv/y of effective dose. The values found in this work do not represent a risk to human health. (author)

  18. Radiation exposure of relatives of patients treated with Ra-223 dichloride; Strahlenexposition von Angehoerigen bei Therapie mit Ra-223-Dichlorid

    Energy Technology Data Exchange (ETDEWEB)

    Wanke, C.; Szermerski, B.; Solle, A.; Geworski, L. [Medizinische Hochschule Hannover (Germany). Stabsstelle Strahlenschutz und Abt. Medizinische Physik; Pinkert, J. [Bayer Vital GmbH, Leverkusen (Germany); Kranert, W.T. [Frankfurt Univ. (Germany). Klinik fuer Nuklearmedizin; Andreeff, M. [Universitaetsklinikum ' ' Carl Gustav Carus' ' TU Dresden (Germany). Klinik fuer Nuklearmedizin

    2015-07-01

    Since November 2013, a radiopharmaceutical containing Ra-223 dichloride as active substance is approved in the European Union for patients with castration resistant prostate cancer with symptomatic bone metastases and no known visceral metastases. Ra-223 (T{sub 1/2} = 11.43 d) decays via a chain of 4 alpha and 2 beta decays. This therapy is presently the only application of an alpha emitter in clinical routine therapy. To show that the exposure of relatives and caregivers of patients treated with Ra-223 dichloride in an outpatient setting does not exceed a value of 1 mSv, the multicenter study ''RAPSODY'' was conducted. As Ra-223 and most of its progeny emit alpha particles, the internal exposure had to be evaluated in particular. Within this study, measurements of the radiation emitted from the patient were performed using standard dose-rate meters. Wipe-tests were taken in the patients' homes to identify significant contaminations and evaluated by liquid scintillation counting. Samples of saliva and sweat were taken and measured using gamma spectrometry. Ra-223 disintegrates to the noble gas Rn-219 and was measured in the exhaled breath from the patients using conventional Radon Monitors. Furthermore, a computational fluid dynamics simulation (CFD) was performed to assess the radioactivity in the air, which could be inhaled by persons close to the patient. Conclusions: The potential exposure of relatives and caregivers by external irradiation and incorporation of radioactivity exhaled or excreted by the patient with saliva or sweat is well below 1 mSv. No objections are seen regarding outpatient treatment. This paper summarizes contents of a poster presented at the Annual Meeting of the Society of Nuclear Medicine and Molecular Imaging.

  19. Treatment of ankylosing spondylitis with [{sup 224}Ra]-Radiumchloride; Therapie der Spondylitis ankylosans mit [{sup 224}Ra]-Radiumchlorid

    Energy Technology Data Exchange (ETDEWEB)

    Reiners, C. [Klinik und Poliklinik fuer Nuklearmedizin der Univ. Wuerzburg (Germany); Braun, J. [Rheumazentrum Ruhrgebiet Herne (Germany)

    2001-07-01

    Ankylosing spondylitis (AS) is a chronic disease which in 30-50% of the patients leads to considerable episodes of pain, a remarkable reduction of quality of life and disablement. For treatment mostly nonsteroidal antiphlogistic drugs are used which are able to reduce pain in approximately 80% of the patients only. Those drugs however, have to be withdrawn in approximately 30% of the patients due to its known toxicity (mainly in the gastrointestinal tract). Basis medication (DMARDs) is helpful in a minority of AS patients only. Recently [{sup 224}Ra]-Radiumchloride, which has been used previously between 1955 and 1990, has been made available again for treatment of AS. Whereas biokinetics, radiation exposure and the risk-profile of [{sup 224}Ra]-Radiumchloride are documented well by experimental and clinical data, most of the historical studies about the efficacy of this radiopharmaceutical do not fulfill the requirements of modern therapy studies. Therefore as many patients as possible should be recruited for a prospective long-time Phase IV study. A close and well-coordinated cooperation between rheumatologists and nuclear medicine physicians is needed, when [{sup 224}Ra]-Radiumchloride is used for treatment of AS. (orig.) [German] Die meist chronisch, oft auch in Schueben verlaufende Spondylitis ankylosans (AS) fuehrt bei 30-50% der Patienten zu betraechtlichen Schmerzen und einer nicht selten erheblichen Einschraenkung der Lebensqualitaet und Behinderung. Die am haeufigsten zur Therapie verwendeten nichtsteroidalen Antiphlogistika koennen nur bei etwa 80% der Patienten die Schmerzen lindern. Allerdings muessen diese Medikamente bei 20-30% der AS-Patienten wegen ihrer bekannten Toxizitaet - vor allem im Gastrointestinaltrakt - abgesetzt werden. Basistherapeutika (DMARDs) helfen bei der AS nur sehr begrenzt. Mit [{sup 224}Ra]-Radiumchlorid steht seit kurzem ein bereits in den Jahren 1945-1990 fuer die Behandlung der AS verwendetes Radiopharmakon wieder zur

  20. Trapping of short lived Ra{sup +} ions

    Energy Technology Data Exchange (ETDEWEB)

    Bekker, H.; Nunes Portela, M.; Seelen, D.; Dermois, O.; Jungmann, K.; Onderwater, C.J.G.; Timmermans, R.G.E.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen, NL (Germany)

    2012-07-01

    A precision measurement of atomic parity violation in order to determine electroweak mixing angle at low energy scale is underway at the KVI, University of Groningen. The experiment exploits the large sensitivity of a single trapped Ra{sup +} ion. It requires the trapping of short lived radium ions in a Paul trap. Our first laser spectroscopy on an ensemble of trapped short-lived {sup 209-214}Ra{sup +} isotopes employed buffer gas cooled ions in a linear Paul trap. It provided hyperfine structure of the 6d {sup 2}D{sub 3/2} states and isotope shift of the 6d {sup 2}D{sub 3/2}-7p {sup 2}P{sub 1/2} transition. In a next step the buffer gas cooled Ra ions are extracted from the trap and transported in an electrostatic transport system towards a small Paul trap in an UHV environment. Here the ion can be cooled and subsequently microwave transitions between hyperfine states in the 6d {sup 2}D{sub 3/2} manifold can be driven in order to yield high precision results on the hyperfine constants. These results provide input for the ongoing precision atomic structure calculations.

  1. Octupole collectivity in $^{220}$Rn and $^{224}$Ra

    CERN Document Server

    Gaffney, Liam Paul

    Collective properties of the radioactive nuclei $^{220}$Rn and $^{224}$Ra have been studied via Coulomb excitation of a 2.8$\\,$A.MeV radioactive ion beam (RIB) incident upon $^{60}$Ni, $^{112,114}$Cd and $^{120}$Sn targets. The experiments took place at the REX-ISOLDE RIB facility, CERN. De-excitation $\\gamma$-ray yields following multiple-step Coulomb excitation were detected in coincidence with recoiling target nuclei in the Miniball spectrometer. For the first time, B(E3;3$^+ \\rightarrow 0^+$) values have been directly measured with a radioactive ion beam. In the process, $^{224}$Ra becomes the heaviest post-accelerated RIB to date at ISOLDE (with the possible exception of the quasi-stable $^{238}$U). The measurements presented in this thesis represent a tripling of the number of nuclei around Z$\\simeq88$ and N$\\simeq134$, for which direct measurements of the octupole collectivity have been performed. The only previous measurements being for the relatively long-lived $^{226}$Ra. The $\\gamma$-ray yields, in...

  2. Raízes e estruturas da sociedade brasileira

    Directory of Open Access Journals (Sweden)

    Leonor Natividade de Campos Medeiros

    2014-05-01

    Full Text Available Este estudo teve como objetivo conhecer e refletir as raízes e estruturas da sociedade brasileira, na visão de dois grandes pensadores: Sérgio Buarque de Holanda com Raízes do Brasil e Gilberto Freyre com Casa-Grande & Senzala. Holanda dividiu o Brasil em duas fases a primeira da colonização portuguesa e a segunda uma critica ao Estado Novo. Freyre mostra a organização social, política e econômica da época da colonização e desenvolve seus estudos ao final da década de 1920, época em que o ambiente intelectual brasileiro está sob a força do modernismo. Conclui-se que o pensamento de Holanda e Freyre se assemelha em alguns aspectos e diverge em outros.   Sociologia de Freyre; Sociologia de Holanda; Raízes da sociedade brasileira

  3. Pharmacological inhibition of ALDH1A in mice decreases all-trans retinoic acid concentrations in a tissue specific manner

    OpenAIRE

    Arnold, Samuel L. M.; Kent, Travis; Hogarth, Cathryn A.; Griswold, Michael D.; Amory, John K.; Isoherranen, Nina

    2015-01-01

    all-trans retinoic acid (atRA), the active metabolite of vitamin A, is an essential signaling molecule. Specifically the concentrations of atRA are spatiotemporally controlled in target tissues such as the liver and the testes. While the enzymes of the aldehyde dehydrogenase 1A family (ALDH1A) are believed to control the synthesis of atRA, a direct relationship between altered ALDH1A activity and tissue atRA concentrations has never been shown. To test whether inhibition of ALDH1A enzymes dec...

  4. Osteoprotegerin expression in synovial tissue from patients with rheumatoid arthritis, spondyloarthropathies and osteoarthritis and normal controls

    NARCIS (Netherlands)

    Haynes, D. R.; Barg, E.; Crotti, T. N.; Holding, C.; Weedon, H.; Atkins, G. J.; Zannetino, A.; Ahern, M. J.; Coleman, M.; Roberts-Thomson, P. J.; Kraan, M.; Tak, P. P.; Smith, M. D.

    2003-01-01

    OBJECTIVES: To demonstrate the expression of osteoprotegerin (OPG) and receptor activator of nuclear factor kappaB ligand (RANKL) in synovial tissue from rheumatoid arthritis (RA) patients, establish the cell lineage expressing OPG and compare the expression of OPG in RA, spondyloarthropathies,

  5. Cell therapy centered on IL-1Ra is neuroprotective in experimental stroke

    DEFF Research Database (Denmark)

    Clausen, Bettina Hjelm; Lambertsen, Kate Lykke; Dagnæs-Hansen, Frederik

    2016-01-01

    irradiated mice with IL-1Ra-producing bone marrow cells is associated with neuroprotection and recruitment of IL-1Ra-producing leukocytes after stroke. Neuroprotection is also achieved by therapeutic injection of IL-1Ra-producing bone marrow cells 30 min after stroke onset, additionally improving...... production of IL-1Ra and IL-1α/β identifies microglia, not infiltrating leukocytes, as the major sources of IL-1Ra after experimental stroke, and shows IL-1Ra and IL-1β to be produced by segregated subsets of microglia with a small proportion of these cells co-expressing IL-1α. Reconstitution of whole body...... by demonstration of IL-1Ra-producing cells in the human cortex early after ischemic stroke. Taken together, our results attribute distinct neuroprotective or neurotoxic functions to segregated subsets of microglia and suggest that treatment strategies increasing the production of IL-1Ra by infiltrating leukocytes...

  6. Resolution of a periodontoid rheumatoid pannus mass in an elderly ...

    African Journals Online (AJOL)

    geal joints. The primary pathology involves the synovium, which is thickened as a result of chronic inflammatory cell proliferation and surface cell hyperplasia. ... also noted in the upper body down to the mammary region, with no further neurological deficits. Initial care was given by our rheumatologists, owing to chronic.

  7. U-Th-Ra disequilibria at the Masaya (Nicaragua); Desequilibres U-Th-Ra au Masaya (Nicaragua)

    Energy Technology Data Exchange (ETDEWEB)

    Sigmarsson, O.; Condomines, M. [Centre de Recherches Volcanologiques, CNRS URA-10, 63 - Clermont Ferrand (France)

    1996-12-31

    {sup 238}U-{sup 230}Th-{sup 226}Ra radioactive disequilibria were measured in several basalt samples of the post-caldera flows of the Masaya volcano (Nicaragua). {sup 230}Th/{sup 232}Th ratios are from the highest known in the world (about 2.53) with {sup 230}Th/{sup 238}U ratios close to 1. These exceptionally high isotopic thorium ratios from the Masaya and other neighboring volcanoes (Conception, Cerro Negro, Momotombo) are followed by very high {sup 10}Be/{sup 9}Be ratios (60 10{sup -11} for the 1722 flow). These geochemical characteristics with {delta}{sup 18}O of typical mantle origin (5.55) suggest an influence of the subducted sediments fluids in the magma source. The age of the metasomatism ranges from 10 to 0.3 Ma. Initial {sup 226}Ra/{sup 230}Th ratios measured in four historical flows vary from 1.3 to 1.4 and are anti-correlated with the Th content. These variations are probably linked to the fractionated crystallisation of plagioclase minerals. The initial {sup 226}Ra/Ba ratio remains constant and suggests the existence of a huge stationary magmatic reservoir. This hypothesis is also confirmed by the disproportion between the SO{sub 2} quantity emitted by the volcano and by the degassing of lavas on the ground. The {sup 226}Ra excess observed in the Masaya lavas can be the result of a second stage of metasomatism which occurred less than 8000 years B.P. during partial fusion. Abstract only. (J.S.).

  8. An evaluation of ²²⁶Ra and ²²⁸Ra in drinking water in several counties in Texas, USA.

    Science.gov (United States)

    Landsberger, S G; George, G

    2013-11-01

    Naturally Occurring Radioactive Material (NORM) or Technology Enhanced Naturally Occurring Radioactive Material (TENORM) can be a potential health risk. It is now well known that the underlying geology in many parts of Texas has given rise to levels of (226)Ra and (228)Ra that often exceed the limits set by the US Environmental Protection Agency. A detailed literature search was undertaken to assess the levels of (226)Ra and (228)Ra in all of the Texas counties. Several statistical evaluations of the data were performed. The Hickory aquifer in the Llano Uplift region of Texas has consistently had the highest number of (226)Ra and (228)Ra concentrations above the legal limit. As well many of the affected rural communities may not have the financial resources to rectify the problem. Copyright © 2013. Published by Elsevier Ltd.

  9. Selective targeted delivery of the TNF-alpha receptor p75 and uteroglobin to the vasculature of inflamed tissues: a preliminary report.

    Science.gov (United States)

    Ventura, Elisa; Balza, Enrica; Borsi, Laura; Tutolo, Giorgia; Carnemolla, Barbara; Castellani, Patrizia; Zardi, Luciano

    2011-11-10

    Ligand-targeted approaches have proven successful in improving the therapeutic index of a number of drugs. We hypothesized that the specific targeting of TNF-alpha antagonists to inflamed tissues could increase drug efficacy and reduce side effects. Using uteroglobin (UG), a potent anti-inflammatory protein, as a scaffold, we prepared a bispecific tetravalent molecule consisting of the extracellular ligand-binding portion of the human TNF-alpha receptor P75 (TNFRII) and the scFv L19. L19 binds to the ED-B containing fibronectin isoform (B-FN), which is expressed only during angiogenesis processes and during tissue remodeling. B-FN has also been demonstrated in the pannus in rheumatoid arthritis. L19-UG-TNFRII is a stable, soluble homodimeric protein that maintains the activities of both moieties: the immuno-reactivity of L19 and the capability of TNFRII to inhibit TNF-alpha. In vivo bio-distribution studies demonstrated that the molecule selectively accumulated on B-FN containing tissues, showing a very fast clearance from the blood but a very long residence time on B-FN containing tissues. Despite the very fast clearance from the blood, this fusion protein was able to significantly improve the severe symptomatology of arthritis in collagen antibody-induced arthritis (CAIA) mouse model. The recombinant protein described here, able to selectively deliver the TNF-alpha antagonist TNFRII to inflamed tissues, could yield important contributions for the therapy of degenerative inflammatory diseases.

  10. Radiochemical determination and separation or total radium, 226Ra and 224Ra; Analisis Radioquimico de Radio total, Radio-226 y Radio-224

    Energy Technology Data Exchange (ETDEWEB)

    Suarez, J. A.; Gonzalez, J. A.; Pablo, M. A. de

    1987-07-01

    Radiochemical purification and separation of radium has been carried out and the determination of total radium solubilized in aqueous samples has been studied assuming that all the alpha emitters of the sample have their origin in the 226Ra and elements of its desintegration chain. Also, the activities of 22Ra and 226 Ra have been evaluated separately doing a measurement after the chemical separation of the radium and another one 10 days after. (Author) 9 refs.

  11. Measurement by liquid scintillation of {sup 226} Ra coprecipitated in BaSO{sub 4}; Medicion por centelleo liquido de {sup 226} Ra coprecipitado en BaSO{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Lopez del Rio, H.; Davila R, J.I.; Badillo A, V.E.; Mireles G, F.; Quirino T, L.; Lugo R, J.F.; Pinedo V, J.L.; Rios M, C. [UAEN-UAZ, A.P. 579C, Cipres 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)]. e-mail: idavila@cantera.reduaz.mx

    2003-07-01

    The {sup 226} Ra is one of the more radio toxic nuclides since when entering to the organism it continues metabolically to the calcium, accumulating mainly in the bone tissue where it becomes in an internal radiation source. For the analysis of radium in water the methods of radon emanation are generally applied and coprecipitation with barium sulfate. This last is quick and efficient, and the radium in the precipitate can be measured by alpha or gamma spectrometry, or liquid scintillation dissolving the precipitate one with EDTA. In this work it is proposed a procedure for the radium measurement in water based on the coprecipitation with barium sulfate and in the detection by liquid scintillation. The precipitate of Ba(Ra)SO{sub 4} it is carried with water and blended with the liquid scintillator OptiPhase Hi Safe 3, avoiding the dissolution with EDTA. A 92{+-} 1.4% of radium it was recovered and it was reached a minimum activity detectable of 4.2 {+-} 0.9 mBq{sup -1}. The procedure was essayed with natural mineral water with a knew activity in concentration of {sup 226} Ra. The analytic result it coincided with the reported value with a relative error of 9%. (Author)

  12. Ra+ ion trapping : toward an atomic parity violation measurement and an optical clock

    NARCIS (Netherlands)

    Portela, M. Nunez; Dijck, E. A.; Mohanty, A.; Bekker, H.; van den Berg, Joost E.; Giri, G. S.; Hoekstra, S.; Onderwater, C. J. G.; Schlesser, S.; Timmermans, R.G.E.; Versolato, O. O.; Willmann, L.; Wilschut, H. W.; Jungmann, K.

    2014-01-01

    A single Ra+ ion stored in a Paul radio frequency ion trap has excellent potential for a precision measurement of the electroweak mixing angle at low momentum transfer and as the most stable optical clock. The effective transport and cooling of singly charged ions of the isotopes Ra-209 to Ra-214 in

  13. Selective extraction of naturally occurring radioactive Ra2+ from aqueous waste streams

    NARCIS (Netherlands)

    van Leeuwen, F.W.B.

    2005-01-01

    This thesis describes the design and selectivity of new Ra2+ extractants. The results presented provide insight in both the requirements needed to give Ra2+ selectivity and in the achievable Ra2+/Mn+ (Mn+ = alkali(ne earth) cation) separations.

  14. Calculation of P,T-odd interaction effect in ^{225}RaO

    CERN Document Server

    Kudashov, A D; Skripnikov, L V; Mosyagin, N S; Titov, A V

    2012-01-01

    The 10-electron generalized relativistic effective core potential and the corresponding correlation spin-orbital basis sets are generated for the Ra atom and the relativistic coupled cluster calculations for the RaO molecule are performed. The main goal of the study is to evaluate the P,T-odd parameter X characterized by the molecular electronic structure and corresponding to a "volume effect" in the interaction of the ^{225}Ra nucleus Schiff moment with electronic shells of RaO. Our final result for X(^{225}RaO) is -7532 which is surprisingly close to that in ^{205}TlF but has different sign. The obtained results are discussed and the quality of the calculations is analyzed. The value is of interest for a proposed experiment on RaO [PRA 77, 024501 (2008)] due to a very large expected Schiff moment of the ^{225}Ra nucleus.

  15. Raúl Castro a la hora de las decisiones

    Directory of Open Access Journals (Sweden)

    Janette HABEL

    2010-01-01

    Full Text Available Este artículo trata sobre el nuevo rol político de Raúl Castro en Cuba. Su misión no es fácil. Debe redefinir un proyecto de desarrollo viable en condiciones históricas y geopolíticas nuevas; garantizar la estabilidad del país; organizar el relevo entre los antiguos dirigentes históricos y las nuevas generaciones; y, además, iniciar negociaciones con la administración Obama. ¿Se podrá hablar en adelante de un «raulismo» o se seguirá imponiendo el «fidelismo»? Asimismo, ¿cómo salvaguardar la soberanía e independencia, junto a las principales conquistas sociales desde hace cincuenta años, mientras al mismo tiempo se llevan a cabo las reformas «estructurales » y se intenta normalizar relaciones con el continente, específicamente con Estados Unidos? Esa respuesta, que no es obvia, la debe dar Raúl Castro.

  16. Determination of Ra-223 in human excretion samples by means of α-spectrometry; Bestimmung von {sup 223}Ra in Ausscheidungsproben mittels α-Spektrometrie

    Energy Technology Data Exchange (ETDEWEB)

    Zoriy, M.V.; Froning, M.; Hill, P. [Forschungszentrum Juelich GmbH (Germany). Geschaeftsbereich Strahlenschutz und Sicherheit

    2015-07-01

    To ensure the safety of occupationally exposed person for possible incorporation of {sup 223}Ra during the handling with Alpharadin / Xofigo {sup registered}, the determination of {sup 223}Ra activity in its excretion sample (e.g, in a stool sample) might be of great importance. To assess the {sup 223}Ra activity in human faeces samples a new analytical method was developed in our laboratory. The determination is performed by means of grid-ionization a-spectrometry. After a relatively simple sample preparation procedure (usually within max. 6 hours) and the addition of an internal standard, a direct determination of {sup 223}Ra with the grid ionization chamber (GIK) is possible. The method was optimized and successfully tested. The procedure-related LOD for {sup 223}Ra in a 24-hour faeces sample was 0.1 Bq/Probe.

  17. Carbamylation/citrullination of IgG Fc in bronchiectasis, established RA with bronchiectasis and RA smokers: a potential risk factor for disease

    Directory of Open Access Journals (Sweden)

    David Hutchinson

    2017-09-01

    Full Text Available Bronchiectasis (BR and smoking are risk factors for rheumatoid arthritis (RA development. The mechanisms by which smoking and BR trigger RA are unknown, but are associated with concurrent rheumatoid factor (RF and anti-cyclic citrullinated peptide antibody (anti-CCP positivity. Anti-carbamylated protein antibodies (anti-CarP have also been observed in BR patients and can be induced by smoking. Given that RF only has one antigen, immunoglobulin G (IgG we have suggested that post-translational modifications to the Fc region of the heavy chain of IgG (IgGH are a potential explanation for the clustering of the RA-associated autoantibodies in RA. Protein analysis was undertaken on 22 individuals. Four of the individuals had a diagnosis of BR at the time of protein analysis and subsequently developed RA up to 18 months following blood sampling. Four smoking RA patients and 4 patients with both BR and RA and 10 healthy controls were also studied. We identified modified arginines (Arg frequently in the variable region and CH3 domains of IgG in patients and control subjects alike, but only observed carbamylated Lys and/or citrullinated Arg modifications in the RF binding site of the IgG CH2 domain of 5/12 (41.7% patients investigated (1 BR, 2 RA and 2 BRRA, but in no control subjects (0/10, 0% p=0.02. This is the first report of citrullination and carbamylation at the RF binding site of IgG in RA. These results point towards the concept of a universal antigen in RA, an antigen that is post-translationally modified at the Fc region of IgGH.

  18. Dosimetry of bone metastases in targeted radionuclide therapy with alpha-emitting {sup 223}Ra-dichloride

    Energy Technology Data Exchange (ETDEWEB)

    Pacilio, Massimiliano [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Medical Physics; Ventroni, Guido; Mango, Lucio [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Nuclear Medicin; De Vincentis, Giuseppe; Di Castro, Elisabetta; Frantellizzi, Viviana; Follacchio, Giulia Anna; Garkavaya, Tatiana [Rome Univ. (Italy). Dept. of Radiological, Oncological and Anatomo Pathological Sciences; Cassano, Bartolomeo; Lorenzon, Leda [Rome Univ. (Italy). Postgraduate School of Medical Physics; Pellegrini, Rosanna; Pani, Roberto [Rome Univ. (Italy). Dept. of Molecular Medicine; Ialongo, Pasquale [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Radiology

    2016-01-15

    Ra-dichloride is an alpha-emitting radiopharmaceutical used in the treatment of bone metastases from castration-resistant prostate cancer. Image-based dosimetric studies remain challenging because the emitted photons are few. The aim of this study was to implement a methodology for in-vivo quantitative planar imaging, and to assess the absorbed dose to lesions using the MIRD approach. The study included nine Caucasian patients with 24 lesions (6 humeral head lesions, 4 iliac wing lesions, 2 scapular lesions, 5 trochanter lesions, 3 vertebral lesions, 3 glenoid lesions, 1 coxofemoral lesion). The treatment consisted of six injections (one every 4 weeks) of 50 kBq per kg body weight. Gamma-camera calibrations for {sup 223}Ra included measurements of sensitivity and transmission curves. Patients were statically imaged for 30 min, using an MEGP collimator, double-peak acquisition, and filtering to improve the image quality. Lesions were delineated on {sup 99m}Tc-MDP whole-body images, and the ROIs superimposed on the {sup 223}Ra images after image coregistration. The activity was quantified with background, attenuation, and scatter correction. Absorbed doses were assessed deriving the S values from the S factors for soft-tissue spheres of OLINDA/EXM, evaluating the lesion volumes by delineation on the CT images. In 12 lesions with a wash-in phase the biokinetics were assumed to be biexponential, and to be monoexponential in the remainder. The optimal timing for serial acquisitions was between 1 and 5 h, between 18 and 24 h, between 48 and 60 h, and between 7 and 15 days. The error in cumulated activity neglecting the wash-in phase was between 2 % and 12 %. The mean effective half-life (T{sub 1/2eff}) of {sup 223}Ra was 8.2 days (range 5.5-11.4 days). The absorbed dose (D) after the first injection was 0.7 Gy (range 0.2-1.9 Gy). Considering the relative biological effectiveness (RBE) of alpha particles (RBE = 5), D{sub RBE} = 899 mGy/MBq (range 340-2,450 mGy/MBq). The

  19. An implanted $^{228}$Ra source for response characterization of bolometers

    CERN Multimedia

    TeO$_{2}$ crystals are used as bolometers in experiments searching for Double $\\beta$ Decay without emission of neutrinos. One of the most important issues in this extremely delicate kind of experiments is the discrimination of the background from the real signal. A deep knowledge of the bolometric response to $\\alpha$-particles is therefore needed to recognize and discard them, since it has been proven that $\\alpha$ surface contamination could be a major contribution in our background budget. We would like to use ISOLDE’s capability of implanting $^{228}$Ra to make a long-lived source feeding several monochromatic $\\alpha$- and recoiling nuclei, with little or no $\\alpha$-peak broadening due to the source itself, for tests of our detectors in Milano and Gran Sasso INFN National Lab.

  20. Energy efficient LoRa GPS tracker for dementia patients.

    Science.gov (United States)

    Hadwen, Tim; Smallbon, Vanessa; Qing Zhang; D'Souza, Matthew

    2017-07-01

    Continuous GPS tracking devices always suffer short battery life when used by caregivers to reduce the risk of wandering to dangerous areas by dementia patients. Currently the best existing tracker for dementia patients on the market only supports less than 10 hours battery life with a gigantic battery. It not only requires daily battery charging from patients/caregivers, but also becomes a very restrictive device. In this paper we inspected individual energy consumption of the components in a GPS tracker and proposed a novel energy efficient, small wristband by integrating the latest LoRa communication and GPS duty cycling technologies. We verify our prototype's communication distance and energy efficiency through extensive experiments in the real world. Our model and data show the GPS wristband is able to support up to 40 hours continuous GPS tracking with a frequent 60 seconds location update rate. Its range also spans 3km, effectively monitoring patient locations.

  1. Loe-ära-loe! Eesti lastekirjandus 2007 / Jaanika Palm

    Index Scriptorium Estoniae

    Palm, Jaanika, 1973-

    2008-01-01

    Hainsalu, Lehte. Rõõmuratas (TEA Kirjastus) ; Vilep, Heiki. Katus sõidab (Vilep & Vallik) ; Vaiksoo, Jaanus. Onu Heino eksis ära (Koolibri) ; Vallik, Aidi. Tirtsti ja turtsti (TEA Kirjastus) ; Trull, Ilmar. Järvevaht ja joogivesi (Eesti Ekspressi Kirjastus) ; Kassel, Riina. Kalliralli (Ilo) ; Kumberg, Krista. Autopõnn Anto lemmiktoit (Koolibri) ; Ojar, Triinu. Suur must koer = Suur must pini (Päike ja Pilv) ; Pervik, Aino. Suleline, Puhuja ja must Munk (Tänapäev) ; Tomusk, Ilmar. Tere, Volli! (Tänapäev) ; Ausman, Piia. Tähtsad asjad (Haus Galerii) ; Ulman, Mihkel. Võlur taskust (Elmatar) ; Tangsoo, Jaan. Kotermann Juko imeline reis läbi Eestimaa (Varrak) ; Made, Reet. Tuhin tiibades (Koolibri) ; Vallik, Aidi. Mis sinuga juhtus, Ann? (Tänapäev)

  2. Assessing Medication Adherence in Patients with Rheumatoid Arthritis (RA)

    Science.gov (United States)

    2017-03-24

    the moat useful method Jn the dnlcal aetting The Morisky Medle1tion Adherence Scale ( MMAS ) waa developed to UHH medlcebon adherence Intent 1nd hll...been v1Ud11ed in sever.I common dl1HM but not In RA There ue several v1ri1tion1 of the MMAS but we used the MMA $a8 which hll eight qu11tion1 The...than 1 minute 1IO oomplei. lh• MMAS -3 OBJECTIVES The p.n.m1ry cbjec:trve i i to dtt1rm1ne tf there 11 a conellt>on between the COR Uil, COR5, and

  3. The Paran\\'a Ra'anga expedition

    CERN Document Server

    Gangui, Alejandro; Vena, Pablo

    2013-01-01

    Paran\\'a Ra'anga (the image of Paran\\'a, in Guaran\\'i) is the name of a cultural and scientific expedition that traveled the rivers: R\\'io de la Plata, Paran\\'a and Paraguay, from Buenos Aires to Asunci\\'on, during March 2010. The project brought together some forty scientists and artists from three countries in a slow and enriching cruise, putting in active contact actors from different backgrounds and disciplines -which usually run separately- in the framework of an unusual space-time experience. The project recovers the historical tradition of the trip as an instrument of knowledge and collaboration between the arts and sciences, necessary to build new ways of seeing and understanding the river and its banks. This article reports on the motivations of this project and its projection.

  4. Annual intakes of (226)Ra, (228)Ra and (40)K in staple foodstuffs from a high background radiation area in the southwest region of Cameroon.

    Science.gov (United States)

    Ele Abiama, P; Ben-Bolie, G H; Amechmachi, N; Najib, F; El Khoukhi, T; Owono Ateba, P

    2012-08-01

    Concentrations of naturally occurring radionuclides (226)Ra, (228)Ra and (40)K were determined in five most consumed vegetables in a high-level background radiation area (HLBRA) in the southwest region of Cameroon. A total of 25 foodstuff samples collected from Akongo, Ngombas, Awanda, Bikoué and Lolodorf rural districts were analyzed by gamma spectrometry. The average activity concentration values of (226)Ra, (228)Ra and (40)K were respectively 2.30, 1.50 and 140.40 Bq kg(-1) fresh-weights. The effective dose for individual consumption of the investigated foodstuff types was calculated on an estimated annual intake of such diets in the study area. The estimated total daily effective doses from the ingestion of the investigated foodstuffs for each studied long-life natural radionuclide were respectively 0.41 μSv for (226)Ra, 0.84 μSv for (228)Ra and 0.71 μSv for (40)K. The total annual effective dose was estimated at 0.70 mSv y(-1). (228)Ra (44%) and (40)K (36%) were found to be the main sources for internal irradiation which is very likely due to the specific uptake of these radionuclides by the studied plants. Copyright © 2012 Elsevier Ltd. All rights reserved.

  5. [Risk factors for osteoporotic fractures of spine in RA patients].

    Science.gov (United States)

    Sun, Yu; Liu, Qiming; Zhao, Qinghua; Zhang, Jian; Li, Feng; Zhang, Ke

    2015-09-15

    To investigate the risk factors of osteoporotic fractures (OPF) in patients with RA. From February 2011 to March 2015, 244 patients with rheumatoid arthritis (RA) were treated in Department of Orthopedics, Huaibei People's Hospital, according to the occurrence of osteoporotic fractures (OPF) into the OPF group (n=31) and the non OPF group (n=213), observed two groups general information, glucocorticoid usinge, -28 joint disease activity score (DAS28), health status Questionnaire (HAQ), C-reactive protein (CRP), anti-cyclic citrullinated peptide (CCP) antibody, erythrocyte sedimentation rate (ESR), etc. OPF group the mean age and disease duration for (64.3±10.9) years and (9.0±3.3) years were significantly higher than that of non OPF group (57.4±11.2) years and (6.0±2.7) years (POPF group and non OPF group ESR, CRP, anti CCP, HAQ and DAS28 difference was not statistically significant (P>0.05); OPF group sharp score (56.0±18.4), hormone use time (785 d), and hormone cumulant (7,100 mg·d) were significantly higher than that in non OPF group [sharp score (86.1±17.1), hormone use time (191 d), and hormone cumulant (1,900 mg·d)], the difference was statistically significant (POPF femoral neck, Ward area, total femur area and thoracic spine 2-3 bone mineral density T value significantly lower than non OPF group (P<0.05). Age and osteoporosis are risk factors for the occurrence of osteoporotic fractures in patients with rheumatoid arthritis, so patients should conduct a risk assessment to guide rational drug use.

  6. Development of a liquid scintillation method for in vitro determination of {sup 226}Ra and {sup 228} Ra in bioassay samples

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Paulo Cesar P.; Sousa, Wanderson O.; Juliao, Ligia M.Q.C.; Dantas, Bernardo M., E-mail: pcesar@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2011-07-01

    Radium isotopes are dispersed in the environment according to their physicochemical characteristics. The intake of {sup 226}Ra and {sup 228}Ra in humans can occur by inhalation and ingestion and the risk of internal exposure are related to their long half-lives, characteristics of the emission and biokinetics of the isotopes in the human body. The goal of this work is to develop a methodology for the analysis of {sup 226}Ra and {sup 228}Ra in excreta samples (urine and feces), using liquid scintillation technique. Excreta samples were provided by non-exposed humans for the purpose of standardizing the methodology and the establishment of a background level of radium excretion. Radium isotopes were concentrated and separated from the constituents of the sample by co-precipitation with barium sulphate. The precipitate of Ba(Ra)SO{sub 4} was filtrated and weighted for the determination of the chemical yield. The filter containing the precipitate was transferred to a scintillation vial. In the scintillation vial, 8 mL of water, 8 mL of Instagel XF and 4 mL of UltimaGold were added, forming a gel suspension, after stirring the solution. The {sup 226}Ra and {sup 228}Ra activities were determined 21 days after the precipitation of samples. The samples were counted in a liquid scintillation spectrometer. The technique presented adequate sensitivity and reproducibility for the analysis of urine and feces. The activities of {sup 226}Ra and {sup 228}Ra in excreta samples provide useful information for the identification of the main route of intake and for the assessment of the internal exposure of occupationally exposed workers and inhabitants of high background areas. (author)

  7. The role of the sewing ring in tissue healing: a pathologic study of explanted mechanical heart valves.

    Science.gov (United States)

    Kurian, Mathew V; Sabareeswaran, Arumugam; Kanchanamala, Muniraj; Balachandran, Seetharaman; Mogileswari, Dhananjayan; Subban, Vijayakumar

    2012-03-01

    Serious complications may occur after heart valve replacement, and many such patients will require reoperation. The study aim was to identify the pattern of tissue response around the sewing ring of those valves that have been explanted as a result of various valve-associated complications. A total of 51 mechanical heart valves (MHVs) was explanted from 45 patients who had undergone reoperation for valve-related complications. The examination of the valves included an analysis of the operative findings, macroscopic findings, histopathology, and dissection of the sewing ring. The extent of tissue hyperplasia was variable around the sewing rings of valves explanted for various pathologies. In pannus, the hyperplastic tissue extended into the valve orifice and produced an obstruction to flow, whereas in thrombosed valves the thrombus was attached to the tissue at the annulus. In non-infective pathologies, the histology revealed cellular infiltration that was limited to the peripheral fabric layers of the sewing ring, though the extent of infiltration was not increased with the duration of implantation. In prosthetic valve endocarditis (PVE), the surrounding hyperplastic tissue was granulomatous, but cellular infiltration into the sewing ring was absent. The dissection of various models of explanted valves revealed that different types of filler and fixing mechanisms had increased the bulk of the sewing ring. Tissue hyperplasia of varying extent occurs around the sewing ring after MHV implantation. The cellular elements grow into the peripheral layers, but not the deeper layers, of the sewing ring. In PVE, there was an absence of cellular infiltration into the sewing ring.

  8. Tissue tests

    NARCIS (Netherlands)

    Sonneveld, C.; Voogt, W.

    2009-01-01

    Tissue tests are widely used in horticulture practice and have in comparison with soil or substrate testing advantages as well disadvantages in comparison with soil testing. One of the main advantages of tissue tests is the certainty that analysed nutrients in plant tissues are really present in the

  9. Impact of foliage on LoRa 433MHz propagation in tropical environment

    Science.gov (United States)

    Ahmad, Khairol Amali; Salleh, Mohd Sharil; Segaran, Jivitraa Devi; Hashim, Fakroul Ridzuan

    2018-02-01

    LoRa is being considered as one of the promising system for Low-Power-Wide-Area-Network (LPWAN) to support the growth of Internet of Things (IoT) applications. Designed to operate in the industrial, scientific and medical (ISM) bands, LoRa had been tested and evaluated mainly in Europe and US in the 868 MHz and 915 MHz modulation bands. Using chirp spread spectrum technology, LoRa is expected to be robust against degredation. This paper provides some early results in the performance of LoRa signal propagation of 433 MHz modulation in tropical foliage environments.

  10. First Measurement of the Atomic Electric Dipole Moment of $^{225}$Ra

    CERN Document Server

    Parker, R H; Kalita, M R; Lemke, N D; Bailey, K G; Bishof, M N; Greene, J P; Holt, R J; Korsch, W; Lu, Z -T; Mueller, P; O'Connor, T P; Singh, J T

    2015-01-01

    The radioactive radium-225 ($^{225}$Ra) atom is a favorable case to search for a permanent electric dipole moment (EDM). Due to its strong nuclear octupole deformation and large atomic mass, $^{225}$Ra is particularly sensitive to interactions in the nuclear medium that violate both time-reversal symmetry and parity. We have developed a cold-atom technique to study the spin precession of $^{225}$Ra atoms held in an optical dipole trap, and demonstrated the principle of this method by completing the first measurement of its atomic EDM, reaching an upper limit of $|$$d$($^{225}$Ra)$|$ $<$ $5.0\\!\\times\\!10^{-22}$ $e \\cdot$cm (95$\\%$ confidence).

  11. Tracking suspended particle transport via radium isotopes ((226)Ra and (228)Ra) through the Apalachicola-Chattahoochee-Flint River system.

    Science.gov (United States)

    Peterson, Richard N; Burnett, William C; Opsahl, Stephen P; Santos, Isaac R; Misra, Sambuddha; Froelich, Philip N

    2013-02-01

    Suspended particles in rivers can carry metals, nutrients, and pollutants downstream which can become bioactive in estuaries and coastal marine waters. In river systems with multiple sources of both suspended particles and contamination sources, it is important to assess the hydrologic conditions under which contaminated particles can be delivered to downstream ecosystems. The Apalachicola-Chattahoochee-Flint (ACF) River system in the southeastern United States represents an ideal system to study these hydrologic impacts on particle transport through a heavily-impacted river (the Chattahoochee River) and one much less impacted by anthropogenic activities (the Flint River). We demonstrate here the utility of natural radioisotopes as tracers of suspended particles through the ACF system, where particles contaminated with arsenic (As) and antimony (Sb) have been shown to be contributed from coal-fired power plants along the Chattahoochee River, and have elevated concentrations in the surficial sediments of the Apalachicola Bay Delta. Radium isotopes ((228)Ra and (226)Ra) on suspended particles should vary throughout the different geologic provinces of this river system, allowing differentiation of the relative contributions of the Chattahoochee and Flint Rivers to the suspended load delivered to Lake Seminole, the Apalachicola River, and ultimately to Apalachicola Bay. We also use various geochemical proxies ((40)K, organic carbon, and calcium) to assess the relative composition of suspended particles (lithogenic, organic, and carbonate fractions, respectively) under a range of hydrologic conditions. During low (base) flow conditions, the Flint River contributed 70% of the suspended particle load to both the Apalachicola River and the bay, whereas the Chattahoochee River became the dominant source during higher discharge, contributing 80% of the suspended load to the Apalachicola River and 62% of the particles entering the estuary. Neither of these hydrologic

  12. Disease: H00630 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00630 Rheumatoid arthritis Rheumatoid arthritis (RA) is a chronic autoimmune joint... a hyperplastic pannus with infiltrated macrophage-like and fibroblast-like synoviocytes and invades joints

  13. Polymorphism analysis of IL17RA gene to the IL17RA concentration and chronicity differences in nefritis lupus NL patients

    Directory of Open Access Journals (Sweden)

    Mahrus Ismail

    2014-12-01

    Full Text Available Nefritis lupus (NL is autoimmune disease and one of serious complication from Systemic Eritematosus Lupus (LES. Clinical manifestation of NL was variated, there are hematuria microscopic asymptomatic until renal failure. In addition of clinical manifestation, the NL disorder degree also measured from histopathological grade. Although, the mechanism that mixed up with pathogenesis of NL was known, however the cytokine also play a role to the disease process. The cytokine that assumpted have a role to the inflammation is IL-17RA, the increase production of IL-17RA influenced to the in-flammation and NL chronicity degree. The aim of this study to analyzed the relationship between polymorphism of IL-17RA gene, blood IL-17RA con-centration with the NL disorder degree. These studies were used cross sectional with control case design. The sample were used 40 patients consist NL pa-tients and Lupus patient without nephritis as a control. The polymorphisms of IL-17RA gene were investigated by using PCR method and gene sequence analysis. The alterations of allele frequency of IL-17RA gene were analyzed by bioinformatics method. The bloods IL-17RA concentration were in-vestigated by ELISA method. The NL chronicity degrees were investigated by NL histopathological grade. The hypothesis were proofed by data normality test and homogeneity test, Chi-square and Odds ratio, Spearman correlation by using SPSS 17.0 for windows. The result of showed that there are sig-nificantly different between IL-17RA gene mutant genotype frequency of NL patient (NL with the control patient with value OR 8.48. There are sig-nificantly different between G allele of IL-17RA gene of NL patient (case with the control patient with the value OR 4.17. There are no significantly di-fferent between IL-17RA concentrations of NL patient (case with the different chronicity value. There are positive correlation with the OR value 4.17 bet-ween IL-17RA concentrations with the chronicity value

  14. Neo-Epitopes—Fragments of Cartilage and Connective Tissue Degradation in Early Rheumatoid Arthritis and Unclassified Arthritis

    DEFF Research Database (Denmark)

    Maijer, Karen I; Gudmann, Natasja Stæhr; Karsdal, Morten Asser

    2016-01-01

    Objective: Tissue destruction in rheumatoid arthritis (RA) is predominantly mediated by matrix metalloproteinases (MMPs), thereby generating protein fragments. Previous studies have revealed that these fragments include MMP-mediated collagen type I, II, and III degradation, citrullinated and MMP...

  15. Impossible cartographies: approaching Raúl Ruiz’s cinema

    Directory of Open Access Journals (Sweden)

    Michael Goddard

    2013-06-01

    Full Text Available Raúl Ruiz (1931-2011, while considered one of the world’s most significant filmmakers by several film critics, is yet to be the subject of any thorough academic engagement with his work in English. My book Impossible Cartographies sets out on this task by mapping, as fully as possible, Ruiz’s cinematic trajectory across more than five decades of prolific work ranging from his earliest work in Chile to high budget ‘European’ costume dramas culminating in the recent Mysteries of Lisbon (2010. It does this by treating Ruiz’s work, with its surrealist, magic realist, popular cultural and neo-Baroque sources, as a type of ‘impossible’ cinematic cartography, mapping real, imaginary and virtual spaces, and crossing between different cultural contexts, aesthetic strategies, and technical media. In argues that across the different phases of Ruiz’s work identified, there are key continuities such as the invention of singular cinematic images and the interrogation of their possible and impossible combinations. This article will present some of the key themes of Ruiz’s cinema and use ideas of virtual cartography, tableaux vivants and the neo-baroque to illuminate a range of Ruiz’s films from the Hypothesis of the Stolen Painting (1978 to Mysteries of Lisbon, his last major project.

  16. Precision measurement of the RaE shape factor

    Energy Technology Data Exchange (ETDEWEB)

    Grau, C.A. [CIEMAT, Madrid (Spain). Direccion de Tecnologia; Grau, M.A. [Centro de Investigaciones Energeticas, Medioambientales y Tecnologicas (CIEMAT), Madrid (Spain). Inst. de Investigacion Basica

    1996-01-01

    We apply to RaE a new method to determine the shape factor coefficients of pure beta transitions with energies over the Cherenkov threshold of water. This method is based on the precision measurement of one observable, the ft-value, and two quasi-observables, the Cherenkov counting efficiency and the position of the maximum point of the liquid-scintillation logarithmic pulse-height spectrum. We found for the revised shape factor function that the ground state wave function vertical stroke {sup 210}Bi, 1{sup -} right angle is the combination of the three wave functions vertical stroke 1h{sub 9/2}2g{sub 9/2} right angle, vertical stroke 1h{sub 9/2} 1i{sub 11/2} right angle and vertical stroke 1h{sub 9/2}2g{sub 7/2} right angle. This result is also confirmed by the excellent agreement we obtain with experiment for the longitudinal electron polarization. (orig.).

  17. RA diagnostics applying optical tomography in frequency domain

    Science.gov (United States)

    Klose, Alexander D.; Prapavat, Viravuth; Minet, Olaf; Beuthan, Juergen; Mueller, Gerhard J.

    1998-01-01

    Our aim is to reconstruct the optical parameters in a slice of a finger joint phantom for further investigations about rheumatoid arthritis (RA). Therefore, we have developed a flexible NIR scanning system in order to collect amplitude and phase delay of photon density waves in frequency-domain. A cylindrical finger joint phantom was embedded in a container of Intralipid solution due to the application of an inverse method for infinite geometry. The joint phantom was investigated by a laser beam obtaining several projections. The average optical parameters of each projection was calculated. Using different reconstruction techniques, e.g. ART and SIRT with a special projection operator, we reconstructed the optical parameters in a slice. The projection operator can be heuristically described by a photon path density function of a homogeneous media with infinite geometry. Applied to an object with an unknown distribution of optical parameters it calculates the expectation value of the investigated object. The potentials and limits of these fast reconstruction methods will be presented.

  18. Background Characterization for Thermal Ion Release Experiments with 224Ra

    Energy Technology Data Exchange (ETDEWEB)

    Kwong, H.; /Stanford U., Phys. Dept.; Rowson, P.; /SLAC

    2005-12-15

    The Enriched Xenon Observatory for neutrinoless double beta decay uses {sup 136}Ba identification as a means for verifying the decay's occurrence in {sup 136}Xe. A current challenge is the release of Ba ions from the Ba extraction probe, and one possible solution is to heat the probe to high temperatures to release the ions. The investigation of this method requires a characterization of the alpha decay background in our test apparatus, which uses a {sup 228}Th source that produces {sup 224}Ra daughters, the ionization energies of which are similar to those of Ba. For this purpose, we ran a background count with our apparatus maintained at a vacuum, and then three counts with the apparatus filled with Xe gas. We were able to match up our alpha spectrum in vacuum with the known decay scheme of {sup 228}Th, while the spectrum in xenon gas had too many unresolved ambiguities for an accurate characterization. We also found that the alpha decays occurred at a near-zero rate both in vacuum and in xenon gas, which indicates that the rate was determined by {sup 228}Th decays. With these background measurements, we can in the future make a more accurate measurement of the temperature dependency of the ratio of ions to neutral atoms released from the hot surface of the probe, which may lead to a successful method of Ba ion release.

  19. HMM_RA: An Improved Method for Alpha-Helical Transmembrane Protein Topology Prediction

    Directory of Open Access Journals (Sweden)

    Changhui Yan

    2008-01-01

    Full Text Available α-helical transmembrane (TM proteins play important and diverse functional roles in cells. The ability to predict the topology of these proteins is important for identifying functional sites and inferring function of membrane proteins. This paper presents a Hidden Markov Model (referred to as HMM_RA that can predict the topology of α-helical transmembrane proteins with improved performance. HMM_RA adopts the same structure as the HMMTOP method, which has five modules: inside loop, inside helix tail, membrane helix, outside helix tail and outside loop. Each module consists of one or multiple states. HMM_RA allows using reduced alphabets to encode protein sequences. Thus, each state of HMM_RA is associated with n emission probabilities, where n is the size of the reduced alphabet set. Direct comparisons using two standard data sets show that HMM_RA consistently outperforms HMMTOP and TMHMM in topology prediction. Specifically, on a high-quality data set of 83 proteins, HMM_RA outperforms HMMTOP by up to 7.6% in topology accuracy and 6.4% in α-helices location accuracy. On the same data set, HMM_RA outperforms TMHMM by up to 6.4% in topology accuracy and 2.9% in location accuracy. Comparison also shows that HMM_RA achieves comparable performance as Phobius, a recently published method.

  20. Persistence of octupole correlations in sup 2 sup 3 sup 1 Ra

    CERN Document Server

    Fraile-Prieto, L M; Mach, H; Boutami, R; Aas, A J; Fogelberg, B; García-Raffi, L M; Grant, I S; Gulda, K; Hageboe, E; Kurcewicz, W; Kvasil, J; López, M J; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2001-01-01

    The structure of sup 2 sup 3 sup 1 Ra, the heaviest odd Ra nucleus currently accessible for detailed spectroscopic investigation, has been studied in the beta sup - decay of sup 2 sup 3 sup 1 Fr. The main purpose has been to verify whether fast B(E1) rates and significant octupole correlations recently established in sup 2 sup 2 sup 9 Ra persist in sup 2 sup 3 sup 1 Ra. The excited states in sup 2 sup 3 sup 1 Ra have been determined for the first time. Spins and parities have been deduced from conversion electron measurements, while level half-lives in the ps and ns ranges have been measured with the Advanced Time Delayed beta gamma gamma(t) method. The moderately fast B(E1) rates found for transitions connecting the lowest-lying K suppi=5/2 sup+- and K suppi=1/2 sup+- bands, reveal the persistence of octupole collective effects in sup 2 sup 3 sup 1 Ra, although the B(E1) rates are lower than in sup 2 sup 2 sup 9 Ra. These findings reinforce the differences in the B(E1) systematics between isotonic Ra and Th ...

  1. Association of Variants in IL2RA With Progression of Joint Destruction in Rheumatoid Arthritis

    NARCIS (Netherlands)

    Knevel, R.; de Rooy, D. P. C.; Zhernakova, A.; Grondal, G.; Krabben, A.; Steinsson, K.; Wijmenga, C.; Cavet, G.; Toes, R. E. M.; Huizinga, T. W. J.; Gregersen, P. K.; van der Helm-van Mil, A. H. M.

    ObjectiveHeritability studies have suggested an important role of genetic predisposition in the progression of joint destruction in rheumatoid arthritis (RA); the heritability is estimated at 45-58%. Several single-nucleotide polymorphisms (SNPs) have been identified as being associated with RA

  2. Demand Side Management Using the Internet of Energy Based on LoRaWAN Technology

    DEFF Research Database (Denmark)

    Shahryari, Kolsoom; Anvari-Moghaddam, Amjad; Shahryari, Shadi

    2017-01-01

    into cloud because of a long range, low power, wide area and low bit rate wireless telecommunication system which is called LoRaWAN. All devices in fog domain are connected by long range wide area network (LoRa) into a smart gateway. The gateway which bridges fog domain and cloud, is introduced...

  3. Gender, body mass index and rheumatoid arthritis disease activity: results from the QUEST-RA Study

    DEFF Research Database (Denmark)

    Jawaheer, D; Olsen, J; Lahiff, M

    2010-01-01

    To investigate whether body mass index (BMI), as a proxy for body fat, influences rheumatoid arthritis (RA) disease activity in a gender-specific manner.......To investigate whether body mass index (BMI), as a proxy for body fat, influences rheumatoid arthritis (RA) disease activity in a gender-specific manner....

  4. Selective 226Ra2+ ionophores provided by self-assembly of guanosine and isoguanosine derivatives.

    Science.gov (United States)

    van Leeuwen, Fijs W B; Verboom, Willem; Shi, Xiaodong; Davis, Jeffery T; Reinhoudt, David N

    2004-12-22

    The self-assembled guanosine (G 1)-based hexadecamers and isoguanosine (isoG 2)-based decamers are excellent 226Ra2+ selective ionophores even in the presence of excess alkali (Na+, K+, Rb+, and Cs+) and alkaline earth (Mg2+, Ca2+, Sr2+, and Ba2+) cations over the pH range 3-11. G 1 requires additional picrate anions to provide a neutral assembly, whereas the isoG 2 assembly extracts 226Ra2+ cations without any such additives. Both G 1-picrate and isoG 2 assemblies show 226Ra2+ extraction even at a 0.35 x 10(6) fold excess of Na+, K+, Rb+, Cs+, Mg2+, or Ca2+ (10(-2) M) to 226Ra2+ (2.9 x 10(-8) M) and at a 100-fold salt to ionophore excess. In the case of the G 1-picrate assembly, more competition was observed from Sr2+ and Ba2+, as extraction of 226Ra2+ ceased at an M2+/226Ra2+ ratio of 10(6) and 10(4), respectively. With the isoG 2 assembly, 226Ra2+ extraction also occurred at a Sr2+/226Ra2+ ratio of 10(6) but ceased at a 10(6) excess of Ba2+. The results clearly demonstrate the power of molecular self-assembly for the construction of highly selective ionophores.

  5. {sup 226}Ra measurement by thermal ionisation mass spectrometry: Use of {sup 226}Ra and {sup 14}C for groundwater dating

    Energy Technology Data Exchange (ETDEWEB)

    Dever, L. [Universite Paris-SUD, Orsay, (France). Lab d`Hydrologie et Geochemie Isotopique; Hillaire-Marcel, C. [Geotop, Universite du Quebec a Montreal, Montreal (Canada)

    1997-10-01

    Recent developments in thermal ionisation mass spectrometry (TIMS) and in chemical separation Ra and Ba allow to analyse {sup 226}Ra on smaller water samples (<200 ml) than with conventional counting techniques (10{sup 3} litres). The sampling has been realised on the Chalk aquifer of the Paris basin. The water samples have been collected in the unsaturated zone using in situ filtering devices and in the unconfined and confined parts of the aquifer in the boreholes used for public water supply. {sup 226}Ra contents vary from 0.064{+-}0.02 dpm/kg (n=6) in the unsaturated zone to 0.119{+-}0.069 dpm/kg (n=7) in the unconfined aquifer and 0.319{+-}0.057 dpm/kg (n=9) in the confined aquifer. For all the samples the {sup 226}Ra/{sup 238}U activity ratios are much lower than the secular equilibrium. This points out that the two isotopes have different input function in the water during the mineralisation of the solution. The good correlation (r{sup 2}=0.9) between the {sup 226}Ra and Sr indicates that dissolution of Chalk is the dominant mechanism of mineralisation in {sup 226}Ra of the solution. In the Chalk the mineralisation of the water occurs in the first metres of the unsaturated zone, during the water percolation the water rock interaction takes place through dissolution and precipitation of calcite in a non steady state. According to his distribution coefficient Sr is then a better tracer of dissolution/precipitation process than Ba. Using a geochemical model based on {sup 226}Ra/Sr and Sr/Ca ratios an `age` of the water could be determined. With {sup 226}Ra half life of 1620 years we obtain `ages` varying from 150 years to 1950 years in the unconfined aquifer. For the confined part of the aquifer where the redox condition is different it is necessary to use a geochemical model based on the U concentration in the water, the {sup 226}Ra gives in such case ages varying from 1.8ka to 12.8ka. The radiocarbon ages obtained through usual chemical and/or isotopic models

  6. SU-E-T-588: Optimization of Imaging Following 223Ra Administration in Targeted Alpha-Emitting Radionuclide Therapy of Bone Metastases

    Energy Technology Data Exchange (ETDEWEB)

    Benabdallah, N; Bernardini, M [Hopital Europeen George Pompidou, Paris, Ile de France (France); Desbree, A [Institut de Radioprotection et de Surete Nucleaire, Fontenay-aux-roses, Ile-de-France (France); Labriolle-Vaylet, C de [Hopital Trousseau, Paris, Ile de France (France); Franck, D [Institut de Radioprotection et de Suretu Nucleaire, Fontenay Aux Roses, Ile de France (France)

    2015-06-15

    Purpose: With a growing demand of alpha-emitting radiopharmaceuticals, especially Xofigo ({sup 223}RaCl{sub 2}) which is used in the treatment of metastatic bone disease, the optimization of dosimetry becomes necessary. Indeed, in Europe, as stated on the council directive 2013/59/euratom, exposures of target volumes for radiotherapeutic purposes shall be individually planned taking into account that doses to non-target volumes and tissues shall be as low as reasonably achievable. To that aim, the possibility of imaging {sup 223}Ra was first investigated. Methods: The experiments were conducted at the Hopital Europeen Georges Pompidou with an Infinia Hawkeye 4 gamma camera, equipped with a medium-energy collimator. Imaging parameters, such as sensibility, spatial resolution and energy spectrum, were determined using several physical phantoms with a source of 6 MBq of {sup 223}Ra. Bone metastases were modeled with a NEMA Body Phantom to investigate image degradation based on the concentration of {sup 223}Ra. Results: The acquired energy spectrum allowed to visualize several photon peaks: at 85, 154 and 270 keV. Camera sensitivity measured from the phantom study was 102.3 cps/MBq for the 85 keV ± 20 %, 89.9 cps/MBq for the 154 ± 20 % window and 65.4 cps/MBq for the 270 ± 10 % window. The spatial resolution (full-width at half-maximum) was respectively 1.7, 1.9 and 1.8 cm for the three energy windows. SPECT/CT images of NEMA Body Phantom without and with attenuation have permitted to determine the best reconstruction parameters. Conclusion: This study has demonstrated that it is possible to obtain clinically relevant information from images of {sup 223}Ra. All these results will be valuable to analyze biodistribution imaging of the radiopharmaceutical in the patient body and go further in the reconstruction of patient images in order to personalize the dosimetry.

  7. Inflammation and ectopic lymphoid structures in rheumatoid arthritis synovial tissues dissected by genomics technology - Identification of the interleukin-7 signaling pathway in tissues with lymphoid neogenesis

    NARCIS (Netherlands)

    Timmer, Trieneke C. G.; Baltus, Belinda; Vondenhoff, Mark; Huizinga, Tom W. J.; Tak, Paul P.; Verweij, Cornelis L.; Mebius, Reina E.; van der Pouw Kraan, Tineke C. T. M.

    2007-01-01

    In similar to 25% of synovial tissues from rheumatoid arthritis (RA) patients, infiltrates of T cells, B cells, and follicular dendritic cells (FDCs) are spatially organized into structures resembling lymph nodes with germinal centers. The remainder of the tissues lack FDCs and show either a diffuse

  8. Follow-up study of late effects in /sup 224/Ra treated ankylosing spondylitis patients

    Energy Technology Data Exchange (ETDEWEB)

    Wick, R.R.; Goessner, W.

    1983-01-01

    Fifteen hundred thirty-one patients treated with /sup 224/Ra from 14 hospitals in the F.R.G. and 267 control patients with ankylosing spondylitis not treated with any form of ionizing radiation are being followed. Since 1970 three cases of malignant tumour in the skeleton have been found among /sup 224/Ra-treated patients with skeletal doses below 90 rad compared with 0.4-0.6 expected. Two of these three cases were tumours of the bone marrow. An effect of /sup 224/Ra on the haematopoietic system cannot be excluded. Also, seven cases of cataract were found among 274 /sup 224/Ra patients. The mean time since /sup 224/Ra treatment was 26 yr. The mean age at diagnosis was 66 yr. The cataract incidence was not unusual for people of this age.

  9. Ion neutralisation mass-spectrometry route to radium monofluoride (RaF)

    CERN Document Server

    Isaev, T A; Willmann, L; Berger, R

    2013-01-01

    The diatomic molecule radium monofluoride (RaF) has recently been proposed as a versatile probe for physics beyond the current standard model. Herein, a route towards production of a RaF molecular beam via radium ions is proposed. It takes advantage of the special electronic structure expected for group 2 halides and group 2 hydrides: The electronic ground state of neutral RaF and its monocation differ in occupation of a non-bonding orbital of $\\sigma$ symmetry. This implies similar equilibrium distances and harmonic vibrational wavenumbers in the two charge states and thus favourable Franck--Condon factors for neutralisation without dissociation in neutralising collisions. According to the calculated ionisation energy of RaF, charge exchange collisions of RaF$^+$ with sodium atoms are almost iso-enthalpic, resulting in large cross-sections for the production of neutral radium monofluoride.

  10. Tissue types (image)

    Science.gov (United States)

    ... are 4 basic types of tissue: connective tissue, epithelial tissue, muscle tissue, and nervous tissue. Connective tissue supports ... binds them together (bone, blood, and lymph tissues). Epithelial tissue provides a covering (skin, the linings of the ...

  11. Distribution of 226Ra Radionuclide in Upwelling Event Off Ulsan, Gampo and Pohang, Korea

    Directory of Open Access Journals (Sweden)

    Muslim

    2009-07-01

    Full Text Available Upwelling is an important event in the sea for it makes the area to become more productive. The objective of this study is to determine the distribution of radium-226 as radiotoxic in the upwelling area in the summer season. Measurements of the horizontal and vertical activities of 226Ra in the Ulsan, Gampo and Pohang waters were conducted in June, August 1999 and June 2000 when the upwelling event was expected to occur. Water temperature, salinity and dissolved oxygen (DO were also measured concurrently. The thermocline layer or the layer where the temperature decreased drastically occurred at a depth between 30 m to 100 m for samples dated June 1999 and 30 m to more than 100 m for samples dated August 1999 and June 2000. The salinity decreased with depth but the DO concentration increased in this layer. The condition affected the vertical distribution of 226Ra in the study area, where the 226Ra activities showed to be relatively homogeneous vertically in each station. This indicates that the upwelling which occurred in the study area was capable to distribute the 226Ra activities from the bottom to the surface. Thus, the 226Ra distribution at that time did not increase with depth, opposite to what usually occurs in the ocean at normal condition. The 226Ra activities also did not decrease after elapsed time of one year, in fact, it increased. However, horizontally the 226Ra activities decreased with increasing distance from the coastal zone. Based on these results, it can be concluded that the upwelling event in the Ulsan, Gampo and Pohang was effective for increasing the 226Ra activities and was capable to create homogeneous 226Ra activities from the bottom to the surface in the water column, and the source of 226Ra was likely to originate from outside area (i.e. coastal zone and bottom area.

  12. Assessment of the Influence of the RaD-X Balloon Payload on the Onboard Radiation Detectors

    Science.gov (United States)

    Gronoff, Guilluame; Mertens, Christopher J.; Norman, Ryan B.; Straume, Tore; Lusby, Terry C.

    2016-01-01

    The NASA Radiation Dosimetry Experiment (RaD-X) stratospheric balloon flight mission, launched on 25 September 2015, provided dosimetric measurements above the Pfotzer maximum. The goal of taking these measurements is to improve aviation radiation models by providing a characterization of cosmic ray primaries, which are the source of radiation exposure at aviation altitudes. The RaD-X science payload consists of four instruments. The main science instrument is a tissue-equivalent proportional counter (TEPC). The other instruments consisted of three solid state silicon dosimeters: Liulin, Teledyne total ionizing dose (TID) and RaySure detectors. The instruments were housed in an aluminum structure protected by a foam cover. The structure partially shielded the detectors from cosmic rays but also created secondary particles, modifying the ambient radiation environment observed by the instruments. Therefore, it is necessary to account for the influence of the payload structure on the measured doses. In this paper, we present the results of modeling the effect of the balloon payload on the radiation detector measurements using a Geant-4 (GEometry ANd Tracking) application. Payload structure correction factors derived for the TEPC, Liulin, and TID instruments are provided as a function of altitude. Overall, the payload corrections are no more than a 7% effect on the radiation environment measurements.

  13. Protection against bronchiolitis obliterans syndrome is associated with allograft CCR7+ CD45RA- T regulatory cells.

    Directory of Open Access Journals (Sweden)

    Aric L Gregson

    2010-06-01

    Full Text Available Bronchiolitis obliterans syndrome (BOS is the major obstacle to long-term survival after lung transplantation, yet markers for early detection and intervention are currently lacking. Given the role of regulatory T cells (Treg in modulation of immunity, we hypothesized that frequencies of Treg in bronchoalveolar lavage fluid (BALF after lung transplantation would predict subsequent development of BOS. Seventy BALF specimens obtained from 47 lung transplant recipients were analyzed for Treg lymphocyte subsets by flow cytometry, in parallel with ELISA measurements of chemokines. Allograft biopsy tissue was stained for chemokines of interest. Treg were essentially all CD45RA(-, and total Treg frequency did not correlate to BOS outcome. The majority of Treg were CCR4(+ and CD103(- and neither of these subsets correlated to risk for BOS. In contrast, higher percentages of CCR7(+ Treg correlated to reduced risk of BOS. Additionally, the CCR7 ligand CCL21 correlated with CCR7(+ Treg frequency and inversely with BOS. Higher frequencies of CCR7(+ CD3(+CD4(+CD25(hiFoxp3(+CD45RA(- lymphocytes in lung allografts is associated with protection against subsequent development of BOS, suggesting that this subset of putative Treg may down-modulate alloimmunity. CCL21 may be pivotal for the recruitment of this distinct subset to the lung allograft and thereby decrease the risk for chronic rejection.

  14. Association of variants in IL2RA with progression of joint destruction in rheumatoid arthritis.

    Science.gov (United States)

    Knevel, R; de Rooy, D P C; Zhernakova, A; Gröndal, G; Krabben, A; Steinsson, K; Wijmenga, C; Cavet, G; Toes, R E M; Huizinga, T W J; Gregersen, P K; van der Helm-van Mil, A H M

    2013-07-01

    Heritability studies have suggested an important role of genetic predisposition in the progression of joint destruction in rheumatoid arthritis (RA); the heritability is estimated at 45-58%. Several single-nucleotide polymorphisms (SNPs) have been identified as being associated with RA susceptibility. Our objective was to study the association of several of these loci with progression of joint destruction. We studied 1,750 RA patients in 4 independent data sets with 4,732 radiographs scored using the modified Sharp/van der Heijde method. Thirteen susceptibility SNPs that were not previously associated with joint destruction were tested in 596 Dutch RA patients. Subsequently, significant SNPs were studied in data sets of RA patients from North America and Iceland. Data were summarized in inverse-weighted variance meta-analyses. Further, the association with circulating protein levels was studied and the associated region was fine-mapped. In stage 1, 3 loci (AFF3, IL2RA, and BLK) were significantly associated with the rate of joint destruction and were further analyzed in the additional data sets. In the combined meta-analyses, the minor (C) allele of IL2RA (rs2104286) was associated with less progression of joint destruction (P = 7.2 × 10(-4) ). Furthermore, the IL2RA (rs2104286) protective genotype was associated with lower (0.85-fold [95% confidence interval 0.77-0.93], P = 1.4 × 10(-3) ) circulating levels of soluble interleukin-2 receptor α (sIL-2Rα). Additionally, lower sIL-2Rα levels were associated with a lower rate of joint destruction (P = 3.4 × 10(-3) ). The association of IL2RA with the rate of joint destruction was further localized to a 40-kb region encompassing the IL2RA intron 1 and the 5' region of IL2RA and RBM17. The present genetic and serologic data suggest that inherited altered genetic constitution at the IL2RA locus may predispose to a less destructive course of RA. Copyright © 2013 by the American College of Rheumatology.

  15. 226Ra and 228Ra tracer study on material transport in the east coast of Hainan Island, China: a case of nutrients

    Directory of Open Access Journals (Sweden)

    Ni SU

    2011-06-01

    Full Text Available Material fluxes (e.g. nutrients from coast to offshore play an important role in controlling the water quality in the concerned adjacent sea not only by the increase of nutrient concentration but by the change of nutrient structure. In the present work, naturally occurring isotopes (226Ra and 228Ra had been measured by alpha spectrometry in Wenjiao/Wenchang and Wanquan river estuaries and adjacent sea water of the east coast of Hainan Island. The excess dissolved 226Ra and 228Ra activities were observed in comparison with the values expected from the conservative mixing of freshwater and seawater end-members in both estuaries. Using 1-Dimensional Diffusion model, the estimated horizontal eddy diffusion coefficients (Kh derived from 228Ra activities away from its sources was 3.16?105 cm2 s-1. Furthermore, the corresponding nutrient fluxes into the coastal area were assessed. The results can provide useful information for the processes of mixing and exchange of coastal water as well as the transportation of dissoluble pollutants in this sea area.

  16. 'If I didn't have RA I wouldn't give them house room': the relationship between RA, footwear and clothing choices.

    Science.gov (United States)

    Goodacre, Lynne J; Candy, Fiona J

    2011-03-01

    The aim of this study was to develop a greater understanding of the impact of RA on women's self-image and self-presentation via an exploration of their clothing choices. Located within a qualitative symbolic interactionist approach, 15 women with RA (age range 38-74 years, disease duration 1-47 years) each participated in two interviews. The first explored the impact of RA on their feelings about their bodies and their appearance; the second explored the factors that informed their clothing choices and the way they presented themselves. All interviews were digitally recorded and transcribed verbatim, digital photographs of the women's clothes and shoes were taken. Data were analysed jointly by both authors using thematic network analysis. Shoes were identified as greatly influencing the women's clothing choices and how they presented themselves. Three themes were identified that explored the structural and symptomatic impact of RA on the women's feet, the strategies they had developed to resolve their footwear needs outside of prescription footwear and the significant impact that footwear had on their clothing choices and self-presentation. Insights from these data highlight the polarity that exists between the clinical, functional attitudes towards shoes and their social status. While aesthetic issues challenge the acceptability of prescription footwear, problems also exist with the functionality and comfort of footwear available on high streets. A more collaborative approach to the design of footwear is required for both prescription and mainstream footwear to meet the needs of women with RA.

  17. Studies on sup(226) Ra and sup(210) Pb activities and the concentration factors of sup(226) Ra in the surface organic layers of the estuarine sediments of Mindola and Purna rivers in India

    Digital Repository Service at National Institute of Oceanography (India)

    Joshi, L.U.; Zingde, M.D.; Desai, B.N.

    consumed by humans The sampling techniques, experimental procedures and the distribution of the isotopes of sup(226) Ra and sup(210) Pb in the estuarine regions and the concentration factors of sup(226) Ra in the region are detailed....

  18. Sanshool on The Fingertip Interferes with Vibration Detection in a Rapidly-Adapting (RA Tactile Channel.

    Directory of Open Access Journals (Sweden)

    Scinob Kuroki

    Full Text Available An Asian spice, Szechuan pepper (sanshool, is well known for the tingling sensation it induces on the mouth and on the lips. Electrophysiological studies have revealed that its active ingredient can induce firing of mechanoreceptor fibres that typically respond to mechanical vibration. Moreover, a human behavioral study has reported that the perceived frequency of sanshool-induced tingling matches with the preferred frequency range of the tactile rapidly adapting (RA channel, suggesting the contribution of sanshool-induced RA channel firing to its unique perceptual experience. However, since the RA channel may not be the only channel activated by sanshool, there could be a possibility that the sanshool tingling percept may be caused in whole or in part by other sensory channels. Here, by using a perceptual interference paradigm, we show that the sanshool-induced RA input indeed contributes to the human tactile processing. The absolute detection thresholds for vibrotactile input were measured with and without sanshool application on the fingertip. Sanshool significantly impaired detection of vibrations at 30 Hz (RA channel dominant frequency, but did not impair detection of higher frequency vibrations at 240 Hz (Pacinian-corpuscle (PC channel dominant frequency or lower frequency vibrations at 1 Hz (slowly adapting 1 (SA1 channel dominant frequency. These results show that the sanshool induces a peripheral RA channel activation that is relevant for tactile perception. This anomalous activation of RA channels may contribute to the unique tingling experience of sanshool.

  19. Early administration of IL-6RA does not prevent radiation-induced lung injury in mice

    Directory of Open Access Journals (Sweden)

    Inoue Takehiro

    2010-04-01

    Full Text Available Abstract Background Radiation pneumonia and subsequent radiation lung fibrosis are major dose-limiting complications for patients undergoing thoracic radiotherapy. Interleukin-6 (IL-6 is a pleiotropic cytokine and plays important roles in the regulation of immune response and inflammation. The purpose of this study was to investigate whether anti-IL-6 monoclonal receptor antibody (IL-6RA could ameliorate radiation-induced lung injury in mice. Methods BALB/cAnNCrj mice having received thoracic irradiation of 21 Gy were injected intraperitoneally with IL-6RA (MR16-1 or control rat IgG twice, immediately and seven days after irradiation. Enzyme-linked immunosorbent assay was used to examine the plasma level of IL-6 and serum amyloid A (SAA. Lung injury was assessed by histological staining with haematoxylin and eosin or Azan, measuring lung weight, and hydroxyproline. Results The mice treated with IL-6RA did not survive significantly longer than the rat IgG control. We observed marked up-regulation of IL-6 in mice treated with IL-6RA 150 days after irradiation, whereas IL-6RA temporarily suppressed early radiation-induced increase in the IL-6 release level. Histopathologic assessment showed no differences in lung section or lung weight between mice treated with IL-6RA and control. Conclusions Our findings suggest that early treatment with IL-6RA after irradiation alone does not protect against radiation-induced lung injury.

  20. Tissue Classification

    DEFF Research Database (Denmark)

    Van Leemput, Koen; Puonti, Oula

    2015-01-01

    Computational methods for automatically segmenting magnetic resonance images of the brain have seen tremendous advances in recent years. So-called tissue classification techniques, aimed at extracting the three main brain tissue classes (white matter, gray matter, and cerebrospinal fluid), are now...... well established. In their simplest form, these methods classify voxels independently based on their intensity alone, although much more sophisticated models are typically used in practice. This article aims to give an overview of often-used computational techniques for brain tissue classification...

  1. Guayaquil au temps du choléra

    Directory of Open Access Journals (Sweden)

    1996-01-01

    Full Text Available L’épidémie de choléra survenue en 1991 en Équateur a frappé certaines villes et régions plus que d’autres sur la Côte. Guayaquil, la première ville du pays par le nombre de ses habitants (1 600 000 habitants, a connu le record de cas. L’analyse de la répartition des malades hospitalisés dans la ville montre que les quartiers pauvres, récents et, de surcroît, bâtis sur les eaux polluées du delta ne sont pas les plus frappés alors que la zone centrale taudifiée a concentré un nombre de cas élevé. Les pratiques sociales sont-elles davantage responsables de cette situation que les facteurs pourtant très contraignants ici de l’environnement ? GUAYAQUIL EN LOS TIEMPOS DEL CÓLERA. La epidemia del cólera, ocurrida en 1991 en Ecuador, ha golpeado mucho más algunas ciudades y regiones de la Costa. Guayaquil, la primera ciudad del país con 1 600 000 habitantes, ha conocido un número de casos record. El análisis de la distribución de los enfermos hospitalizados en la ciudad revela que los barrios pobres, recientes y además construidos sobre las aguas contaminadas del delta no son los más afectados por esta epidemia en relación con la parte central tugurizada. Las prácticas sociales tal vez tienen más responsabilidad en esta situación que las condiciones particularmente difíciles del medio ambiente. GUAYAQUIL DURING THE CHOLERA. The cholera epidemic, which occured in 1991, impacted some cities and regions of the coast much more than others. Guayaquil, inhabitants Ecuador's largest city with a population of some 1, 6000 000 inhabitants, experienced a record number of cases. An analysis of the sick hospitalized in this city reveals that the poor urban sections, which were built recently and moreover were constructed upon the contaminated waters of the delta, were not the most affected by this epidemic, particularly when compared to the congested central part of the city. This suggests that social practices were more

  2. Recombinant Rhipicephalus appendiculatus gut (Ra86) and salivary gland cement (Trp64) proteins as candidate antigens for inclusion in tick vaccines: protective effetcs of Ra86 on infestation with adult R. appendiculatus.

    NARCIS (Netherlands)

    Saimo, M.; Odongo, D.O.; Mwaura, S.; Vlak, J.M.; Musoke, A.J.; Lubega, G.W.; Bishop, R.P.; Oers, van M.M.

    2011-01-01

    Rhipicephalus appendiculatus gut protein Ra86 (variants Ra85A and Ra92A) and the salivary gland cement protein (Trp64) were expressed in the baculovirus-insect cell system. The recombinant gut proteins expressed as soluble proteins and the recombinant cement protein, as insoluble inclusion bodies,

  3. Vertikalna raščlanjenost reljefa kopnenog dijela Republike Hrvatske

    OpenAIRE

    Lozić, Sanja

    1995-01-01

    U ovom radu dana je analiza vertikalne raščlanjenosti reljefa kopnenog dijela Republike Hrvatske. Vertikalna raščlanjenost numerički je parametar reljefa i određena je visinskom razlikom najviše i najniže točke unutar jedinične površine terena. Kao izraz morfostrukturnih i morfogenetskih osobina reljefa dinamičkog karaktera, značajan je kvantitativni indikator geomorfoloških osobina i procesa koji se odvijaju u reljefu. Rezultati analize vertikalne raščlanjenosti reljefa Hrvatske omogućuj...

  4. Localization of powdery mildew resistance gene Ml-ra on barley chromosome 5

    DEFF Research Database (Denmark)

    Doll, Hans; Jensen, Hans Peter

    1986-01-01

    Evidence is presented that the powdery mildew resistance gene called Ml-(41/145) represents a unique, unnamed locus, which we suggest to be designated Ml-ra with reference to variety 'Ragusa b' [Hordeum vulgare]. Ml-ra is located on the short arm of chormosome 5 near powdery mildew resistance loc...... Ml-a and the seed storage protein loci Hor1 and Hor2. The most likely order of the loci is Hor1, Ml-a, Ml-ra, and Hor2....

  5. Ra and the average effective strain of surface asperities deformed in metal-working processes

    DEFF Research Database (Denmark)

    Bay, Niels; Wanheim, Tarras; Petersen, A. S

    1975-01-01

    and γ0. View the MathML sourcege is highly dependent on γ0, View the MathML sourcege increasing with increasing γ0. It is shown that the Ra-value and the strain are hardly affected by the normal pressure until interacting deformation of the asperities begins, that is until the limit of Amonton's law...... is reached. After that Ra decreases and the strain increases rapidly with the normal pressure, Ra approaching zero whilst View the MathML sourcege approaches a limiting value depending on the initial slope of the asperities....

  6. Specificities of anti-neutrophil autoantibodies in patients with rheumatoid arthritis (RA)

    DEFF Research Database (Denmark)

    Brimnes, J; Halberg, P; Jacobsen, Søren

    1997-01-01

    The objective of this study was to characterize antigens recognized by neutrophil-specific autoantibodies from patients with RA. Sera from 62 RA patients were screened by indirect immunofluorescence (IIF). Positive sera were further tested by ELISAs for antibodies against various granule proteins......D from nuclei. In conclusion, anti-neutrophil autoantibodies from RA patients recognize different antigens in the cytoplasm and in the nucleus. Lactoferrin is one of the common antigens recognized, but also unknown nuclear antigens of 25-35 kD mol. wt are involved....

  7. Determination of natural radionuclides, U, Th-232, Ra-226, Ra-228, Pb-210 and K-40 in sediments from CananÉIa-Iguape System, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Jesus, Gleyka J.D.; Chiozzini, Vitor G.; Saueia, Cátia H.R.; Nisti, Marcelo B.; Braga, Elisabete S.; Fávaro, Deborah I.T., E-mail: gjdjesus@ipen.br, E-mail: chsaueia@ipen.br, E-mail: mbnisti@ipen.br, E-mail: defavaro@ipen.br, E-mail: vitor.chio@usp.br, E-mail: edsbraga@usp.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Universidade de São Paulo (USP), SP (Brazil). Instituto Oceanográfico

    2017-07-01

    The Cananéia-Iguape estuarine-lagoon complex, located in the south of São Paulo State, Brazil, is a protected area recognized by UNESCO as part of the Biosphere Reserve, due to its importance as a natural ecosystem. However, along the years, the mining activities in the region affected the river basin, to such an extent that contamination was observed for As, Cu, Pb and Zn. Since the mining activities can also enhance the levels of natural radioactivity in the sediments, this study aimed to determine the activity concentration of the natural radionuclides (K-40, U, Ra-226, Pb-210, Th-232 and Ra-228) in 34 bottom sediments samples collected in the Cananéia-Iguape system. The samples were measured by gamma spectrometry, using a HPGe for the determination of K-40, Ra-226, Pb-210 and Ra-228. The concentration of U and Th-232 was determined by instrumental neutron activation analysis. The activity concentration of K-40 varied from 119 ± 17 to 522 ± 74 Bq kg{sup -1}; U-238 varied from 0.31 ± 0.05 to 5.8 ± 0.3 mg kg{sup -1}; Ra-226 varied from 3.7 ± 0.3 to 43.3 ± 1.5 Bq kg{sup -1}; Pb-210 varied from 5.8 ± 2.6 to 118 ± 12 Bq kg{sup -1}; Th-232 varied from 0.67 ± 0.02 to 16.6 ± 0.4 mg kg{sup -1} and Ra-228 varied from 3.5 ± 0.6 to 64.9 ± 2.4 Bq kg{sup -1}. These results were compared with literature values for the region, indicating that they are the background of the region and no contamination was observed from NORM (Naturally Occurring Radioactive Material) industries. (author)

  8. Nuclear-chemical methods in a hard tooth tissue abrasion study

    Science.gov (United States)

    Gosman, A.; Spěváček, V.; Koníček, J.; Vopálka, D.; Houŝová, D.; Doležalová, L.

    1999-01-01

    The advanced method consists in implantation—labelling of the thin surface layers of the solid objects, e.g. hard tooth tissue, by atoms of suitable natural or artificial radionuclides. Nuclides from the uranium series were implanted into the surface by using nuclear recoil effect at alpha decay of 226Ra to 222Rn, alpha decay of 222Rn to RaA, alpha decay of RaA to RaB (beta-emitter) and further alpha or beta emitters. With regard to chosen alpha detection and to the half—lives of the radionuclides, there was actually measured the activity of 222Rn, RaA and RaC’ in the thin surface layer. This was followed by the laboratory simulation of the abrasion in the system of “toothbrush—various suspensions of the tooth-pastes—hard tooth tissue (or material standard—ivory)” in specially designed device—the dentoabrasionmeter. The activities of the tissue surface measured before and after abrasion were used for calculations of the relative drop of the surface activity. On this basis the influence of various tooth-pastes containing various abrasive substances was determined.

  9. Exploración de raíces sacras: indicaciones, técnica y resultados

    National Research Council Canada - National Science Library

    Arlandis Guzmán, S; Alapont Alacreu, J.M; Bonillo García, M.Á; Ruiz Cerdá, J.L; Martínez Agulló, E; Jiménez Cruz, F

    2003-01-01

    ... eléctricos aplicados sobre las raíces sacras. La exploración de raíces sacras (ERS) es fundamental para considerar a un paciente candidato al implante definitivo del estimulador de la raíz sacra...

  10. Towards a precise measurement of atomic parity violation in a single Ra{sup +} ion

    Energy Technology Data Exchange (ETDEWEB)

    Nunez Portela, M., E-mail: nunez@kvi.nl; Berg, J. E. van den; Bekker, H.; Boell, O.; Dijck, E. A.; Giri, G. S.; Hoekstra, S.; Jungmann, K.; Mohanty, A.; Onderwater, C. J. G.; Santra, B.; Schlesser, S.; Timmermans, R. G. E.; Versolato, O. O.; Wansbeek, L. W.; Willmann, L.; Wilschut, H. W. [Kernfysisch Versneller Instituut (KVI) (Netherlands)

    2013-03-15

    A single trapped Ra{sup + } (Z = 88) ion provides a very promising route towards a most precise measurement of Atomic Parity Violation (APV), since APV effects grow faster than Z{sup 3}. This experiment promises the best determination of the electroweak coupling constant at the lowest accessible energies. Such a measurement provides a sensitive test of the Standard Model in particle physics. At the present stage of the experiment, we focus on trapping and laser cooling stable Ba{sup + } ions as a precursor for radioactive Ra{sup + }. Online laser spectroscopy of the isotopes {sup 209 - 214}Ra{sup + } in a linear Paul trap has provided information on transition wavelengths, fine and hyperfine structures and excited state lifetimes as test of atomic structure calculations. Additionaly, a single trapped Ra{sup + } ion could function as a very stable clock.

  11. Data of evolutionary structure change: 1C5RA-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C5RA-3BSQC 1C5R 3BSQ A C IVGGYTCGANTVPYQVSLNSG-YHFCGGSLINSQWVVSA...AHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDS... 3BSQ C 3BSQC 3BSQ C 3BSQC VSW...VID> 2 3BSQ C 3BSQC

  12. Hispaania võib oma väed Iraagist ära tuua / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Hispaania parlamendivalimised võitnud sotsialistliku partei liider, arvatav uus peaminister Jose Luis Rodriguez Zapatero lubas Hispaania väed Iraagist ära tuua. Diagrammid: Hispaania valimistulemused

  13. Ajakohatu küsimine kunsti algupära järele / Leo Luks

    Index Scriptorium Estoniae

    Luks, Leo, 1976-

    2002-01-01

    Rets.: Martin Heidegger. Kunstiteose algupära. Saksa keelest tõlkinud Ülo Matjus. Tartu, 2002 (Avatud Eesti Raamat). Konkreetse Heideggeri teose mõistmiseks vajalikust taustast. Kogumikust - Kaasaegne poliitiline filosoofia

  14. I-RaCM: A Fully Integrated Risk and Lifecycle Cost Model Project

    Data.gov (United States)

    National Aeronautics and Space Administration — SpaceWorks Engineering, Inc. (SEI) proposes development of the Integrated Risk and Cost Model I-RaCM, as the innovation to meet the need for integrated cost and risk...

  15. Peeter ei võta lapsi ära / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Vastukaja ajalehes "Eesti Ekspress" 29. märtsil ilmunud artiklile "Peeter Kreitzberg: võtame vaestelt lapsed ära!" ja ajalehes "SL Õhtuleht" ilmunud Imbi Paju artiklile "Põhjala igavus ja Eesti hiilgus"

  16. Factors affecting {sup 223}Ra therapy: clinical experience after 532 cycles from a single institution

    Energy Technology Data Exchange (ETDEWEB)

    Etchebehere, Elba C. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States); Campinas State University (Unicamp), Department of Nuclear Medicine, Campinas (Brazil); Milton, Denai R. [The University of Texas MD Anderson Cancer Center, Department of Biostatistics, Houston, TX (United States); Araujo, John C. [The University of Texas MD Anderson Cancer Center, Department of Genitourinary Medical Oncology, Houston, TX (United States); Swanston, Nancy M.; Macapinlac, Homer A.; Rohren, Eric M. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States)

    2016-01-15

    The aim of this study was to identify baseline features that predict outcome in {sup 223}Ra therapy. We retrospectively reviewed 110 patients with metastatic castration-resistant prostate cancer treated with {sup 223}Ra. End points were overall survival (OS), progression-free survival (PFS), bone event-free survival (BeFS), and bone marrow failure (BMF). The following parameters were evaluated prior to the first {sup 223}Ra cycle: serum levels of hemoglobin (Hb), prostate-specific antigen (PSA), alkaline phosphatase (ALP), Eastern Cooperative Oncology Group (ECOG) status, pain score, use of chemotherapy, and external beam radiation therapy (EBRT). During/after {sup 223}Ra we evaluated: the total number of radium cycles (Ra{sub Tot}), the PSA doubling time (PSA{sub DT}), and the use of chemotherapy, EBRT, abiraterone, and enzalutamide. A significant reduction of ALP (p < 0.001) and pain score (p = 0.041) occurred throughout the {sup 223} Ra cycles. The risk of progression was associated with declining ECOG status [hazard ratio (HR) = 3.79; p < 0.001] and decrease in PSA{sub DT} (HR = 8.22; p < 0.001). Ra{sub Tot}, ALP, initial ECOG status, initial pain score, and use of abiraterone were associated with OS (p ≤ 0.008), PFS (p ≤ 0.003), and BeFS (p ≤ 0.020). Ra{sub Tot}, ALP, initial ECOG status, and initial pain score were significantly associated with BMF (p ≤ 0.001) as well as Hb (p < 0.001) and EBRT (p = 0.009). On multivariable analysis, only Ra{sub Tot} and abiraterone remained significantly associated with OS (p < 0.001; p = 0.033, respectively), PFS (p < 0.001; p = 0.041, respectively), and BeFS (p < 0.001; p = 0.019, respectively). Additionally, Ra{sub Tot} (p = 0.027) and EBRT (p = 0.013) remained significantly associated with BMF. Concomitant use of abiraterone and {sup 223}Ra seems to have a beneficial effect, while the EBRT may increase the risk of BMF. (orig.)

  17. Boron neutron capture therapy (BNCT) translational studies in the hamster cheek pouch model of oral cancer at the new "B2" configuration of the RA-6 nuclear reactor.

    Science.gov (United States)

    Monti Hughes, Andrea; Longhino, Juan; Boggio, Esteban; Medina, Vanina A; Martinel Lamas, Diego J; Garabalino, Marcela A; Heber, Elisa M; Pozzi, Emiliano C C; Itoiz, María E; Aromando, Romina F; Nigg, David W; Trivillin, Verónica A; Schwint, Amanda E

    2017-11-01

    Boron neutron capture therapy (BNCT) is based on selective accumulation of B-10 carriers in tumor followed by neutron irradiation. We demonstrated, in 2001, the therapeutic effect of BNCT mediated by BPA (boronophenylalanine) in the hamster cheek pouch model of oral cancer, at the RA-6 nuclear reactor. Between 2007 and 2011, the RA-6 was upgraded, leading to an improvement in the performance of the BNCT beam (B2 configuration). Our aim was to evaluate BPA-BNCT radiotoxicity and tumor control in the hamster cheek pouch model of oral cancer at the new "B2" configuration. We also evaluated, for the first time in the oral cancer model, the radioprotective effect of histamine against mucositis in precancerous tissue as the dose-limiting tissue. Cancerized pouches were exposed to: BPA-BNCT; BPA-BNCT + histamine; BO: Beam only; BO + histamine; CONTROL: cancerized, no-treatment. BNCT induced severe mucositis, with an incidence that was slightly higher than in "B1" experiments (86 vs 67%, respectively). BO induced low/moderate mucositis. Histamine slightly reduced the incidence of severe mucositis induced by BPA-BNCT (75 vs 86%) and prevented mucositis altogether in BO animals. Tumor overall response was significantly higher in BNCT (94-96%) than in control (16%) and BO groups (9-38%), and did not differ significantly from the "B1" results (91%). Histamine did not compromise BNCT therapeutic efficacy. BNCT radiotoxicity and therapeutic effect at the B1 and B2 configurations of RA-6 were consistent. Histamine slightly reduced mucositis in precancerous tissue even in this overly aggressive oral cancer model, without compromising tumor control.

  18. Contrasting genetic association of IL2RA with SLE and ANCA – associated vasculitis

    Directory of Open Access Journals (Sweden)

    Todd John A

    2009-03-01

    Full Text Available Abstract Background Autoimmune diseases are complex and have genetic and environmental susceptibility factors. The objective was to test the genetic association of systemic lupus erythematosus (SLE and anti-neutrophil cytoplasmic antibody (ANCA – associated systemic vasculitis (AAV with SNPs in the IL2RA region and to correlate genotype with serum levels of IL-2RA. Methods Using a cohort of over 700 AAV patients, two SLE case-control studies and an SLE trio collection (totalling over 1000 SLE patients, and a TaqMan genotyping approach, we tested 3 SNPs in the IL2RA locus, rs11594656, rs2104286 & rs41295061, each with a prior association with autoimmune disease; rs11594656 and rs41295061 with type 1 diabetes (T1D and rs2104286 with multiple sclerosis (MS and T1D. Results We show that SLE is associated with rs11594656 (P = 3.87 × 10-7 and there is some evidence of association of rs41295061 with AAV (P = 0.0122, which both have prior association with T1D. rs2104286, an MS and T1D – associated SNP in the IL2RA locus, is not associated with either SLE or AAV. Conclusion We have confirmed a previous suggestion that the IL2RA locus is associated with SLE and showed some evidence of association with AAV. Soluble IL-2RA concentrations correlate with rs11594656 genotype in quiescent disease in both AAV and SLE. Differential association of autoimmune diseases and SNPs within the IL2RA locus suggests that the IL2RA pathway may prove to play differing, as yet undefined, roles in each disease.

  19. The space (reorganization in Guaíra after the end of “Sete Quedas”

    Directory of Open Access Journals (Sweden)

    Edson Belo Clemente de Souza

    2007-12-01

    Full Text Available This article analyses the space (re organization in themunicipality of Guaíra – PR after the formation of Itaipu Lakewith consequent immersions of the “Sete Quedas”. Due tothe socio-environmental impact caused by the flood, a newphase of development is going to be implemented in Guaírabased on the Directory Plans of 1980 and 1992, reorganizingthe geographic area of Guaíra in a corollary way.

  20. Ra isotopes in trees: Their application to the estimation of heartwood growth rates and tree ages

    Science.gov (United States)

    Hancock, Gary J.; Murray, Andrew S.; Brunskill, Gregg J.; Argent, Robert M.

    2006-12-01

    The difficulty in estimating growth rates and ages of tropical and warm-temperate tree species is well known. However, this information has many important environmental applications, including the proper management of native forests and calculating uptake and release of atmospheric carbon. We report the activities of Ra isotopes in the heartwood, sapwood and leaves of six tree species, and use the radial distribution of the 228Ra/226Ra activity ratio in the stem of the tree to estimate the rate of accretion of heartwood. A model is presented in which dissolved Ra in groundwater is taken up by tree roots, translocated to sapwood in a chemically mobile (ion-exchangeable) form, and rendered immobile as it is transferred to heartwood. Uptake of 232Th and 230Th (the parents of 228Ra and 226Ra) is negligible. The rate of heartwood accretion is determined from the radioactive decay of 228Ra (half-life 5.8 years) relative to long-lived 226Ra (half-life 1600 years), and is relevant to growth periods of up to 50 years. By extrapolating the heartwood accretion rate to the entire tree ring record the method also appears to provide realistic estimates of tree age. Eight trees were studied (three of known age, 72, 66 and 35 years), including three Australian hardwood eucalypt species, two mangrove species, and a softwood pine (P. radiata). The method indicates that the rate of growth ring formation is species and climate dependent, varying from 0.7 rings yr-1 for a river red gum (E. camaldulensis) to around 3 rings yr-1 for a tropical mangrove (X. mekongensis).

  1. Bioavailability of radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb present in the brazilian phosphate fertilizers and phosphogypsum; Avaliacao da biodisponibilidade dos radionuclideos {sup 226}Ra, {sup 228}Ra e {sup 210}Pb presentes nos fertilizantes fosfatados e no fosfogesso de procedencia nacional

    Energy Technology Data Exchange (ETDEWEB)

    Russo, Ana Carolina

    2013-08-01

    Phosphogypsum, also called gypsum, by-product of the phosphate fertilizer industry, can be used as soil conditioner since it provides improvements in the soil-plant system. However, this by-product concentrates radionuclides of the U and Th series, present in the phosphate rock used as raw material, which can impact the environment. In order to study the bioavailability of radionuclides, samples of phosphogypsum and phosphate fertilizers (monoammonium phosphate and triple superphosphate) were analyzed. The concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb were determined by gamma spectrometry. The samples were leached with a mild EDTA solution and the radionuclides present in the final solution were determined by total alpha and beta counting on a gas flow proportional counter. The percentage of extraction varied from 1.6% to 1.7% for {sup 210}Pb, from 0.5% to 1.4% for {sup 226}Ra and from 0.1% to 1.0% for the {sup 228}Ra in phosphogypsum samples. The low percentage of extraction obtained for the radionuclides can be partly explained by the low solubility of phosphogypsum, which ranged from 7.7% to 16%. For the monoammonium phosphate samples the percentage of extraction were less than 26% for {sup 226}Ra, less than 10% for '2{sup 28}Ra and less than 10% for {sup 210}Pb. In spite of the high solubility of 77% of monoammonium phosphate in the EDTA solution, low concentrations of radionuclides were observed in the leached solution. For the triple superphosphate samples, the percentage of extraction was 2.3% for {sup 226}Ra, 1.2% for {sup 228}Ra and 11.3% for {sup 210}Pb. In spite of the high solubility of 66% of triple superphosphate in the EDTA solution, low concentrations of radionuclides were observed in the leached solution. (author)

  2. Joint Program on Rapid Prototyping. RaPIER (Rapid Prototyping to Investigate End-User Requirements).

    Science.gov (United States)

    1985-03-28

    for reuse. The Ada langauge contains a rich set of features that support reusability. Some of the most important ones are: o packages, o separate...telephone consultants for RaPIER at least through the fifth year of this project. Beyond that, the Computer Sciences Center will need to transfer...motivated to exploit them, can/will become a RaPIER skilled user; 6. deals with requirements; T . deals with new products; 8. is part of the contractor’s

  3. Oceanographic profile data collected from CTD casts aboard RA-3, RA-4 and NOAA Ship RAINIER as part of project OPR-R976-RA-15 in the Beaufort Sea and Bering Sea from 2015-06-22 to 2015-08-22 (NCEI Accession 0131250)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0131250 includes physical and profile data collected aboard the RA-3, RA-4 and NOAA Ship RAINIER during project OPR-R976-RA-15 in the Beaufort Sea and...

  4. Selective targeted delivery of the TNF-alpha receptor p75 and uteroglobin to the vasculature of inflamed tissues: a preliminary report

    Directory of Open Access Journals (Sweden)

    Ventura Elisa

    2011-11-01

    Full Text Available Abstract Background Ligand-targeted approaches have proven successful in improving the therapeutic index of a number of drugs. We hypothesized that the specific targeting of TNF-alpha antagonists to inflamed tissues could increase drug efficacy and reduce side effects. Results Using uteroglobin (UG, a potent anti-inflammatory protein, as a scaffold, we prepared a bispecific tetravalent molecule consisting of the extracellular ligand-binding portion of the human TNF-alpha receptor P75 (TNFRII and the scFv L19. L19 binds to the ED-B containing fibronectin isoform (B-FN, which is expressed only during angiogenesis processes and during tissue remodeling. B-FN has also been demonstrated in the pannus in rheumatoid arthritis. L19-UG-TNFRII is a stable, soluble homodimeric protein that maintains the activities of both moieties: the immuno-reactivity of L19 and the capability of TNFRII to inhibit TNF-alpha. In vivo bio-distribution studies demonstrated that the molecule selectively accumulated on B-FN containing tissues, showing a very fast clearance from the blood but a very long residence time on B-FN containing tissues. Despite the very fast clearance from the blood, this fusion protein was able to significantly improve the severe symptomatology of arthritis in collagen antibody-induced arthritis (CAIA mouse model. Conclusions The recombinant protein described here, able to selectively deliver the TNF-alpha antagonist TNFRII to inflamed tissues, could yield important contributions for the therapy of degenerative inflammatory diseases.

  5. An easy method for Ra-226 determination in river waters by liquid-scintillation counting

    Science.gov (United States)

    Moreno, H. P.; Vioque, I.; Manjón, G.; García-Tenorio, R.

    1999-01-01

    226Ra activity concentration in river water was determined using a low background liquid scintillation counter. Radium was extracted from the samples as Ra-BaSO4 precipitate which, afterwards, was dissolved with EDTA in ammonia medium. Solution was transferred into a low potassium glass vial and then mixed with a scintillation cocktail. Two different scintillation cocktails were selected for comparison. Efficiency, recovery yield and α/β separation were studied with both liquid scintillation cocktails. One single measurement, made one month after radium separation, allows to calculate the226Ra concentration as well as to assess the presence of alpha contamination of the sample. In the case of negligible interferences,224Ra concentrations can be subsequently evaluated in the same sample by the measurement made just after chemical separation of radium. This method has been applied for the determination of226Ra and224Ra activity concentrations in river water collected from different locations along the Odiel river estuary area (South-west of Spain). The presence of chemical industry, the wastes of which are released into the river, could be connected with radium activity concentration enhancements in the water.

  6. Tissue Classification

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, David Gerald [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-01-01

    The project began as a e ort to support InLight and Lumidigm. With the sale of the companies to a non-New Mexico entity, the project then focused on supporting a new company Medici Technologies. The Small Business (SB) is attempting to quantify glucose in tissue using a series of short interferometer scans of the nger. Each scan is produced from a novel presentation of the nger to the device. The intent of the project is to identify and, if possible, implement improved methods for classi cation, feature selection, and training to improve the performance of predictive algorithms used for tissue classi cation.

  7. IL-1RA gene-transfected bone marrow-derived mesenchymal stem cells in APA microcapsules could alleviate rheumatoid arthritis.

    Science.gov (United States)

    Hu, Jianhua; Li, Hongjian; Chi, Guanhao; Yang, Zhao; Zhao, Yi; Liu, Wei; Zhang, Chao

    2015-01-01

    In order to investigate the encapsulation of interleukin 1 receptor antagonist (IL-RA) gene-modified mesenchymal stem cells (MSCs) in alginate-poly-L-lysine (APA) microcapsules for the persistent delivery of interleukin 1 receptor antagonist (IL-RA) to treat Rheumatoid arthritis (RA). We transfect mesenchymal stem cells with IL-RA gene, and quantify the IL-RA proteins released from the encapsulated cells followed by microencapsulation of recombinant mesenchymal stem cells, and thus observe the permeability of APA microcapsules and evaluate clinical effects after induction and treatment of collagen-induced arthritis (CIA). The concentration of IL-RA in the supernatant was determined by IL-RA ELISA kit by run in technical triplicates using samples from three separate mice. Encapsulated IL-RA gene-transfected cells were capable of constitutive delivery of IL-RA proteins for at least 30 days. Moreover, the APA microcapsules could inhibit the permeation of fluorescein isothiocyanate-conjuncted immunoglobulin G. Also, it has been found that the APA microcapsules can significantly attenuate collagen induced arthritis after delivering of APA microcapsules to rats. Our results demonstrated that the nonautologous IL-RA gene-transfected stem cells are of potential utility for RA therapy.

  8. Migration area of the Tsushima Warm Current Branches within the Sea of Japan: Implications from transport of 228Ra

    Science.gov (United States)

    Inoue, M.; Shirotani, Y.; Furusawa, Y.; Fujimoto, K.; Kofuji, H.; Yoshida, K.; Nagao, S.; Yamamoto, M.; Hamajima, Y.; Honda, N.; Morimoto, A.; Takikawa, T.; Shiomoto, A.; Isoda, Y.; Minakawa, M.

    2017-07-01

    We investigated lateral profiles of 228Ra (half-life; 5.75 years) activity and 228Ra/226Ra (1600 years) activity ratio using 241 surface water samples collected in/around the Sea of Japan and the East China Sea (ECS) during June-October of 2009-2014. In the ECS, the 228Ra/226Ra ratio in the surface waters exhibited markedly wide variation (mixing between the 228Ra-rich continental shelf water and the 228Ra-depleted Kuroshio Current water. In July, the surface waters of the central Sea of Japan (135-138°E) became separated into three currents: the Offshore Branch of the Tsushima Warm Current (OBTWC) (228Ra/226Ra =0.7-1.2) at 39-41°N, the Coastal Branch of the TWC (CBTWC) ( 0.7) on the southern side, and sub-Arctic Current ( 0.7) on the northern side. From the central to northeastern Sea of Japan, the 228Ra/226Ra ratio at the surface (0.8-1.0) was within a range between that of the CBTWC and OBTWC. The fraction of continental shelf water in the CBTWC, OBTWC, and in their combined current was estimated to be 11-16%, 8%, and 10-11%, respectively.

  9. Competition of IL-1 and IL-1ra determines lymphocyte response to delayed stimulation with PHA.

    Science.gov (United States)

    Dabrowski, M P; Stankiewicz, W; Płusa, T; Chciałowski, A; Szmigielski, S

    2001-06-01

    Human peripheral blood mononuclear cells (PBMC) left in microcultures for 24h without mitogen do not respond to subsequent stimulation with PHA. They regain reactivity if the native culture medium is absorbed with other party lymphocytes or partially replaced with the medium from a PHA-stimulated culture. The observations suggest that, during the incubation, some inhibitory agent had accumulated in the culture medium. The study was performed to determine the nature of the observed phenomenon in respect of the possible role of monocytes and their products IL-1 and IL-1 receptor antagonist (IL-1ra), and to test for immunodiagnostic purposes the significance of quantifying the lymphocyte response to delayed stimulation with PHA in patients suffering from inflammatory prosesses. Lymphocyte response to delayed stimulation with PHA, calculated as the lymphocyte-monokine interaction (LM) index, was determined in the microcultures of PBMC isolated from the blood of healthy donors or of patients with acute tonsilitis. The values of LM indices were compared with the ratios of IL-1ra/IL-1beta concentration estimated by enzyme-linked immunosorbent assay method in the culture supernatants. The influences of exogenous IL-1beta, IL-1ra, anti-IL1ra antibodies and antibiotic cefaclor on the monokine concentrations and on the values of LM index were tested. The results show that the level of lymphocyte response to delayed stimulation with PHA (LM index) is inversely proportional to the ratio of IL-1ra/IL-1beta concentration in the culture. The low LM values at high IL-1ra/IL-1beta ratios in PBMC cultures from healthy donors, reversed proportions found in patients' PBMC (acute tonsilitis), and the cefaclor-induced reduction of LM value with correlated increase of the IL-1ra/IL-1beta ratio suggest that the LM assay may prove to be useful for immunodiagnostic purposes.

  10. Advanced myocardial tissue characterisation by a multi-component CMR protocol in patients with rheumatoid arthritis

    Energy Technology Data Exchange (ETDEWEB)

    Greulich, Simon; Kaesemann, Philipp; Patrascu, Alexandru; Sechtem, Udo; Mahrholdt, Heiko [Robert-Bosch-Medical Center Stuttgart, Division of Cardiology, Stuttgart (Germany); Mayr, Agnes [University Hospital Innsbruck, Division of Radiology, Innsbruck (Austria); Kitterer, Daniel; Latus, Joerg; Braun, Niko; Alscher, M.D. [Robert-Bosch-Medical Center Stuttgart, Division of Nephrology, Department of Internal Medicine, Stuttgart (Germany); Henes, Joerg [University Hospital Tuebingen, Centre for Interdisciplinary Clinical Immunology, Rheumatology and Auto-inflammatory Diseases and Department of Internal Medicine II (Oncology, Haematology, Immunology, Rheumatology, Pulmology), Tuebingen (Germany); Vecchio, Francesco [Robert-Bosch-Medical Center Stuttgart, Division of Cardiology, Stuttgart (Germany); Universita degli Studi di Roma ' ' Tor Vergata' ' , Division of Cardiology, Rome (Italy); Greiser, Andreas; Groeninger, Stefan [Siemens Healthcare GmbH, Erlangen (Germany); Romeo, Francesco [Universita degli Studi di Roma ' ' Tor Vergata' ' , Division of Cardiology, Rome (Italy)

    2017-11-15

    Rheumatoid arthritis (RA) patients are at increased risk of suffering from adverse cardiovascular events. Cardiovascular magnetic resonance (CMR) mapping techniques might be appropriate tools to complement late gadolinium enhancement (LGE) for the assessment of myocardial involvement. This study aimed to perform advanced myocardial tissue characterisation in RA patients by a multicomponent CMR protocol. 22 RA patients were prospectively enrolled and underwent CMR, including LGE and T1/T2 mapping sequences; 20 volunteers served as controls. Mean LV-EF was 66%; prevalence of LGE was 18%. RA patients had increased native T1 (985 vs. 959 ms, p = 0.03), expanded extracellular volume (ECV) (27 vs. 25%, p = 0.02) and higher T2 values (52 vs. 49 ms, p < 0.001) compared to controls irrespective of the presence of LGE. T2 mapping showed the highest prevalence of values beyond the 95% percentile of controls. RA patients demonstrated higher T1, ECV and T2 values compared to controls, with most significant differences for T2. Since these results seem to be independent of the presence of LGE, advanced myocardial tissue characterisation including CMR mapping techniques in addition to LGE-CMR might be useful in the evaluation of myocardial involvement in RA patients. (orig.)

  11. Safety and biodistribution assessment of sc-rAAV2.5IL-1Ra administered via intra-articular injection in a mono-iodoacetate-induced osteoarthritis rat model

    Directory of Open Access Journals (Sweden)

    Gensheng Wang

    2016-01-01

    Full Text Available Interleukin-1 (IL-1 plays an important role in the pathophysiology of osteoarthritis (OA, and gene transfer of IL-1 receptor antagonist (IL-1Ra holds promise for OA treatment. A preclinical safety and biodistribution study evaluated a self-complementary adeno-associated viral vector carrying rat IL-1Ra transgene (sc-rAAV2.5rIL-1Ra at 5 × 108, 5 × 109, or 5 × 1010 vg/knee, or human IL-1Ra transgene (sc-rAAV2.5hIL-1Ra at 5 × 1010 vg/knee, in Wistar rats with mono-iodoacetate (MIA–induced OA at days 7, 26, 91, 180, and 364 following intra-articular injection. The MIA-induced OA lesions were consistent with the published data on this model. The vector genomes persisted in the injected knees for up to a year with only limited vector leakage to systemic circulation and uptake in tissues outside the knee. Low levels of IL-1Ra expression and mitigation of OA lesions were observed in the vector-injected knees, albeit inconsistently. Neutralizing antibodies against the vector capsid developed in a dose-dependent manner, but only the human vector induced a small splenic T-cell immune response to the vector capsid. No local or systemic toxicity attributable to vector administration was identified in the rats as indicated by clinical signs, body weight, feed consumption, clinical pathology, and gross and microscopic pathology through day 364. Taken together, the gene therapy vector demonstrated a favorable safety profile.

  12. Analytical study of (226)Ra activity concentration in market consuming foodstuffs of Ramsar, Iran.

    Science.gov (United States)

    Gooniband Shooshtari, M; Deevband, M R; Kardan, M R; Fathabadi, N; Salehi, A A; Naddafi, K; Yunesian, M; Nabizadeh Nodehi, R; Karimi, M; Hosseini, S S

    2017-01-01

    Ramsar, a city of Iran located on the coast of the Caspian Sea, has been considered to be enormously important due to its high natural radioactivity levels. People living in High Level Natural Radiation Areas (HLNRAs) have been exposed by several sources, one of which could be foodstuff. However, many studies have been carried out to measure the environmental radioactivity in Ramsar, but no survey has been conducted in all stapled consumed foods yet. This study was dedicated to determine (226)Ra activity concentration in the daily diets of Ramsar residents as a probable exposure. Approximately 70 different market samples were collected during the four seasons based on the daily consumption patterns of residents which have the highest consumption and their availability in the seasons. All samples, after washing, drying and pretreatment, were analyzed for (226)Ra radionuclide determination by α-spectrometry. The mean radioactivity concentration of (226)Ra ranged between 7 ± 1 mBq Kg(-1) wet weight in meat, and 318 ± 118 mBq Kg(-1) for tea dry leaves. The (226)Ra activity concentrations in collected samples varied from below the minimum detectable activity up to 530 ± 30 mBq Kg(-1). To compare the results with United Nations Scientific Committee on Effects of Atomic Radiation (UNSCEAR) reference values, the (226)Ra activity concentrations concluded from the results appear to be higher in milk, chicken and eggs and less in grain products, vegetables, fruits and fish products. These results indicate that no significant (226)Ra contamination is present in market foodstuffs and provide reference values for the foodstuffs in Ramsar. Of the total daily dietary (226)Ra exposure from market consuming foodstuffs for adults in Ramsar, the largest percentage was from wheat. The residents consuming wheat and manufacturing wheat products such as bread, pasta, porridge, crackers, biscuits, pancakes, pies, pastries, cakes, cookies, muffins, rolls, doughnuts, breakfast

  13. Single Ra{sup +} ion spectroscopy - towards a measurement of atomic parity violation

    Energy Technology Data Exchange (ETDEWEB)

    Nunez Portela, Mayerlin; Mohanti, A.; Dijck, E.A.; Bekker, H.; Boell, O.; Berg, J. van den; Giri, G.S.; Jungmann, K.; Onderwater, C.J.G.; Santra, B.; Timmermans, R.G.E.; Versolato, O.O.; Wansbeek, L.W.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen, Groningen (Netherlands)

    2013-07-01

    The sensitivity of the Atomic Parity Violation (APV) signal grows faster than the third power of the atomic number Z. Ra{sup +} (Z=88) is heaviest alkaline earth ion available. A single trapped Ra{sup +} ion opens a very promising path for a measurement atomic parity violation. One of the experimental challenges is the localization of the ion within a fraction of an optical wavelength. For this the current experiments are focused on trapping and laser cooling of Ba{sup +} ions as a precursor for Ra{sup +}. Ba{sup +} ions are trapped and laser cooled in a precision hyperbolic Paul trap. Work towards single Ba{sup +} ion localization and detection is in progress. Recently the hyperfine structure of the 6d{sub 2}D{sub 3/2} states and the isotope shift of the 6d{sub 2}D{sub 3/2}-7p{sub 2}P{sub 1/2} transition in the isotopes {sup 209-214}Ra{sup +} has been measured in online laser spectroscopy experiments at the KVI AGOR/TRIμP facility. These results are essential for the interpretation of an APV measurement in Ra{sup +}.

  14. Long-term clinical investigation of patients with ankylosing spondylitis treated with /sup 224/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, E. (Universitatsklinik Friedrichsheim, Frankfurt, West Germany); Ruckbeil, C.; Wick, R.R.

    1983-01-01

    Between 1952 and 1980 about 250 patients with ankylosing spondylitis were treated with /sup 224/Ra at the Orthopaedic University Hospital of Frankfurt/M. In 1970, 119 of them were examined and X-rayed as was another group of 40 patients in 1980. The results of those examined could be compared with a group of 40 patients treated without /sup 224/Ra. Patients with /sup 224/Ra demonstrated a long-lasting period of subjective improvement after the treatment, with reduced consumption of antirheumatoid and analgesic drugs, on the average. Blood examinations show inflammatory activities. Nevertheless, the ankylosing spondylitis proceeded. In the final stages of the disease, neither the clinical aspects nor the X-rays showed any specific changes. We observed no case of malignant bone tumor. Of the 169 examined patients, 22 had a total of 32 children after the treatment with /sup 224/Ra. Among these was a set of twins with cerebral palsy and diabetes insipidus renalis. In conclusion, /sup 224/Ra in ankylosing spondylitis is a recommended treatment without higher risk compared to the common therapy with drugs.

  15. A Dual Key-Based Activation Scheme for Secure LoRaWAN

    Directory of Open Access Journals (Sweden)

    Jaehyu Kim

    2017-01-01

    Full Text Available With the advent of the Internet of Things (IoT era, we are experiencing rapid technological progress. Billions of devices are connected to each other, and our homes, cities, hospitals, and schools are getting smarter and smarter. However, to realize the IoT, several challenging issues such as connecting resource-constrained devices to the Internet must be resolved. Recently introduced Low Power Wide Area Network (LPWAN technologies have been devised to resolve this issue. Among many LPWAN candidates, the Long Range (LoRa is one of the most promising technologies. The Long Range Wide Area Network (LoRaWAN is a communication protocol for LoRa that provides basic security mechanisms. However, some security loopholes exist in LoRaWAN’s key update and session key generation. In this paper, we propose a dual key-based activation scheme for LoRaWAN. It resolves the problem of key updates not being fully supported. In addition, our scheme facilitates each layer in generating its own session key directly, which ensures the independence of all layers. Real-world experimental results compared with the original scheme show that the proposed scheme is totally feasible in terms of delay and battery consumption.

  16. Castration modulates singing patterns and electrophysiological properties of RA projection neurons in adult male zebra finches

    Directory of Open Access Journals (Sweden)

    Songhua Wang

    2014-04-01

    Full Text Available Castration can change levels of plasma testosterone. Androgens such as testosterone play an important role in stabilizing birdsong. The robust nucleus of the arcopallium (RA is an important premotor nucleus critical for singing. In this study, we investigated the effect of castration on singing patterns and electrophysiological properties of projection neurons (PNs in the RA of adult male zebra finches. Adult male zebra finches were castrated and the changes in bird song assessed. We also recorded the electrophysiological changes from RA PNs using patch clamp recording. We found that the plasma levels of testosterone were significantly decreased, song syllable’s entropy was increased and the similarity of motif was decreased after castration. Spontaneous and evoked firing rates, membrane time constants, and membrane capacitance of RA PNs in the castration group were lower than those of the control and the sham groups. Afterhyperpolarization AHP time to peak of spontaneous action potential (AP was prolonged after castration.These findings suggest that castration decreases song stereotypy and excitability of RA PNs in male zebra finches.

  17. La Realidad Aumentada (RA. Recursos y propuestas para la innovación educativa

    Directory of Open Access Journals (Sweden)

    Javier J. Maquilón Sánchez

    2017-01-01

    Full Text Available Este artículo contiene una propuesta de experiencia práctica de enseñanza-­‐aprendizaje, basada en la realidad aumentada (RA como recurso didáctico innovador. RA es tanto un concepto como una tecnología 3D interactiva actualmente en desarrollo. Por este motivo, en primer lugar se ha expuesto, por un lado, qué es la RA y, por otro lado, cuáles son las variantes tecnológicas actuales principales. Seguidamente, se ha hecho un análisis reflexivo de varios aspectos, que el docente ha de considerar respecto a la RA como tecnología aplicada a la educación, destacando la aportación innovadora de la RA como recurso didáctico. Finalmente se presenta el diseño y la elaboración de la actividad, tipo webquest que incluye un blog de aula.

  18. Immunomodulation of RA Patients’ PBMC with a Multiepitope Peptide Derived from Citrullinated Autoantigens

    Directory of Open Access Journals (Sweden)

    Smadar Gertel

    2017-01-01

    Full Text Available Citrullinated peptides are used for measuring anticitrullinated protein antibodies (ACPA in rheumatoid arthritis (RA. Accumulation of citrullinated proteins in the inflamed synovium suggests that they may be good targets for inducing peripheral tolerance. In view of the multiplicity of citrullinated autoantigens described as ACPA targets, we generated a multiepitope citrullinated peptide (Cit-ME from the sequences of major citrullinated autoantigens: filaggrin, β-fibrinogen, vimentin, and collagen type II. We assessed the ability of Cit-ME or the citrullinated β60-74 fibrinogen peptide (β60-74-Fib-Cit which bears immunodominant citrullinated epitopes (i to modify cytokine gene expression and (ii to modulate Treg and Th17 subsets in PBMC derived from newly diagnosed untreated RA patients. RA patient’s PBMC incubated with Cit-ME or β60-74-Fib-Cit, showed upregulation of TGF-β expression (16% and 8%, resp., and increased CD4+Foxp3+ Treg (22% and 19%, resp.. Both peptides were shown to downregulate the TNF-α and IL-1β expression; in addition, Cit-ME reduced CD3+IL17+ T cells. We showed that citrullinated peptides can modulate the expression of anti- and proinflammatory cytokines in PBMC from RA patients as well as the proportions of Treg and Th17 cells. These results indicate that citrullinated peptides could be active in vivo and therefore might be used as immunoregulatory agents in RA patients.

  19. RA-RAR-β counteracts myelin-dependent inhibition of neurite outgrowth via Lingo-1 repression.

    Science.gov (United States)

    Puttagunta, Radhika; Schmandke, André; Floriddia, Elisa; Gaub, Perrine; Fomin, Natalie; Ghyselinck, Norbert B; Di Giovanni, Simone

    2011-06-27

    After an acute central nervous system injury, axonal regeneration is limited as the result of a lack of neuronal intrinsic competence and the presence of extrinsic inhibitory signals. The injury fragments the myelin neuronal insulating layer, releasing extrinsic inhibitory molecules to signal through the neuronal membrane-bound Nogo receptor (NgR) complex. In this paper, we show that a neuronal transcriptional pathway can interfere with extrinsic inhibitory myelin-dependent signaling, thereby promoting neurite outgrowth. Specifically, retinoic acid (RA), acting through the RA receptor β (RAR-β), inhibited myelin-activated NgR signaling through the transcriptional repression of the NgR complex member Lingo-1. We show that suppression of Lingo-1 was required for RA-RAR-β to counteract extrinsic inhibition of neurite outgrowth. Furthermore, we confirm in vivo that RA treatment after a dorsal column overhemisection injury inhibited Lingo-1 expression, specifically through RAR-β. Our findings identify a novel link between RA-RAR-β-dependent proaxonal outgrowth and inhibitory NgR complex-dependent signaling, potentially allowing for the development of molecular strategies to enhance axonal regeneration after a central nervous system injury.

  20. Angiopoietin-1 upregulates de novo expression of IL-1β and Il1-Ra, and the exclusive release of Il1-Ra from human neutrophils.

    Science.gov (United States)

    Haddad, Lydia E; Sirois, Martin G

    2014-01-01

    The expression of the angiopoietin (Ang) receptor, Tie2, on both endothelial and inflammatory cells supports the idea that Ang signaling may play a fundamental role in initiating and maintaining the inflammatory response. We have previously shown that Ang1 and/or Ang2 alter the innate immune response by enhancing human neutrophil survival, chemotaxis and production of inflammatory cytokine interleukin-8 (IL-8) in vitro. Thus, we hypothesized that Ang1 and Ang2 could modulate other inflammatory signals in neutrophils, a possibility we explored through a gene-based assay looking at changes in the mRNA expression of 84 inflammatory cytokines and their receptors. We observed that Ang1 (10(-8) M), but not Ang2, increased mRNA expression of prominent pro-inflammatory cytokine IL-1β and its natural antagonist IL-1RA, by up to 32.6- and 10.0-fold respectively, compared to PBS-control. The effects of Ang1 extended to the proteins, as Ang1 increased intracellular levels of precursor and mature IL-1β, and extracellular levels of IL-1RA proteins, by up to 4.2-, 5.0- and 4.4-fold respectively, compared to PBS-control. Interestingly, Ang1 failed at inducing IL-1β protein release or at increasing intracellular IL-1RA, but the ratio of IL-1RA to mature IL-1β remained above 100-fold molar excess inside and outside the cells. The above-noted effects of Ang1 were mediated by MAP kinases, whereby inhibiting MEK1/2 lead to up to 70% effect reduction, whereas the blockade of p38MAPK activity doubled Ang1's effect. These findings suggest that Ang1 selectively alters the balance of neutrophil-derived inflammatory cytokines, favoring the blockade of IL-1 activity, a consideration for future therapies of inflammatory diseases.

  1. Angiopoietin-1 upregulates de novo expression of IL-1β and Il1-Ra, and the exclusive release of Il1-Ra from human neutrophils.

    Directory of Open Access Journals (Sweden)

    Lydia E Haddad

    Full Text Available The expression of the angiopoietin (Ang receptor, Tie2, on both endothelial and inflammatory cells supports the idea that Ang signaling may play a fundamental role in initiating and maintaining the inflammatory response. We have previously shown that Ang1 and/or Ang2 alter the innate immune response by enhancing human neutrophil survival, chemotaxis and production of inflammatory cytokine interleukin-8 (IL-8 in vitro. Thus, we hypothesized that Ang1 and Ang2 could modulate other inflammatory signals in neutrophils, a possibility we explored through a gene-based assay looking at changes in the mRNA expression of 84 inflammatory cytokines and their receptors. We observed that Ang1 (10(-8 M, but not Ang2, increased mRNA expression of prominent pro-inflammatory cytokine IL-1β and its natural antagonist IL-1RA, by up to 32.6- and 10.0-fold respectively, compared to PBS-control. The effects of Ang1 extended to the proteins, as Ang1 increased intracellular levels of precursor and mature IL-1β, and extracellular levels of IL-1RA proteins, by up to 4.2-, 5.0- and 4.4-fold respectively, compared to PBS-control. Interestingly, Ang1 failed at inducing IL-1β protein release or at increasing intracellular IL-1RA, but the ratio of IL-1RA to mature IL-1β remained above 100-fold molar excess inside and outside the cells. The above-noted effects of Ang1 were mediated by MAP kinases, whereby inhibiting MEK1/2 lead to up to 70% effect reduction, whereas the blockade of p38MAPK activity doubled Ang1's effect. These findings suggest that Ang1 selectively alters the balance of neutrophil-derived inflammatory cytokines, favoring the blockade of IL-1 activity, a consideration for future therapies of inflammatory diseases.

  2. A comparative study of different radiometric methodologies for the determination of 226Ra in water

    Directory of Open Access Journals (Sweden)

    Ibrahim F. Al-Hamarneh

    2018-02-01

    Full Text Available An evaluation of various radiometric methods to analyze 226Ra in water has been employed on a set of 10 standard solutions of different concentrations in the range of 1–10 Bq/L−1. The analysis was carried out using well-established procedures by means of gamma-ray, alpha-particle and liquid scintillation spectrometry. The feasibility of the various methods has been quantified in terms of relative standard error and percentage error. Correlations between the various methods have been presented and discussed. In general, good agreement was found in the results of various methodologies, which assures the accuracy of the methods and allows for the validation of instrumentation and procedures. Of the different methods adopted here, a combined procedure for the determination of 226Ra along with 228Ra using Quantulus 1220 ultra-low level background liquid scintillation counting gave the most accurate results.

  3. Determination of {sup 226}Ra in urine samples by alpha spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Kehagia, K.; Potiriadis, C.; Bratakos, S.; Koukouliou, V.; Drikos, G. [Greek Atomic Energy Commission, PO Box 60092, Agia Paraskevi, Attiki 15310 (Greece)

    2007-07-01

    A radiation protection system to assess the internal contamination of workers during decontamination activities in an abounded fertilizer industry in the region of Attika, Greece, has been implemented. This system concerns, among other radionuclides, {sup 226}Ra. Because of the low {sup 226}Ra activities in urine, alpha spectrometry was used as the determination method after radiochemical separation. Radium was co precipitated with lead sulphate and purified using anion and cation exchange techniques. The source for the alpha spectrometric measurement was prepared by the electrodeposition of radium, from an aqueous/ethanol solution, onto stainless steel. The tracer used was {sup 229}Th. The chemical yield and the activity concentration were calculated via its daughter radionuclide {sup 217}At. Using the time-evolution formulas to calculate the {sup 217}At growth from its parent radionuclide {sup 225}Ra, a computer software was developed. This software was incorporated in a database, which automatically calculates and stores the results. (authors)

  4. Geology and Topography of Ra Patera, Io, in the Voyager era: Prelude to Eruption

    Science.gov (United States)

    Schenk, Paul M.; McEwen, Alfred; Davies, A. G.; Davenport, Trevor; Jones, Kevin; Fessler, Brian

    1997-01-01

    Voyager era stereo images are used to map the geology and topography of Ra Patera (a major active volcanic center and possible site of sulfur eruptions on Io). The summit of Ra Patera reaches only approx.1 km above the surrounding plains. Pre-Voyager-era lava flows occur on slopes of 0.1-0.3 deg, comparable to the lunar mare. These flows were emplaced at either low viscosities, high eruption rates, or both. A 600- km-long ridged mountain unit (rising to approx. 8 km near Carancho Patera) forms a 60 by 90 km wide plateau approx. 0.5 km high 50 km east of Ra Patera. The new lava flows observed by Galileo flowed around the southern edge of this plateau.

  5. The genetics of rheumatoid arthritis: risk and protection in different stages of the evolution of RA

    Science.gov (United States)

    Yarwood, Annie; Huizinga, Tom W. J.

    2016-01-01

    There is now a general consensus that RA has a spectrum of disease stages that can begin many years before the onset of clinical symptoms. It is widely thought that understanding the complex interplay between genetics and environment, and their role in pathogenesis, is essential in gaining further insight into the mechanisms that drive disease development and progression. More than 100 genetic susceptibility loci have now been identified for RA through studies that have focused on patients with established RA compared with healthy controls. Studying the early preclinical phases of disease will provide valuable insights into the biological events that precede disease and could potentially identify biomarkers to predict disease onset and future therapeutic targets. In this review we will cover recent advances in the knowledge of genetic and environmental risk factors and speculate on how these factors may influence the transition from one stage of disease to another. PMID:25239882

  6. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things

    Directory of Open Access Journals (Sweden)

    Aloÿs Augustin

    2016-09-01

    Full Text Available LoRa is a long-range, low-power, low-bitrate, wireless telecommunications system, promoted as an infrastructure solution for the Internet of Things: end-devices use LoRa across a single wireless hop to communicate to gateway(s, connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server. This paper provides an overview of LoRa and an in-depth analysis of its functional components. The physical and data link layer performance is evaluated by field tests and simulations. Based on the analysis and evaluations, some possible solutions for performance enhancements are proposed.

  7. Lasercooled RaF as a promising candidate to measure molecular parity violation

    CERN Document Server

    Isaev, T A; Berger, R

    2010-01-01

    The parameter $W_\\mathrm{a}$, which characterizes nuclear spin-dependent parity violation effects within the effective molecular spin-rotational Hamiltonian, was computed for the electronic ground state of radium fluoride (RaF) and found to be one of the largest absolute values predicted so far. These calculations were performed with the complex generalised Hartree-Fock method within a two-component (quasi-relativistic) zeroth-order regular approximation framework. Peculiarities of the molecular electronic structure of RaF lead to highly diagonal Franck-Condon matrices between vibrational states of the electronic ground and first excited states, which renders the molecule in principle suitable for direct laser cooling. As a trapped gas of cold molecules offers a superior coherence time, RaF can be considered a promising candidate for high-precision spectroscopic experiments aimed at the search of molecular parity-violation effects.

  8. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things.

    Science.gov (United States)

    Augustin, Aloÿs; Yi, Jiazi; Clausen, Thomas; Townsley, William Mark

    2016-09-09

    LoRa is a long-range, low-power, low-bitrate, wireless telecommunications system, promoted as an infrastructure solution for the Internet of Things: end-devices use LoRa across a single wireless hop to communicate to gateway(s), connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server. This paper provides an overview of LoRa and an in-depth analysis of its functional components. The physical and data link layer performance is evaluated by field tests and simulations. Based on the analysis and evaluations, some possible solutions for performance enhancements are proposed.

  9. Production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Meriarty, H; Metcalfe, P; Knittel, T; Allen, B J

    2007-09-01

    The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. The production of Ac-225 has been achieved using bremsstrahlung photons from an 18 MV medical linear accelerator (linac) to bombard a Ra-226 target. A linac dose of 2800 Gy produced about 64 microCi of Ra-225, which decays to Ac-225. This result, while consistent with the theoretical calculations, is far too low to be of practical use. A more powerful linac is required that runs at a higher current, longer pulse length and higher frequency for practical production. This process could also lead to the reduction of the nuclear waste product Ra-226.

  10. Diatom species composition in the Raška river (Southwestern Serbia

    Directory of Open Access Journals (Sweden)

    Vidaković Danijela P.

    2015-01-01

    Full Text Available The paper presents data on the composition of epilithic diatoms in the Raška River. Samples were collected by scraping stone surfaces with a brush from 5 localities along the Raška River in April, June, August and November 2011 and March and May 2012. Diatom frustules were cleaned using cold acid method, and mounted on permanent slides. An investigation of the Raška River resulted in description of 106 diatom taxa. The most species rich genera are Navicula (10, Gomphonema (10 and Nitzschia (9, while other genera are presented with one or more species. Detailed floristic analysis of the benthic diatom flora in this river has not been conducted before. Therefore, this paper provides a groundwork for future researches. [Projekat Ministarstva nauke Republike Srbije, br. TR 037009

  11. A survey on LPWA technology: LoRa and NB-IoT

    Directory of Open Access Journals (Sweden)

    Rashmi Sharan Sinha

    2017-03-01

    Full Text Available By 2020, more than twenty five billion devices would be connected through wireless communications. In accordance with the rapid growth of the internet of things (IoT market, low power wide area (LPWA technologies have become popular. In various LPWA technologies, narrowband (NB-IoT and long range (LoRa are two leading technologies. In this paper, we provide a comprehensive survey on NB-IoT and LoRa as efficient solutions connecting the devices. It is shown that unlicensed LoRa has advantages in terms of battery lifetime, capacity, and cost. Meanwhile, licensed NB-IoT offers benefits in terms of QoS, latency, reliability, and range.

  12. Evaluation of the activity concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in sediments from Antarctica in the Admiralty bay region; Avaliacao da concentracao de atividade de Ra-226, Ra-228 e Pb-210 em sedimentos provenientes da Antartica na regiao da baia do Almirantado

    Energy Technology Data Exchange (ETDEWEB)

    Mora, Tamires de Araujo

    2015-07-01

    The natural radionuclides from radioactive series of {sup 238}U, {sup 235}U and {sup 232}Th have been applied as tracers in environmental studies for understanding the dynamics that occur in both marine and terrestrial environment, as for example, in research of oceanic processes and management of the coastal region. In the marine environment, these radionuclides can be used to estimate biogeochemical fluxes of marine particles and nutrients that occur in the water column as well as in the sediment. Several research works applied the distribution and the respective disequilibrium degree of natural radionuclides in the environment, including geochronological models for obtaining historical information on samples of certain sediment profile. In this study we performed a radiochemical characterization of the distribution of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb from a sedimentary column called 1B (248 cm long) collected in the Admiralty Bay, Antarctic Peninsula region. The methodology used included the acid leaching of sediment samples followed by the radiochemical sequential separation of {sup 226}Ra and {sup 228}Ra by co-precipitation with Ba(Ra)SO{sub 4} and {sup 210}Pb by co-precipitation with PbCrO{sub 4}. All measurements were carried out by counting of gross alpha and gross beta measures in a low background gas flow proportional detector. The activity concentrations of {sup 226}Ra and {sup 210}Pb were used to estimate the unsupported {sup 210}Pb activities present in sediment profile 1 B. Based on unsupported {sup 210}Pb data and the application of the CIC model (Constant Initial Concentration), it was possible to determine the sedimentation rate of 0.59 ± 0.05 cm /year. (author)

  13. Reação de cultivares de abacateiro à podridão de raízes Reaction of avocado cultivars to avocado root rot

    Directory of Open Access Journals (Sweden)

    Ciro Hideki Sumida

    2009-07-01

    Full Text Available As cultivares de abacateiro (Persea americana Mill 'Margarida', 'Fortuna' e 'Hass' têm muita importância econômica no mercado nacional e internacional. Em função disso, este trabalho teve como objetivo avaliar a reação dessas cultivares frente à Phytophthora cinnamomi Rands., agente causal da podridão das raízes. A inoculação do patógeno foi feita por meio de implantação de tecidos de raízes sintomáticas. Foram inoculadas quatro raízes em três árvores diferentes, uma de cada cultivar, em três pontos diferentes da raiz. Em cada cultivar, das quatro raízes, uma foi utilizada como testemunha, nas quais foram implantados tecidos sadios. A avaliação foi realizada aos 120 dias após a inoculação, observando-se as raízes externamente quanto à alteração da coloração e presença de estruturas de patógenos na região da superfície da casca nos pontos inoculados. Internamente, foram removidas as cascas para visualização das alterações a partir do ponto inoculado, sendo observadas alterações de coloração dos tecidos e realizada mensuração da extensão do escurecimento (lesão aparente. Nas extremidades das lesões foram retirados segmentos de raízes e implantados em meio de cultivo farinha de milho-ágar e incubados, para verificação da colonização na área sem escurecimento, ou seja, a colonização não- aparente. Das cultivares avaliadas, a 'Hass' foi a menos suscetível ao P. cinnamomi, quando comparada às cultivares 'Fortuna' e 'Margarida'. O patógeno P. cinnamomi pode apresentar desenvolvimento ou colonização nos tecidos radiculares além da área sintomática.Cultivars of the avocado (Persea americana Mill 'Margarida', 'Fortuna' and 'Geada' have importance in the national and international markets. The present paper had as objective to evaluate the reaction of such cultivars to Phytophthora cinanamomi Rands, the causal agent of avocado root rot. They were inoculated four roots in three different

  14. Developing a Construct to Evaluate Flares in Rheumatoid Arthritis: A Conceptual Report of the OMERACT RA Flare Definition Working Group

    DEFF Research Database (Denmark)

    Alten, Rieke; Choy, Ernest H; Christensen, Robin

    2011-01-01

    is intended to enhance patient-HCP communication. This article describes the conceptual framework being used by the OMERACT RA Flare Definition Working Group in developing a standardized method for description and measurement of "flare in RA" to guide individual patient treatment.......Rheumatoid arthritis (RA) patients and healthcare professionals (HCP) recognize that episodic worsening disease activity, often described as a "flare," is a common feature of RA that can contribute to impaired function and disability. However, there is no standard definition to enable measurement...... of its intensity and impact. The conceptual framework of the Outcome Measures in Rheumatology Clinical Trials (OMERACT) RA Flare Definition Working Group includes an anchoring statement, developed at OMERACT 9 in 2008: "flare in RA" is defined as worsening of signs and symptoms of sufficient intensity...

  15. miRA: adaptable novel miRNA identification in plants using small RNA sequencing data.

    Science.gov (United States)

    Evers, Maurits; Huttner, Michael; Dueck, Anne; Meister, Gunter; Engelmann, Julia C

    2015-11-05

    MicroRNAs (miRNAs) are short regulatory RNAs derived from longer precursor RNAs. miRNA biogenesis has been studied in animals and plants, recently elucidating more complex aspects, such as non-conserved, species-specific, and heterogeneous miRNA precursor populations. Small RNA sequencing data can help in computationally identifying genomic loci of miRNA precursors. The challenge is to predict a valid miRNA precursor from inhomogeneous read coverage from a complex RNA library: while the mature miRNA typically produces many sequence reads, the remaining part of the precursor is covered very sparsely. As recent results suggest, alternative miRNA biogenesis pathways may lead to a more diverse miRNA precursor population than previously assumed. In plants, the latter manifests itself in e.g. complex secondary structures and expression from multiple loci within precursors. Current miRNA identification algorithms often depend on already existing gene annotation, and/or make use of specific miRNA precursor features such as precursor lengths, secondary structures etc. Consequently and in view of the emerging new understanding of a more complex miRNA biogenesis in plants, current tools may fail to characterise organism-specific and heterogeneous miRNA populations. miRA is a new tool to identify miRNA precursors in plants, allowing for heterogeneous and complex precursor populations. miRA requires small RNA sequencing data and a corresponding reference genome, and evaluates precursor secondary structures and precursor processing accuracy; key parameters can be adapted based on the specific organism under investigation. We show that miRA outperforms the currently best plant miRNA prediction tools both in sensitivity and specificity, for data involving Arabidopsis thaliana and the Volvocine algae Chlamydomonas reinhardtii; the latter organism has been shown to exhibit a heterogeneous and complex precursor population with little cross-species miRNA sequence conservation, and

  16. Extração de ecdisterona em raízes de ginseng brasileiro

    OpenAIRE

    Flores, Rejane; Nicoloso,Fernando Teixeira; Brondani, Daniela; Maldaner, Joseila; Cezarotto,Verciane; Giacomelli, Sandro Rogério

    2009-01-01

    Este estudo teve como objetivo otimizar a extração de ecdisterona em raízes de ginseng brasileiro. Primeiramente, para se avaliar a eficiência do solvente extrator, amostras de raízes dois acessos (BRA e JB-UFSM) de P. glomerata foram extraídas em Soxhlet com metanol e clorofórmio, separadamente, durante 4 horas. No segundo ensaio, com o intuito de se escolher o método extrator, a extração foi conduzida em Soxhlet e em ultrassom, utilizando metanol como solvente. Em P. tuberosa, as amostras f...

  17. Performance Comparisons of Improved Regular Repeat Accumulate (RA and Irregular Repeat Accumulate (IRA Turbo Decoding

    Directory of Open Access Journals (Sweden)

    Ahmed Abdulkadhim Hamad

    2017-08-01

    Full Text Available In this paper, different techniques are used to improve the turbo decoding of regular repeat accumulate (RA and irregular repeat accumulate (IRA codes. The adaptive scaling of a-posteriori information produced by Soft-output Viterbi decoder (SOVA is proposed. The encoded pilots are another scheme that applied for short length RA codes. This work also suggests a simple and a fast method to generate a random interleaver having a free 4 cycle Tanner graph. Progressive edge growth algorithm (PEG is also studied and simulated to create the Tanner graphs which have a great girth.

  18. Coverage and Capacity Analysis of Sigfox, LoRa, GPRS, and NB-IoT

    DEFF Research Database (Denmark)

    Vejlgaard, Benny; Lauridsen, Mads; Nguyen, Huan Cong

    2017-01-01

    In this paper the coverage and capacity of SigFox, LoRa, GPRS, and NB-IoT is compared using a real site deployment covering 8000 km2 in Northern Denmark. Using the existing Telenor cellular site grid it is shown that the four technologies have more than 99 % outdoor coverage, while GPRS...... uplink and downlink connectivity with less than 5 % failure rate, while SigFox is able to provide an unacknowledged uplink data service with about 12 % failure rate. Both GPRS and LoRa struggle to provide sufficient indoor coverage and capacity....

  19. Determination of specific activities of U-238, Ra-226, Ra-228 e Th-228 in samples of mineral fertilizers with phosphorus; Determinacao das atividades especificas de U-238, Ra-226, Ra-228 e Th-228 em amostras de fertilizantes minerais com fosforo

    Energy Technology Data Exchange (ETDEWEB)

    Garcez, R.W.D.; Lopes, J.M.; Silva, A.X. da, E-mail: rgarcez@nuclear.ufrj.br [Coordenacao dos Programas de Pos-Graduacao em Engenharoa (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Domingues, A.M.; Lima, M.A.F. [Universidade Federal Fluminense (UFF),Niteroi, RJ (Brazil)

    2016-07-01

    Samples were analyzed by gamma spectrometry mineral fertilizers with the HPGe detector and aid LabSOCS software for calculating the detection efficiency curve. Specific activities found for Pa-234m, Ra-226, Ra-228 and Th-228 in samples of phosphate fertilizers were 505 Bq.kg{sup -1}, 458 Bq.kg{sup -1}, 450 Bq.kg{sup -1} and 394 Bq.kg{sup -1}, respectively. And for the NPK fertilizer samples were found average values of 390 Bq.kg{sup -1}, 252 Bq.kg{sup -1}, 280 Bq.kg{sup -1} and 268 Bq.kg{sup -1}, respectively. (author)

  20. Membangun Karakter AUD dalam Pengembangan Nilai Agama dan Moral di RA Masyithoh Pabelan Kab. Semarang

    Directory of Open Access Journals (Sweden)

    Amin Sabi'ati

    2016-06-01

    Full Text Available This article is intended to reveal the importance of character building of children through the development of religious and moral values ​​in early childhood in RA Masyithoh Pabelan Semarang regency, the factors that influence the character building, the process of the development of moral and religious values, behavioral changes, and its implementation in the system for early childhood learning. The results showed that the learning that emphasizes hands-on learning and do as habituation, very influential in improving the development of religious and moral values early childhood in RA (Kindergarten Masyithoh Pabelan Semarang District.

  1. A rapid analysis of {sup 226}Ra in raw materials and by-products using gamma-ray spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Chung Sup; Chung, Kun Ho; Kim, Chang Jong; Ji, Young Yong [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2017-03-15

    A gamma-ray peak of {sup 226}Ra (186.2 keV) overlaps with one of {sup 235}U (185.7 keV) in a gamma-ray spectrometry system. Though reference peaks of {sup 235}U can be used to correct the peak interference of {sup 235}U in the analysis of {sup 226}Ra, this requires a complicated calculation process and a high limit of quantitation. On the other hand, evaluating {sup 226}Ra using the correction constant in the overlapped peak can make a rapid measurement of {sup 226}Ra without the complicated calculation process as well as overcome the disadvantage in the indirect measurement of {sup 214}Bi, which means the confinement of {sup 222}Rn gas in a sample container and a time period to recover the secular equilibrium. About 93 samples with 6 species for raw-materials and by-products were prepared to evaluate the activity of {sup 226}Ra using the correction constant. The results were compared with the activity of {sup 214}Bi, which means the indirect measurement of {sup 226}Ra, to validate the method of the direct measurement of {sup 226}Ra using the correction constant. The difference between the direct and indirect measurement of {sup 226}Ra was generally below about ± 20%. However, in the case of the phospho gypsum, a large error of about 50% was found in the comparison results, which indicates the disequilibrium between {sup 238}U and {sup 226}Ra in the materials. Application results of the contribution ratio of {sup 226}Ra were below about ± 10% . The direct measurement of {sup 226}Ra using the correction constant can be an effective method for its rapid measurement of raw materials and by-products because the activity of {sup 226}Ra can be produced with a simple calculation without the consideration of the integrity of a sample container and the time period to recover the secular equilibrium.

  2. {sup 232}Th-{sup 228}Ra-{sup 228}Th disequilibrium in East China Sea sediments

    Energy Technology Data Exchange (ETDEWEB)

    Chen, H.Y.; Huh, C.A. [Institute of Earth Sciences, Academia Sinica, P.O. Box 1-55, Nankang, Taipei, Taiwan (China)

    1999-01-01

    Five sediment cores collected from the East China Sea have been analyzed for {sup 228}Ra and {sup 228}Th (via {sup 228}Ac and {sup 208}Tl, respectively) by {gamma}-ray spectrometry with a 150% efficiency HPGe detector. In four cores, the {sup 228}Th/{sup 228}1 at the core top to a subsurface minimum around a depth of 5 cm and then increases towards unity at deeper layers. Such disequilibrium relationships between {sup 228}Th and {sup 228}Ra downcore manifest the decay with depth of {sup 228}Th scavengedfrom the water column and the ingrowth of {sup 228}Th towards equilibrium with {sup 228}Ra after burial. Profiles of {sup 228}Ra are characterized by an upward decrease to minimum values at core tops, indicating diffusion of {sup 228}Ra to seawater. From deficiencies of {sup 228}Ra relative to {sup 232}Th in the studied sediment cores, fluxes of {sup 228}Ra are estimated to be 1.2-3.1 dpm cm{sup -2} (year){sup -1} at the steady state. Assuming the study area is representative of the East China Sea Shelf, it is estimated from the measured sedimentary {sup 228}Ra fluxes and water column {sup 228}Ra data that the residence time of the East China Sea shelf water with respect to the exchange with the open ocean water via Kuroshio is about 1-3 years. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  3. Ra-224 Labeling of Calcium Carbonate Microparticles for Internal α-Therapy: Preparation, Stability and Biodistribution in Mice.

    Science.gov (United States)

    Westrøm, Sara; Malenge, Marion; Jorstad, Ida Sofie; Napoli, Elisa; Bruland, Øyvind S; Bønsdorff, Tina B; Larsen, Roy H

    2018-01-29

    Internal therapy with α-emitters should be well suited for micrometastatic disease. Radium-224 emits multiple α-particles through its decay and has a convenient 3.6 days half-life. Despite its attractive properties, the use of 224 Ra has been limited to bone-seeking applications because it cannot be stably bound to a targeting molecule. Alternative delivery systems for 224 Ra are therefore of considerable interest. In this study, calcium carbonate (CaCO 3 ) microparticles are proposed as carriers for 224 Ra, designed for local therapy of disseminated cancers in cavitary regions, such as peritoneal carcinomatosis. CaCO 3 microparticles were radiolabeled by precipitation of 224 Ra on the particle surface, resulting in high labeling efficiencies for both 224 Ra and daughter 212 Pb and retention of more than 95 % of these nuclides for up to one week in vitro. The biodistribution after intraperitoneal administration of the 224 Ra-labeled CaCO 3 microparticles in immunodeficient mice revealed that the radioactivity mainly remained in the peritoneal cavity. In addition, the systemic distribution of 224 Ra was found to be strongly dependent on the amount of administered microparticles, with a reduced skeletal uptake of 224 Ra with increasing dose. The results altogether suggest that the 224 Ra-labeled CaCO 3 microparticles have promising properties for use as a localized internal α-therapy of cavitary cancers. This article is protected by copyright. All rights reserved.

  4. Bioaccumulation of {sup 226}Ra by plants growing in fresh water ecosystem around the uranium industry at Jaduguda, India

    Energy Technology Data Exchange (ETDEWEB)

    Jha, V.N., E-mail: jhavn1971@gmail.co [Environmental Assessment Division, Bhabha Atomic Research Centre, Mumbai-400085 (India); Tripathi, R.M., E-mail: tripathirm@yahoo.co [Environmental Assessment Division, Bhabha Atomic Research Centre, Mumbai-400085 (India); Sethy, N.K.; Sahoo, S.K.; Shukla, A.K.; Puranik, V.D. [Environmental Assessment Division, Bhabha Atomic Research Centre, Mumbai-400085 (India)

    2010-09-15

    A field study has been conducted to evaluate the {sup 226}Ra bioaccumulation among aquatic plants growing in the stream/river adjoining the uranium mining and ore-processing complex at Jaduguda, India. Two types of plant group have been investigated namely free floating algal species submerged into water and plants rooted in stream and riverbed. The highest {sup 226}Ra activity concentration (9850 Bq kg{sup -1}) was found in filamentous algae growing in the residual water of tailings pond. The concentration ratios of {sup 226}Ra in filamentous algae (activity concentration of {sup 226}Ra in plant Bq kg{sup -1} fresh weight/activity concentration of {sup 226}Ra in water Bq l{sup -1}) widely varied i.e. from 1.1 x 10{sup 3} to 8.6 x 10{sup 4}. Other aquatic plants were also showing wide variability in the {sup 226}Ra activity concentration. The ln-transformed filamentous algae {sup 226}Ra activity concentration was significantly correlated with that of ln-transformed water concentration (r = 0.89, p < 0.001). There was no correlation between the activity concentrations of {sup 226}Ra in stream/riverbed rooted plants and the substrate. For this group, correlation between {sup 226}Ra activity concentration and Mn, Fe, Cu concentration in plants were statistically significant.

  5. Rheumatoid arthritis antigens homocitrulline and citrulline are generated by local myeloperoxidase and peptidyl arginine deiminases 2, 3 and 4 in rheumatoid nodule and synovial tissue.

    Science.gov (United States)

    Turunen, Sanna; Huhtakangas, Johanna; Nousiainen, Tomi; Valkealahti, Maarit; Melkko, Jukka; Risteli, Juha; Lehenkari, Petri

    2016-10-20

    Seropositive rheumatoid arthritis (RA) is characterized by autoantibodies binding to citrullinated and homocitrullinated proteins. We wanted to study the expression patterns of these disease-associated protein forms and if the rheumatoid nodule and synovial tissue itself contain biologically active levels of citrullinating peptidyl arginine deiminases 2, 3 and 4 and homocitrullination-facilitating neutrophil enzyme myeloperoxidase. Total of 195 synovial samples from metatarsal joints from five ACPA/RF-positive RA patients (n = 77), synovial samples from knees of eight seropositive RA (n = 60), seven seronegative RA (n = 33) and five osteoarthritis (n = 25) patients were analyzed for citrulline and homocitrulline contents using HPLC. The location of citrulline- and homocitrulline-containing proteins, PAD 2, 3, 4 and myeloperoxidase were shown by immunostaining. Myeloperoxidase and citrulline- or homocitrulline-containing proteins were stained on Western blot. Overall, necrosis was frequent in metatarsals of seropositive RA and absent in seronegative RA and osteoarthritis patients. In histological analysis, there was a significant local patterning and variation in the citrulline and homocitrulline content and it was highest in metatarsal synovial tissues of seropositive RA patients. We found peptidyl arginine deiminase 2, 3 and 4 in the lining and sublining layers of intact synovial tissue. Myeloperoxidase was found locally around necrotic areas. The tissues with necrosis contained the highest levels of citrulline and homocitrulline. Rheumatoid nodules and synovia contain significant amount of PAD2, 3 and 4 and myeloperoxidase enzymes. These enzymes could explain the levels of citrulline and homocitrulline in seropositive RA synovial and rheumatoid nodule tissues especially around necrotic tissue.

  6. 1Uhunmwangho EJ, 2Ojieh GC, 1Anyanwu RA, 3Idehen IC, 4Isibor

    African Journals Online (AJOL)

    Uwaifoh

    2012-05-23

    NATAL WOMEN IN BENIN CITY, NIGERIA. *1Uhunmwangho E.J., 2Ojieh G.C., 1Anyanwu R.A., 3Idehen I.C.,. 4Isibor J.O., 1Turay A.A., 5Okhia O. Department of 1Medical Laboratory Science, 2Medical Biochemistry, 5Nursing ...

  7. Fission characteristics of 216 Ra formed in heavy-ion induced ...

    Indian Academy of Sciences (India)

    particles for 216Ra formed in 19F + 197Au reactions and results are compared with the experimental data. To calculate these quantities, the effects of temperature and spin K about the symmetry axis have been considered in the calculations of the ...

  8. Teater annab ära tuleviku / Inna Grünfeldt

    Index Scriptorium Estoniae

    Grünfeldt, Inna, 1961-

    2003-01-01

    Rakvere Teatris esineb 8. ja 9. aug. rahvusvaheline performance'i trupp Insightout Company, kus teeb kaasa ka Mari Mägi. Lavastus kannab pealkirja "Ära anda tulevik" ja see on inspireeritud trupi liikmete mälupiltidest ja I. Allende romaanist "Paula"

  9. A Triplane Fracture of The Distal Femoral Epiphysis. RA Gosselin et ...

    African Journals Online (AJOL)

    user

    2005-12-02

    Dec 2, 2005 ... 2Senior House Officer, 3Consultant. Orthopedic Surgeon. Dept. of Orthopedics, Mulago Hospital, Kampala, UGANDA. Correspondence to: Dr. RA Gosselin MD University of California, Berkeley, P.O. Box 1983, El. Granada, CA 94018, USA. Fax: 650-712-8927. E-mail; froggydoc@comcast.net. Introduction.

  10. RAGE activation induces invasiveness of RA fibroblast-like synoviocytes in vitro

    NARCIS (Netherlands)

    Steenvoorden, M.M.C.; Toes, R.E.M.; Ronday, H.K.; Huizinga, T.W.J.; Groot, J. de

    2007-01-01

    Ligands for the receptor for advanced glycation endproducts (RAGE) are increased in RA synovial fluid (SF), serum and synovium. Since RAGE is present on fibroblast-like synoviocytes (FLS), the present study investigates whether the RAGE ligands HMGB-1 and AGEs are able to stimulate the

  11. Zunde raMambo as a traditional coping mechanism for the care of ...

    African Journals Online (AJOL)

    This study sought to examine the feasibility of rejuvenating and strategically repositioning the Zunde raMambo (King's granary) as a traditional orphans and vulnerable children (OVC) coping mechanism in Zimbabwe with a special reference to Gutu District. The study was motivated by the intellectual and theoretical paucity ...

  12. Cosmic Radiation Dose Measurements from the RaD-X Flight Campaign

    Science.gov (United States)

    Mertens, Christopher J.; Gronoff, Guillaume P.; Norman, Ryan B.; Hayes, Bryan M.; Lusby, Terry C.; Straume, Tore; Tobiska, W. Kent; Hands, Alex; Ryden, Keith; Benton, Eric; hide

    2016-01-01

    The NASA Radiation Dosimetry Experiment (RaD-X) stratospheric balloon flight mission obtained measurements for improving the understanding of cosmic radiation transport in the atmosphere and human exposure to this ionizing radiation field in the aircraft environment. The value of dosimetric measurements from the balloon platform is that they can be used to characterize cosmic ray primaries, the ultimate source of aviation radiation exposure. In addition, radiation detectors were flown to assess their potential application to long-term, continuous monitoring of the aircraft radiation environment. The RaD-X balloon was successfully launched from Fort Sumner, New Mexico (34.5 degrees North, 104.2 degrees West) on 25 September 2015. Over 18 hours of flight data were obtained from each of the four different science instruments at altitudes above 20 kilometers. The RaD-X balloon flight was supplemented by contemporaneous aircraft measurements. Flight-averaged dosimetric quantities are reported at seven altitudes to provide benchmark measurements for improving aviation radiation models. The altitude range of the flight data extends from commercial aircraft altitudes to above the Pfotzer maximum where the dosimetric quantities are influenced by cosmic ray primaries. The RaD-X balloon flight observed an absence of the Pfotzer maximum in the measurements of dose equivalent rate.

  13. NuSTAR ground calibration: The Rainwater Memorial Calibration Facility (RaMCaF)

    DEFF Research Database (Denmark)

    Brejnholt, Nicolai; Christensen, Finn Erland; Jakobsen, Anders Clemen

    2011-01-01

    The Nuclear Spectroscopic Telescope Array (NuSTAR) is a NASA Small Explorer mission that will carry the first focusing hard X-ray (5-80 keV ) telescope to orbit. The ground calibration of the three flight optics was carried out at the Rainwater Memorial Calibration Facility (RaMCaF) built...

  14. Spectroscopic Confirmation of ASASSN-16ra as a 2016 Galactic Nova in Norma

    Science.gov (United States)

    Chomiuk, L.; Strader, J.; Bahramian, A.; Stanek, K. Z.; Kochanek, C. S.

    2017-09-01

    We present spectroscopic confirmation of the recently announced optical transient ASASSN-16ra (ATel #10740) as a Galactic nova in the nebular phase. The spectrum was obtained with the Goodman Spectrograph on the SOAR telescope on Sep 20.98, 18 months after it first appeared in ASAS-SN data.

  15. Data of evolutionary structure change: 1B7RA-2G4NF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B7RA-2G4NF 1B7R 2G4N A F KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...G HHHH - GGGG -- EVID>EVID> 0 2G4N... F 2G4NF IVQN...tation> 0.7171639800071716 1.2988790273666382 EVI...D> 1 2G4N F 2G4NF

  16. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things

    National Research Council Canada - National Science Library

    Augustin, Aloÿs; Yi, Jiazi; Clausen, Thomas; Townsley, William Mark

    2016-01-01

    ...: end-devices use LoRa across a single wireless hop to communicate to gateway(s), connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server...

  17. Evaluation of the Psychometric Properties of SOGS-RA in the Polish Version

    Directory of Open Access Journals (Sweden)

    Jolanta Jarczyńska

    2016-09-01

    Full Text Available Objective: The objective was to adapt the American pathological gambling screening tool /SOGS-RA The South Oaks Gambling Screen - Revised for Adolescent/ by K. Winters, R. Stinchfield and J. Fulkerson (1993 and to evaluate its psychometric properties. Method: The adapted tool was used in research on a randomly selected sample of 2,617 adolescents aged 13-20 years in the 2012/2013 school year. Results: On the SOGS-RA scale, 2.6% of the trial participants achieved a score indicating past year problem gambling before the survey, 4.1% were classified as problem gamblers, whereas 17.3% of adolescents engaged in social gambling that did not pose a problem gambling risk at the time. The SOGS-RA demonstrated satisfactory internal consistency (Cronbach's alpha = 0.78. Conclusions: The Polish adaptation of the SOGS-RA scale is reliable and accurate, which is why it is worth recommending it for use in further research on Polish adolescents.

  18. Activity concentrations of K, Th, Ra and radiation exposure levels in ...

    African Journals Online (AJOL)

    use

    where CRa, CTh and CK are activity concentrations of 226Ra, 232Th and 40K, respectively in Bqkg-1. The value of this index should be less than 1 mSvy-1 in order for the radiation hazard to be considered acceptable to the public (Beretka and Mathew, 1985). Internal hazard index (Hin). The internal hazard index (Hin) ...

  19. Data of evolutionary structure change: 1C5RA-2FOAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ntryIDChain>1C5RA PVVCS----GKLQG >EEEE ---- EEEE...>PLHCLVNGQYAVHG >EEEEEE EEEEEEure> ...ence>VSWGS--GCAQK >EEE -- > ATOM.../pdbID> A 2FOAA TSFVSRLGCNVT ...>EEE > ATOM 1549 CA THR A 221 43.465 26.521 43.443

  20. Social Security in Zimbabwe : Phase II: Zunde raMambo and Burial ...

    African Journals Online (AJOL)

    Zunde raMambo, which provide for the contingency of famine and chronic poverty, was useful in alleviating the plight of rural people but the scheme was not being implemented in all communities because of problems such as lack of fertile land, inputs and poor community mobilization. Communities need more land, seed ...

  1. Tourism potentials of the Raška region and development of rural tourism

    Directory of Open Access Journals (Sweden)

    Pavlović Mila

    2011-01-01

    Full Text Available In order to find solutions for stopping negative economic processes in the Raška region, as well as land reclamation and depopulation of villages, one of the main activities is adequate restructuration of the economy, according to available resources. In this paper we analyze a place of tourism in the Raška region, as an activity to which is not given appropriate developmental role in the previous development policies, as opposed to diverse and attractive natural and anthropogenic values. In the paper we identify the most significant tourism potentials of the Raška region and their evaluation score. Special attention is given to rural tourism as one of the activities that can have a greater role in future plans for demographic and economic revitalization of this area. We analyze the current state of rural tourism in the Raška region, and indicate main limiting factors that prevent rapid development of this, in many ways, primary form of tourism.

  2. The charophytes-rich Barremian-Albian record in Jebel Ksaïra (Central Tunisia)

    Science.gov (United States)

    Salmouna, Amal; Cojan, Isabelle; Touir, Jamel

    2017-06-01

    On the southern margin of the Tethys, Early Cretaceous sediments cover most of the Central Tunisia. As a result of a Middle Cretaceous sub-aerial exposure, the Late Barremian -Early Albian interval is mainly characterized by a major stratigraphic gap (hiatus). However in the Sidi Bouzid area a continental succession has been deposited called ;Kebar Formation;. The Kebar Formation was previously studied in Jebel Kebar and Jebel Koumine and attributed respectively to the Late Aptian-Early Albian and the Late Barremian- Early Albian intervals. In the Jebel Ksaïra area, located at the East of Sidi Bouzid area and 4 km East of the Jebel Kebar, the Kebar Formation includes a rich association of charophytes that allows us to assign this Formation to the Late Barremian -Early Albian. Therefore, the Kebar Formation should have been deposited in Jebel Ksaïra earlier than in Jebel Kebar. The vertical stacking pattern and facies association of the Kebar Formation in the Jebel Ksaïra locality reflect variable depositional settings ranging from palustrine to marginal marine and infratidal environments. In fact, the sedimentary deposition in Jebel Ksaïra area was cyclic, alternating between (i) continental deposition materialized by bedded limestones rich in charophytes and limnic ostracods and (ii) marginal marine to infratidal deposition receiving episodically conglomerate inputs related to recurrent halokinetic activity (diapir of Jebel Rheouis).

  3. Laryngeal features in Latundê (Northern Nambikwára

    Directory of Open Access Journals (Sweden)

    Stella Telles

    2013-08-01

    Full Text Available This paper is about the status of laryngeal features in Latundê, a language of the Northern Nambikwára subgroup. Data were collected in the field by the author between the years 1997-2001. The available literature on other languages of the family was also taken into consideration for the analysis. The article is organized in five sections: in the first section, information on the Nambikwára family and the segmental inventories of three languages of the family will be provided; in the second section, the phonological charts (consonants and vowels of Latundê are presented; in the third section data that demonstrate the realization of laryngeal features in the consonants (glottalization and aspiration and vowels (creaky voice of Latundê can be found; considerations on laryngeal variation are provided in the fourth section; in the final section, correspondences between segments with laryngeal features in Latundê and Mamaindê, a closely related Northern Nambikwára language, will be considered. The research shows that in Latundê laryngeal features were neutralized for consonants, while for vowels, creaky voice remained contrastive. Within the Northern Nambikwára branch, the correspondence between Mamaindê and Latundê consonants seems to indicate that the latter language is the most innovative in the process of historical change.

  4. Data of evolutionary structure change: 2B9RA-2BPMD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B9RA-2BPMD 2B9R 2BPM A D -VKDIYAYLRQLEAAQAVRPKYLLGR-EVTGNMRAILID...line>THR CA 261 GLY CA 332 ASN CA 307 2BPM... D 2BPMD YMKKQPDITNS .../line> ASP CA 206 VAL CA 247 GLU CA 298 2BPM... D 2BPMD

  5. ETV Report: Siemens Model V-40R-A150 Open Channel UV System

    Science.gov (United States)

    Verification testing of the Siemens Barrier Sunlight V-40R-A150 UV System was completed at the UV Validation and Research Center of New York (UV Center), located in Johnstown, NY. The V-40R System supplied by Siemens utilizes 40 high-output, low-pressure amalgam lamps, oriented ...

  6. A loudspeaker-based room auralisation (LoRA) system for auditory perception research

    DEFF Research Database (Denmark)

    Buchholz, Jörg; Favrot, Sylvain Emmanuel

    of the LoRA processing is first presented, followed by a battery of objective and subjective tests to demonstrate the applicability of the different components of the system. In the objective evaluation, monaural and binaural room acoustic measures (e.g., reverberation time, clarity, interaural cross...... correlation coefficient) were considered. The subject evaluation included speech intelligibility and distance perception measures....

  7. Comparison of shaping ability of RaCe and Hero Shaper instruments in simulated curved canals.

    Science.gov (United States)

    Aydin, Cumhur; Inan, Ugur; Yasar, Senay; Bulucu, Bilinc; Tunca, Yasar M

    2008-03-01

    This study compared the shaping ability of Hero Shaper and RaCe instruments in simulated curved canals. Forty simulated canals in resin blocks were divided into 2 experimental groups, each comprising 20 resin blocks, and prepared with Hero Shaper and RaCe using the crown-down technique. Preoperative and postoperative photographs, recorded using a digital camera, were superimposed and aberrations were recorded. Material removal was measured at 10 points beginning 1 mm from the end point of the canal. Mean total widths, outer and inner width measurements, were determined on each central canal path and differences were statistically analyzed using Student t test. The Hero Shaper and RaCe instruments removed almost the same amount of material from the inner side of the simulated canals. On the outer canal wall, the RaCe instruments removed significantly more material from the first 3 mm (P Hero Shaper removed more material from the middle and coronal aspects of the canal and the differences were statistically significant (P Hero Shaper removed more material from the middle and coronal thirds on the outer canal wall. Hero Shaper instruments showed better centering ability and fewer aberrations. No instrument fractures but some deformations were observed for both systems.

  8. The 226 Ra, 210 Pb and essential elements bioavailability to pines at Urgeirica uranium mill tailings

    Energy Technology Data Exchange (ETDEWEB)

    Madruga, M.J.; Faria, I. [Nuclear and Technological Institute, Dept. of Radiological Protection and Nuclear Safety (Portugal)

    2006-07-01

    The objective of this study is to correlate the uptake of the natural radilides {sup 226}Ra and {sup 210}Pb with the essential elements, potassium, calcium and magnesium in the pines growing at the 'Urgeirica uranium mill tailings. It can be concluded that the potassium, calcium and magnesium mean concentration ratio values are, about two to three orders of magnitude, higher than the values obtained to {sup 226}Ra and {sup 210}Pb for pines growing on the Urgeirica uranium mill tailings. The concentration ratio values higher than 1 obtained to the potassium, calcium and magnesium elements indicate that pines are behaving as accumulators to these elements. Contrarily, the {sup 226}Ra and {sup 210}Pb concentration ratio values lower than 1 indicates that pines are behaving as excluders to these radionuclides. So, it can be concluded that this kind of plants is not suitable to a phyto remediation strategy. In general, a marginally significant correlation was observed between the potassium, calcium and magnesium concentrations, the cation-exchange capacity and the ph in the tailings and the {sup 226}Ra and {sup 210}Pb pines/tailings concentration ratios. (N.C.)

  9. NetRaVE: constructing dependency networks using sparse linear regression

    DEFF Research Database (Denmark)

    Phatak, A.; Kiiveri, H.; Clemmensen, Line Katrine Harder

    2010-01-01

    NetRaVE is a small suite of R functions for generating dependency networks using sparse regression methods. Such networks provide an alternative to interpreting 'top n lists' of genes arising out of an analysis of microarray data, and they provide a means of organizing and visualizing the resulting...... information in a manner that may suggest relationships between genes....

  10. Selective 226RA2+ionophores provided by self-assembly of guanosine and isoguanosine deratives

    NARCIS (Netherlands)

    van Leeuwen, F.W.B.; Verboom, Willem; Shi, Xiaodong; Davis, J.T.; Davis, Jeffery T.; Reinhoudt, David

    2004-01-01

    The self-assembled guanosine (G 1)-based hexadecamers and isoguanosine (isoG 2)-based decamers are excellent 226Ra2+ selective ionophores even in the presence of excess alkali (Na+, K+, Rb+, and Cs+) and alkaline earth (Mg2+, Ca2+, Sr2+, and Ba2+) cations over the pH range 3-11. G 1 requires

  11. Thiacalix(4)arene derivatives as radium ionophores: a study on the requirements for Ra2+ extraction

    NARCIS (Netherlands)

    van Leeuwen, F.W.B.; Beijleveld, H.; Beijleveld, Hans; Velders, Aldrik; Huskens, Jurriaan; Verboom, Willem; Reinhoudt, David

    2005-01-01

    The synthesis and NOE-based structural characterization is described of thiacalix[4]arene tricarboxylic acid ( 7), thiacalix[4]crown-5 and -6 monocarboxylic acids ( 2 and 5), and the bis(N-methylsulfonyl)thiacalix[4]crowns-5 and -6 ( 4a,b). The 226Ra2+ selectivity coefficients, log(KRaex/KMex), of

  12. Fission characteristics of Ra formed in heavy-ion induced reactions

    Indian Academy of Sciences (India)

    section of the evap- oration residue, fission cross-section, average pre-fission multiplicities of protons and α-particles for 216Ra formed in 19F+197Au reactions and results are compared with the experimental data. To calculate these quantities, the ...

  13. Performance analysis of LoRa radio for an indoor IoT applications

    NARCIS (Netherlands)

    Ayele, Eyuel D.; Hakkenberg, Chiel; Meijers, Jan Pieter; Zhang, Kyle; Meratnia, Nirvana; Havinga, Paul J.M.

    2017-01-01

    LoRa is an emerging wireless standard specifically designed for Low Power Wide Area Networks (LPWANs). It provides long range, low data rate, and energy efficient wireless communication and is believed to have high potential for realization of a large number of Internet of Things (IoT) applications.

  14. GPS-free Geolocation using LoRa in Low-Power WANs

    DEFF Research Database (Denmark)

    Fargas, Bernat Carbones; Petersen, Martin Nordal

    2017-01-01

    Internet of Things (IoT) has been growing over the last few years in multiple applications and due to the high need GPS for tracking capabilities, an innovative opportunity arises. This paper reports on a design and implementation of a LoRaWAN tracking system which is capable exploiting transmitted...

  15. Rheumatologists' knowledge, attitude and current management of fatigue in patients with rheumatoid arthritis (RA).

    NARCIS (Netherlands)

    Repping-Wuts, H.; Riel, P.L.C.M. van; Achterberg, T. van

    2008-01-01

    To describe rheumatologists' knowledge, attitude and current management of fatigue in patients with rheumatoid arthritis (RA), a postal questionnaire was sent to all rheumatologists (N = 204) and trainees (N = 49), members of the Dutch Society of Rheumatology. The overall response rate was 44% (N =

  16. Functional analysis of the Phycomyces carRA gene encoding the enzymes phytoene synthase and lycopene cyclase.

    Directory of Open Access Journals (Sweden)

    Catalina Sanz

    Full Text Available Phycomyces carRA gene encodes a protein with two domains. Domain R is characterized by red carR mutants that accumulate lycopene. Domain A is characterized by white carA mutants that do not accumulate significant amounts of carotenoids. The carRA-encoded protein was identified as the lycopene cyclase and phytoene synthase enzyme by sequence homology with other proteins. However, no direct data showing the function of this protein have been reported so far. Different Mucor circinelloides mutants altered at the phytoene synthase, the lycopene cyclase or both activities were transformed with the Phycomyces carRA gene. Fully transcribed carRA mRNA molecules were detected by Northern assays in the transformants and the correct processing of the carRA messenger was verified by RT-PCR. These results showed that Phycomyces carRA gene was correctly expressed in Mucor. Carotenoids analysis in these transformants showed the presence of ß-carotene, absent in the untransformed strains, providing functional evidence that the Phycomyces carRA gene complements the M. circinelloides mutations. Co-transformation of the carRA cDNA in E. coli with different combinations of the carotenoid structural genes from Erwinia uredovora was also performed. Newly formed carotenoids were accumulated showing that the Phycomyces CarRA protein does contain lycopene cyclase and phytoene synthase activities. The heterologous expression of the carRA gene and the functional complementation of the mentioned activities are not very efficient in E. coli. However, the simultaneous presence of both carRA and carB gene products from Phycomyces increases the efficiency of these enzymes, presumably due to an interaction mechanism.

  17. Quantification of {sup 235} U and {sup 226} Ra in soil samples by means of Gamma spectroscopy; Cuantificacion de {sup 235} U y {sup 226} Ra en muestras de suelo por medio de espectrometria gamma

    Energy Technology Data Exchange (ETDEWEB)

    Quintero P, E.; Rojas M, V.P.; Montes M, F.R.; Gaso P, M.I.; Cervantes N, M.L. [Gerencia de Innovacion Tecnologica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

    2000-07-01

    In this work it is presented the Gamma Spectroscopy method which is realized in the Environmental Radiological Surveillance Laboratory using the option of deconvolution of a commercial software for the quantification of {sup 235} U and {sup 226} Ra; also is presented the method for the {sup 226} Ra correction activity. (Author)

  18. SU-F-J-08: Quantitative SPECT Imaging of Ra-223 in a Phantom

    Energy Technology Data Exchange (ETDEWEB)

    Yue, J; Hobbs, R; Sgouros, G; Frey, E [Johns Hopkins University Baltimore, MD (United States)

    2016-06-15

    Purpose: Ra-223 therapy of prostate cancer bone metastases is being used to treat patients routinely. However, the absorbed dose distribution at the macroscopic and microscopic scales remains elusive, due to the inability to image the small activities injected. Accurate activity quantification through imaging is essential to calculate the absorbed dose in organs and sub-units in radiopharmaceutical therapy, enabling personalized absorbed dose-based treatment planning methodologies and more effective and optimal treatments. Methods: A 22 cm diameter by 20 cm long cylindrical phantom, containing a 3.52 cm diameter sphere, was used. A total of 2.01 MBq of Ra-223 was placed in the phantom with 177.6 kBq in the sphere. Images were acquired on a dual-head Siemens Symbia T16 gamma camera using three 20% full-width energy windows and centered at 84, 154, and 269 keV (120 projections, 360° rotation, 45 s per view). We have implemented reconstruction of Ra-223 SPECT projections using OS-EM (up to 20 iterations of 10 subsets) with compensation for attenuation using CT-based attenuation maps, collimator-detector response (CDR) (including septal penetration, scatter and Pb x-ray modeling), and scatter in the patient using the effective source scatter estimation (ESSE) method. The CDR functions and scatter kernels required for ESSE were computed using the SIMIND MC simulation code. All Ra-223 photon emissions as well as gamma rays from the daughters Rn-219 and Bi-211 were modeled. Results: The sensitivity of the camera in the three combined windows was 107.3 cps/MBq. The visual quality of the SPECT images was reasonably good and the activity in the sphere was 27% smaller than the true activity. This underestimation is likely due to partial volume effect. Conclusion: Absolute quantitative Ra-223 SPECT imaging is achievable with careful attention to compensate for image degrading factors and system calibration.

  19. Risk assessment of human exposure to Ra-226 in oil produced water from the Bakken Shale.

    Science.gov (United States)

    Torres, Luisa; Yadav, Om Prakash; Khan, Eakalak

    2018-01-20

    Unconventional oil production in North Dakota (ND) and other states in the United States uses large amounts of water for hydraulic fracturing to stimulate oil flow. Most of the water used returns to the surface as produced water (PW) containing different constituents. Some of these contents are total dissolved solids and radionuclides. The most predominant radionuclide in PW is radium-226 (Ra-226) of which level depends on several factors including the content of certain cations. A multivariate regression model was developed to predict Ra-226 in PW from the Bakken Shale based on the levels of barium, strontium, and calcium. The simulated Ra-226 activity concentration in PW was 535 pCi/L supporting extremely limited actual data based on three PW samples from the Bakken (527, 816, and 1210 pCi/L). The simulated activity concentration was further analyzed by studying its impact in the event of a PW spill reaching a surface water body that provides drinking water, irrigation water for crops, and recreational fishing. Using food transfer factors found in the literature, the final annual effective dose rate for an adult in ND was estimated. The global average annual effective dose rate via food and drinking water is 0.30 mSv, while the predicted dose rate in this study was 0.49 mSv indicating that there is potential risk to human health in ND due to Ra-226 in PW spills. This predicted dose rate is considered the best case scenario as it is based on the simulated Ra-226 activity concentration in PW of 535 pCi/L which is close to the low end actual activity concentration of 527 pCi/L. Copyright © 2018 Elsevier B.V. All rights reserved.

  20. LoRa Scalability: A Simulation Model Based on Interference Measurements.

    Science.gov (United States)

    Haxhibeqiri, Jetmir; Van den Abeele, Floris; Moerman, Ingrid; Hoebeke, Jeroen

    2017-05-23

    LoRa is a long-range, low power, low bit rate and single-hop wireless communication technology. It is intended to be used in Internet of Things (IoT) applications involving battery-powered devices with low throughput requirements. A LoRaWAN network consists of multiple end nodes that communicate with one or more gateways. These gateways act like a transparent bridge towards a common network server. The amount of end devices and their throughput requirements will have an impact on the performance of the LoRaWAN network. This study investigates the scalability in terms of the number of end devices per gateway of single-gateway LoRaWAN deployments. First, we determine the intra-technology interference behavior with two physical end nodes, by checking the impact of an interfering node on a transmitting node. Measurements show that even under concurrent transmission, one of the packets can be received under certain conditions. Based on these measurements, we create a simulation model for assessing the scalability of a single gateway LoRaWAN network. We show that when the number of nodes increases up to 1000 per gateway, the losses will be up to 32%. In such a case, pure Aloha will have around 90% losses. However, when the duty cycle of the application layer becomes lower than the allowed radio duty cycle of 1%, losses will be even lower. We also show network scalability simulation results for some IoT use cases based on real data.

  1. LoRa Scalability: A Simulation Model Based on Interference Measurements

    Directory of Open Access Journals (Sweden)

    Jetmir Haxhibeqiri

    2017-05-01

    Full Text Available LoRa is a long-range, low power, low bit rate and single-hop wireless communication technology. It is intended to be used in Internet of Things (IoT applications involving battery-powered devices with low throughput requirements. A LoRaWAN network consists of multiple end nodes that communicate with one or more gateways. These gateways act like a transparent bridge towards a common network server. The amount of end devices and their throughput requirements will have an impact on the performance of the LoRaWAN network. This study investigates the scalability in terms of the number of end devices per gateway of single-gateway LoRaWAN deployments. First, we determine the intra-technology interference behavior with two physical end nodes, by checking the impact of an interfering node on a transmitting node. Measurements show that even under concurrent transmission, one of the packets can be received under certain conditions. Based on these measurements, we create a simulation model for assessing the scalability of a single gateway LoRaWAN network. We show that when the number of nodes increases up to 1000 per gateway, the losses will be up to 32%. In such a case, pure Aloha will have around 90% losses. However, when the duty cycle of the application layer becomes lower than the allowed radio duty cycle of 1%, losses will be even lower. We also show network scalability simulation results for some IoT use cases based on real data.

  2. O cromossomo Y na raça Chianina no Brasil

    Directory of Open Access Journals (Sweden)

    Gilberto Pedroso da Rocha

    2000-01-01

    Full Text Available Foram cariotipados 95 touros puros de origem, da raça Chianina, ditribuidos em 19 empresas pastoris, em 5 estados brasileiros. O objetivo foi investigar a incidência de indivíduos portadores de cromossomo Y acrocêntrico, típico das raças de Bos taurus indicus, face às especulações de que as raças indianas poderiam ter contribuido para a formação do Chianina. Todos os indivíduos avaliados mostraram o cromossomo Y de Bos taurrus taurus. O índice centromérico obtido foi de 43,91%, o que permitiu classificar o centrômero deste cromossomo como localizado na região mediana. Foram avaliados também 29 touros com o objetivo de verificar a presença do polimorfismo intraracial do cromossomo Y. O índice centromérico e o tamanho relativo do Y foi determinado. O tamanho do cromossomo X serviu como base para estimar o tamano relativo do Y. A análise de variância mostrou diferenças entre touros apenas no tamanho relativo do Y, sendo que o índice centromérico não difereiu entre os mesmos. Concluimos que este polimorfismo indica que a raça Chianina pode ter recebido contribuição de outras raças em passado remoto ou pode também indicar a possibilidade de cruzamentos mais recentes.

  3. Interleukin-1Ra rs2234663 and Interleukin-4 rs79071878 Polymorphisms in Familial Mediterranean Fever.

    Science.gov (United States)

    Nursal, Ayse Feyda; Tekcan, Akin; Kaya, Suheyla Uzun; Sezer, Ozlem; Yigit, Serbulent

    2016-05-15

    Familial Mediterranean Fever (FMF) is an autosomal recessively inherited auto inflammatory disorder. MEFV gene, causing FMF, encodes pyrin that is associated with the interleukin-1 (IL-1) related inflammation cascade. The aim of this study was to investigate the relationship of interleukin-1 receptor antagonist (IL-1Ra) and interleukin-4 (IL-4) polymorphisms with the risk of FMF in the Turkish population. This study included 160 patients with FMF (74 men, 86 women) and 120 healthy controls (50 men, 70 women), respectively. Genotyping of IL-1Ra rs2234663 polymorphism was evaluated by gel electrophoresis after polymerase chain reaction (PCR). The IL-4 rs79071878 polymorphism was determined by PCR-based restriction fragment length polymorphism (PCR-RFLP) analysis. The results of analyses were evaluated for statistical significance. There was no significant difference in IL-1Ra genotype and allele distributions between FMF and the control groups (p>0.05). However, a significant association was observed between FMF patients and control groups according to IL-4 genotype distribution (p=0.016), but no association was found in the allelic frequency of IL-4 between FMF patients and the controls (p>0.05, OR: 1.131, CI 95%: 0.71-1.81). The IL-4 rs79071878 polymorphism, was associated whereas the IL-1Ra rs2234663 polymorphism was not associated with FMF risk in the Turkish population. Larger studies with different ethnicities are needed to determine the impact of IL-1Ra and IL-4 polymorphism on the risk of developing FMF. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. The Cossacks of the South of Russia in R.A. Fadeev’s geopolitical plans

    Directory of Open Access Journals (Sweden)

    Kuznetsov Oleg Viktorovich

    2013-11-01

    Full Text Available The political project of a conservative writer of political essays of the second half of the XIX c. R.A. Fadeev (1824–1883, in which a key part is assigned to the attraction of the Cossacks of Southern Russia to solving the pressing foreign policy issues, is analyzed. A conclusion that the Cossacks could be used as a militant vanguard, i.e. military force (infantry, cavalry, reconnaissance and an effective tool of the colonization of the suburbs of the Russian Empire – is drawn. The conditions under which R.A. Fadeev could implement his plans are revealed. The key condition is the preservation of the identity of the Cossacks as a class and as a sub-ethnos. The historical assessment of the R.A. Fadeev’s plans is given. According to the plans R.A. Fadeev, revived after the reforms of its military power, Russia should not only play a key role in international relations, but also strive for a first impact and then rule on its neighboring Asian and European territories. And in the perspective he saw the new world order, in which there would be two dominating superpowers, Russia and the United States. The Cossacks were assigned an important role in the implementation of these plans by the publicist.This geopolitical project, no matter how attractive it was not for the Russians at first glance, was a utopia. The publicist obviously overestimated the military and economic capabilities of contemporary Imperial Russia, the ability of the autocracy to the socio-economic and political renewal of the country corresponding to the demands of the times. Consequently, the Cossacks were not destined to play the role which was assigned to them by R.A. Fadeev. Althoughhe anticipated accurately the individual elements of the future world order established for several decades in the XX century.

  5. Therapy palliative with {sup 2}23Ra without special radiation protection measures?; Palliative Therapie mit {sup 223}Ra ohne besondere Strahlenschutzmassnahmen?

    Energy Technology Data Exchange (ETDEWEB)

    Just, Guenther [Forschungsbuero Radonbalneologie (FRB), Grosspoesna (Germany); Petzold, Juergen

    2015-07-01

    For nearly 2 years now as a therapy of the castration resistant prostata carcinoma a nuclide therapy with {sup 223}Ra-Dichloride (trade-mark Xofigo) is applied. Xofigo is applied by a medical specialist for nuclear medicine altogether 6 times in a monthly distance. The activity used in each case is according to the body weight (50 kBq/kg BW). This therapy is licensed by the supervisory authorities of the German federal countries as an ambulant therapy. Special radiation protection measures are only required when exceeding a given number of 17 patients per year as incorparation measurements.

  6. Carne da raça Churra do Campo : contributo para a preservação da raça

    OpenAIRE

    Carvalho, J.; Andrade, C.S.C.R.; Almeida, J.P.F.

    2011-01-01

    Comunicação oral apresentada na Jornada Técnica de Produção de Ruminantes que decorreu na Escola Superior Agrária do Instituto Politécnico de Castelo Branco, em 31 de Março de 2011. O presente trabalho apresenta uma caracterização da população actual de ovinos da raça Churra do Campo, no que respeita ao crescimento dos borregos e à composição e qualidade da carcaça e carne 45 vs 120 dias.

  7. IL-1Ra (recombinant human IL-1 receptor antagonist in the treatment of rheumatoid arthritis: the efficacy

    Directory of Open Access Journals (Sweden)

    L. Cozzi

    2011-09-01

    Full Text Available Interleukin 1 receptor antagonist (IL-1Ra is a naturally occurring IL-1 inhibitor, acting as a “receptor antagonist”, which blocks IL-1 mediated signal transduction. In 1990 IL-1Ra was cloned and later on, a large numbers of studies led to disclosure of the crucial importance of the imbalance between IL-1 and IL-1Ra in the pathogenesis of rheumatoid arthritis (RA. In 1991, almost 8 years after the initial isolation of IL-1, recombinant IL-1Ra (IL-1ra, Kineret was introduced in clinical trials involving patients with RA. Between 2001 and 2002 IL-1ra was approved by the US Food and Drug Administration and by the European Agency for the Evaluation of the Medicinal Products and in 2003 it was registered in Italy, too. In RA recombinant IL-1ra has been evaluated in 5 randomized, placebo-controlled clinical trials involving more than 2900 patients. Two of the trials involved the use of IL-1ra as monotherapy versus placebo and two trials in combination with methotrexate (MTX; the last trial explored the use of a fixed 100 mg/day IL-1ra dosage in a RA patient population including a wide array of co-morbid conditions as well as concomitant medications. The studies confirmed both the efficacy and the safety of IL-1ra in patients with active and severe RA. 43% of patients receiving 150 mg/day IL-1ra achieved a 20% response according to the American College of Rheumatology criteria (ACR20, compared to 27% in the placebo group. In the MTX combination therapy study, 42% of the patients receiving 1 mg/Kg/day of IL-1ra achieved an ACR20, 24% an ACR50 and 10% an ACR70. In each study, significant improvements in the Health Assessment Questionnaire scores (HAQ were observed. There were rapid gains in the number of days at work or domestic activity in the treated patients, and the increases in productivity were dose related. At early 24 weeks, there was significant reduction of both the score for progression of joint space narrowing (JSN and the Total modified

  8. TissueCypher™: A systems biology approach to anatomic pathology

    Directory of Open Access Journals (Sweden)

    Jeffrey W Prichard

    2015-01-01

    Full Text Available Background: Current histologic methods for diagnosis are limited by intra- and inter-observer variability. Immunohistochemistry (IHC methods are frequently used to assess biomarkers to aid diagnoses, however, IHC staining is variable and nonlinear and the manual interpretation is subjective. Furthermore, the biomarkers assessed clinically are typically biomarkers of epithelial cell processes. Tumors and premalignant tissues are not composed only of epithelial cells but are interacting systems of multiple cell types, including various stromal cell types that are involved in cancer development. The complex network of the tissue system highlights the need for a systems biology approach to anatomic pathology, in which quantification of system processes is combined with informatics tools to produce actionable scores to aid clinical decision-making. Aims: Here, we describe a quantitative, multiplexed biomarker imaging approach termed TissueCypher™ that applies systems biology to anatomic pathology. Applications of TissueCypher™ in understanding the tissue system of Barrett's esophagus (BE and the potential use as an adjunctive tool in the diagnosis of BE are described. Patients and Methods: The TissueCypher™ Image Analysis Platform was used to assess 14 epithelial and stromal biomarkers with known diagnostic significance in BE in a set of BE biopsies with nondysplastic BE with reactive atypia (RA, n = 22 and Barrett's with high-grade dysplasia (HGD, n = 17. Biomarker and morphology features were extracted and evaluated in the confirmed BE HGD cases versus the nondysplastic BE cases with RA. Results: Multiple image analysis features derived from epithelial and stromal biomarkers, including immune biomarkers and morphology, showed significant differences between HGD and RA. Conclusions: The assessment of epithelial cell abnormalities combined with an assessment of cellular changes in the lamina propria may serve as an adjunct to conventional

  9. Disparities in rheumatoid arthritis disease activity according to gross domestic product in 25 countries in the QUEST-RA database

    DEFF Research Database (Denmark)

    Sokka, T; Kautiainen, H; Pincus, T

    2009-01-01

    OBJECTIVE: To analyse associations between the clinical status of patients with rheumatoid arthritis (RA) and the gross domestic product (GDP) of their resident country. METHODS: The Quantitative Standard Monitoring of Patients with Rheumatoid Arthritis (QUEST-RA) cohort includes clinical and que...

  10. SF Treg cells transcribing high levels of Bcl-2 and microRNA-21 demonstrate limited apoptosis in RA

    NARCIS (Netherlands)

    van der Geest, Kornelis S. M.; Smigielska, Katarzyna; Park, Ji-Ah; Abdulahad, Wayel H.; Kim, Hye-Won; Kroesen, Bart-Jan; van den Berg, Anke; Boots, Annemieke M. H.; Lee, Eun-Bong; Brouwer, Elisabeth

    Objective. The aim of this study was to investigate the turnover of Treg cells in the SF of RA patients. Methods. Treg cells were enumerated in peripheral blood and SF of RA patients and analysed by flow cytometry for expression of the proliferation marker Ki-67 and binding of the apoptosis marker

  11. Evaluating the rheological properties of PMB-containing RA binders from surface-layer asphalt mixtures to be recycled

    NARCIS (Netherlands)

    Liu, G.; Leegwater, G.; Nielsen, E.; Komacka, J.; Ven, M.V.D.

    2013-01-01

    A rapidly increasing source of reclaimed asphalt (RA) that contains polymer modified bitumen (PMB) offers a potential premium material contribution when performing recycling. This study investigated the rheological properties of three PMB-containing RA binders from different "old" surface-layer

  12. ra kontoris segab tööd / Patrick Kurtz ; tõlk. Pille Korpen

    Index Scriptorium Estoniae

    Kurtz, Patrick

    2005-01-01

    Üldnõuetest kontorite planeerimisel. Müra vähendamise planeerimisest. Tabelid: Müra helivõimsuse taseme allikad; Arvutitöökohtade akustika. Vt. ka: Avatud kontor võib olla ka vaikne. BNSi vastutav peatoimetaja Anvar Samost räägib avatud tööruumi eelistest

  13. Secretory activity of subcutaneous abdominal adipose tissue in male patients with rheumatoid arthritis and osteoarthritis - association with clinical and laboratory data.

    Science.gov (United States)

    Kontny, Ewa; Zielińska, Agnieszka; Księżopolska-Orłowska, Krystyna; Głuszko, Piotr

    2016-01-01

    Adipose tissue exerts widespread effects on the metabolism and immune system, but its activity differs between the genders. In the general population low-grade adipose tissue inflammation contributes to development of diseases of affluence. Little is known about the systemic impact of peripheral fat tissue in osteoarthritis (OA) and rheumatoid arthritis (RA), characterized by chronic, low- and high-grade systemic inflammation, respectively. To clarify this we evaluated the secretory activity of subcutaneous abdominal adipose tissue (SAAT) obtained from male patients affected with RA (n = 21) and OA (n = 13), and assessed its association with body mass and composition, demographic, clinical and laboratory data. Basal and interleukin (IL)-1β-triggered secretion of selected adipocytokines from SAAT explants was measured by specific enzyme-linked immunosorbent assays (ELISA). Patients' body composition was evaluated by bioelectric impendence technique. Rheumatoid SAAT secreted more adiponectin and macrophage migration inhibitory factor (MIF) than respective osteoarthritis tissue. In both RA and OA patient groups, stimulation of SAAT explants with IL-1β (1 ng/ml/100 mg tissue) significantly up-regulated release of pro-(IL-6, IL-8, tumor necrosis factor - TNF) and anti-inflammatory (IL-10) cytokines but had no effect on the secretion of adiponectin, leptin, MIF and hepatocyte growth factor (HGF). Compared with RA, patients with OA were more obese. In RA patients SAAT-released adiponectin and TNF inversely correlated with body mass index (BMI) and visceral fat rating (FVSC). In addition, SAAT-secreted adiponectin and leptin positively correlated with DAS28 and disease duration, respectively. In the OA group tissue-released TNF positively correlated with patients' age. We conclude that in RA male patients adipocytokines originating from SAAT are of clinical importance because: (i) adiponectin and TNF may contribute to maintenance of normal body composition and mass, (ii

  14. Periadventitial atRA citrate-based polyester membranes reduce neointimal hyperplasia and restenosis after carotid injury in rats.

    Science.gov (United States)

    Gregory, Elaine K; Webb, Antonio R; Vercammen, Janet M; Flynn, Megan E; Ameer, Guillermo A; Kibbe, Melina R

    2014-11-15

    Oral all-trans retinoic acid (atRA) has been shown to reduce the formation of neointimal hyperplasia; however, the dose required was 30 times the chemotherapeutic dose, which already has reported side effects. As neointimal formation is a localized process, new approaches to localized delivery are required. This study assessed whether atRA within a citrate-based polyester, poly(1,8 octanediolcitrate) (POC), perivascular membrane would prevent neointimal hyperplasia following arterial injury. atRA-POC membranes were prepared and characterized for atRA release via high-performance liquid chromatography with mass spectrometry detection. Rat adventitial fibroblasts (AF) and vascular smooth muscle cells (VSMC) were exposed to various concentrations of atRA; proliferation, apoptosis, and necrosis were assessed in vitro. The rat carotid artery balloon injury model was used to evaluate the impact of the atRA-POC membranes on neointimal formation, cell proliferation, apoptosis, macrophage infiltration, and vascular cell adhesion molecule 1 (VCAM-1) expression in vivo. atRA-POC membranes released 12 μg of atRA over 2 wk, with 92% of the release occurring in the first week. At 24 h, atRA (200 μmol/l) inhibited [(3)H]-thymidine incorporation into AF and VSMC by 78% and 72%, respectively (*P = 0.001), with negligible apoptosis or necrosis. Histomorphometry analysis showed that atRA-POC membranes inhibited neointimal formation after balloon injury, with a 56%, 57%, and 50% decrease in the intimal area, intima-to-media area ratio, and percent stenosis, respectively (P = 0.001). atRA-POC membranes had no appreciable effect on apoptosis or proliferation at 2 wk. Regarding biocompatibility, we found a 76% decrease in macrophage infiltration in the intima layer (P atRA-POC membranes, with a coinciding 53% reduction in VCAM-1 staining (P atRA inhibited neointimal formation and restenosis. These data suggest that atRA-POC membranes may be suitable as localized therapy to inhibit

  15. The experimental treatment of corneal graft rejection with the interleukin-1 receptor antagonist (IL-1ra gene.

    Directory of Open Access Journals (Sweden)

    Jin Yuan

    Full Text Available PURPOSE: To investigate the protective effects of interleukin-1 receptor antagonist (IL-1ra gene transfer in a rat model of corneal graft rejection. METHODS: We constructed a recombinant plasmid (pcDNA3.1-hIL-1ra with high IL-1ra expression in eukaryotic cells. Using a Wistar-SD rat model of corneal graft rejection, we examined the effects of IL-1ra in vivo after cationic polymer jetPEI-mediated nonviral gene delivery. Four groups were included: negative controls (group I, n = 20, pcDNA3.1-hIL-1ra corneal stromal injection (group II, n = 34, pcDNA3.1-hIL-1ra anterior chamber injection (group III, n = 34, and 500 µg/ml IL-1ra protein subconjunctiva injection (group IV, n = 20. IL-1ra expression after transfection was evaluated by real-time polymerase chain reaction (RT-PCR and western blotting. The rejection indices of corneal grafts were analysed in the different groups. The expression levels of transforming growth factor β1 (TGF-β1, inflammatory chemokines including RANTES, interleukin-1 (IL-1 and the numbers of CD4+ and CD8+ T cells in the grafts were determined by biochemical assays at different time points after corneal transplantation. RESULTS: Various degrees of inflammatory cell infiltration and graft neovascularisation were observed by histopathology. After injecting the pcDNA3.1-hIL-1ra plasmid into the cornea, IL-1ra mRNA and protein expression was detected in the corneal stroma and reached a peak on day 3. The graft survival curves indicated that the corneal transparency rates of grafts in the IL-1ra gene-treated group and the IL-1ra protein-treated group were higher compared with the untreated group (P<0.05. During the period of acute rejection, TGF-β1, RANTES, IL-1α and IL-1β levels in the grafts in the IL-1ra treatment groups were lower than the control group (P<0.05. CD4+ and CD8+ T cell counts were reduced significantly in the corneal grafts of groups II, III and IV compared with group I (P<0.05. CONCLUSION

  16. Long-lived natural Ra isotopes in mineral, therapeutic and spring waters in Caxambu, Minas Gerais state, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Negrao, Sergio Garcia; Oliveira, Joselene de [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Laboratorio de Radiometria Ambiental. Gerencia de Metrologia das Radiacoes

    2011-07-01

    In many countries all around the world, there is an increasing tendency to replace surface drinking water by commercially available bottled mineral water from different springs for consumption purposes. These practices involve an increased risk of finding higher activities of natural radionuclides in such waters, predominantly of the uranium-radium decay series. Naturally occurring radionuclides such as {sup 238}U, {sup 226}Ra, {sup 222}Rn, {sup 210}Po and {sup 228}Ra are found frequently dissolved in water supplies and their concentrations vary over an extremely wide range. However, from the point of view of radiation hygiene, results of many worldwide surveys indicate that only {sup 222}Rn, {sup 226}Ra and {sup 228}Ra have been found in concentrations that may be of health concern. {sup 226}Ra and {sup 228}Ra are the most radiotoxic isotopes of radium due to their long half-lives, 1,600 and 5.75 years, respectively. Since their chemical behavior is similar to that of calcium, radium isotopes tend to accumulate mostly in the skeleton after ingestion. For the purposes of this study, samples of mineral spring water were taken in Caxambu, a thermal resort located in the extreme south of Minas Gerais, 370 km south of Belo Horizonte. Caxambu is renowned by its waterpark, which has twelve sources of mineral water already being used in treatment of stomach, liver and kidney diseases, between others. {sup 226}Ra activity concentrations varied from 83 to 3,599 mBq L-1, the highest value determined at Venancio spring. Activity concentrations of {sup 228}Ra ranged from 69 to 4,481 mBq L-1. {sup 228}Ra/ {sup 226}Ra activity ratios varied from 0.079 to 4.2. (author)

  17. The WMO RA VI Regional Climate Centre Network - a support to users in Europe

    Science.gov (United States)

    Rösner, S.

    2012-04-01

    Climate, like weather, has no limits. Therefore the World Meteorological Organization (WMO), a specialized United Nations organization, has established a three-level infrastructure to better serve its member countries. This structure comprises Global Producing Centres for Long-range Forecasts (GPCs), Regional Climate Centres (RCCs) and National Meteorological or Hydrometeorological Services (NMHSs), in most cases representing their countries in WMO governance bodies. The elements of this infrastructure are also part of and contribute to the Global Framework for Climate Services (GFCS) agreed to be established by World Climate Conference 3 (WCC-3) and last year's Sixteenth World Meteorological Congress (WMO Cg-XVI). RCCs are the core element of this infrastructure at the regional level and are being establish in all WMO Regional Associations (RAs), i.e. Africa (RA I); Asia (II); South America (III); North America, Central America and the Caribbean (IV); South-West Pacific (V); Europe (VI). Addressing inter-regional areas of common interest like the Mediterranean or the Polar Regions may require inter-regional RCCs. For each region the RCCs follow a user driven approach with regard to governance and structure as well as products generated for the users in the respective region. However, there are common guidelines all RCCs do have to follow. This is to make sure that services are provided based on best scientific standards, are routinely and reliably generated and made available in an operational mode. These guidelines are being developed within WMO and make use of decade-long experience gained in the business of operational weather forecast. Based on the requirements of the 50 member countries of WMO RA VI it was agreed to establish the WMO RCC as a network of centres of excellence that create regional products including long-range forecasts that support regional and national climate activities, and thereby strengthen the capacity of WMO Members in the region to

  18. Stimulation of tissue-type plasminogen activator expression by retinoic acid in human endothelial cells requires retinoic acid receptor beta 2 induction.

    Science.gov (United States)

    Lansink, M; Kooistra, T

    1996-07-15

    We previously showed the involvement of retinoic acid receptor alpha (RAR alpha) in the induction of tissue-type plasminogen activator (t-PA) synthesis by RA in human umbilical vein endothelial cells (HUVECs). However, the rather slow onset of this induction of t-PA synthesis suggested an indirect role of RAR alpha. Here, we show that the protein synthesis inhibitor, cycloheximide completely blocks the induction of t-PA by RA, which points to the need of an intermediary protein in t-PA stimulation. This intermediary protein is likely to be RAR beta 2 on the basis of the following findings: (1) the induction of RAR beta by RA exactly precedes that of t-PA; (2) HUVECs with elevated RAR beta mRNA levels show an undelayed t-PA induction on stimulation with RA, and this response can be almost completely inhibited with an RAR antagonist; and (3) an antisense oligodeoxynucleotide against the translation initiation site of RAR beta 2 mRNA greatly reduces the t-PA induction by RA. Thus, induction of t-PA by RA in HUVECs involves a 2-step mechanism requiring induction of RAR beta 2 via RAR alpha, followed by induction of t-PA synthesis via RAR beta 2. Each of these steps is shown to have a different activation profile with RA and 9 cis RA.

  19. PACKAGING WASTE MANAGEMENT ON EXAMPLE OF CITY ZIELONA GÓRA

    Directory of Open Access Journals (Sweden)

    Joanna ZARĘBSKA

    2012-01-01

    Full Text Available The article presents the legal requirements of the European Union's packaging waste, and their most recent transposition into Polish law. The author has attempted to describe selected achievements of the Department of Public Utilities and Housing (DPUaH in Zielona Góra, which for many years on behalf of the city, in a systematic way it’s developing municipal waste management system (including packaging, consistent with EU policies and objectives of sustainable development. The deficiencies and weaknesses in the system are taken into consideration, whose liquidation is a priority for future investment of DPUaH consistent with the Waste Management Plan for the City of Zielona Góra.

  20. Olivier Caïra, Jeux de rôle. Les forges de la fiction

    Directory of Open Access Journals (Sweden)

    Antoine Dauphragne

    2010-06-01

    Full Text Available Les forges de la fiction, d’Olivier Caïra, est à ranger parmi les rares ouvrages francophones en sciences humaines s’attachant au jeu de rôles. L’ouvrage en propose une analyse fine et dynamique centrée sur la pratique des joueurs. La démarche annoncée, qui entend proposer un texte accessible aussi bien aux rôlistes qu’aux universitaires, semble renvoyer autant à un souci de clarté qu’au profil de l’auteur. Olivier Caïra est sociologue ; ses travaux portent sur l’industrie du divertissement e...

  1. Făgăraș as Jerusalem? Interethnic and interreligious ethos in Transylvania

    Directory of Open Access Journals (Sweden)

    Toroczkai C. Iulian

    2017-02-01

    Full Text Available The study presents Transylvania as a space of ethnic-religious tolerance, having as a case studythe image of the town Făgăraș, as depicted in Eginald Schlattner’s novels. This space appearsas one of a heavenly nuance, based on a long tradition of coexistence of the members ofdifferent ethnic groups and religions. However, the inter-war and post-war period means theemergence of new challenges posed by the confrontation with the harmful effects of the twoideologies: Nazism and Communism. In this way, the dramas of the socio-historical contextinterweave with elements forming young Eginald. They will remain a constant in the writer’slife, offering Făgăraș the role of a forming educational array, with a paradigmatic value.

  2. Komparasi Manajemen Desain Lingkungan Pendidikan Anak Usia Dini di TK Ceria Timoho dan RA Sahabat Berbah

    Directory of Open Access Journals (Sweden)

    Lailatu Rohmah

    2016-12-01

    Full Text Available At an institute of PAUD one of management that is important to be attentive is management design environment either a design the interior/indoor and outdoor/exterior. It is considering this institution is the protege on children in the golden age is the most rapid development of the brain. The kind of research this is qualitative and the data collection by interviews, documentation, and observation. Data analysis with a groove the reduction of the data, display data, and verification/conclusion. The results of research shows the management of environmental design early childhood education in TK Ceria and RA Sahabat been through the process of good management the planning, organizing, actuating and controlling. The environment for early childhood education facilities indoor and outdoor in TK Ceria had been optimal. RA Sahabat in learning more from the environment as a source of learning.

  3. Parasitismo em bovinos de raças de carne e brava no concelho de Coruche

    OpenAIRE

    Crespo, Maria Virgínia; Mariano, Pedro; Fernanda ROSA

    2013-01-01

    Entre março e maio de 2007 efetuou-se um estudo parasitológico em efetivos bovinos de raças de Carne e Brava do Concelho de Coruche, visando a determinação das principais helmintoses presentes. Colheram-se 206 amostras de fezes em explorações bovinas de carne e 30 em explorações de raça brava. As amostras foram sujeitas a análises coprológicas, com base em métodos qualitativos e quantitativos (técnicas de Willis, de sedimentação e de McMaster). Procedeu-se também à prospeção...

  4. Racismo na Índia? Cor, raça e casta em contexto

    OpenAIRE

    Hofbauer, Andreas

    2015-01-01

    Cor e raça estão entre as categorias-chave mais comuns usadas nos estudos sobre o fenômeno do racismo no mundo ocidental. Quando se fala em discriminação na Índia, o termo casta é aquele ao qual é geralmente atribuído maior poder explicativo. A análise de dois casos específicos - os dalits e os siddis (descendentes de escravos africanos radicados no estado de Karnataka) - revela diversas inter-relações e entrelaçamentos na construção, delimitação e transformação das categorias raça e casta - ...

  5. Measurements of octupole collectivity in Rn and Ra nuclei using Coulomb excitation

    CERN Multimedia

    We propose to exploit the unique capability of HIE-ISOLDE to provide post-accelerated $^{221,222}$Rn and $^{222,226,228}$Ra ion beams for the study of octupole collectivity in these nuclei. We will measure E3 transition moments in $^{222}$Rn and $^{222,226,228}$Ra in order to fully map out the variation in E3 strength in the octupole mass region with Z$\\thicksim$88 and N$\\thicksim$134. This will validate model calculations that predict different behaviour as a function of N. We will also locate the position of the parity doublet partner of the ground state in $^{221}$Rn, in order to test the suitability of odd-A radon isotopes for EDM searches.

  6. FLIR/INS/RA Integrated Landing Guidance for Landing on Aircraft Carrier

    Directory of Open Access Journals (Sweden)

    Zhenxing Ding

    2015-05-01

    Full Text Available This paper presents a FLIR/INS/RA integrated landing guidance method to provide information of aircraft states and carrier dynamics for fixed-wing aircraft landing on the aircraft carrier in low-visibility weather and high sea states. The method utilizes the Forward-Looking Infrared (FLIR system, the Inertial Navigation System (INS, and the Radio Altimeter (RA as sensors, to track infrared cooperated targets on the aircraft carrier. Several algorithms like the Newton iterative algorithm, the Kalman Filter (KF, and the Wavelet Transform (WT are employed to compute real-time and high-precision estimates of the aircraft states (runway-related position, attitude, and velocity and the carrier dynamics (pitch, roll, and heave. A simulation experiment is conducted and shows satisfactory results for the aircraft carrier landing guidance.

  7. Precise Study of Fine Structure in $^{14}$C Emission from $^{223}$Ra

    CERN Multimedia

    2002-01-01

    We request 10 shifts in two sessions of beam time at ISOLDE for the production of a $^{223}$Ra source. This source will be used with the superconducting spectrometer SOLENO at Orsay for a precise measurement (good statistics and energy resolution) of the fine stucture in the energy spectrum of $^{14}$C nuclei emitted by $^{223}$Ra, discovered at Orsay in July 1989. The measurement will be devoted to carry out the hindrance factors of the transitions to 15$\\!^-\\!$/2$\\,$ (1.423 MeV) and 5$\\!^+\\!$/2$\\,$ (1.567 MeV) excited states of $^{209}$Pb, which present a particular interest for obtaining spectroscopic information and testing nuclear models.

  8. Fully automated joint space width measurement and digital X-ray radiogrammetry in early RA.

    Science.gov (United States)

    Platten, Michael; Kisten, Yogan; Kälvesten, Johan; Arnaud, Laurent; Forslind, Kristina; van Vollenhoven, Ronald

    2017-01-01

    To study fully automated digital joint space width (JSW) and bone mineral density (BMD) in relation to a conventional radiographic scoring method in early rheumatoid arthritis (eRA). Radiographs scored by the modified Sharp van der Heijde score (SHS) in patients with eRA were acquired from the SWEdish FarmacOTherapy study. Fully automated JSW measurements of bilateral metacarpals 2, 3 and 4 were compared with the joint space narrowing (JSN) score in SHS. Multilevel mixed model statistics were applied to calculate the significance of the association between ΔJSW and ΔBMD over 1 year, and the JSW differences between damaged and undamaged joints as evaluated by the JSN. Based on 576 joints of 96 patients with eRA, a significant reduction from baseline to 1 year was observed in the JSW from 1.69 (±0.19) mm to 1.66 (±0.19) mm (p0) joints: 1.68 mm (95% CI 1.70 to 1.67) vs 1.54 mm (95% CI 1.63 to 1.46). Similarly the unadjusted multilevel model showed significant differences in JSW between undamaged (1.68 mm (95% CI 1.72 to 1.64)) and damaged joints (1.63 mm (95% CI 1.68 to 1.58)) (p=0.0048). This difference remained significant in the adjusted model: 1.66 mm (95% CI 1.70 to 1.61) vs 1.62 mm (95% CI 1.68 to 1.56) (p=0.042). To measure the JSW with this fully automated digital tool may be useful as a quick and observer-independent application for evaluating cartilage damage in eRA. NCT00764725.

  9. Final Report Ra Power Management 1255 10-15-16 FINAL_Public

    Energy Technology Data Exchange (ETDEWEB)

    Iverson, Aaron [Ra Power Management, Inc., Oakland, CA (United States)

    2016-09-30

    Ra Power Management (RPM) has developed a cloud based software platform that manages the financial and operational functions of third party financed solar projects throughout their lifecycle. RPM’s software streamlines and automates the sales, financing, and management of a portfolio of solar assets. The software helps solar developers automate the most difficult aspects of asset management, leading to increased transparency, efficiency, and reduction in human error. More importantly, our platform will help developers save money by improving their operating margins

  10. Final Report Ra Power Management 1255 10-15-16 FINAL_Public

    Energy Technology Data Exchange (ETDEWEB)

    Iverson, Aaron [Ra Power Management, Inc., Oakland, CA (United States)

    2016-10-12

    Ra Power Management (RPM) has developed a cloud based software platform that manages the financial and operational functions of third party financed solar projects throughout their lifecycle. RPM’s software streamlines and automates the sales, financing, and management of a portfolio of solar assets. The software helps solar developers automate the most difficult aspects of asset management, leading to increased transparency, efficiency, and reduction in human error. More importantly, our platform will help developers save money by improving their operating margins

  11. Different behaviours of promoters in Mycobacterium tuberculosis H37Rv and H37Ra.

    Science.gov (United States)

    Dokladda, Kanchana; Billamas, Pamaree; Palittapongarnpim, Prasit

    2015-02-01

    Mycobacterium tuberculosis H37Rv and H37Ra are two closely-related bacterial strains in which the former is virulent whereas the latter is not. Although the genetic differences between these strains are known, our understanding of how they control the difference in virulence characteristics is incomplete. In this work, we tested the activities of different mycobacterium gene promoters in the two strains using a gfp reporter gene. The promoter activities were compared between growth in vitro and growth of bacteria residing in U937 cells (a-macrophage-like cell line). The promoters tested included M. tuberculosis isocitrate lyase (icl), alpha crystalline homolog (hspX) and moeZ, and the M. avium macrophage-induced gene (mig) promoter. Two hspX constructs with different lengths of the promoter sequence were tested. All promoters except the shorter hspX construct were active in the H37Ra strain in both liquid culture and in U937 cells. In the H37Rv strain, the shorter hspX and icl constructs were induced in infected U937 cells relative to liquid culture, whereas the mig construct was active in both conditions. In conclusion, the inducible properties of the shorter hspX and the icl promoters evident in H37Rv appeared to be lost in the H37Ra strain. Furthermore, sequence further upstream of the hspX gene appears to modulate the inducible property of the hspX promoter in a strain-dependent manner.

  12. Adsorption of {sup 241}Am and {sup 226}Ra from natural water by wood charcoal

    Energy Technology Data Exchange (ETDEWEB)

    Miro, C. [Departamento de Fisica Aplicada, Facultad de Veterinaria, Universidad de Extremadura, Avda. de la Universidad s/n, 10071 Caceres (Spain)], E-mail: cmiro@unex.es; Baeza, A.; Salas, A. [Departamento de Fisica Aplicada, Facultad de Veterinaria, Universidad de Extremadura, Avda. de la Universidad s/n, 10071 Caceres (Spain); Pastor-Valle, J.F.; Pastor-Villegas, J. [Departamento de Quimica Organica e Inorganica Facultad de Formacion del Profesorado, Universidad de Extremadura, Avda. de la Universidad s/n, 10071 Caceres (Spain)

    2008-01-15

    The adsorption of {sup 241}Am and {sup 226}Ra from natural water by a granulated wood charcoal was investigated as a function of the solution pH, in the range 4-10, and of the water flow, in the range 3.5-42 cm{sup 3}/min. The percentage adsorption of {sup 241}Am (fairly constant at >80% for all pHs) was greater than that of {sup 226}Ra (which increased with increasing pH from {approx}40% up to >80%). The results are explained by considering the different species of each radionuclide present at the pH values of the solution at the end of the adsorbent column, and the pH of the point of zero charge of the adsorbent. At pH 6, the elimination of {sup 241}Am from natural water was independent of the water flow, while the elimination of {sup 226}Ra declined linearly as the flow rate was increased.

  13. [The life and work of Zaíra Cintra Vidal].

    Science.gov (United States)

    Lopes, G T; Caldas, N P; Lima, T C; Martingil, I C

    2001-01-01

    This is a social-historical study that aims at describing the trajectory of Zaíra Cintra Vidal, her participation in the Nursing School Rachel Haddock Lobo and in the Brazilian Association of Nursing (ABEn). The study is based on the concepts of symbolic power, habitus and symbolic struggle of Pierre Bourdieu. The primary sources are documents which were collected in the Documentation Center of Escola de Enfermagem Ana Neri (EEAN--Ana Neri School of Nursing) in the Federeal University of Rio de Janeiro (UFRJ) and at the Memory Center of the Faculty of Nursing (FENF) in the State University of Rio de Janeiro (UERJ). The data was collected between August 2000 and April 2001 by means of document analysis script. The outcomes showed that Zaíra Cintra Vidal was born on 5 May 1903; graduated from the Nursing School of the National Public Health Department in 1926; studied and post-graduated in the United States from 1927 until 1929 and returned to Brazil in 1943. Zaíra Cintra Vidal was the founder of the Nursing School Rachel Haddock Lobo and was its first director for nine years. She also and took part in ABEn's Direction Board and in the Revista Anais de Enfermagem (Nursing Magazine).

  14. Strategic planning for MyRA performance: A causal loop diagram approach

    Science.gov (United States)

    Abidin, Norhaslinda Zainal; Zaibidi, Nerda Zura; Karim, Khairah Nazurah

    2017-10-01

    The nexus of research and innovation in higher education are continually receiving worldwide priority attention. Hence, Malaysia has taken its move to enhance public universities as a center of excellence by introducing the status of Research University (RU). To inspire all universities towards becoming a research university, The Ministry of Higher Education (MoHE) had revised an assessment called Malaysian Research Assessment Instrument (MyRA) to evaluate the performance of existence RUs, and other potential higher education institutions. The available spreadsheet tool to access MyRA performance is inadequate to support strategic planning. Since, higher education management is a complex system, in which components and their interactions are ever changing over time, there is a need to for an efficient approach to investigate system behavior and devise research management policies for the benefit of the institution itself and the higher education system. In this paper, we proposed a system dynamics simulation model to evaluate the impact of policies for obtaining the highest performance in MyRA assessment. Causal loop diagram is developed to investigate the relationship of various elements in research management, their inter-relationship that link together and their evolution of behavior over time.

  15. [Automatization of colorimetric serum zinc determination using the Bayer RA 1000 autoanalyzer].

    Science.gov (United States)

    Shum-Cheong-Sing, J; Arnaud, J; Favier, A

    1994-01-01

    A colorimetric method for the determination of zinc in serum was adapted for use with the Bayer RA 1000 autoanalyzer. Zinc is dissociated from proteins by guanidinium hydrochloride and complexed with 2-(5-bromo-2-pyridylazo)-5-(N-propyl-N- sulfopropylamino-)phenol (5-Br-PAPS). Precision (within-run CVs from 1.4 to 4.2%; between-run CVs from 3.5 to 8.1%), accuracy (93 to 103%) and detection limit (1.15 mumol/l) were sufficient for routine determinations. Moreover, results obtained with the proposed Bayer RA 1000 method were in good agreement with those obtained by flame atomic absorption spectrometry (FAAS) which could be considered the reference method. For 119 sera, the correlation coefficient r was found to be 0.958 and the regression line was as follows: serum zinc (RA 1000) = 0.96 serum zinc (FAAS) + 0.8 mumol/l. Moreover, 98% of the differences between colorimetry and FAAS were within the range Md +/- 1.96 SDd, where Md is the mean of the differences and SDd is the standard deviation of the differences.

  16. Movimento negro e educação: ressignificando e politizando a raça

    Directory of Open Access Journals (Sweden)

    Nilma Lino Gomes

    2012-09-01

    Full Text Available Este artigo discute o papel do movimento negro brasileiro na ressignificação e politização da ideia de raça. A raça é aqui entendida como construção social que marca, de forma estrutural e estruturante, as sociedades latino-americanas, em especial, a brasileira. Ao refletir sobre a atuação do movimento negro, parte-se da premissa de que este movimento social, por meio de suas ações políticas, sobretudo em prol da educação, reeduca a si próprio, o Estado, a sociedade e o campo educacional sobre as relações étnico-raciais no Brasil, caminhando rumo à emancipação social. A ideia de raça analisada no presente artigo se assenta na reflexão realizada pelos estudos pós-coloniais, que discutem a sua centralidade nos países com passado colonial e a sua operacionalidade nas relações de poder, as quais têm sido mantidas e subsistem no pensamento moderno ocidental, inclusive, no educacional.

  17. Machine Vision System for Characterizing the Electric Field for the 225 Ra EDM Experiment

    Science.gov (United States)

    Sanchez, Andrew

    2017-09-01

    If an atom or fundamental particle possesses an electric dipole moment (EDM), that would imply time-reversal violation. At our current capability, if an EDM is detected in such a particle, that would suggest the discovery of beyond the standard model (BSM) physics. The unique structure of 225 Ra makes its atomic EDM favorable in the BSM search. An upgraded Ra-EDM apparatus will increase experimental sensitivity and the target electric field of 150 kV/cm will more than double the electric field used in previous experiments. To determine the electric field, the potential difference and electrode separation distance must be known. The optical method I have developed is a high-precision, non-invasive technique to measure electrode separation without making contact with the sensitive electrode surfaces. A digital camera utilizes a bi-telecentric lens to reduce parallax error and produce constant magnification throughout the optical system, regardless of object distance. A monochrome LED backlight enhances sharpness of the electrode profile, reducing uncertainty in edge determination and gap width. A program utilizing an edge detection algorithm allows precise, repeatable measurement of the gap width to within 1% and measurement of the relative angle of the electrodes. This work (SAM, Ra EDM) is supported by Michigan State University. This work (REU Program) is supported by U.S. National Science Foundation under Grant Number #1559866.

  18. Ultra-traces of 226Ra in nylon used in the BOREXINO solar neutrino experiment

    Science.gov (United States)

    Zuzel, G.; Wójcik, M.; Buck, C.; Rau, W.; Heusser, G.

    2003-02-01

    BOREXINO is a large-scale liquid scintillator detector for solar neutrinos with a low expected event rate, therefore requiring an extremely low radioactive background. In this paper we present a method, which makes it possible to measure the surface and bulk activities of 226Ra in thin nylon foils for use in BOREXINO at unprecedented concentration levels, as low as 0.5 μBq/m 2 and 10 μBq/kg, respectively. It is based on high-sensitivity 222Rn emanation detection, taking advantage of the fact that the permeability of nylon for radon is strongly enhanced in the presence of water. A mathematical diffusion model is outlined to distinguish the surface and bulk activity of 226Ra from the 222Rn emanation rates of dry and wet film. The experimental method is described in connection with screening measurements of nylon foils of different origin. One foil could be identified with a low 226Ra contamination (corresponding to ˜10 -12 g/g 238U-equivalent) for application in BOREXINO. This film will be used for the construction of a liquid scintillator containment vessel as the central part of the BOREXINO solar neutrino detector.

  19. IL-17RA Signaling in Airway Inflammation and Bronchial Hyperreactivity in Allergic Asthma.

    Science.gov (United States)

    Willis, Cynthia R; Siegel, Lori; Leith, Anh; Mohn, Deanna; Escobar, Sabine; Wannberg, Sharon; Misura, Kira; Rickel, Erika; Rottman, James B; Comeau, Michael R; Sullivan, John K; Metz, Daniela P; Tocker, Joel; Budelsky, Alison L

    2015-12-01

    Asthma is a heterogeneous disease characterized by airway inflammation and hyperreactivity. IL-17 receptor A (IL-17RA) is a shared receptor subunit required for activity of IL-17 family cytokines, including IL-17A and IL-25. IL-17A and IL-25 induce different proinflammatory responses, and concentrations are elevated in subjects with asthma. However, the individual contributions of IL-17A and IL-25 to disease pathogenesis are unclear. We explored proinflammatory activities of the IL-17 pathway in models of pulmonary inflammation and assessed its effects on contractility of human bronchial airway smooth muscle. In two mouse models, IL-17RA, IL-17RB, or IL-25 blockade reduced airway inflammation and airway hyperreactivity. Individually, IL-17A and IL-25 enhanced contractility of human bronchial smooth muscle induced by methacholine or carbachol. IL-17A had more pronounced effects on methacholine-induced contractility in bronchial rings from donors with asthma compared with donors without asthma. Blocking the IL-17 pathway via IL-17RA may be a useful therapy for some patients with asthma by reducing pulmonary inflammation and airway hyperreactivity.

  20. Short and long term bystander effect induction by fathead minnows (Pimephales promelas, Rafinesque, 1820) injected with environmentally relevant whole body doses of 226Ra.

    Science.gov (United States)

    Smith, Richard W; Seymour, Colin B; Mothersill, Carmel E

    2013-12-01

    Bystander effect induction by fathead minnows injected with environmentally relevant doses of (226)Ra was investigated. Twenty four h and 6 months after injection with a single dose of 21, 210 or 2100 μBq, fin tissue samples emitted a pro-apoptotic signal, which reduced the clonogenic survival of an apoptosis sensitive reporter cell line. Twenty four h and 10 weeks after injection explants from non-injected bystander fish, swum with the injected fish, also emitted a pro-apoptotic signal. However 6 months after injection the bystander fish to 21 and 210 μBq injected fish emitted an anti-apoptotic signal. This demonstrates that extremely low dose irradiation can have effects outside of the irradiated fish. This has implications for population and ecosystem responses to contamination. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. Shared care or nurse consultations as an alternative to rheumatologist follow-up for rheumatoid arthritis (RA) outpatients with stable low disease-activity RA

    DEFF Research Database (Denmark)

    Sørensen, Jan; Primdahl, J; Horn, Hc

    2014-01-01

    Objectives: To compare the cost-effectiveness of three types of follow-up for outpatients with stable low-activity rheumatoid arthritis (RA). Method: In total, 287 patients were randomized to either planned rheumatologist consultations, shared care without planned consultations, or planned nurse......-effectiveness rates (ICERs) were estimated in comparison with rheumatologist consultations. Results: Changes in disease activity, functional status, and health-related quality of life were not statistically significantly different for the three groups, although the mean scores were better for the shared care...... and nurse care groups compared with the rheumatologist group. Shared care and nurse care were non-significantly less costly than rheumatologist care. As both shared care and nurse care were associated with slightly better EQ-5D improvements and lower costs, they dominated rheumatologist care. At EUR 10 000...

  2. Uptake of Ra during the recrystallization of barite: a microscopic and time of flight-secondary ion mass spectrometry study.

    Science.gov (United States)

    Klinkenberg, Martina; Brandt, Felix; Breuer, Uwe; Bosbach, Dirk

    2014-06-17

    A combined macroscopic and microanalytical approach was applied on two distinct barite samples from Ra uptake batch experiments using time of flight-secondary ion mass spectrometry (ToF-SIMS) and detailed scanning electron microscopy (SEM) investigations. The experiments were set up at near to equilibrium conditions to distinguish between two possible scenarios for the uptake of Ra by already existent barite: (1) formation of a Ba1-xRaxSO4 solid solution surface layer on the barite or (2) a complete recrystallization, leading to homogeneous Ba1-xRaxSO4 crystals. It could be clearly shown that Ra uptake in all barite particles analyzed within this study is not limited to the surface but extends to the entire solid. For most grains a homogeneous distribution of Ra could be determined, indicating a complete recrystallization of barite into a Ba1-xRaxSO4 solid solution. The maxima of the Ra/Ba intensity ratio distribution histograms calculated from ToF-SIMS are identical with the expected Ra/Ba ratios calculated from mass balance assuming a complete recrystallization. In addition, the role of Ra during the recrystallization of barite was examined via detailed SEM investigations. Depending on the type of barite used, an additional coarsening effect or a strong formation of oriented aggregates was observed compared to blank samples without Ra. In conclusion, the addition of Ra to a barite at close to equilibrium conditions has a major impact on the system leading to a fast re-equilibration of the solid to a Ba1-xRaxSO4 solid solution and visible effects on the particle size distribution, even at room temperature.

  3. (223)Ra-dichloride spectrometric characterization: Searching for the presence of long-lived isotopes with radiological protection implications.

    Science.gov (United States)

    Sánchez-Jiménez, J; López-Montes, A; Núñez-Martínez, L; Villa-Abaunza, A; Fraile, L M; Sánchez-Tembleque, V; Udías, J M

    2017-03-01

    (223)Ra-dichloride was approved with the commercial name of Xofigo in 2014 for treatment of metastatic castration-resistant prostate cancer. (223)Ra is obtained by neutron irradiation of (226)Ra yielding (227)Ac, which decays to (227)Th and (223)Fr, both decaying to (223)Ra. Since (223)Ra is predominantly (95.3%) an alpha emitter with a 11.42days long half-life, the radiopharmaceutical, its remnants, the patient, and waste material can be managed and disposed with low radiation protection requirements. (227)Ac is a long-lived (T1/2=21.77years) beta emitter that demands strong radiation protection measures. In particular waste disposal has to follow the International Atomic Energy Agency (IAEA) and European Commission (EC) regulations. Since (227)Ac is involved in the production of (223)Ra, an impurity analysis of each batch is required after production. Due to time restrictions, the manufacturer's detection limit (<0.001%) exceeds the one required to assure that (227)Ac concentrations are below direct disposal levels. To improve the detection limit, long-term accurate spectroscopy is required. Alpha and gamma spectroscopy measurements were carried out at the Complutense University Nuclear Physics Laboratory. After twelve months follow up of a sample, (227)Ac concentration was found to be smaller than 10(-9). This allows for direct waste disposal and no additional radiation protection restrictions than those required for (223)Ra. The presence of contamination by other radioisotopes was also ruled out by this experiment. Specifically (226)Ra, involved in (223)Ra production as the original parent and with a very long-lived (T1/2=1577years) alpha emitter, was also below the experimental detection limit. Copyright © 2017 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.

  4. Adiponectin aggravates bone erosion by promoting osteopontin production in synovial tissue of rheumatoid arthritis.

    Science.gov (United States)

    Qian, Jie; Xu, Lingxiao; Sun, Xiaoxuan; Wang, Yani; Xuan, Wenhua; Zhang, Qian; Zhao, Pengfei; Wu, Qin; Liu, Rui; Che, Nan; Wang, Fang; Tan, Wenfeng; Zhang, Miaojia

    2018-02-08

    We have previously reported that adiponectin (AD), an adipokine that is secreted by adipocytes, correlates well with progressive bone erosion in rheumatoid arthritis (RA). The exact mechanism of AD in promoting joint destruction remains unclear. Osteopontin (OPN) is required for osteoclast recruitment. We hypothesized that AD exacerbates bone erosion by inducing OPN expression in synovial tissue. This study aimed to evaluate a novel role for AD in RA. The serum levels of AD and OPN were determined in 38 patients with RA, 40 patients with osteoarthritis (OA), and 20 healthy controls using enzyme-linked immunosorbent assay (ELISA). AD and OPN production were measured by double immunofluorescence in RA and OA synovial tissue. Quantitative real-time PCR and immunofluorescence were used to evaluate the mRNA and protein expression levels of OPN in RA synovial fibroblasts (RASFs) and OA synovial fibroblasts after pre-incubation with AD, respectively. Migration of the RAW264.7 osteoclast precursor cell line was assessed using the Transwell migration assay and co-culture system. Bone destruction and osteoclastogenesis were assessed by immunohistochemical staining, microcomputed tomography and tartrate-resistant acid phosphatase (TRAP) staining in AD-treated collagen-induced arthritis (CIA) mice with or without OPN silencing. The expression levels of OPN and integrin α v β 3 in the ankle joint tissues of the mice were examined by double immunofluorescence. Our results indicated that the AD and OPN expression levels increased noticeably and were associated with each other in the RA serum. The AD distribution was coincident with that of OPN in the RA synovial tissue. AD stimulation of RASFs increased OPN production in a dose-dependent manner. AD-treated RASFs promoted RAW264.7 cell migration, and the effect was blocked with a specific antibody against OPN. Silencing of OPN using lentiviral-OPN short hairpin RNA reduced the number of TRAP-positive osteoclasts and the extent

  5. Concentrations and environmental fate of Ra in cation-exchange regeneration brine waste disposed to septic tanks and accumulation in sludge, New Jersey Coastal Plain, USA.

    Science.gov (United States)

    Szabo, Zoltan; Jacobsen, Eric; Kraemer, Thomas F; Parsa, Bahman

    2008-06-01

    Concentrations of Ra in liquid and solid wastes generated from 15 softeners treating domestic well waters from New Jersey Coastal Plain aquifers (where combined Ra ((226)Ra plus (228)Ra) concentrations commonly exceed 0.185 Bq L(-1)) were determined. Softeners, when maintained, reduced combined Ra about 10-fold (septic-tank effluents receiving brine waste were less than in the untreated ground waters. The maximum combined Ra concentration in aquifer sands (40.7 Bq kg(-1) dry weight) was less than that in sludge from the septic tanks (range, 84-363 Bq kg(-1)), indicating Ra accumulation in sludge from effluent. The combined Ra concentration in sludge from the homeowners' septic systems falls within the range reported for sludge samples from publicly owned treatment works within the region.

  6. The Evaluation of Pharmacodynamics and Pharmacokinetics of Anti-thrombin DNA Aptamer RA-36

    Directory of Open Access Journals (Sweden)

    Elena Zavyalova

    2017-12-01

    Full Text Available Anticoagulants are a vital class of drugs, which are applied for short-term surgical procedures, and for long-term treatments for thrombosis prevention in high risk groups. Several anticoagulant drugs are commercially available, but all have intrinsic disadvantages, e.g., bleeding risks, as well as specific ones, e.g., immune response to peptide/protein drugs. Therefore, the search for novel, efficient and safe anticoagulants is essential. Nucleic acid aptamers are an emerging class of contemporary pharmaceuticals which are fully biocompatible and biodegradable; they have low toxicity, and are as efficient as many protein-based drugs. The anti-thrombin DNA aptamer RA-36 has been created using a combination of rational design and molecular dynamics, showing several extra-features over existing aptamers. Aptamer RA-36 has a bimodular structure; the first G-quadruplex binds and inhibits thrombin, whereas the second G-quadruplex varies the properties of the first. This bimodular structure provides a favorable dose-effect dependence allowing the risk of bleeding to be potentially decreased. Here, the results of efficiency trials of the aptamer are presented. The aptamer RA-36 has a distinctive species specificity; therefore, the careful selection of experimental animals was required. The anticoagulant activity was characterized in rats and monkeys in vivo. Antithrombotic activity was evaluated in the live murine model of the induced thrombosis. Pharmacokinetics was estimated by tracking radionuclide labeled aptamer in rats. The aptamer was thoroughly characterized using bivalirudin as a reference drug. Despite the different profiles of anticoagulant activity, these two compounds could refer to each other, and the corresponding doses could be estimated. Bivalirudin turned out to have 10-fold higher anticoagulant and antithrombotic activity. The difference in activity is easy to explain due to the pharmacokinetic profiles of the substances: the aptamer

  7. Efecto del Hierro en el Desarrollo de las Raíces de las Plantas

    Directory of Open Access Journals (Sweden)

    Correa Velásquez Jairo

    1964-08-01

    Full Text Available Se investigó el efecto del hierro en el desarrollo de las raíces del cacao, el café y el fríjol. También se observó la velocidad de recuperación de la clorofila en plantas cloróticas de cacao y café, al agregarles cantidades crecientes de hierro, y el efecto de dicha recuperación sobre el desarrollo radical. Además, se estudió el grado de absorción y movilización de Fe50 en plantas de cacao, y el efecto de distintas dosis de hierro en el crecimiento de raíces aisladas cacao, café y fríjol. Las plantas fueron cultivadas en el invernadero en solución HoagIand N° 2 sin Fe y las raíces para cultivo se obtuvieron de semillas germinadas en el laboratorio. Se usaron plantas de cacao del clon uf 668 de 3 meses y de café (variedad caturra con la misma edad. El hierro radiactivo utilizado fue en forma de cloruro (Fe59 cl 3 y el agregado a la solución o al follaje, en forma de quelato (Fe E. D. T. A.. Las adiciones de este elemento se hicieron cuando las plantas mostraban síntomas característicos de su deficiencia. Hubo una recuperación casi total de la clorosis y tanto el volumen como la longitud radical aumentaron con las aplicaciones crecientes de hierro, aunque la longitud relativa de los tallos mostró una tendencia decreciente. En las hojas de cacao se presentó una acumulación del Fe y su movilización hacia los demás órganos de la planta fue lenta y en proporción reducida en relación con el total absorbido. Igual cosa sucedió con el Fe50 suministrado a las raíces. No se pudieron observar los efectos del Fe en el crecimiento de raíces aisladas de cacao, café y fríjol, pues el desarrollo fue muy reducido, debido a que la rápida oxidación de los tejidos (al separar aquéllas del resto de la planta redujo la viabilidad a unos pocos días.

  8. LoRa IoT -radion soveltuvuus käytettyjen työkoneiden tiedonsiirtoon

    OpenAIRE

    Hasu, Lassi

    2017-01-01

    Opinnäytetyön tarkoituksena oli tutkia LoRa-radiotekniikan soveltuvuutta lastinkäsittelylaitteiden tuottaman datan tiedonsiirtoon. LoRa on teollisen internetin sovelluksia varten kehitetty pitkän kantaman radiotekniikka. Tavoitteena oli löytää käyttötapauksia, joihin LoRa-tekniikka soveltuu etsittäessä kustannustehokasta radiotekniikkaa erityisesti käytettyihin lastinkäsittelylaitteisiin. Työn toimeksiantaja oli Cargotec Finland Oy:n Kalmar-liiketoimintayksikkö. Työn tutkimusmenetelmänä käyte...

  9. Mogući učinci igranja računalnih igrica i videoigara na djecu i adolescente

    OpenAIRE

    Bilić, Vesna; Gjukić, Damjan; Kirinić, Giovanna

    2010-01-01

    Oduševljenje i učestala zaokupljenost djece i mladih računalnim igricama i videoigrama razlog je zabrinutosti njihovih roditelja i učitelja. Cilj je ovoga rada na temelju istraživanja i pregleda literature analizirati pozitivne i negativne učinke igranja računalnih igrica i videoigara na djecu i adolescente, s osobitim osvrtom na mogućnost stvaranja ovisnosti o njima. Iako neke računalne igrice i videoigre mogu služiti korisnom učenju, razvoju brzine i koordinacije, usredotočenosti, kontro...

  10. Renal involvement in autoimmune connective tissue diseases.

    Science.gov (United States)

    Kronbichler, Andreas; Mayer, Gert

    2013-04-04

    Connective tissue diseases (CTDs) are a heterogeneous group of disorders that share certain clinical presentations and a disturbed immunoregulation, leading to autoantibody production. Subclinical or overt renal manifestations are frequently observed and complicate the clinical course of CTDs. Alterations of kidney function in Sjögren syndrome, systemic scleroderma (SSc), auto-immune myopathies (dermatomyositis and polymyositis), systemic lupus erythematosus (SLE), antiphospholipid syndrome nephropathy (APSN) as well as rheumatoid arthritis (RA) are frequently present and physicians should be aware of that.In SLE, renal prognosis significantly improved based on specific classification and treatment strategies adjusted to kidney biopsy findings. Patients with scleroderma renal crisis (SRC), which is usually characterized by severe hypertension, progressive decline of renal function and thrombotic microangiopathy, show a significant benefit of early angiotensin-converting-enzyme (ACE) inhibitor use in particular and strict blood pressure control in general. Treatment of the underlying autoimmune disorder or discontinuation of specific therapeutic agents improves kidney function in most patients with Sjögren syndrome, auto-immune myopathies, APSN and RA.In this review we focus on impairment of renal function in relation to underlying disease or adverse drug effects and implications on treatment decisions.

  11. Ordination of environmental data using principal component analysis: the case of the radium isotopes (Ra-226 and Ra-28) in surface waters in an area associated with NORM/TENORM mining

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, Wagner de S.; Py Junior, Delcy de A.; Antunes, Marcos M., E-mail: wspereira@inb.gov.b, E-mail: delcy@inb.gov.b, E-mail: antunes@inb.gov.b [Industrias Nucleares do Brasil SA, Pocos de Caldas, MG (Brazil). Unidade de Tratamento de Minerios. Coordenacao de Protecao Radiologica; Kelecom, Alphonse, E-mail: kelecom@uol.com.b [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Inst. de Biologia. Curso de Pos-Graduacao em Biologia Marinha; Carmo, Roberto F., E-mail: rfcarmo@inb.gov.b [Industrias Nucleares do Brasil SA, Caetite, BA (Brazil). Unidade de Concentracao de Uranio. Coordenacao de Protecao Radiologica; Oliveira, Gabriela T. de [Centro Universitario de Sao Joao da Boa Vista (UNIFAE), SP (Brazil). Curso de Engenharia Quimica

    2009-07-01

    The radium isotopes Ra-226 and Ra-228 were analyzed in surface water at six points, during eighteen months, from June 2006 to December 2007, in the neighborhood of a mine of phosphate associated with uranium in the region of Santa Quiteria, state of Ceara, Brazil. The soluble fraction (which passes through filter of 0.45 micron) and the particulate fraction (which is retained on the 0.45 micron filter) were analyzed using the Principal Component Analysis, PCA, a method for ranking environmental data, and were analyzed also by F test for testing the difference between radionuclides and the difference between the two analyzed fractions. The PCA has identified four groups of samples. Results of Ra-226 in soluble fraction are grouped in the negative part of axis 1 (Factor 1) and axis 2 (Factor 2). Results of Ra-228 in particulate fraction are grouped in the positive part of axis 1 (Factor 1) and in the negative part of axis 2. Results of Ra-226 in soluble fraction are grouped along the positive part of axis 1 (Factor 1). Finally, results of Ra-228 in the particulate fraction are grouped in the positive part of axis 1 (Factor 1) and axis 2 (Factor 2). This last group has two discrepant points (01 and 06). There is no statistical difference between the two analyzed fractions but there are statistical differences between analyzed radionuclides. Therefore, three conclusions can be identified: The use of PCA with radionuclides and analyzed fractions as parameters permits the grouping of collecting data by their environmental similarities; the mean concentration of Ra-226 was statistically higher than that of Ra-228; and there is no statistical difference between soluble and particulate fractions. (author)

  12. Lytic Epstein-Barr virus infection in the synovial tissue of patients with rheumatoid arthritis.

    Science.gov (United States)

    Takeda, T; Mizugaki, Y; Matsubara, L; Imai, S; Koike, T; Takada, K

    2000-06-01

    To evaluate the existence of Epstein-Barr virus (EBV) infection in the synovial tissue of patients with rheumatoid arthritis (RA). Synovial tissues were obtained at synovectomy or arthroplasty from 32 patients with RA and 30 control patients with osteoarthritis (OA). EBV DNA was detected by Southern blot hybridization and/or polymerase chain reaction (PCR) amplification. To localize the EBV-infected cells, tissue sections were studied by RNA in situ hybridization (ISH) for the EBV-encoded small RNA 1 (EBER-1), by DNA ISH for the Bam HI W region of EBV DNA, and by immunohistochemistry for EBV lytic proteins BZLF1 and gp350/220. EBV DNA was detected by PCR in 15 of the 32 samples from RA patients (47%), but in none of those from the 30 OA patients (P 1 EBV copy/1,000 cells (referred to as EBV 2+), and 6 contained 1 copy/1,000-5,000 cells (EBV 1+). Among the 9 EBV 2+ samples, 3 were also positive for EBV DNA by Southern blot hybridization, 5 were positive for EBER-1 by RNA ISH, and 3 were positive for EBV DNA by DNA ISH. Immunohistochemical analysis showed positive signals in all samples for BZLF1 and in 7 samples for gp350/ 220. In each examination, the positive signals were detected not only in lymphocytes, but also in synovial lining cells. EBV was frequently detected in the synovial tissue of RA patients. The infected cells were both lymphocytes and synovial cells, and expressed EBV proteins associated with virus replication. These findings suggest that EBV may play a role in the pathogenesis of RA.

  13. [The role of extracellular chaperone Hsp70 in creating antitumor immunity in rat rhabdomyosarcoma RA-2 model].

    Science.gov (United States)

    Guzhova, I V; Komarova, E Iu; Pimenova, A A; Bakhtin, Iu B; Kaminskaia, E V; Margulis, B A

    2008-01-01

    Immunization of experimental animals with extract or membranes of rat rhabdomyosarcoma RA-2 in combination with pure Hsp70 did not offer any significant effect of protection from subsequent RA-2 cells-stimulated tumor growth. By contrast, immunization with preparations of pure Hsp70 led to a significant decrease in number and size of tumors as well as elevation of concentrations of antibodies against RA-2 cells. Also, enhanced blood levels of Hsp70 involved delayed tumor growth. In vitro tests Hsp70 incubation with RA-2 cells was followed by a 30-35% rise in cytotoxic lymphocytes levels. An ability of pure Hsp70 preparations to stimulate humoral and antitumor response was demonstrated. Hence, they may be used in developing vaccine formulas.

  14. A new system for the 222Rn and 226Ra assay of water and results in the B OREXINO project

    Science.gov (United States)

    Simgen, H.; Buck, C.; Heusser, G.; Laubenstein, M.; Rau, W.

    2003-02-01

    We describe a very sensitive system for the 222Rn and 226Ra assay of water that we have constructed within the framework of the B OREXINO solar neutrino experiment. The technique that is applied for 222Rn measurements is based on concentration of radon from water samples followed by gas purification and subsequent alpha counting in low-background miniaturized proportional counters. The same technique is applied to measure the 226Ra concentration by determining the amount of 222Rn in equilibrium with the 226Ra in the water. Sensitivities of ˜1 mBq/m 3 for 226Ra and ˜100 μBq/m 3 for 222Rn have been achieved. We present results of measurements illustrating the performance of the system as well as investigations of samples from the B OREXINO water plant and the shielding water of the Counting Test Facility (CTF, a test facility for the B OREXINO detector).

  15. Boron neutron capture therapy (BNCT) translational studies in the hamster cheek pouch model of oral cancer at the new ''B2'' configuration of the RA-6 nuclear reactor

    Energy Technology Data Exchange (ETDEWEB)

    Monti Hughes, Andrea; Trivillin, Veronica A.; Schwint, Amanda E. [Constituyentes Atomic Center, National Atomic Energy Commission (CNEA), Department of Radiobiology, San Martin, Province Buenos Aires (Argentina); National Research Council (CONICET), Ciudad Autonoma de Buenos Aires (Argentina); Longhino, Juan; Boggio, Esteban [Bariloche Atomic Center, CNEA, Department of Nuclear Engineering, San Carlos de Bariloche, Province Rio Negro (Argentina); Medina, Vanina A.; Martinel Lamas, Diego J. [National Research Council (CONICET), Ciudad Autonoma de Buenos Aires (Argentina); Pontifical Catholic University of Argentina (UCA), Laboratory of Tumoral Biology and Inflammation, School of Medical Sciences, Institute for Biomedical Research (BIOMED CONICET-UCA), Ciudad Autonoma de Buenos Aires (Argentina); Garabalino, Marcela A.; Heber, Elisa M.; Pozzi, Emiliano C.C. [Constituyentes Atomic Center, National Atomic Energy Commission (CNEA), Department of Radiobiology, San Martin, Province Buenos Aires (Argentina); Itoiz, Maria E. [Constituyentes Atomic Center, National Atomic Energy Commission (CNEA), Department of Radiobiology, San Martin, Province Buenos Aires (Argentina); UBA, Department of Oral Pathology, Faculty of Dentistry, Ciudad Autonoma de Buenos Aires (Argentina); Aromando, Romina F. [UBA, Department of Oral Pathology, Faculty of Dentistry, Ciudad Autonoma de Buenos Aires (Argentina); Nigg, David W. [Idaho National Laboratory, Idaho Falls (United States)

    2017-11-15

    Boron neutron capture therapy (BNCT) is based on selective accumulation of B-10 carriers in tumor followed by neutron irradiation. We demonstrated, in 2001, the therapeutic effect of BNCT mediated by BPA (boronophenylalanine) in the hamster cheek pouch model of oral cancer, at the RA-6 nuclear reactor. Between 2007 and 2011, the RA-6 was upgraded, leading to an improvement in the performance of the BNCT beam (B2 configuration). Our aim was to evaluate BPA-BNCT radiotoxicity and tumor control in the hamster cheek pouch model of oral cancer at the new ''B2'' configuration. We also evaluated, for the first time in the oral cancer model, the radioprotective effect of histamine against mucositis in precancerous tissue as the dose-limiting tissue. Cancerized pouches were exposed to: BPA-BNCT; BPA-BNCT + histamine; BO: Beam only; BO + histamine; CONTROL: cancerized, no-treatment. BNCT induced severe mucositis, with an incidence that was slightly higher than in ''B1'' experiments (86 vs 67%, respectively). BO induced low/moderate mucositis. Histamine slightly reduced the incidence of severe mucositis induced by BPA-BNCT (75 vs 86%) and prevented mucositis altogether in BO animals. Tumor overall response was significantly higher in BNCT (94-96%) than in control (16%) and BO groups (9-38%), and did not differ significantly from the ''B1'' results (91%). Histamine did not compromise BNCT therapeutic efficacy. BNCT radiotoxicity and therapeutic effect at the B1 and B2 configurations of RA-6 were consistent. Histamine slightly reduced mucositis in precancerous tissue even in this overly aggressive oral cancer model, without compromising tumor control. (orig.)

  16. The RaDIATE High-Energy Proton Materials Irradiation Experiment at the Brookhaven Linac Isotope Producer Facility

    OpenAIRE

    Ammigan, Kavin; Amroussia, Aida; Avilov, Mikhail; Boehlert, Carl; Calviani, Marco; Casella, Andrew; Densham, Chris; Fornasiere, Elvis; Hurh, Patrick; Ishida, Taku; KUKSENKO Viacheslav; Lee, Yongjoong; Makimura, Shunsuke; Mausner, Leonard; Medvedev, Dmitri

    2017-01-01

    The RaDIATE collaboration (Radiation Damage In Accelerator Target Environments) was founded in 2012 to bring together the high-energy accelerator target and nuclear materials communities to address the challenging issue of radiation damage effects in beam-intercepting materials. Success of current and future high intensity accelerator target facilities requires a fundamental understanding of these effects including measurement of materials property data. Toward this goal, the RaDIATE collabor...

  17. Síndrome da redundância das raízes lombares: relato de um caso

    Directory of Open Access Journals (Sweden)

    José Carlos Lynch

    1985-06-01

    Full Text Available Um homem de 64 anos apresentava dor ciática crônica. A mielografia revelou compressão extradural e tortuosidade das raízes lombares. Foi verificado tratar-se da síndrome da redundância das raízes lombares. Laminectomia e facetectomia foram realizadas com acentuada melhora dos sintomas no pós-operatório.

  18. Dorsal telencephalon-specific RA-GEF-1 knockout mice develop heterotopic cortical mass and commissural fiber defect.

    Science.gov (United States)

    Bilasy, Shymaa E; Satoh, Takaya; Ueda, Shuji; Wei, Ping; Kanemura, Hoshimi; Aiba, Atsu; Terashima, Toshio; Kataoka, Tohru

    2009-05-01

    Neural migration defects lead to various types of human malformations of cortical development including subcortical band heterotopia, which shows formation of a secondary cortical plate beneath the primary cortex and is typically caused by mutation of the DCX (doublecortin) gene. Subcortical band heterotopia is usually associated with mental retardation and epilepsy. We previously discovered RA-GEF-1 as a guanine nucleotide exchange factor (GEF) for Rap1 small GTPase. Here we have analysed its in-vivo role in formation of the adult cerebral cortex by using telencephalon-specific RA-GEF-1 conditional knockout (cKO) mice, generated by mating RA-GEF-1(flox/flox) mice with Emx1-cre knockin mice. RA-GEF-1 cKO mice showed severe defects in their brain structures including an ectopic cortical mass underlying a relatively normal cortex. The ectopic cortical mass lacked the normal six-layered lamination but preserved the subcortical connectivity as revealed by retrograde tracing. Further, RA-GEF-1 cKO mice exhibited a lower threshold for the induction of epileptic seizures. These phenotypes have a resemblance to those of human subcortical band heterotopia. In addition, the agenesis of anterior commissures, the dorsal hippocampus commissure, the corpus callosum and the enlargement of the lateral ventricles were observed in cKO mice. Our findings suggest a crucial function of RA-GEF-1 in neural migration.

  19. Status and Update of the RaDIATE Collaboration R&D Program

    Energy Technology Data Exchange (ETDEWEB)

    Ammigan, K. [Fermilab; Hurh, P. [Fermilab

    2017-07-01

    The Radiation Damage In Accelerator Target Environments (RaDIATE) collaboration was founded in 2012 and currently consists of over 50 participants and 11 institutions globally. Due to the increasing power of future proton accelerator sources in target facilities, there is a critical need to further understand the physical and thermo-mechanical radiation response of target facility materials. Thus, the primary objective of the RaDIATE collaboration is to draw on existing expertise in the nuclear materials and accelerator targets fields to generate new and useful materials data for application within the accelerator and fission/fusion communities. Current research activities of the collaboration include post irradiation examination (PIE) of decommissioned components from existing beamlines such as the NuMI beryllium beam window and graphite NT-02 target material. PIE of these components includes advanced microstructural analyses (SEM/TEM, EBSD, EDS) and micro-mechanics technique such as nano-indentation, to help characterize any microstructural radiation damage incurred during operation. New irradiation campaigns of various candidate materials at both low and high energy beam facilities are also being pursued. Beryllium helium implantation studies at the University of Surrey as well as high energy proton irradiation of various materials at Brookhaven National Laboratory’s BLIP facility have been initiated. The program also extends to beam-induced thermal shock experiments using high intensity beam pulses at CERN’s HiRadMat facility, followed by advanced PIE activities to evaluate thermal shock resistance of the materials. Preliminary results from ongoing research activities, as well as the future plans of the RaDIATE collaboration R&D program will be discussed.

  20. Familial pulmonary alveolar proteinosis caused by mutations in CSF2RA.

    Science.gov (United States)

    Suzuki, Takuji; Sakagami, Takuro; Rubin, Bruce K; Nogee, Lawrence M; Wood, Robert E; Zimmerman, Sarah L; Smolarek, Teresa; Dishop, Megan K; Wert, Susan E; Whitsett, Jeffrey A; Grabowski, Gregory; Carey, Brenna C; Stevens, Carrie; van der Loo, Johannes C M; Trapnell, Bruce C

    2008-11-24

    Primary pulmonary alveolar proteinosis (PAP) is a rare syndrome characterized by accumulation of surfactant in the lungs that is presumed to be mediated by disruption of granulocyte/macrophage colony-stimulating factor (GM-CSF) signaling based on studies in genetically modified mice. The effects of GM-CSF are mediated by heterologous receptors composed of GM-CSF binding (GM-CSF-Ralpha) and nonbinding affinity-enhancing (GM-CSF-Rbeta) subunits. We describe PAP, failure to thrive, and increased GM-CSF levels in two sisters aged 6 and 8 yr with abnormalities of both GM-CSF-Ralpha-encoding alleles (CSF2RA). One was a 1.6-Mb deletion in the pseudoautosomal region of one maternal X chromosome encompassing CSF2RA. The other, a point mutation in the paternal X chromosome allele encoding a G174R substitution, altered an N-linked glycosylation site within the cytokine binding domain and glycosylation of GM-CSF-Ralpha, severely reducing GM-CSF binding, receptor signaling, and GM-CSF-dependent functions in primary myeloid cells. Transfection of cloned cDNAs faithfully reproduced the signaling defect at physiological GM-CSF concentrations. Interestingly, at high GM-CSF concentrations similar to those observed in the index patient, signaling was partially rescued, thereby providing a molecular explanation for the slow progression of disease in these children. These results establish that GM-CSF signaling is critical for surfactant homeostasis in humans and demonstrate that mutations in CSF2RA cause familial PAP.

  1. Minimum speed limit for ocean ridge magmatism from 210Pb-226Ra-230Th disequilibria.

    Science.gov (United States)

    Rubin, K H; van der Zander, I; Smith, M C; Bergmanis, E C

    2005-09-22

    Although 70 per cent of global crustal magmatism occurs at mid-ocean ridges-where the heat budget controls crustal structure, hydrothermal activity and a vibrant biosphere-the tempo of magmatic inputs in these regions remains poorly understood. Such timescales can be assessed, however, with natural radioactive-decay-chain nuclides, because chemical disruption to secular equilibrium systems initiates parent-daughter disequilibria, which re-equilibrate by the shorter half-life in a pair. Here we use 210Pb-226Ra-230Th radioactive disequilibria and other geochemical attributes in oceanic basalts less than 20 years old to infer that melts of the Earth's mantle can be transported, accumulated and erupted in a few decades. This implies that magmatic conditions can fluctuate rapidly at ridge volcanoes. 210Pb deficits of up to 15 per cent relative to 226Ra occur in normal mid-ocean ridge basalts, with the largest deficits in the most magnesium-rich lavas. The 22-year half-life of 210Pb requires very recent fractionation of these two uranium-series nuclides. Relationships between 210Pb-deficits, (226Ra/230Th) activity ratios and compatible trace-element ratios preclude crustal-magma differentiation or daughter-isotope degassing as the main causes for the signal. A mantle-melting model can simulate observed disequilibria but preservation requires a subsequent mechanism to transport melt rapidly. The likelihood of magmatic disequilibria occurring before melt enters shallow crustal magma bodies also limits differentiation and heat replenishment timescales to decades at the localities studied.

  2. CuRa: Cooperation on non-polluting resource exchange for cost reduction. Final report; CuRa: Cooperation fuer umweltschonenden Ressourcenaustausch zur Nutzung von Kostenreduktionspotenzialen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Schoen, M.; Delahaye, F.; Hiessl, H.; Kotz, C.; Kuntze, U.; Matuschweski, A.; Schuenke, P.; Zoche, P.; Hafkesbrink, J.; Rebhan, A.; Schroll, M.

    2003-02-01

    The project CuRa: (German acronym for Cooperation for Environmentally Friendly Exchange of Resources) aimed to design elements to put into practice the model of sustainable development. The focus was on the participation of industry and business on a regional level and two model regions were chosen for the analysis of case studies. It was intended to give impulses for regional material flow networks between companies, for example by bundling similar material flows to achieve a better profitability and by one-to-one cooperation between companies, one of them using the waste of the partner as raw material. In addition, the potential for reducing material throughput using modern information technology was investigated in a case study. A set of theses derived from institutional theory was verified on the basis of the empirical results. Useful for the development and the stabilization of networks are, among others, expected economic benefits for the partners, common socio-cultural values and traditions, and using existing institutional arrangements as a basis. Different forms of market and policy failures were identified as obstacles, e.g. the established system of waste disposal services, the focus among the responsible actors on compliance with existing rules, and different regulatory obstacles. Nevertheless, in spite of the insufficient number of successful examples and demonstration projects, a shift in orientation from focusing on mere waste disposal towards a closed loop recycling economy and even towards sustainable development was identified within the commercial sector. (orig.) [German] Im Projekt CuRa: (Cooperation fuer umweltschonenden Ressourcenaustausch) sollten in zwei Modellregionen Bausteine fuer die operative Umsetzung des Leitbildes nachhaltiger Entwicklung durch regionale Akteure aus Industrie und Gewerbe entwickelt werden. Es sollte ein Anstoss zu zwischen- und ueberbetrieblicher Vernetzung von Materialfluessen sowie zu einer Umgestaltung der

  3. The potential of {sup 223}Ra and {sup 18}F-fluoride imaging to predict bone lesion response to treatment with {sup 223}Ra-dichloride in castration-resistant prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Murray, Iain; Chittenden, Sarah J.; Denis-Bacelar, Ana M.; Flux, Glenn D. [Royal Marsden NHS Foundation Trust, Joint Department of Physics, Sutton, Surrey (United Kingdom); The Institute of Cancer Research, London (United Kingdom); Hindorf, Cecilia [Royal Marsden NHS Foundation Trust, Joint Department of Physics, Sutton, Surrey (United Kingdom); The Institute of Cancer Research, London (United Kingdom); Skaane University Hospital, Department of Radiation Physics, Lund (Sweden); Parker, Christopher C. [Royal Marsden NHS Foundation Trust, Department of Urology, Sutton (United Kingdom); Chua, Sue [Royal Marsden NHS Foundation Trust, Department of Nuclear Medicine, Sutton (United Kingdom)

    2017-10-15

    The aims of this study were to calculate bone lesion absorbed doses resulting from a weight-based administration of {sup 223}Ra-dichloride, to assess the relationship between those doses and corresponding {sup 18}F-fluoride uptake and to assess the potential of quantitative {sup 18}F-fluoride imaging to predict response to treatment. Five patients received two intravenous injections of {sup 223}Ra-dichloride, 6 weeks apart, at 110 kBq/kg whole-body weight. The biodistribution of {sup 223}Ra in metastatic lesions as a function of time after administration as well as associated lesion dosimetry were determined from serial {sup 223}Ra scans. PET/CT imaging using {sup 18}F-fluoride was performed prior to the first treatment (baseline), and at week 6 immediately before the second treatment and at week 12 after baseline. Absorbed doses to metastatic bone lesions ranged from 0.6 Gy to 44.1 Gy. For individual patients, there was an average factor difference of 5.3 (range 2.5-11.0) between the maximum and minimum lesion dose. A relationship between lesion-absorbed doses and serial changes in {sup 18}F-fluoride uptake was demonstrated (r{sup 2} = 0.52). A log-linear relationship was demonstrated (r{sup 2} = 0.77) between baseline measurements of {sup 18}F-fluoride uptake prior to {sup 223}Ra-dichloride therapy and changes in uptake 12 weeks after the first cycle of therapy. Correlations were also observed between both {sup 223}Ra and {sup 18}F-fluoride uptake in lesions (r = 0.75) as well as between {sup 223}Ra absorbed dose and {sup 18}F-fluoride uptake (r = 0.96). There is both inter-patient and intra-patient heterogeneity of absorbed dose estimates to metastatic lesions. A relationship between {sup 223}Ra lesion absorbed dose and subsequent lesion response was observed. Analysis of this small group of patients suggests that baseline uptake of {sup 18}F-fluoride in bone metastases is significantly correlated with corresponding uptake of {sup 223}Ra, the associated {sup 223

  4. Archaeological investigations of the Bronze Age village of Bagnara di Romagna (RA

    Directory of Open Access Journals (Sweden)

    Maurizio Cattani

    2014-12-01

    Full Text Available This paper summarizes the results of researches carried out in the area next to the modern village of Bagnara di Romagna (RA, where several evidences related to a Bronze Age settlement have been collected. Recently test trenches and surface collections allowed to retrieve bronze and ceramics dating from the Middle Bronze Age (phase BM2 to the Recent Bronze Age (phase BR2. The analysis of landscape and the palaeoenvironmental reconstruction complete the outline of the region of Imola, Faenza and Lugo during the Bronze Age where are well known the ancient settlements of Solarolo, via Ordiere, Monte Castellaccio end S. Giuliano di Toscanella.

  5. Rotation Period Determination for 8994 Kashkashian, (25980) 2001 FK53 and (29128) 1985 RA1

    Science.gov (United States)

    Papini, Riccardo; Franco, Lorenzo; Marchini, Alessandro; Cicali, Cristina; Poggialini, Anna; Salvaggio, Fabio

    2018-01-01

    Photometric observations of three main-belt asteroids were made from the Astronomical Observatory of the University of Siena (Italy) in order to determine their rotation periods. For 8994 Kashkashian, we found a period of 11.761 ± 0.001 h with an amplitude of 0.24 ± 0.01 mag. For (25980) 2001 FK53 the period was 2.762 ± 0.002 h with an amplitude of 0.10 ± 0.02 mag. For (29128) 1985 RA1 we found a period of 5.056 ± 0.004 h with an amplitude of 0.18 ± 0.04 mag.

  6. Tulumaksumäära langetamine on kõigi huvides / Meelis Atonen

    Index Scriptorium Estoniae

    Atonen, Meelis, 1966-

    2001-01-01

    Ilmunud ka: Valgamaalane, 10. nov. 2001, lk. 2; Severnoje Poberezhje, 13. nov. 2001, lk. 2; Koit, 13. nov. 2001, lk. 6; Võrumaa Teataja, 13. nov. 2001, lk. 2; Põhjarannik, 15. nov. 2001, lk. 2; Vooremaa, 15. nov. 2001, lk. 2; Pärnu Postimees, 17. nov. 2001, lk. 2; Hiiu Leht, 20. nov. 2001, lk. 2; Lääne Elu, 20. nov. 2001, lk. 4; Sakala, 21. nov. 2001, lk. 2; Nädaline, 24. nov. 2001, lk. 4. Tulumaksumäära langetamine on majanduskliima säilitamiseks hädavajalik. Autor: Reformierakond. Parlamendisaadik

  7. Theorising the Right to Be Political in Motion: khôra as Condition of Possibility

    Directory of Open Access Journals (Sweden)

    Mark F.N. Franke

    2016-09-01

    Full Text Available The most rightful aspect of being human is our movement. Yet, while the spatialised orders of modern human rights regimes frustrate recognition of this fact, we do not theorise rights with any greater universality via concepts of time. Both spatial and temporal descriptions overlook how human rights must be thought of through the specificity of human movement itself. Through a critical analysis of the concept of khôra from Plato’s Timaeus, I suggest a way of reading the politics of human rights in these terms. And I propose a rethinking of fundamental human rights through the right to be political in motion.

  8. Microbioma no trato gastrointestinal de bovino da raça Nelore

    OpenAIRE

    Oliveira, Marcelo Nagem Valério de

    2013-01-01

    O avanço no desenvolvimento de tecnologias moleculares tem sustentado o surgimento de novas linhas de pesquisas, dentre as quais o estudo de microbiomas associados ao trato gastrointestinal (TGI) de animais. Este trabalho representa o primeiro estudo da microbiota associada ao TGI de um bovino da raça Nelore (Bos indicus), a qual representa até 70 % do rebanho no Brasil. No presente trabalho foi desenvolvida e testada uma estratégia de amostragem do TGI que possibilitou a identificação da ...

  9. Raúl Serrano: dialéctica y creación teatral

    OpenAIRE

    Ana Cecilia Prenz

    1994-01-01

    Raúl Serrano estudioso de teatro, tiene una formación completamente diferente con respecto a la de los hombres de teatro argentino; es, con toda seguridad, la persona que más profunda y científicamente se ha dedicado al estudio de K. Stanislavskij en el ámbito del teatro de este país. La experiencia teatral adquirida en Europa influenciará profundamente sobre este autor en sus investigaciones, de tal modo que al regresar a su país de origen será profundamente crítico con respecto a la realida...

  10. Ra y el oro en los Textos de las Pirámides: Algunas notas

    OpenAIRE

    Borrego Gallardo, Francisco L.

    2011-01-01

    Las relaciones entre Ra, el dios del sol, y el oro parecen ser un tema bien conocido de la religión egipcia antigua dadas las asociaciones solares de dicho metal precioso. Sin embargo, no existen estudios que se hayan ocupado de conocer en detalle dichas relaciones. En este trabajo se propone un análisis de los encantamientos de los Textos de las Pirámides donde existen vínculos entre dicha deidad y el oro, teniendo en cuenta tanto los precedentes de dichas asociaciones de signifi...

  11. Coverage and Capacity Analysis of Sigfox, LoRa, GPRS, and NB-IoT

    OpenAIRE

    Vejlgaard, Benny; Lauridsen, Mads; Nguyen, Huan Cong; Kovács, István; Mogensen, Preben Elgaard; Sørensen, Mads

    2017-01-01

    In this paper the coverage and capacity of SigFox, LoRa, GPRS, and NB-IoT is compared using a real site deployment covering 8000 km2 in Northern Denmark. Using the existing Telenor cellular site grid it is shown that the four technologies have more than 99 % outdoor coverage, while GPRS is challenged for indoor coverage. Furthermore, the study analyzes the capacity of the four technologies assuming a traffic growth from 1 to 10 IoT device per user. The conclusion is that the 95 %-tile uplink ...

  12. HQtrônicas e realidade aumentada (RA): novas potencialidades narrativas

    OpenAIRE

    PRADO, Jordana Inácio de Almeida

    2012-01-01

    Essa pesquisa exploratória de mestrado, desenvolvida no Programa de Pós-graduação em Cultura Visual da FAV/UFG, na linha de pesquisa Poéticas Visuais e Processos de Criação, teve como objetivos o estudo da linguagem das HQtrônicas uma narrativa intermídia em expansão e da tecnologia emergente da Realidade Aumentada (RA), visando vislumbrar as possibilidades narrativas abertas por essa tecnologia e seus desdobramentos no âmbito das HQtrônicas. Além das investigações teóricas e conceituais ...

  13. Rudarjenje bitcoinov s podatkovno pretočnim računalnikom Maxeler

    OpenAIRE

    MEDEN, ROK

    2017-01-01

    Bitcoin je prva decentralizirana kriptografska valuta, ki omogoča neposredno trgovanje med entitetami po vsem svetu. Nakazila se izvedejo preko spleta s t. i. digitalnimi kovanci - bitcoini, ki se sproti ustvarjajo in izdajajo pri procesu rudarjenja bitcoinov. Rudarji s prilagojeno računalniško rudarsko opremo tekmujejo pri potrjevanju nakazil in širjenju javne knjige nakazil (t. i. verige blokov) z namenom prejetja nagrade v bitcoinih in na ta način varujejo omrežje Bitcoin. Ker je rudarjenj...

  14. Analiza vpliva ekspozicijskih pogojev na kakovost slik pri računalniški radiografiji

    OpenAIRE

    Vodopivec, Lea; Žakelj, Tadeja

    2017-01-01

    Uvod: Kvaliteta rentgenske slike temelji na dobrem prikazu struktur in je posledica dobre kontrastne in prostorske ločljivosti. Z računalniško obdelavo lahko sliki dodamo večjo diagnostično uporabnost in boljšo kakovost. Namen: Zanimalo nas je, kako ekspozicijski pogoji in obdelava slik vplivajo na njihovo kakovost ter ali so slike z višjim razmerjem signal-šum bolj kakovostne od tistih z nižjim. Metode dela: Pregledali smo literaturo in pridobili rentgenske slike prsnih in trebušnih organov ...

  15. Atividade antimicrobiana de extratos de raízes de Byrsonima crassifolia

    Directory of Open Access Journals (Sweden)

    Luís Fernando Albarello Gellen

    2016-06-01

    Full Text Available A Byrsonima crassifolia ou popularmente conhecida como “murici” é amplamente difundida nas regiões norte, nordeste e algumas partes da região centro-oeste. Bastante utilizado na culinária local tanto pelo seu gosto exótico, como pelos seus efeitos terapêuticos. O objetivo do trabalho foi avaliar o potencial antimicrobiano do extrato de raízes de Byrsonima crassifolia sobre bactérias de interesse médico. As amostras de B. crassifolia foram coletadas no interior do estado do Tocantins, na região do município de Cristalândia. Em seguida as raízes foram encaminhadas para o Centro Universitário Luterano de Palmas - TO, onde foram realizados os processos de produção dos extratos provenientes das raízes. Os demais procedimentos foram realizados na Universidade Federal do Tocantins, campus de Gurupi. Foram utilizadas quatro cepas bacterianas, sendo elas: Klebsiella pneumoniae ATCC700603, Escherichia coli ATCC 35218, Staphylococcus aureus ATCC 25923 e Pseudomonas aeruginosa ATCC 27853. A concentração dos extratos consistiu de 10% aquecido, 20% aquecido e 20% não aquecido. A resistência aos antimicrobianos foi realizada pelo método de difusão em disco, cuja as avaliações procederam-se 24 horas após aplicação do extrato, com auxílio de um paquímetro digital e o resultado expresso em mm. As concentrações do extrato aquoso de Byrsonima crassifólia foram eficientes na inibição bacteriana, exceto para Escherichia coli ATCC 35218. Foram observadas nas raízes pigmentações de cor característica de antocianina e quercetina, condição que pode ter influenciado no potencial antimicrobiano, pela ação antibacteriana, antiflamatório e cicatrizante destes dois flavonoides natural.

  16. Traços laringais em Latundê (Nambikwára do Norte

    Directory of Open Access Journals (Sweden)

    Stella Telles

    Full Text Available Este trabalho reflete o status dos traços laringais na língua Latundê, pertencente ao subgrupo Nambikwára do Norte, da família Nambikwára. Os dados foram coletados in loco pela autora entre os anos 1997-2001. Para a análise, considerou-se também a literatura disponível sobre outras línguas da família. O presente artigo está organizado em cinco seções: na primeira, são fornecidas informações sobre a família Nambikwára e os inventários segmentais de três línguas da família; na segunda, são apresentados os quadros fonológicos (consonantal e vocálico do Latundê; na terceira, encontram-se dados que evidenciam a realização dos traços laringais existentes em consoantes Latundê (glotalização e aspiração e o contraste do traço creaky voice, nas vogais; na quarta, são feitas considerações sobre a variação laringal no Latundê; finalmente, na quinta seção, são apresentadas reflexões sobre a correspondência entre segmentos com traço laringal do Latundê e do Mamaindê, outra língua Nambikwára do Norte. Os resultados do estudo evidenciaram que no Latundê as consoantes neutralizaram os traços laringais, enquanto que as vogais os mantêm contrastivamente. No interior do ramo do Norte, a correspondência entre consoantes Latundê e Mamaindê parece indicar que a primeira língua é mais inovadora no processo de mudança histórica.

  17. Računalniški vid za pametno knjižnico

    OpenAIRE

    Trček, Matej

    2016-01-01

    S prostoročnimi vmesniki lahko tehnologijo na udoben način vključimo v vsakdanje dejavnosti. Diplomsko delo opisuje izdelavo aplikacije za prepoznavanje knjižnih platnic z barvno-globinsko kamero za rabo v pametni knjižnici. Aplikacija v globinski sliki zazna ravnino, v njej najde štirikotnik in ga naravna v ravnino kamere. V naslednjem koraku s tehnikami računalniškega vida primerja najdeno sliko s pripravljeno podatkovno bazo posnetkov knjižnih platnic in najde najboljše ujemanje. Globinska...

  18. Efeito da IATF em novilhas da raça Nelore no Norte de Minas

    OpenAIRE

    Barbosa, Lucélia Karoline Gonçalves; Cunha, Rafael Silva; Leite, Juliana Guedes; Rodrigues, Lucas Aquino; Ribeiro, José Alcides de Castro Machado; Murta, Danillo Velloso Ferreira

    2015-01-01

    A atual situação econômica da pecuária mundial exige alta produtividade como garantia de retorno do capital investido a médio e curto prazo, tendo em vista que a reprodução animal é um dos alicerces da cadeia produ­tiva. A inseminação artificial tempo fixo (IATF) se torna uma alternativa para melhorar a eficiência reprodutiva. Objetivou-se com este trabalho analisar a fertilidade de novilhas da raça Nelore, submetidas à IATF. Utilizou-se 173 novilhas, as quais foram divididas, onde um grupo f...

  19. As raízes do Brasil no espelho de próspero

    Directory of Open Access Journals (Sweden)

    Pedro Meira Monteiro

    2009-03-01

    Full Text Available O espelho de Próspero é um passo a mais na paixão latino-americanista que une autores tão diversos como Darío, Martí, Rodó, Mariátegui, Manoel Bonfim, Sérgio Buarque de Holanda ou Gilberto Freyre - toda uma linhagem, enfim, a conceber o espaço fantástico de uma "outra" América, pensada ou sentida no contraste com o grande irmão do Norte. O espelho norte-americano refunda, desde o século XIX, a geografia shakespeariana que impressionou Sérgio Buarque e que porventura o assombraria enquanto concebia, na aventura do exílio, Raízes do Brasil. Embora esse ensaio clássico não seja explicitamente referido n'O espelho de Próspero, parece razoável supor que o livro de Richard Morse seja uma espécie de reescritura de Raízes do Brasil, capaz de radicalizar a promessa ibero-americana que brilha, também, no horizonte de Sérgio Buarque de Holanda.Prospero's Mirror is one further step in the Latin Americanist Passion that brings together authors such as Darío, Martí, Rodó, Mariátegui, Manoel Bonfim, Sérgio Buarque de Holanda and Gilberto Freyre - a whole lineage of writers who delineate the fantastic space of "another" America, thought of, and felt, in contrast to her northern big brother. Beginning in the 19th century, a North American mirror reshapes the Shakespearean geography which impressed Sérgio Buarque de Holanda, and which would haunt him while he composed Raízes do Brasil in exile. Even though Holanda's classic book is not explicitly used in Prospero's Mirror, one can think that Morse's own book is a sort of re-writing of Raízes do Brasil, going into more depth in the Ibero-American promise that also shines in Buarque de Holanda's horizon.

  20. Desenvolvimento relativo das partes do corpo de zebuínos de quatro raças Relative development of body portions from four zebu breeds

    Directory of Open Access Journals (Sweden)

    André Mendes Jorge

    2001-10-01

    Full Text Available Utilizaram-se 63 machos não-castrados, sendo 16 de cada, das raças Gir, Guzerá, e Mocho Tabapuã e 15 da raça Nelore, com média de idade 24 meses e média de pesos vivos iniciais de 376,4; 357,6, 362,0 e 368,6kg, respectivamente. Os animais de cada raça foram divididos, aleatoriamente, em cinco categorias. Uma categoria foi abatida imediatamente (AB, três receberam, em baias individuais, ração contendo 50% de concentrado na matéria seca "ad libitum" (I, II e III e uma recebeu a mesma ração, em quantidade restrita, suprindo níveis de proteína e energia 15% acima da mantença (AR. Os animais das categorias I, II e III foram abatidos ao atingirem pesos vivos individuais de 405, 450 e 500kg, respectivamente. No abate, determinou-se o peso de corpo vazio, e pesaram-se os órgãos e vísceras. Adotou-se a equação de regressão do logaritmo da quantidade corporal de órgãos e vísceras em função do logaritmo do peso do corpo vazio. Os componentes do trato gastrintestinal e os outros órgãos internos, excetuando-se o fígado e o baço, revelaram um menor ímpeto de crescimento em relação ao do peso corporal vazio.Sixty-three intact males, 16 Gyr, 16 Guzerat, 15 Nellore and 16 'Mocho Tabapuã', averaging, respectively, 376.4, 357.6, 362.0 and 368.6kg initial live weight and twenty-four months of age, were used. The animals from each breed were divided into five groups (categories. One group was ramdomly assigned to immediate slaughter (AB, three groups were full-fed a ration containing 50% concentrate, dry matter basis until reaching the slaughter weights of 405, 450 and 500kg, respectively (group I, II and III. The fifth group was fed a restricted amount of the same ration to supply levels of protein and energy 15% above maintenance (AR. Each AR animal was slaughtered when an animal correspondent to group II reached the slaughter weight. At slaughter, the empty body weight was determined and the weight of internal organs were

  1. Tissue bionics: examples in biomimetic tissue engineering.

    Science.gov (United States)

    Green, David W

    2008-09-01

    Many important lessons can be learnt from the study of biological form and the functional design of organisms as design criteria for the development of tissue engineering products. This merging of biomimetics and regenerative medicine is termed 'tissue bionics'. Clinically useful analogues can be generated by appropriating, modifying and mimicking structures from a diversity of natural biomatrices ranging from marine plankton shells to sea urchin spines. Methods in biomimetic materials chemistry can also be used to fabricate tissue engineering scaffolds with added functional utility that promise human tissues fit for the clinic.

  2. Tissue bionics: examples in biomimetic tissue engineering

    Energy Technology Data Exchange (ETDEWEB)

    Green, David W [Bone and Joint Research Group, Developmental Origins of Health and Disease, General Hospital, University of Southampton, SO16 6YD (United Kingdom)], E-mail: Hindoostuart@googlemail.com

    2008-09-01

    Many important lessons can be learnt from the study of biological form and the functional design of organisms as design criteria for the development of tissue engineering products. This merging of biomimetics and regenerative medicine is termed 'tissue bionics'. Clinically useful analogues can be generated by appropriating, modifying and mimicking structures from a diversity of natural biomatrices ranging from marine plankton shells to sea urchin spines. Methods in biomimetic materials chemistry can also be used to fabricate tissue engineering scaffolds with added functional utility that promise human tissues fit for the clinic.

  3. Recombinant Rhipicephalus appendiculatus gut (Ra86 and salivary gland cement (Trp64 proteins as candidate antigens for inclusion in tick vaccines: protective effects of Ra86 on infestation with adult R. appendiculatus

    Directory of Open Access Journals (Sweden)

    Saimo M

    2011-11-01

    Full Text Available Margaret Saimo1,2,*, David O Odongo3,4,*, Stephen Mwaura3, Just M Vlak1, Anthony J Musoke5, George W Lubega2, Richard P Bishop3, Monique M van Oers11Laboratory of Virology, Wageningen University, Wageningen, The Netherlands; 2School of Veterinary Medicine, Makerere University, Kampala, Uganda; 3International Livestock Research Institute, Nairobi, Kenya; 4School of Biological Sciences, University of Nairobi, Nairobi, Kenya; 5Onderstepoort Veterinary Institute, Onderstepoort, Pretoria, South Africa *These two authors made an equal contribution to this workAbstract: Rhipicephalus appendiculatus gut protein Ra86 (variants Ra85A and Ra92A and the salivary gland cement protein (Trp64 were expressed in the baculovirus-insect cell system. The recombinant gut proteins expressed as soluble proteins and the recombinant cement protein, as insoluble inclusion bodies, were used to immunize rabbits, which were then challenged with larval, nymphal, and adult stages of R. appendiculatus ticks. High tick mortality (23.3% occurred on adult ticks that fed on rabbits vaccinated with the gut proteins, compared with 1.9% mortality in ticks that fed on unvaccinated naïve control rabbits. The mean weight of engorged female ticks was significantly reduced by 31.5% in rabbits vaccinated with the Ra86 recombinant protein compared with controls, as was egg production. Marked effects on these parameters were also observed in adult ticks as a result from vaccination using Trp64, but these were not statistically significant. For both antigens, there was no demonstrable effect on larval or nymphal ticks. This study demonstrates for the first time the protective efficacy of a homolog of Boophilus microplus Bm86 in reducing tick infestation by the adult stage of the three-host tick R. appendiculatus. The results demonstrate the potential of Ra86 for vaccine development against this tick and for the control of East Coast fever.Keywords: baculovirus, Ra85A, Ra92A, Boophilus

  4. Efficacy benefit of an NK1 receptor antagonist (NK1RA) in patients receiving carboplatin: supportive evidence with NEPA (a fixed combination of the NK1 RA, netupitant, and palonosetron) and aprepitant regimens.

    Science.gov (United States)

    Jordan, Karin; Gralla, Richard; Rizzi, Giada; Kashef, Kimia

    2016-11-01

    Antiemetic guideline recommendations are inconsistent as to whether a neurokinin-1 receptor antagonist (NK1 RA) should be administered with a 5-hydroxytryptamine-3 (5HT3) RA + dexamethasone (DEX) in patients receiving carboplatin. Patients receiving cisplatin routinely receive an NK1 RA-containing regimen with a resulting 14-22 % benefit in no emesis rates over a 5-HT3 RA/DEX control. Recent studies suggest a similar benefit in patients receiving carboplatin. NEPA is the first fixed antiemetic combination agent and comprises the highly selective NK1 RA, netupitant, and pharmacologically distinct 5-HT3 RA, palonosetron (PALO). This paper presents the efficacy of NEPA in the subset of patients receiving carboplatin in a phase 3 trial (NCT01376297), in the context of aprepitant (APR) data in the carboplatin setting. One hundred ninety-six patients (47 % of all study patients: n = 145 NEPA + DEX; n = 51 APR + PALO + DEX) received carboplatin in a multinational, double-blind, randomized phase 3 study. Complete response (CR: no emesis/rescue) and no significant nausea (NSN: score ≤25 on 100 mm visual analog scale) rates were calculated. Cycle 1-4 overall (0-120 h) CR rates were similar for NEPA (80, 91, 92, and 93 %) and APR (82, 88, 88, and 90 %). Overall NSN rates were also similar (NEPA 84-96 %; APR 82-90 %). Response rates for NEPA and APR regimens were similar and consistent with prior studies evaluating the contribution of adding NK1 RAs in patients receiving carboplatin. Considering such evidence, guideline groups/practitioners should consider giving a NK1 RA antiemetic triplet in patients receiving carboplatin.

  5. Cleanliness of Canal Walls following Gutta-Percha Removal with Hand Files, RaCe and RaCe plus XP-Endo Finisher Instruments: A Photographic in Vitro Analysis.

    Science.gov (United States)

    Karamifar, Kasra; Mehrasa, Neda; Pardis, Pouyan; Saghiri, Mohammad Ali

    2017-01-01

    Gutta-percha must be removed from the root canal space during retreatment to ensure a more favorable outcome. The aim of this study was to compare the efficacy of hand instruments, RaCe and RaCe plus XP-endo finisher instruments in removal of gutta-percha from root canal walls during retreatment. Thirty single-rooted premolars were prepared, obturated, and divided into three groups according to retreatment method; in group 1, retreatment was carried out by hand instruments, while in groups 2 and 3 retreatment was done using RaCe rotary files alone or accompanied by XP-endo finisher instruments, respectively. After retreatment, teeth were sectioned longitudinally and photographic images were taken. The amount of remaining gutta-percha in coronal, middle and apical thirds was quantified using Image J software. The two-way ANOVA and post hoc Tukey's tests were used to analyze data. The level of significance was set at 0.05. RaCe cleaned the apical third significantly better than hand instrumentation. In the coronal third, RaCe+XP-endo finisher was more effective than RaCe. RaCe+XP-endo finisher was more effective than hand instrumentation in the entire root canal. The amount of remaining gutta-percha was the least in the apical part and increased toward the coronal part with the use of XP-endo finisher (P<0.05). Rotary instrumentation was more effective in removing gutta-percha from the canal walls. Furthermore, use of XP-endo finisher file resulted in cleaner canal walls and was more effective in removing gutta-percha from the coronal toward the apical part of the canal.

  6. MSFIA-LOV system for {sup 226}Ra isolation and pre-concentration from water samples previous radiometric detection

    Energy Technology Data Exchange (ETDEWEB)

    Rodríguez, Rogelio [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Environment and Energy Department, Advanced Materials Research Center (CIMAV) S.C., Miguel de Cervantes 120, Chihuahua, Chih. 31136 (Mexico); Borràs, Antoni [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Leal, Luz [Environment and Energy Department, Advanced Materials Research Center (CIMAV) S.C., Miguel de Cervantes 120, Chihuahua, Chih. 31136 (Mexico); Cerdà, Víctor [Department of Chemistry, University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Ferrer, Laura, E-mail: laura.ferrer@uib.es [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain)

    2016-03-10

    An automatic system based on multisyringe flow injection analysis (MSFIA) and lab-on-valve (LOV) flow techniques for separation and pre-concentration of {sup 226}Ra from drinking and natural water samples has been developed. The analytical protocol combines two different procedures: the Ra adsorption on MnO{sub 2} and the BaSO{sub 4} co-precipitation, achieving more selectivity especially in water samples with low radium levels. Radium is adsorbed on MnO{sub 2} deposited on macroporous of bead cellulose. Then, it is eluted with hydroxylamine to transform insoluble MnO{sub 2} to soluble Mn(II) thus freeing Ra, which is then coprecipitated with BaSO{sub 4}. The {sup 226}Ra can be directly detected in off-line mode using a low background proportional counter (LBPC) or through a liquid scintillation counter (LSC), after performing an on-line coprecipitate dissolution. Thus, the versatility of the proposed system allows the selection of the radiometric detection technique depending on the detector availability or the required response efficiency (sample number vs. response time and limit of detection). The MSFIA-LOV system improves the precision (1.7% RSD), and the extraction frequency (up to 3 h{sup −1}). Besides, it has been satisfactorily applied to different types of water matrices (tap, mineral, well and sea water). The {sup 226}Ra minimum detectable activities (LSC: 0.004 Bq L{sup −1}; LBPC: 0.02 Bq L{sup −1}) attained by this system allow to reach the guidance values proposed by the relevant international agencies e.g. WHO, EPA and EC. - Highlights: • Automatic, rapid and selective method for {sup 226}Ra extraction/pre-concentration from water. • MSFIA-LOV system performs a sample clean-up prior to {sup 226}Ra radiometric detection. • {sup 226}Ra sample preparation allows using two radiometric detectors (LBPC and LSC). • Environmental levels of {sup 226}Ra are easily quantified. • High sensitivity and selectivity are achieved, reaching the

  7. Retinoids, carotenoids, and tocopherols in breast adipose tissue and serum of benign breast disease and breast cancer patients

    Science.gov (United States)

    Various retinoic acid (RA) isomers (all-trans, 13-cis, 11-cis, and 9-cis) as well as retinol, carotenoids, and tocopherol concentrations were determined in both serum and breast adipose tissue of 22 benign breast disease patients and 52 breast cancer patients categorized into 4 stages by malignancy....

  8. American Association of Tissue Banks

    Science.gov (United States)

    ... Brightest in Tissue Banking FIND AATB ACCREDITED TISSUE BANK INSTITUTIONS SEARCH STANDARDS FOR TISSUE BANKING ACCESS CERTIFIED TISSUE BANK SPECIALISTS (CTBS) MANAGE QDEW Workshop | Baltimore, MD Save ...

  9. Average Frequency – RA Value for Reinforced Concrete Beam Strengthened with Carbon Fibre Sheet

    Directory of Open Access Journals (Sweden)

    Mohamad M. Z.

    2016-01-01

    Full Text Available Acoustic Emission (AE is one of the tools that can be used to detect the crack and to classify the type of the crack of reinforced concrete (RC structure. Dislocation or movement of the material inside the RC may release the transient elastic wave. In this situation, AE plays important role whereby it can be used to capture the transient elastic wave and convert it into AE parameters such as amplitude, count, rise time and duration. Certain parameter can be used directly to evaluate the crack behavior. But in certain cases, the AE parameter needs to add and calculate by using related formula in order to observe the behavior of the crack. Using analysis of average frequency and RA value, the crack can be classified into tensile or shear cracks. In this study, seven phases of increasing static load were used to observe the crack behavior. The beams were tested in two conditions. For the first condition, the beams were tested in original stated without strengthened with carbon fibre sheet (CFS at the bottom of the beam or called as tension part of the beam. For the second condition, the beams were strengthened with CFS at the tension part of the beam. It was found that, beam wrapped with CFS enhanced the strength of the beams in term of maximum ultimate load. Based on the relationship between average frequency (AF and RA value, the cracks of the beams can be classified.

  10. Lack of Association for Reported Endocrine Pancreatic Cancer Risk Loci in the PANDoRA Consortium.

    Science.gov (United States)

    Campa, Daniele; Obazee, Ofure; Pastore, Manuela; Panzuto, Francesco; Liço, Valbona; Greenhalf, William; Katzke, Verena; Tavano, Francesca; Costello, Eithne; Corbo, Vincenzo; Talar-Wojnarowska, Renata; Strobel, Oliver; Zambon, Carlo Federico; Neoptolemos, John P; Zerboni, Giulia; Kaaks, Rudolf; Key, Timothy J; Lombardo, Carlo; Jamroziak, Krzysztof; Gioffreda, Domenica; Hackert, Thilo; Khaw, Kay-Tee; Landi, Stefano; Milanetto, Anna Caterina; Landoni, Luca; Lawlor, Rita T; Bambi, Franco; Pirozzi, Felice; Basso, Daniela; Pasquali, Claudio; Capurso, Gabriele; Canzian, Federico

    2017-08-01

    Background: Pancreatic neuroendocrine tumors (PNETs) are rare neoplasms for which very little is known about either environmental or genetic risk factors. Only a handful of association studies have been performed so far, suggesting a small number of risk loci.Methods: To replicate the best findings, we have selected 16 SNPs suggested in previous studies to be relevant in PNET etiogenesis. We genotyped the selected SNPs (rs16944, rs1052536, rs1059293, rs1136410, rs1143634, rs2069762, rs2236302, rs2387632, rs3212961, rs3734299, rs3803258, rs4962081, rs7234941, rs7243091, rs12957119, and rs1800629) in 344 PNET sporadic cases and 2,721 controls in the context of the PANcreatic Disease ReseArch (PANDoRA) consortium.Results: After correction for multiple testing, we did not observe any statistically significant association between the SNPs and PNET risk. We also used three online bioinformatic tools (HaploReg, RegulomeDB, and GTEx) to predict a possible functional role of the SNPs, but we did not observe any clear indication.Conclusions: None of the selected SNPs were convincingly associated with PNET risk in the PANDoRA consortium.Impact: We can exclude a major role of the selected polymorphisms in PNET etiology, and this highlights the need for replication of epidemiologic findings in independent populations, especially in rare diseases such as PNETs. Cancer Epidemiol Biomarkers Prev; 26(8); 1349-51. ©2017 AACR. ©2017 American Association for Cancer Research.

  11. Upgrades for an improved measurement of the EDM of 225Ra

    Science.gov (United States)

    Rabga, Tenzin; Bailey, Kevin; Dietrich, Matthew R.; Greene, John P.; Holt, Roy J.; Korsch, Wolfgang; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Tom P.; Fromm, Steven; Ready, Roy; Singh, Jaideep T.

    2017-01-01

    If charge conjugation (C), parity (P) and time-reversal (T) symmetries, collectively form a good symmetry of nature, CPT, then T-violating phenomena would also violate CP. An Electric Dipole Moment (EDM) would violate time-reversal symmetry, and therefor EDMs provide a sensitive way for probing CP-violation that might explain the abundance of matter over anti-matter in the Universe. The 225Ra atom (t1/2 = 15 days, I = 1/2) is a particularly attractive candidate for an EDM search in diamagnetic atoms due to its octupole deformed nuclear structure, nearly degenerate parity doublet ground state, and a large mass, that make it sensitive to T-violating interactions in the nuclear sector. Our latest measurement limits the atomic EDM of 225Ra to be less than 1.4x10-23 e-cm (95% C.L). Further experimental upgrades are being implemented including an electric field upgrade to enhance the EDM sensitivity and STIRAP for an improved spin precession detection scheme. With these upgrades in place our EDM sensitivity should increase by nearly two orders of magnitude and allow us to substantially improve constraints on certain T-violating processes within the nucleus. This work is supported by the U.S. DOE, Office of Science, Office of Nuclear Physics, under contract DE-AC02-06CH11357 and the Michigan State University.

  12. Spectroscopy of Rn, Ra and Th isotopes using multi-nucleon transfer reactions

    CERN Document Server

    Cocks, J F C; Amzal, N; Butler, P A; Cann, K J; Greenlees, P T; Jones, G D; Asztalos, S; Clark, R M; Deleplanque, M A; Diamond, R M; Fallon, P; Lee, I Y; Macchiavelli, A O; MacLeod, R W; Stephens, F S; Jones, P; Julin, R; Broda, R; Fornal, B; Smith, J F; Lauritsen, T; Bhattacharya, P; Zhang, C T

    1999-01-01

    High-spin spectroscopy of Rn, Ra and Th isotopes has been performed. The nuclei have been populated using multi-nucleon transfer reactions involving a sup 2 sup 3 sup 2 Th target and a sup 1 sup 3 sup 6 Xe projectile. This type of reaction offers the only mechanism for populating high-spin states in many of these nuclei. Interleaving bands with opposite parities have been observed to high spin (approx 28(Planck constant/2 pi)) in sup 2 sup 1 sup 8 sup , sup 2 sup 2 sup 0 sup , sup 2 sup 2 sup 2 Rn, sup 2 sup 2 sup 2 sup , sup 2 sup 2 sup 4 sup , sup 2 sup 2 sup 6 sup , sup 2 sup 2 sup 8 Ra and sup 2 sup 2 sup 8 sup , sup 2 sup 3 sup 0 sup , sup 2 sup 3 sup 4 Th. A systematic study of the rotational alignment properties of octupole bands in radon, radium and thorium isotopes reveals information concerning the role of the octupole phonon and the onset of stable octupole deformation with increasing rotational frequency. Measurement of the magnitude of the intrinsic electric dipole moment, D sub 0 , provides addi...

  13. Rapid Reagentless Detection of M. tuberculosis H37Ra in Respiratory Effluents

    Energy Technology Data Exchange (ETDEWEB)

    Adams, K L; Steele, P T; Bogan, M J; Sadler, N M; Martin, S; Martin, A N; Frank, M

    2008-01-29

    Two similar mycobacteria, Mycobacteria tuberculosis H37Ra and Mycobacteria smegmatis are rapidly detected and identified within samples containing a complex background of respiratory effluents using Single Particle Aerosol Mass Spectrometry (SPAMS). M. tuberculosis H37Ra (TBa), an avirulent strain, is used as a surrogate for virulent tuberculosis (TBv); M. smegmatis (MSm) is utilized as a near neighbor confounder for TBa. Bovine lung surfactant and human exhaled breath condensate are used as first-order surrogates for infected human lung expirations from patients with pulmonary tuberculosis. This simulated background sputum is mixed with TBa or MSm and nebulized to produce conglomerate aerosol particles, single particles that contain a bacterium embedded within a background respiratory matrix. Mass spectra of single conglomerate particles exhibit ions associated with both respiratory effluents and mycobacteria. Spectral features distinguishing TBa from MSm in pure and conglomerate particles are shown. SPAMS pattern matching alarm algorithms are able to distinguish TBa containing particles from background matrix and MSm for >50% of the test particles, which is sufficient to enable a high probability of detection and a low false alarm rate if an adequate number of such particles are present. These results indicate the potential usefulness of SPAMS for rapid, reagentless tuberculosis screening.

  14. Concerted action of NIC relaxase and auxiliary protein MobC in RA3 plasmid conjugation.

    Science.gov (United States)

    Godziszewska, Jolanta; Moncalián, Gabriel; Cabezas, Matilde; Bartosik, Aneta A; de la Cruz, Fernando; Jagura-Burdzy, Grazyna

    2016-08-01

    Conjugative transfer of the broad-host-range RA3 plasmid, the archetype of the IncU group, relies on the relaxase NIC that belongs to the as yet uncharacterized MOBP4 subfamily. NIC contains the signature motifs of HUH relaxases involved in Tyr nucleophilic attack. However, it differs in the residue involved in His activation for cation coordination and was shown here to have altered divalent cation requirements. NIC is encoded in the mobC-nic operon preceded directly by oriT, where mobC encodes an auxiliary transfer protein with a dual function: autorepressor and stimulator of conjugative transfer. Here an interplay between MobC and NIC was demonstrated. MobC is required for efficient NIC cleavage of oriT in supercoiled DNA whereas NIC assists MobC in repression of the mobC-nic operon. A 7-bp arm of IR3 (IR3a) was identified as the binding site for NIC and the crucial nucleotides in IR3a for NIC recognition were defined. Fully active oriTRA3 was delineated to a 47-bp DNA segment encompassing a conserved cleavage site sequence, the NIC binding site IR3a and the MobC binding site OM . This highly efficient RA3 conjugative system with defined requirements for minimal oriT could find ample applications in biotechnology and computational biology where simple conjugative systems are needed. © 2016 John Wiley & Sons Ltd.

  15. Natural radioactivity levels (K, Th and Ra in some areas of Punjab, India

    Directory of Open Access Journals (Sweden)

    Kumar Sanjeev

    2012-04-01

    Full Text Available Radioactivity, natural and man-made, is omnipresent in the earth's crust in different amounts. Natural radioactive materials under certain conditions can reach hazardous radiological levels. So, it becomes necessary to study the natural radioactivity levels in soil to assess the dose for the population in order to know the health risks and to have a baseline for future changes in the environmental radioactivity due to human activities. 226Ra, 232Th and 40K analysis has been carried out in soil samples collected from some areas of Punjab, India using gamma-ray spectrometry. Phe technique of gamma ray spectrometry was applied using high purity germanium gamma-ray detector and a PC based MCA. Radium equivalent activities are calculated for the analyzed samples to assess radiation hazards arising due to the use of these soil samples in construction of dwellings. Phe measured activity in the soil ranges from 23.17 to 57.87 Bq kg−1, 59.03 to 160.40 Bq kg−1 and 228.06 to 501.03 Bq kg−1 for 226Ra, 232Ph and 40K with mean values of 37.93, 84.47 and 351.17Bqkg−1 respectively. It has been observed that on the average the outdoor terrestrial gamma air absorbed dose rate is about 84.65nGyh−1.

  16. Aniela Meyer Ginsberg e os estudos de raça/etnia e intercultura no Brasil

    Directory of Open Access Journals (Sweden)

    Renata Rocha Tsuji da Cunha

    2014-12-01

    Full Text Available Este ensaio delineia as contribuições de Aniela Meyer Ginsberg (1902-1986 para o estudo das relações étnico-raciais e interculturais no Brasil. Sua produção sobre estes temas – entre artigos, capítulos de livros e resumos de congressos – foi nosso objeto central de interesse. Influenciada pela agenda antirracista do pós-guerra, os processos inter e intraculturais, as relações étnico-raciais e as migrações estavam no centro de suas investigações. Aniela é uma personagem importante da história do pensamento psicológico brasileiro, seus estudos sobre raça/ etnia no Brasil configuram-se como estudos intraculturais da sociedade nacional e de suas amplas diversidades. A autora procurou desconstruir a visão determinista biológica das raças/etnias e mostrar que é na interação dos indivíduos com a sociedade que as diferenças podem transformar-se em desigualdades.

  17. Diffusion tensor imaging: the normal evolution of ADC, RA, FA, and eigenvalues studied in multiple anatomical regions of the brain

    Energy Technology Data Exchange (ETDEWEB)

    Loebel, Ulrike [University Hospital Jena, Institute of Diagnostic and Interventional Radiology, Jena (Germany); St. Jude Children' s Research Hospital, Department of Radiological Sciences, Memphis, TN (United States); Sedlacik, Jan [St. Jude Children' s Research Hospital, Department of Radiological Sciences, Memphis, TN (United States); University Hospital Jena, Medical Physics Group, Institute of Diagnostic and Interventional Radiology, Jena (Germany); Guellmar, Daniel [University Hospital Jena, Medical Physics Group, Institute of Diagnostic and Interventional Radiology, Jena (Germany); University Hospital Jena, Biomagnetic Center, Department of Neurology, Jena (Germany); Kaiser, Werner A.; Mentzel, Hans-Joachim [University Hospital Jena, Institute of Diagnostic and Interventional Radiology, Jena (Germany); Reichenbach, Juergen R. [University Hospital Jena, Medical Physics Group, Institute of Diagnostic and Interventional Radiology, Jena (Germany)

    2009-04-15

    The aim of our work was to investigate the process of myelination in healthy patients using the diffusion parameters apparent diffusion coefficient (ADC), relative anisotropy (RA), fractional anisotropy (FA), and eigenvalues. Age-dependent changes were assessed using the slope m of the fit functions that best described the data. Seventy-two patients (3 weeks-19 years) without pathological magnetic resonance imaging findings were selected from all pediatric patients scanned with diffusion tensor imaging over a 5-year period at our institution. ADC, RA, FA, and eigenvalue maps were calculated and regions of interest were selected in anterior/posterior pons, genu/splenium of corpus callosum (CC), anterior/posterior limb of internal capsule (IC), and white matter (WM) regions (frontal, temporal, parietal, occipital WM). Statistical analysis was performed using Spearman correlation coefficient and regression analysis. Mean values ranged 71.6 x 10{sup -5} to 90.3 x 10{sup -5} mm{sup 2}/s (pons/parietal WM) for ADC, 0.32-0.94 (frontal WM/CC) for RA, and 0.36-0.81 (frontal WM/splenium) for FA. Logarithmic fit functions best described the data. Strong age influences were observed for CC, pons, and parietal/frontal WM and changes were significant for all three eigenvalues, most pronounced for perpendicular eigenvalues. Changes in RA and FA differed depending on the structure anisotropy. Changes observed for ADC, RA, FA, and eigenvalues with age were consistent with previous findings. Changes detected for RA and FA varied due to the different scaling of both parameters. We found that the use of the largely linear scaled RA adds more valuable information for the assessment of age-dependent structural changes as compared to FA. Additionally, we report normative values for the diffusion parameters studied. (orig.)

  18. Retinoic acid signaling and mouse embryonic stem cell differentiation: Cross talk between genomic and non-genomic effects of RA.

    Science.gov (United States)

    Rochette-Egly, Cécile

    2015-01-01

    Retinoic acid (RA), the active derivative of vitamin A, a fat-soluble vitamin, plays key roles in cell growth and differentiation by activating nuclear receptors, RARs (α, β and γ), which are ligand dependent regulators of transcription. The past years highlighted several novelties in the field that increased the complexity of RA effects. Indeed, in addition to its classical genomic effects, RA also has extranuclear and non-transcriptional effects. RA induces the rapid and transient activation of kinase cascades, which are integrated in the nucleus via the phosphorylation of RARs at a conserved serine residue located in the N-terminal domain and their coregulators. In order to investigate the relevance of RARs' phosphorylation in cell differentiation, mouse embryonic stem (mES) cells were used as a model. When treated with RA, these pluripotent cells give rise to neuronal cells. Cells invalidated for each RAR were generated as well as stable rescue lines expressing RARs mutated in phosphor acceptor sites. Such a strategy revealed that RA-induced neuronal differentiation involves the RARγ2 subtype and requires RARγ2 phosphorylation. Moreover, in gene expression profiling experiments, the phosphorylated form of RARγ2 was found to regulate a small subset of genes through binding a novel RA response element consisting of two direct repeats with a 7 base pair spacer. These new findings suggest an important role for RAR phosphorylation during cell differentiation, and pave the way for further investigations with other cell types and during embryonic development. This article is part of a Special Issue entitled Linking transcription to physiology in lipodomics. Copyright © 2014 Elsevier B.V. All rights reserved.

  19. RaMP: A Comprehensive Relational Database of Metabolomics Pathways for Pathway Enrichment Analysis of Genes and Metabolites.

    Science.gov (United States)

    Zhang, Bofei; Hu, Senyang; Baskin, Elizabeth; Patt, Andrew; Siddiqui, Jalal K; Mathé, Ewy A

    2018-02-22

    The value of metabolomics in translational research is undeniable, and metabolomics data are increasingly generated in large cohorts. The functional interpretation of disease-associated metabolites though is difficult, and the biological mechanisms that underlie cell type or disease-specific metabolomics profiles are oftentimes unknown. To help fully exploit metabolomics data and to aid in its interpretation, analysis of metabolomics data with other complementary omics data, including transcriptomics, is helpful. To facilitate such analyses at a pathway level, we have developed RaMP (Relational database of Metabolomics Pathways), which combines biological pathways from the Kyoto Encyclopedia of Genes and Genomes (KEGG), Reactome, WikiPathways, and the Human Metabolome DataBase (HMDB). To the best of our knowledge, an off-the-shelf, public database that maps genes and metabolites to biochemical/disease pathways and can readily be integrated into other existing software is currently lacking. For consistent and comprehensive analysis, RaMP enables batch and complex queries (e.g., list all metabolites involved in glycolysis and lung cancer), can readily be integrated into pathway analysis tools, and supports pathway overrepresentation analysis given a list of genes and/or metabolites of interest. For usability, we have developed a RaMP R package (https://github.com/Mathelab/RaMP-DB), including a user-friendly RShiny web application, that supports basic simple and batch queries, pathway overrepresentation analysis given a list of genes or metabolites of interest, and network visualization of gene-metabolite relationships. The package also includes the raw database file (mysql dump), thereby providing a stand-alone downloadable framework for public use and integration with other tools. In addition, the Python code needed to recreate the database on another system is also publicly available (https://github.com/Mathelab/RaMP-BackEnd). Updates for databases in RaMP will be

  20. The IL-1Ra gene variable number tandem repeat variant is associated with susceptibility to temporomandibular disorders in Turkish population.

    Science.gov (United States)

    Tumer, Mehmet Kemal; Nursal, Ayse Feyda; Tekcan, Akin; Yerliyurt, Kaan; Geyko, Anastasia; Yigit, Serbulent

    2017-06-14

    Temporomandibular joint disorders (TMD) are a group of disorders involving temporomandibular joint and related structures. Interleukine-1 receptor antagonist (IL-1Ra) is an important anti-inflammatory molecule that competes with other interleukin-1 molecules. This study was designed to investigate the possible association of the IL-1Ra VNTR variant with the risk of TMD in the Turkish population. Peripheral blood samples were collected from 100 patients with TMD (23 males, 77 females) and 110 healthy individuals (35 males, 75 females). Genotyping of IL-1Ra 86 bp VNTR variant was evaluated by gel electrophoresis after polymerase chain reaction (PCR). Our results show that there is a statistically significant difference between TMD patients and control group with respect to IL-1Ra genotype distribution and allele frequencies. 1.2, 1.4, and 4.4 genotypes were more common in patients, while 2.2 and 3.3 genotypes were rarer (P<.000). Frequency of alleles 1 and 4 was higher in patient groups (P<.000), whereas alleles 2 and 3 had a lower frequency in patients with TMD (P<.000). This is the first correlation study that evaluates the association between IL-1Ra gene VNTR variant and TMD. The VNTR variant related to IL-1Ra gene showed a strong pattern of association with TMD that may have a potential impact on disease counseling and management. Larger studies with various ethnicities are needed to establish the impact of IL-1Ra VNTR variant on risk of developing TMD. © 2017 Wiley Periodicals, Inc.

  1. Electrochemical corrosion assessment of RaCe and Mtwo rotary nickle-titanium instruments after clinical use and sterilization

    Science.gov (United States)

    Shahi, Shahriar; Rahimi, Saeed; Shiezadeh, Vahab; Ashasi, Habib; Abdolrahimi, Majid; Foroughreyhani, Mohammad

    2012-01-01

    Aim: The aim of the present study was to electrochemically evaluate corrosion resistance of RaCe and Mtwo files after repeated sterilization and preparation procedures. Study Design: A total of 450 rotary files were used. In the working groups, 72 files from each file type were distributed into 4 groups. RaCe and Mtwo files were used to prepare one root canal of the mesial root of extracted human mandibular first molars. The procedure was repeated to prepare 2 to 8 canals. The following irrigation solutions were used: group 1, RaCe files with 2.5% NaOCl; group 2, RaCe files with normal saline; group 3, Mtwo files with 2.5% NaOCl; and group 4, Mtwo files with normal saline in the manner described. In autoclave groups, 72 files from each file type were evenly distributed into 2 groups. Files were used for a cycle of sterilization without the use of files for root canal preparation. Nine new unused files from each file type were used as controls. Then the instruments were sent for corrosion assessment. Mann-Whitney U and Wilcoxon tests were used for independent and dependent groups, respectively. Results: Statistical analysis indicated that there were significant differences in corrosion resistance of files associated with working and autoclave groups between RaCe and Mtwo file types (pCorrosion resistance of #25, #30, and #35 Mtwo files is significantly higher than that in RaCe files with similar sizes. Key words:Corrosion, NiTi instruments, autoclave, RaCe, Mtwo. PMID:22143690

  2. Effect of duration of exposure to RaCl{sub 2} and a radium apatite from freshwater mussels on intestinal transport and bone deposition of radium

    Energy Technology Data Exchange (ETDEWEB)

    Domel, R.U. [Australian Nuclear Science and Technology Organsiation, Lucas Heights, NSW (Australia). Environment Division; Beal, A.M. [University of New South Wales, NSW (Australia). Biological Science

    1997-10-01

    Natural leaching of uranium ore bodies can result in {sup 226}Ra pollution of adjacent waterways and consequent incorporation of radium into the food chain. Mining has the potential to augment this effect. In the Magela flood plain, Northern Territory, the freshwater mussel (Velesunio angasi) concentrates radium in its tissues as a phosphate compound. The availability of mussel radium for uptake and tissue incorporation was assessed relative to radium chloride using rats. The results were compared for jejunal transport (in situ in vivo, ligated segment using anaesthetised animals) and feed trial experiments. In addition, the influence of age and duration of dosage (hours in the case of the jejunal transport and weeks in the feed trial studies) were investigated. Mussel radium transport across the jejunum of adults and juveniles (<0.3%) was very small when compared to radium chloride (50% injected dose). The amount of mussel radium available for intestinal uptake in the feed trials was also low (<0.5%) but significant when compared to the uptake of radium chloride (< 1.5%). Incorporation of mussel radium into bone was less than that of radium chloride (p=0.0001) for both adults and juveniles. Extrapolation of the data from the animal model to humans suggests that eating these mussels carries with it only a low risk of exceeding the Annual Limit of Intake (ALI) set for members of the public, even in juveniles 18 refs., 5 figs.

  3. Developing a construct to evaluate flares in rheumatoid arthritis: a conceptual report of the OMERACT RA Flare Definition Working Group.

    Science.gov (United States)

    Alten, Rieke; Pohl, Christof; Choy, Ernest H; Christensen, Robin; Furst, Daniel E; Hewlett, Sarah E; Leong, Amye; May, James E; Sanderson, Tessa C; Strand, Vibeke; Woodworth, Thasia G; Bingham, Clifton O

    2011-08-01

    Rheumatoid arthritis (RA) patients and healthcare professionals (HCP) recognize that episodic worsening disease activity, often described as a "flare," is a common feature of RA that can contribute to impaired function and disability. However, there is no standard definition to enable measurement of its intensity and impact. The conceptual framework of the Outcome Measures in Rheumatology Clinical Trials (OMERACT) RA Flare Definition Working Group includes an anchoring statement, developed at OMERACT 9 in 2008: "flare in RA" is defined as worsening of signs and symptoms of sufficient intensity and duration to lead to change in therapy. Subsequently, domains characterizing flare have been identified by comprehensive literature review, patient focus groups, and patient/HCP Delphi exercises. This led to a consensus regarding preliminary domains and a research agenda at OMERACT 10 in May 2010. The conceptual framework of flare takes into account validated approaches to measurement in RA: (1) various disease activity indices (e.g., Disease Activity Score, Clinical Disease Activity Index, Simplified Disease Activity Index); (2) use of patient-reported outcomes (PRO); and (3) characterization of minimally clinically detectable and important differences (MCDD, MCID). The measurement of RA flare is composed of data collection assessing a range of unique domains describing key features of RA worsening at the time of patient self-report of flare, and then periodically for the duration of the flare. The components envisioned are: (1) Patient self-report using a "patient global question" with well characterized and validated anchors; (2) Patient assessment using a flare questionnaire and PRO available at the time of each self-report; (3) Physician/HCP assessment of disease activity status; and (4) Physician's determination whether to change treatment. In randomized controlled trials and observational studies, such a conceptual approach is intended to lead to a valid measure of

  4. Differential effects of Th1 versus Th2 cytokines in combination with hypoxia on HIFs and angiogenesis in RA

    Science.gov (United States)

    2012-01-01

    Introduction Hypoxia and T-helper cell 1 (Th1) cytokine-driven inflammation are key features of rheumatoid arthritis (RA) and contribute to disease pathogenesis by promoting angiogenesis. The objective of our study was to characterise the angiogenic gene signature of RA fibroblast-like synoviocytes (FLS) in response to hypoxia, as well as Th1 and T-helper cell 2 (Th2) cytokines, and in particular to dissect out effects of combined hypoxia and cytokines on hypoxia inducible transcription factors (HIFs) and angiogenesis. Methods Human angiogenesis PCR arrays were used to screen cDNA from RA FLS exposed to hypoxia (1% oxygen) or dimethyloxalylglycine, which stabilises HIFs. The involvement of HIF isoforms in generating the angiogenic signature of RA FLS stimulated with hypoxia and/or cytokines was investigated using a DNA-binding assay and RNA interference. The angiogenic potential of conditioned media from hypoxia-treated and/or cytokine-treated RA FLS was measured using an in vitro endothelial-based assay. Results Expression of 12 angiogenic genes was significantly altered in RA FLS exposed to hypoxia, and seven of these were changed by dimethyloxalylglycine, including ephrin A3 (EFNA3), vascular endothelial growth factor (VEGF), adipokines angiopoietin-like (ANGPTL)-4 and leptin. These four proangiogenic genes were dependent on HIF-1 in hypoxia to various degrees: EFNA3 >ANGPTL-4 >VEGF >leptin. The Th1 cytokines TNFα and IL-1β induced HIF-1 but not HIF-2 transcription as well as activity, and this effect was additive with hypoxia. In contrast, Th2 cytokines had no effect on HIFs. IL-1β synergised with hypoxia to upregulate EFNA3 and VEGF in a HIF-1-dependent fashion but, despite strongly inducing HIF-1, TNFα suppressed adipokine expression and had minimal effect on EFNA3. Supernatants from RA FLS subjected to hypoxia and TNFα induced fewer endothelial tubules than those from FLS subjected to TNFα or hypoxia alone, despite high VEGF protein levels. The Th2

  5. Stages of change, barriers, benefits, and preferences for exercise in RA patients: a cross-sectional study.

    Science.gov (United States)

    Henchoz, Y; Zufferey, P; So, A

    2013-01-01

    To determine the distribution of exercise stages of change in a rheumatoid arthritis (RA) cohort, and to examine patients' perceptions of exercise benefits, barriers, and their preferences for exercise. One hundred and twenty RA patients who attended the Rheumatology Unit of a University Hospital were asked to participate in the study. Those who agreed were administered a questionnaire to determine their exercise stage of change, their perceived benefits and barriers to exercise, and their preferences for various features of exercise. Eighty-nine (74%) patients were finally included in the analyses. Their mean age was 58.4 years, mean RA duration 10.1 years, and mean disease activity score 2.8. The distribution of exercise stages of change was as follows: precontemplation (n = 30, 34%), contemplation (n = 11, 13%), preparation (n = 5, 6%), action (n = 2, 2%), and maintenance (n = 39, 45%). Compared to patients in the maintenance stage of change, precontemplators exhibited different demographic and functional characteristics and reported less exercise benefits and more barriers to exercise. Most participants preferred exercising alone (40%), at home (29%), at a moderate intensity (64%), with advice provided by a rheumatologist (34%) or a specialist in exercise and RA (34%). Walking was by far the preferred type of exercise, in both the summer (86%) and the winter (51%). Our cohort of patients with RA was essentially distributed across the precontemplation and maintenance exercise stages of change. These subgroups of patients exhibit psychological and functional differences that make their needs different in terms of exercise counselling.

  6. A theoretical model for the production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Fan Liu, Sau; Allen, B J

    2006-09-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation on a small scale by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) to produce Ra-225, which subsequently decays to Ac-225, which can be used as a generator to produce Bi-213 for use in 'targeted alpha therapy' for cancer. This paper examines the possibility of producing Ac-225 with a linac using an accurate theoretical model in which the bremsstrahlung photon spectrum at 18 MV linac electron energy is convoluted with the corresponding photonuclear cross sections of Ra-226. The total integrated yield can then be obtained and is compared with a computer simulation. This study shows that at 18 MV, the photonuclear reaction on Ra-226 can produce low activities of Ac-225 with a linac. However, a high power linac with high current, pulse length and frequency is needed to produce practical amounts of Ac-225 and a useful reduction of Ra-226.

  7. Effect of reciprocating agitation thermal processing (RA-TP) on quality of canned tomato (Solanum lycopersicum) puree.

    Science.gov (United States)

    Pratap Singh, Anubhav; Singh, Anika; Ramaswamy, Hosahalli S

    2017-06-01

    Reciprocating agitation thermal processing (RA-TP) is a recent innovation in the field of canning for obtaining high-quality canned food. The objective of this study was to compare RA-TP processing with conventional non-agitated (still) processing with respect to the impact on quality (color, antioxidant capacity, total phenols, carotenoid and lycopene contents) of canned tomato (Solanum lycopersicum) puree. Owing to a 63-81% reduction in process times as compared with still processing, tomato puree with a brighter red color (closer to fresh) was obtained during RA-TP. At 3 Hz reciprocation frequency, the loss of antioxidant, lycopene and carotenoid contents could be reduced to 34, 8 and 8% respectively as compared with 96, 41 and 52% respectively during still processing. In fact, the phenolic content for RA-TP at 3 Hz was 5% higher than in fresh puree. Quality retention generally increased with an increase in frequency, although the differences were less significant at higher reciprocation frequencies (between 2 and 3 Hz). Research findings indicate that RA-TP can be effective to obtain thermally processed foods with high-quality attribute retention. It can also be concluded that a very high reciprocation frequency (>3 Hz) is not necessarily needed and significant quality improvement can be obtained at lower frequencies (∼2 Hz). © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  8. Ra Tracer-Based Study of Submarine Groundwater Discharge and Associated Nutrient Fluxes into the Bohai Sea, China: A Highly Human-Affected Marginal Sea

    Science.gov (United States)

    Liu, Jianan; Du, Jinzhou; Yi, Lixin

    2017-11-01

    Nutrient concentrations in coastal bays and estuaries are strongly influenced by not only riverine input but also submarine groundwater discharge (SGD). Here we estimate the SGD and the fluxes of the associated dissolved inorganic nitrogen (DIN), phosphorus (DIP), and silicon (DSi) into the Bohai Sea based on a 226Ra and 228Ra mass balance model. This procedure shows that in the Bohai Sea the average radium activities (dpm 100 L-1) are 42.8 ± 6.3 (226Ra) and 212 ± 41.7 (228Ra) for the surface water and 43.0 ± 6.1 (226Ra) and 216 ± 38.4 (228Ra) for the near-bottom water. According to the 228Ra/226Ra age model, the residence time in the Bohai Sea is calculated to be 1.7 ± 0.8 yrs. The mass balance of 226Ra and 228Ra suggests that the yearly SGD flux into the whole Bohai Sea is (2.0 ± 1.3) × 1011 m3 yr-1, of which the percentage of submarine fresh groundwater discharge (SFGD) to the total SGD is approximately (5.1 ± 4.1)%. However, the DIN and DSi fluxes from SFGD constitute 29% and 10%, respectively, of the total fluxes from the SGD. Moreover, nutrient loads, which exhibit high DIN/DIP from SGD, especially the SFGD, may substantially contribute to the nutrient supplies, resulting in the occurrence of red tide in the Bohai Sea.

  9. Våld i nära relationer : En diskursanalys kring framställningar om våld i nära relationer i tidskriften Socionomen

    OpenAIRE

    Alakokkare, Marlene; Andreasson, Cecilia

    2014-01-01

    Syftet med denna kvalitativa uppsats är att undersöka hur våld i nära relationer framställs i tidskriften Socionomen. Vår empiri består av 42 artiklar som berör våld i nära relationer. Artiklarna är publicerade mellan åren 1997 - 2013 i tidskriften Socionomen. Uppsatsens teoretiska utgångspunkt är ett socialkonstruktionistiskt perspektiv, som bidrar med att synliggöra sociala konstruktioner inom forskningsområdet. Som analysmetod används en form av diskursanalys för att urskilja subjektsposit...

  10. [Discontinuation of immunosuppressive and immunomodulatory drugs in connective tissue diseases].

    Science.gov (United States)

    Targońska-Stępniak, Bożena

    2015-01-01

    Remission in connective tissue diseases became a realistic goal of therapy nowadays. However, there is lack of recommendations on the management after achieving a remission. Chronic exposure to immunosuppressive or immunomodulatory drugs may be associated with adverse events, that is why temporal withdrawal or discontinuation of treatment is advisable. In patients with rheumatoid arthritis (RA) who achieve sustained remission lasting for 6-12 months, an attempt to withdraw biological disease modifying antirheumatic drugs (bDMARDs) may be considered. In most patients with established RA discontinuation of bDMARDs is accompanied by a disease flare, butthe risk of loss of good therapeutic response is lower in case of slowly tapering by expanding the interval between doses or reducing the dose of bDMARDs. Patients with early RA are more likely to have successful discontinuation of therapy. Discontinuation of conventional DMARDs (cDMARDs) is usually associated with a disease flare, that is why tapering of doses is advised rather than stopping cDMARDs. DMARDs free remission occurs relatively rare, more often in patients with seronegative RA and with early onset of modifying treatment. In lupus nephritis (LN) patients with persistent, long-term remission, progressive tapering of doses of immunosuppressive drugs and glucocorticoids is recommended, with treatment discontinuation as a goal. An attempt of treatment withdrawal may be taken in patients remaining in LN complete remission as a consequence of maintenance therapy for 3 years.The process of slow tapering of doses preceding discontinuation of drugs, may last several months. The therapy with antimalarial drugs may be helpful to maintain remission after the treatment discontinuation. There is few data on treatment discontinuation in patients with systemic lupus erythematosus (SLE) without kidney involvement. Immunosuppressive drugs withdrawal is usually performed in patients with stable serological and clinically

  11. A Rapid Deployment Seismological network (RaDeSeis) for real time aftershock studies

    Science.gov (United States)

    Hloupis, G.; Vallianatos, F.; Makris, J. P.

    2009-04-01

    The understanding of earthquake faulting process is one of the main factors that contribute to earthquake damage. One of the most valuable and essential tools for the understanding of faulting process in the analysis of aftershocks. The critical point for successful aftershock studies is the mobile seismological network that will deployed in order to provide the required data. The main problem that arise for these networks is how fast the recorded data are available to data centres in order to estimate the focal mechanisms, the source parameters estimation as well as to examine microseismic activity. The ideal situation is to have these data available in real time but this is limited by the different telemetry requirements for every individual installation. Based on the experience gained from several installations in Hellenic Seismological Network of Crete (HSNC) we propose a mobile network scheme (called RaDeSeis) capable of installed in a limited amount of time and provide real time seismological data. RaDeSeis is an hybrid network based on VSAT and WiFi communication links between seismological stations and data centre. The network is deployed in star topology where the central station is the communication hub at the same time. Dedicated point-to-point links between central station and border station established using WiFi links. Communication between central station and data centre is established by VSAT. With appropriate routing on central station the data centre is collecting, control and monitor all the stations from the area of interest in real time. In order to decrease the time needed for each installation a specific software (RaLiEs - Rapid Link Establishment) is originated for the quicker link establishment between border stations and central station (with an average distance of 40km LOS) as well as to data centre. By using this software each telecommunication installation needs less than half an hour to complete the necessary link adjustments

  12. Multiplexed lasing in tissues

    Science.gov (United States)

    Chen, Yu-Cheng; Chen, Qiushu; Fan, Xudong

    2017-02-01

    Biolasers are an emerging technology for next generation biochemical detection and clinical applications. Progress has recently been made to achieve lasing from biomolecules and single living cells. Tissues, which consist of cells embedded in extracellular matrix, mimic more closely the actual complex biological environment in a living body and therefore are of more practical significance. Here, we developed a highly versatile tissue laser platform, in which tissues stained with fluorophores are sandwiched in a high-Q Fabry-Pérot microcavity. Distinct lasing emissions from muscle and adipose tissues stained respectively with fluorescein isothiocyanate (FITC) and boron-dipyrromethene (BODIPY), and hybrid muscle/adipose tissue with dual-staining were achieved with a threshold of only 10 μJ/mm2. Additionally, we investigated how tissue structure/geometry, tissue thickness, and staining dye concentration affect the tissue laser. It is further found that, despite large fluorescence spectral overlap between FITC and BODIPY in tissues, their lasing emissions could be clearly distinguished and controlled due to their narrow lasing bands and different lasing thresholds, thus enabling highly multiplexed detection. Our tissue laser platform can be broadly applicable to various types of tissues/diseases. It provides a new tool for a wide range of biological and biomedical applications, such as diagnostics/screening of tissues and identification/monitoring of biological transformations in tissue engineering.

  13. Assessment of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb concentration in mineral waters from Parque das Águas de Lambari and Contendas, MG and evaluation of the committed effective doses

    Energy Technology Data Exchange (ETDEWEB)

    Wakasugi, Denise S.M.; Damatto, Sandra R., E-mail: denise.sanny@usp.br, E-mail: damatto@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2017-11-01

    The exploration of several Brazilian hydromineral resorts, that have springs of radioactive mineral water consumed by the population support the relevance of the present work. This study is being developed in the IPEN with the aid of the responsible for Parque das Águas de Lambari and Contendas. Thereby, this work aims to determine the activity concentrations of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb to verify the influence of seasonality in these water parks springs. Thereunto, gross alpha and beta measurements were used after radiochemical separation for these radionuclides determination and measurement in a low background proportional detector. The results showed that Parque das Águas de Lambari presented highest concentration values when compared with Contendas. In Parque das Águas de Contendas , the highest concentration values were 77 ± 5 mBq/L and 129 ± 5 mBq/L for {sup 226}Ra for Gasosa II springs and {sup 228}Ra for Gasosa I spring, respectively, which correspond to the spring season; for {sup 210}Pb, 27 ± 2 mBq/L for Magnesiana spring in the same season. In Parque das Águas de Lambari, the highest concentration values for {sup 226}Ra was 177 ± 2 mBq/L and for {sup 210}Pb, 36 ± 2 mBq/L, both in the Magnesiana spring, for the summer season and 135 ± 5 mBq/L for {sup 228}Ra, in Magnesiana spring, for the spring season. The data were analyzed through descriptive and correlational statistical techniques. Therefore, it was possible to evaluate the committed effective doses due to the consumption of these waters and to assess the radiological risk for the radionuclides studied. (author)

  14. Activity concentration and radiological impact assessment of 226Ra, 228Ra and 40K in drinking waters from (OML) 30, 58 and 61 oil fields and host communities in Niger Delta region of Nigeria.

    Science.gov (United States)

    Agbalagba, E O; Avwiri, G O; Ononugbo, C P

    2013-02-01

    This paper presents the concentrations of naturally occurring radionuclides ((226)Ra, (228)Ra and (40)K) measured in hand dug wells, boreholes and river waters collected from three oil mineral leases (OML) 30, 58 & 61 oil and gas fields onshore of the Niger delta, using gamma spectroscopy. Fifty-four water samples from the three sources of drinking water supply were collected within the oil fields and host communities and three water samples from a control site. The results showed average activity concentrations of (226)Ra, (228)Ra and (40)K as 8.9 ± 1.0, 8.1 ± 0.9 and 39.8 ± 3.3 respectively for hand dug wells, 4.4 ± 0.8, 4.6 ± 0.5 and 28.5 ± 3.0 for borehole water and 8.2 ± 1.0, 6.7 ± 0.7 and 32.1 ± 3.5 for river water respectively. These (226)Ra, (228)Ra and (40)K average are well above the WHO permissible levels of 1.0, 0.1 and 10 BqL(-1) respectively and also above the control values. Although the hazard indices calculated are still within their tolerable levels, the estimated committed effective dose due to intake of the sampled water for all the four age groups considered are far above the ICPR 0.1 mSvyr(-1) maximum permissible limit. The result indicates some level of water pollution in the studied area. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Dissolution of [²²⁶Ra]BaSO₄ and partial separation of ²²⁶Ra from radium/barium sulfate: A new treatment method for NORM waste from petroleum industry.

    Science.gov (United States)

    Al Abdullah, Jamal; Al Masri, M S; Amin, Yusr

    2016-01-01

    Complete dissolution of [(226)Ra]BaSO4 precipitate was successfully performed using NaNO2 as a reducing agent in acidic solution at room temperature. Results showed a significant effect of acid and NaNO2 concentrations and temperature on the dissolution efficiency. The method was successfully used for separation of radium from NORM scale samples from the petroleum industry; sufficient volume reduction of NORM waste was achieved. The obtained (226)Ra solution was purified using two separation methods. The dissolution method can be of great interest in the development of radiochemical analysis of radium isotopes. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Laser/tissue interaction.

    Science.gov (United States)

    Dederich, D N

    1991-01-01

    When laser light impinges on tissue, it can reflect, scatter, be absorbed, or transmit to the surrounding tissue. Absorption controls to a great degree the extent to which reflection, scattering and transmission occur, and wavelength is the primary determinant of absorption. The CO2 laser is consistently absorbed by most materials and tissues and the Nd-YAG laser wavelength is preferentially absorbed in pigmented tissues. The factors which determine the initial tissue effect include the laser wavelength, laser power, laser waveform, tissue optical properties, and tissue thermal properties. There are almost an infinite number of combinations of these factors possible, many of which would result in unacceptable damage to the tissues. This underscores the need to thoroughly test any particular combination of these factors on the conceptual, in-vitro, and in-vivo level before a treatment is offered.

  17. Plant tissue culture techniques

    Directory of Open Access Journals (Sweden)

    Rolf Dieter Illg

    1991-01-01

    Full Text Available Plant cell and tissue culture in a simple fashion refers to techniques which utilize either single plant cells, groups of unorganized cells (callus or organized tissues or organs put in culture, under controlled sterile conditions.

  18. FRD tissue archive

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The fishery genetics tissue collection has over 80,000 tissues stored in 95% ethanol representing fishes and invertebrates collected globally but with a focus on the...

  19. Business Process Optimization Through Soa And Cloud Integration Using Soa- Ra Model

    Directory of Open Access Journals (Sweden)

    Syed Ejaz Ali Shah

    2015-08-01

    Full Text Available Business processes workflow architecture based on agility and flexibility plays an important role in the success of any enterprise. In new era most of the processes are automated and they are supported by IT-Services in the form of Service Oriented Architecture SOA components. Due to mobility and scalability as well as high performance computing and distributed working environment it is crucial to focus on an architecture which is agile optimized cost effective and easy to implement. In this paper we have conducted a research study on layer based BPM SOA and cloud integrated architecture. The main contribution of the research study is to propose an agile cost effective and scalable solution framework based on Architectural Building Blocks ABBs following a SOA-RA layered model to integrate BPM SOA and cloud services.

  20. Distributed chaos and Rayleigh-Benard turbulence at very high Ra

    CERN Document Server

    Bershadskii, A

    2016-01-01

    It is shown, by the means of distributed chaos approach and using the experimental data, that at very large Rayleigh number $Ra > 10^{14}$ and Prandtl number $Pr \\sim 1$ the Rayleigh-B\\'{e}nard turbulence can undergo a transition related to spontaneous breaking of the fundamental Lagrangian relabeling symmetry. Due to the Noether's theorem helicity plays central role in this process. After the transition the temperature spectrum has a stretched exponential form $E (k) \\propto \\exp(-k/k_{\\beta})^{\\beta}$ with $\\beta =2/5$ both at the cell midplain and at the near-wall (low boundary) regions. There is a similarity between this phenomenon and the effects of polymer additives.

  1. PARALLELISM BETWEEN DP AND CP BASED ON NOMINALIZATIONS IN TENETEHÁRA LANGUAGE

    Directory of Open Access Journals (Sweden)

    Quesler Fagundes Camargos

    2013-12-01

    Full Text Available In this paper, we investigate the nominalization constructions in Tenetehára language (Tupí-Guaraní family in order to demonstrate that both the DP and the CP contain the functional head To and Aspo which are responsible for encoding the tense and aspectual meaning of the sentences. Following the essential ideas of Chomsky’s (2000, 2001 proposal, our hypothesis is that the temporal morphemes that appear in DPs and in TPs can be treated as a morphological instantiations of the functional head To. They also serve as a piece of evidence that there really occurs the structural Case assignment to possessors and to internal arguments both within the CP and within the DP

  2. Real life Dosages and Costs of TNFα inhibitor therapy for RA patients in Denmark

    DEFF Research Database (Denmark)

    Hostenkamp, Gisela; Sørensen, Jan; Hetland, Merete Lund

    2009-01-01

    about the true long run cost. Taking the actual medication practice into account is important for the evaluation of the costs and optimal sequencing of new and existing biological treatments. Objectives: To investigate the drug cost of TNF-inhibitors in the treatment of RA using real-life data from...... of treatment. Cost estimates based on short term observational data or on instruction leaflets from manufacturers may provide wrong cost assessments of TNF-alpha therapy. It is important to take the long term cost structure into account to arrive at unbiased treatment cost estimates.......Background: When estimating the cost of biological treatment many analyses rely on cross sectional data or standard consumption patterns indicated in the manufacturers' instruction leaflet. Unless such consumption patterns truly reflect routine clinical practice they may result in wrong assumptions...

  3. Estudo farmacognóstico das raízes de Jacaranda decurrens Cham. (carobinha

    Directory of Open Access Journals (Sweden)

    T.B. Oliveira

    Full Text Available Este trabalho estabelece parâmetros farmacognósticos para as raízes de Jacaranda decurrens Cham., Bignoniaceae, conhecida na medicina popular como carobinha. Características morfológicas e histológicas, prospecção fitoquímica, teor de cinzas e de açúcares redutores são descritos. Encontrou-se presença de esteróides/triterpenos, açúcares redutores, amido, mucilagem e saponinas. O teor de cinzas totais foi de 2,21%, e insolúveis em ácido de 0,63%; a umidade, de 6,42% e o teor de açúcares redutores foi de 2,77%.

  4. Las raíces socioestructurales del terrorismo fundamentalista islámico

    Directory of Open Access Journals (Sweden)

    Antonio J. Romero-Ramírez

    2013-01-01

    Full Text Available El terrorismo fundamentalista islámico no es un fenómeno monolítico, ya que es protagonizado por múltiples y variados actores. A pesar de su diversidad, este fenómeno hunde sus raíces en la propia trayectoria histórica de los países árabe-musulmanes, y en el tipo de estructura política, social y económica de estas sociedades. El análisis de dicha serie de variables es indispensable para poder interpretar el papel y la eficacia del terrorismo fundamentalista islámico en el mundo actual.

  5. Elements of record management system for the RA research reactor decommissioning

    Directory of Open Access Journals (Sweden)

    Stejić Milijana

    2004-01-01

    Full Text Available According to latest recommendations, the record management system of a nuclear facility should operate as a part of the integrated management information system, and is implemented at the very beginning of the facility’s life cycle. The record management becomes particularly important at the end of the operation of a facility and then the operational record management system gradually transforms to a decommissioning one. However there is a significant number of nuclear facilities in the world which have reached the decommissioning stage with out having neither the initial decommissioning plan nor the established record management system. The objective of this paper is to introduce constituted elements of the record management system for the decommissioning of the RA research reactor in the VINČA Institute of Nuclear Sciences, and to discuss future planned actions related to this matter.

  6. ExoMars Lander Radioscience LaRa, a Space Geodesy Experiment to Mars.

    Science.gov (United States)

    Dehant, V.; Le Maistre, S.; Baland, R. M.; Yseboodt, M.; Peters, M. J.; Karatekin, O.; Rivoldini, A.; Van Hoolst, T.

    2017-09-01

    The LaRa (Lander Radioscience) experiment is designed to obtain coherent two-way Doppler measurements from the radio link between the ExoMars lander and Earth over at least one Martian year. The Doppler measurements will be used to observe the orientation and rotation of Mars in space (precession, nutations, and length-of-day variations), as well as polar motion. The ultimate objective is to obtain information / constraints on the Martian interior, and on the sublimation / condensation cycle of atmospheric CO2. Rotational variations will allow us to constrain the moment of inertia of the entire planet, including its mantle and core, the moment of inertia of the core, and seasonal mass transfer between the atmosphere and the ice caps.

  7. Composition and Antioxidant Activity of Geopropolis Collected by Melipona subnitida (Jandaíra) Bees.

    Science.gov (United States)

    Alves de Souza, Silvana; Camara, Celso Amorim; Monica Sarmento da Silva, Eva; Silva, Tania Maria Sarmento

    2013-01-01

    An investigation of the geopropolis collected by Melipona subnitida (jandaíra) stingless bee led to the isolation and characterization of two phenylpropanoids, 6-O-p-coumaroyl-D-galactopyranose (1) and 6-O-cinnamoyl-1-O-p-coumaroyl- β -D-glucopyranose (2), and seven flavonoids, 7-O-methyl-naringenin (3), 7-O-methyl aromadendrin (4), 7,4'-di-O-methyl aromadendrin (5), 4'-O-methyl kaempferol (6), 3-O-methyl quercetin (7), 5-O-methyl aromadendrin (8), and 5-O-methyl kaempferol (9). The structure of the new phenylpropanoid (1) was established from IR, LC-ESI-MS, and NMR spectral data, including 2D NMR experiments. The extract and fractions demonstrated significant antioxidant activity in DPPH, ABTS, and β -carotene/linoleic acid tests.

  8. Composition and Antioxidant Activity of Geopropolis Collected by Melipona subnitida (Jandaíra Bees

    Directory of Open Access Journals (Sweden)

    Silvana Alves de Souza

    2013-01-01

    Full Text Available An investigation of the geopropolis collected by Melipona subnitida (jandaíra stingless bee led to the isolation and characterization of two phenylpropanoids, 6-O-p-coumaroyl-D-galactopyranose (1 and 6-O-cinnamoyl-1-O-p-coumaroyl-β-D-glucopyranose (2, and seven flavonoids, 7-O-methyl-naringenin (3, 7-O-methyl aromadendrin (4, 7,4′-di-O-methyl aromadendrin (5, 4′-O-methyl kaempferol (6, 3-O-methyl quercetin (7, 5-O-methyl aromadendrin (8, and 5-O-methyl kaempferol (9. The structure of the new phenylpropanoid (1 was established from IR, LC-ESI-MS, and NMR spectral data, including 2D NMR experiments. The extract and fractions demonstrated significant antioxidant activity in DPPH, ABTS, and β-carotene/linoleic acid tests.

  9. Lutte Contre le Choléra, ou Contre la Culture ?

    Directory of Open Access Journals (Sweden)

    H. Lamaison Marqui

    2014-12-01

    Full Text Available Among the major obstacles in the fight against the cholera epidemic in Madagascar from 1999 to 2000, the non-use of latrines and funeral rites are qualified of ‘cultural barriers’. Is it possible, necessary or desirable to change the culture of the population, or that of professionals?Parmi les principaux obstacles de la lutte contre l’épidémie de choléra à Madagascar en 1999 et 2000, la non utilisation de latrines et les rites funéraires sont qualifiés de ‘freins culturels’. Est-il possible, nécessaire et souhaitable de modifier la culture des habitants, ou celle des professionnels ? 

  10. Groundwater pollution with heavy metals in the Ibar alluvium near Raška (Serbia

    Directory of Open Access Journals (Sweden)

    Miladinović Branko

    2012-01-01

    Full Text Available As a result of the operation of an ore flotation facility at Donja Rudnica near Raška, Serbia, during the period from 1972 to 2002, flotation tailings and wastewater of highly complex chemical compositions were deposited in the alluvial plain of the Ibar River. Due to the excellent groundwater flow characteristics of the alluvial formations underlying the tailings dump, the groundwater and soil over an extended area were continually polluted. High concentrations of heavy metals (Fe = 7.38 mg/L. Zn = 4.04 mg/L, Pb = 2.17 mg/L in the soil and concentrations of sulfate as high as 3709 mg/L, and pH levels of 4.2 in the groundwater have been recorded at some locations. This paper draws attention to the potential risk this site poses for the conservation of biodiversity over the extended area.

  11. Miks ma end ära ei tapa : [luuletused] / Paul-Eerik Rummo

    Index Scriptorium Estoniae

    Rummo, Paul-Eerik, 1942-

    2001-01-01

    Tekst eesti ja inglise k. P.-E. Rummo lühibiograafia eesti ja inglise k. lk. 131. Sisu: Miks ma end ära ei tapa = Why I don't kill myself ; "Maailm mu hinge ei tungind, vaid imbus..." = "The world did not invade my soul, it seeped into it..." ; "Taevas on kummargil üle maa..." = "The sky stoops over the earth..." ; "Nüüd anna jumal jaksu joosta juhuste sajus..." = "Now grant me God the strength to run through the rains of chance..." ; Jälle, jälle, jälle, jälle, jälle... = Again again again again again ; "maailm mille lõpp on mõeldav..." = "a world whose end is conceivable..." ; Kinni hoidmas = Clinging ; Poolüminal = Crooning

  12. Anime (sub)kultūra Lietuvoje: globalaus fenomeno lokali raiška

    OpenAIRE

    Baliūnaitė, Živilė

    2017-01-01

    Šio tyrimo tikslas – anime (sub)kultūros Lietuvoje analizė. Anime kultūra, apimanti manga komiksus, anime filmus, anime kompiuterinius žaidimus, cosplay, kilo Japonijoje ir yra ryški japonų kultūros dalis. Vakarų pasaulį ji pasiekė apie 1970 metus, o nuo 1990 metų anime kultūros populiarumas ėmė sparčiai augti, – šiuo metu daugelyje pasaulio šalių egzistuoja didelės anime kultūros gerbėjų grupės, kurios jau įvardijamos anime subkultūromis. Anime kultūros populiarumas taip išaugo, kad anime ku...

  13. The RA-MAP Consortium: a working model for academia-industry collaboration.

    Science.gov (United States)

    Cope, Andrew P; Barnes, Michael R; Belson, Alexandra; Binks, Michael; Brockbank, Sarah; Bonachela-Capdevila, Francisco; Carini, Claudio; Fisher, Benjamin A; Goodyear, Carl S; Emery, Paul; Ehrenstein, Michael R; Gozzard, Neil; Harris, Ray; Hollis, Sally; Keidel, Sarah; Levesque, Marc; Lindholm, Catharina; McDermott, Michael F; McInnes, Iain B; Mela, Christopher M; Parker, Gerry; Read, Simon; Pedersen, Ayako Wakatsuki; Ponchel, Frederique; Porter, Duncan; Rao, Ravi; Rowe, Anthony; Schulze-Knappe, Peter; Sleeman, Matthew A; Symmons, Deborah; Taylor, Peter C; Tom, Brian; Tsuji, Wayne; Verbeeck, Denny; Isaacs, John D

    2018-01-01

    Collaboration can be challenging; nevertheless, the emerging successes of large, multi-partner, multi-national cooperatives and research networks in the biomedical sector have sustained the appetite of academics and industry partners for developing and fostering new research consortia. This model has percolated down to national funding agencies across the globe, leading to funding for projects that aim to realise the true potential of genomic medicine in the 21st century and to reap the rewards of 'big data'. In this Perspectives article, the experiences of the RA-MAP consortium, a group of more than 140 individuals affiliated with 21 academic and industry organizations that are focused on making genomic medicine in rheumatoid arthritis a reality are described. The challenges of multi-partner collaboration in the UK are highlighted and wide-ranging solutions are offered that might benefit large research consortia around the world.

  14. Hearing Pygmalion's Kiss: A Scientific Object at the Paris Opéra

    Science.gov (United States)

    Lambert, Kevin

    2014-12-01

    In 1748, in his acte de ballet Pygmalion, composer and music theorist Jean-Philippe Rameau arranged the Paris Opéra orchestra to play "nature's chord," harmonies that reproduced the overtones an expert ear could detect in every natural musical vibrating body. The following year Rameau presented his music theory to the French Royal Academy of Sciences for their endorsement. Disillusionment with the promise of Cartesian mechanics as a source of a unified understanding of nature opened up the possibility that matter might have properties beyond extension and motion, such as aversion, desire, and memory. Speculations about this material sensibility also coincided with increasing claims about the authority of spontaneous emotion and feeling. The experience of music at the opera was a significant resource for claims about the cultural authority of sensibility.

  15. Specificities of anti-neutrophil autoantibodies in patients with rheumatoid arthritis (RA)

    DEFF Research Database (Denmark)

    Brimnes, J; Halberg, P; Jacobsen, Søren

    1997-01-01

    neutrophils showed IgG reactions at 25-35 kD, in the 55-kD region, at 80 kD, and at 110 kD. Most sera reacted with more than one band. Except for the 55-kD antigen, none of the antigens appeared in lymphocytes. The most notable reactivity in subcellular fractions was with lactoferrin and with bands of 25-35 k......D from nuclei. In conclusion, anti-neutrophil autoantibodies from RA patients recognize different antigens in the cytoplasm and in the nucleus. Lactoferrin is one of the common antigens recognized, but also unknown nuclear antigens of 25-35 kD mol. wt are involved....

  16. Measurement of Stratospheric Chromatic Scintillation with the AMON-RA Balloonborne Spectrometer

    Science.gov (United States)

    Renard, Jean-Baptiste; Dalaudier, Francis; Hauchecorne, Alain; Robert, Claude; Lemaire, Thierry; Pirre, Michel; Bertaux, Jean-Loup

    2001-08-01

    The balloonborne instrument AMON (which is a French acronym for Absorption par les Minoritaires Ozone et NOx ) has been modified to record chromatic scintillation during stellar occultation by the Earth s atmosphere. A 14-channel spectrophotometer with a sampling rate of 10 Hz was added, and the modified instrument, AMON-RA, performed successful measurements of the setting star Alnilam during the third European Stratospheric Experiment on Ozone (THESEO) project. Unambiguous records of the chromatic scintillation were obtained, to our knowledge for the first time from above the atmosphere, and some of its basic properties are reported. The properties of atmospheric structures that are responsible for this chromatic scintillation were found to be consistent with those of previous monochromatic measurements performed from space. A maximum chromatic delay of 2.5 s was observed for widely different wavelengths.

  17. Estudo farmacognóstico das raízes de Jacaranda decurrens Cham. (carobinha)

    OpenAIRE

    Oliveira,T.B.; Netto,H.J.C. Bezerra; Xavier,M.A.; Prado,D.S.; Garrote,C.F.D.; Asquieri,E.R.; Rezende,M.H.; Ferreira,H. D.; Paula,J.R.

    2003-01-01

    Este trabalho estabelece parâmetros farmacognósticos para as raízes de Jacaranda decurrens Cham., Bignoniaceae, conhecida na medicina popular como carobinha. Características morfológicas e histológicas, prospecção fitoquímica, teor de cinzas e de açúcares redutores são descritos. Encontrou-se presença de esteróides/triterpenos, açúcares redutores, amido, mucilagem e saponinas. O teor de cinzas totais foi de 2,21%, e insolúveis em ácido de 0,63%; a umidade, de 6,42% e o teor de açúcares reduto...

  18. Adipose tissue fibrosis

    OpenAIRE

    Buechler, Christa; Krautbauer, Sabrina; Eisinger, Kristina

    2015-01-01

    The increasing prevalence of obesity causes a major interest in white adipose tissue biology. Adipose tissue cells are surrounded by extracellular matrix proteins whose composition and remodeling is of crucial importance for cell function. The expansion of adipose tissue in obesity is linked to an inappropriate supply with oxygen and hypoxia development. Subsequent activation of hypoxia inducible factor 1 (HIF-1) inhibits preadipocyte differentiation and initiates adipose tissue fibrosis. The...

  19. Bioreactors for tissue engineering.

    Science.gov (United States)

    Chen, Huang-Chi; Hu, Yu-Chen

    2006-09-01

    Bioreactors are essential in tissue engineering, not only because they provide an in vitro environment mimicking in vivo conditions for the growth of tissue substitutes, but also because they enable systematic studies of the responses of living tissues to various mechanical and biochemical cues. The basic principles of bioreactor design are reviewed, the bioreactors commonly used for the tissue engineering of cartilage, bone and cardiovascular systems are assessed in terms of their performance and usefulness. Several novel bioreactor types are also reviewed.

  20. EVALUATION OF SOIL LOSS IN GUARAÍRA BASIN BY GIS AND REMOTE SENSING BASED MODEL

    Directory of Open Access Journals (Sweden)

    Richarde Marques Silva

    2007-12-01

    Full Text Available Environmental degradation, and specifically erosion, is a serious and extensive problem in many areas in Brazil. Prediction of runoff and erosion in ungauged basins is one of the most challenging tasks anywhere and it is especially a very difficult one in developing countries where monitoring and continuous measurements of these quantities are carried out in very few basins either due to the costs involved or due to the lack of trained personnel. The erosion processes and land use in the Guaraíra River Experimental Basin, located in Paraíba state, Brazil, are evaluated using remote sensing and a runoff-erosion model. WEPP is a process-based continuous simulation erosion model that can be applied to hillslope profiles and small watersheds. WEPP erosion model have been compared in numerous studies to observed values for soil loss and sediment delivery from cropland plots, forest roads, irrigated lands and small watersheds. A number of different techniques for evaluating WEPP have been used, including one recently developed in which the ability of WEPP to accurately predict soil erosion can be compared to the accuracy of replicated plots to predict soil erosion. WEPP was calibrated with daily rainfall data from five rain gauges for the period of 2003 to 2005. The obtained results showed the susceptible areas to the erosion process within Guaraíra river basin, and that the mean sediment yield could be in the order of 3.0 ton/ha/year (in an area of 5.84 ha.

  1. Influence of soil structure on the "Fv approach" applied to 238U and 226Ra.

    Science.gov (United States)

    Blanco Rodríguez, P; Vera Tomé, F; Lozano, J C

    2017-02-01

    The soil-to-plant transfer factors were determined in a granitic area for the two long-lived uranium series radionuclides 238U and 226Ra. With the aim to identify a physical fraction of soil whose concentration correlates linearly with the plant concentration, the soil compartment was analyzed in various stages. An initial study identified the soil compartments as being either bulk soil or its labile fraction. The bulk soil was subsequently divided into three granulometric fractions consisting of: coarse sand, fine sand, and silt and clay. The soil-to-plant transfer of radionuclides for each of these three texture fractions was analyzed. Lastly, the labile fraction was extracted from each textural part, and the activity concentration of the radionuclides 238U and 226Ra was measured. In order to assess the influence of soil texture on the soil-to-plant transfer process, we sought to identify possible correlations between the activity concentration in the plant compartment and those found in the different fractions within each soil compartment. The results showed that the soil-to-plant transfer process for uranium and radium depends on soil grain size, where the results for uranium showed a linear relationship between the activity concentration of uranium in the plant and the fine soil fraction. In contrast, a linear relation between the activity concentration of radium in the plant and the soil coarse-sand fraction was observed. Additionally, the presence of phosphate and calcium in the soil of all of the compartments studied affected the soil-to-plant transfer of uranium and radium, respectively. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. IL-15 expression on RA synovial fibroblasts promotes B cell survival.

    Directory of Open Access Journals (Sweden)

    Marta Benito-Miguel

    Full Text Available INTRODUCTION: The purpose of this study was to examine the role of RA Synovial Fibroblast (RASFib IL-15 expression on B cell survival. METHODS: Magnetically sorted peripheral blood memory B cells from 15 healthy subjects were cocultured with RASFib. RESULTS: RASFib constitutively expressed membrane IL-15. Survival of isolated B cells cultured for 6 days, below 5%, was extended in coculture with RASFib to 52+/-8% (p<0.001. IL-15 neutralizing agents but not isotype controls, reduced this rate to 31+/-6% (p<0.05. Interestingly, rhIL-15 had no effect on isolated B cells but significantly increased their survival in coculture with RASFib. In parallel, B cell IL-15R chains were upregulated in cocultures. BAFF and VCAM-1, that are expressed on RASFib, were tested as potential candidates involved in upregulating B cell IL-15R. Culture of B cells in the presence of rhBAFF or rhVCAM-1 resulted in significantly increased survival, together with upregulation of all three IL-15R chains; in parallel, rhIL-15 potentiated the anti-apoptotic effect of BAFF and VCAM-1. Both BAFF and VCAM-1 neutralizing agents downmodulated the effect of RASFib on B cell survival and IL-15R expression. In parallel, rhIL-15 had a lower effect on the survival of B cells cocultured with RASFib in the presence of BAFF or VCAM-1 neutralizing agents. Peripheral blood B cells from 15 early RA patients demonstrated an upregulated IL-15R and increased survival in cocultures. CONCLUSION: IL-15 expression on RASFib significantly contributes to the anti-apoptotic effect of RASFib on B cells. IL-15 action is facilitated by BAFF and VCAM-1 expressed on RASFib, through an upregulation of IL-15R chains.

  3. EVALUATION OF SOIL LOSS IN GUARAÍRA BASIN BY GIS AND REMOTE SENSING BASED MODEL

    Directory of Open Access Journals (Sweden)

    Richarde Marques da Silva

    2007-01-01

    Full Text Available Environmental degradation, and specifically erosion, is a serious and extensive problem in many areas in Brazil. Prediction of runoff and erosion in ungauged basins is one of the most challenging tasks anywhere and it is especially a very difficult one in developing countries where monitoring and continuous measurements of these quantities are carried out in very few basins either due to the costs involved or due to the lack of trained personnel. The erosion processes and land use in the Guaraíra River Experimental Basin, located in Paraíba state, Brazil, are evaluated using remote sensing and a runoff-erosion model. WEPP is a process-based continuous simulation erosion model that can be applied to hillslope profiles and small watersheds. WEPP erosion model have been compared in numerous studies to observed values for soil loss and sediment delivery from cropland plots, forest roads, irrigated lands and small watersheds. A number of different techniques for evaluating WEPP have been used, including one recently developed in which the ability of WEPP to accurately predict soil erosion can be compared to the accuracy of replicated plots to predict soil erosion. WEPP was calibrated with daily rainfall data from five rain gauges for the period of 2003 to 2005. The obtained results showed the susceptible areas to the erosion process within Guaraíra river basin, and that the mean sediment yield could be in the order of 3.0 ton/ha/year (in an area of 5.84 ha.

  4. Use of 210Pb/ 226Ra disequilibria in the dating of deep-sea whale falls

    Science.gov (United States)

    Schuller, Daniel; Kadko, David; Smith, Craig R.

    2004-02-01

    Deep-sea whale falls, in particular the skeletal remains of whales that have sunk to the seafloor, are remarkable temporary reducing habitats. Reduced chemical species created by anaerobic microbial decay of lipid and organic compounds within the whale bone matrix fuel chemosynthetic-based communities, including bacteria, mussels, limpets, snails, and clams. Many of these species exhibit taxonomic affinities to other chemosynthetic deep-sea organisms colonizing hydrothermal vents and cold seeps. Knowledge of the timescales of whale fall community succession and persistence of these assemblages is needed to reliably estimate the abundance of whale fall habitats and to understand the dynamics of the whale fall communities and their potential roles as stepping stones for sulfophilic species. We have developed a radiochemical method based on 210Pb/ 226Ra disequilibria for estimating the ages of seafloor whale bone communities. Measurements of 210Pb/ 226Ra performed on known age bone samples yielded radioisotope ages in good agreement with the known ages. Our results indicate that this technique is valid for bones 10-85 years old (time since cetacean death). This technique, applied to multiple bones of unknown age whale falls taken from Monterey Canyon, Santa Catalina Basin, and San Nicholas Basin, constrained the upper limit ages of these systems (in 2002) to 6.3±1.0 years, 44.0±7.0 to 53.4±8.3 years, and 66.4±9.6 to 82.6±11 years, respectively. These ages were in reasonable agreement with faunal and/or skeletal observations. In addition, a preliminary lipid degradation rate was calculated for the Santa Catalina Basin whale fall using an independent time series and calibrated to the radiochemically determined age. Both radiochemical and lipid degradation evidence suggest that the whale fall microhabitat is able to support life for many decades.

  5. "Comparación de algunas propiedades de las lectinas de semilla y de raíz de haba

    Directory of Open Access Journals (Sweden)

    Yolanda De Navarro

    2010-05-01

    Full Text Available Se aislaron las lectinas de semilla y de las paredes celulares de la raíz de haba. La lectina de raíz se purificó parcialmente por Sephadex G-25 obteniéndose resultados que sugieren la presencia de dos lectinas. El comportamiento en filtración por gel, diálisis, electroforesis inhibición por carbohidratos de la eritroaglutinación, acción aglutinante frente a la cepa B de R. leguminosarum cultivada en medio Bishop. capacidad aglutinante de cepas homologas y heterólogas de las dos lectinas demostraron que ellas son diferentes. La lectina de raíz parece ser más específica, ya que solo aglutinó a R. leguminosarum y R. spp. (caupi, mientras que la Favina presentó actividad bactoaglutinante con cepas nodulantes como con no nodulantes de diferentes especies de Rhizobium.

  6. Interference Measurements in the European 868 MHz ISM Band with Focus on LoRa and SigFox

    DEFF Research Database (Denmark)

    Lauridsen, Mads; Vejlgaard, Benny; Kovács, István

    2017-01-01

    . The focus is on the Low Power Wide Area technologies LoRa and SigFox. The measurements show that there is a 22-33 % probability of interfering signals above -105 dBm within the mandatory LoRa and SigFox 868.0-868.6 MHz band in a shopping area and a business park in downtown Aalborg, which thus limits...... the potential coverage and capacity of LoRa and SigFox. However, the probability of interference is less than 3 % in the three other measurement locations in Aalborg. Finally, a hospital and an industrial area are shown to experience high activity in the RFID subband 865-868 MHz, while the wireless audio band...

  7. Characterizing the transport of natural uranium and its decay product {sup 226}Ra, downstream from former mines in France

    Energy Technology Data Exchange (ETDEWEB)

    Phrommavanh, Vannapha; Boissezon, Helene de; Nos, Jeremy; Koko, Marie-Benedicte; Descostes, Michael [AREVA Mines - Business Group Mines, DEXP/DR et D, Tour AREVA,1 Place Jean Millier, 92084 Paris La Defense (France); Leermakers, Martine [Vrije Universiteit Brussel VUB, Departement Analytische en Milieuchemie ANCH, Brussels (Belgium)

    2013-07-01

    Surface waters downstream from former uranium mines have been studied in order to characterize U and {sup 226}Ra transport and to assess their bioavailability. Filtrations and ultra-filtrations (UF) have been performed (0.45 μm / 0.2 μm / 500 kDa / 100 kDa / 10 kDa) and compared to the in situ technique, diffusive gradients in thin films (DGT). One of the study sites, a stream passing through a peat bog located in the vicinity of a former U mine, shows an increase in total U and a slight increase in {sup 226}Ra concentrations. While {sup 226}Ra is completely dissolved, U is mainly present as particles and colloids, the dissolved fraction reaching only about 5-20%. (authors)

  8. Utilização de fontes de gorduras em rações de vacas leiteiras

    OpenAIRE

    José Esler de Freitas Júnior

    2008-01-01

    O objetivo deste estudo foi avaliar a utilização de diferentes fontes de gordura em rações de vacas em lactação sobre o consumo e digestibilidade dos nutrientes, fermentação ruminal, produção e composição do leite, composição da fração protéica do leite, balanço de energia e de nitrogênio. Foram utilizadas 12 vacas da raça Holandesa, agrupadas em três quadrados latinos balanceados 4x4, alimentadas com as seguintes rações: 1) Controle; 2) Óleo de soja refinado; 3) Grão de soja in natura; e 4) ...

  9. Viimsi water treatment plant for Ra removal: NORM residue/waste generation, radiation safety issues, and regulatory response

    Energy Technology Data Exchange (ETDEWEB)

    Kiisk, M.; Suursoo, S.; Realo, E.; Jantsikene, A.; Lumiste, L.; Vaeaer, K.; Isakar, K.; Koch, R. [University of Tartu (Estonia)

    2014-07-01

    In early 2012, the first large-scale water treatment plant, specifically designed to remove Ra-isotopes from groundwater, was commissioned in Viimsi parish, North-Estonia. The plant serves approximately 15 000 consumers with maximum production capacity of 6000 m{sup 3}/d. The chosen water treatment technology is chemical free and is based on co-precipitation and adsorption with Fe(OH){sub 3} and MnO{sub 2} flocks, and adsorption of residual Ra onto zeolite sand. The chosen technology is a complex approach and is designed to reduce high Fe and Mn concentrations as well as dissolved gases along with Ra isotopes. It is proved to be well adapted with hydro-chemical conditions of the groundwater feeding the plant. As the novel technology has been applied for the first time on a large scale, the plant was taken under long-term investigation when commissioned. The latter focuses on three areas: Ra removal efficiency and its dynamics, build-up of radioactive waste, and radiation safety. The average Ra-226 and Ra-228 activity concentrations in raw water feeding the plant are approximately 0.5 Bq/L and 0.6 Bq/L, respectively, resulting in total indicative dose of 0.4 mSv/y. Operating conditions of the plant are restricted by the established indicative value of 0.1 mSv/y for drinking water, i.e. a minimum 75% removal efficiency for Ra is required. Results of the studies show that the plant operates at Ra-removal efficiency of 98% or higher without the need of regeneration or replacement of filtering materials within the first two years. Measurements confirm that ∼90% of Ra accumulates in the solid filter media, 8-9% is washed out by backwash system as liquid effluent and 1-2% is fed on to the consumer distribution network. It has been calculated that at the level of current production capacity (below 3000 m{sup 3}/d) the yearly accumulation rate in the plant is approximately 300 and 400 MBq/y for Ra-226 and Ra-228, respectively. These values strongly exceed the exemption

  10. Jmjd2/Kdm4 demethylases are required for expression of Il3ra and survival of acute myeloid leukemia cells

    DEFF Research Database (Denmark)

    Agger, Karl; Miyagi, Satoru; Pedersen, Marianne Terndrup

    2016-01-01

    Acute myeloid leukemias (AMLs) with a rearrangement of the mixed-linage leukemia (MLL) gene are aggressive hematopoietic malignancies. Here, we explored the feasibility of using the H3K9- and H3K36-specific demethylases Jmjd2/Kdm4 as putative drug targets in MLL-AF9 translocated leukemia. Using...... a mechanism involving removal of H3K9me3 from the promoter of the Il3ra gene. Importantly, ectopic expression of Il3ra in Jmjd2/Kdm4 knockout cells alleviates the requirement of Jmjd2/Kdm4 for the survival of AML cells, showing that Il3ra is a critical downstream target of Jmjd2/Kdm4 in leukemia...

  11. Vascularization Tissue Engineering

    NARCIS (Netherlands)

    Rouwkema, Jeroen; Rivron, N.C.; van Blitterswijk, Clemens

    2008-01-01

    Tissue engineering has been an active field of research for several decades now. However, the amount of clinical applications in the field of tissue engineering is still limited. One of the current limitations of tissue engineering is its inability to provide sufficient blood supply in the initial

  12. Tertiary lymphoid tissue

    Science.gov (United States)

    Di Caro, Giuseppe; Marchesi, Federica

    2014-01-01

    Tumor-infiltrating lymphocytes influence colorectal cancer progression. We have recently documented that tertiary lymphoid tissue in the colorectal cancer microenvironment orchestrates lymphocyte infiltration and that tertiary lymphoid tissue and lymphocytes cooperate in a coordinated antitumor immune response to improve patient outcome. Thus, tertiary lymphoid tissue represents a potential target in the design of tailored immune-based therapeutic approaches. PMID:25083321

  13. Development of tissue bank

    Directory of Open Access Journals (Sweden)

    R P Narayan

    2012-01-01

    Full Text Available The history of tissue banking is as old as the use of skin grafting for resurfacing of burn wounds. Beneficial effects of tissue grafts led to wide spread use of auto and allograft for management of varied clinical conditions like skin wounds, bone defects following trauma or tumor ablation. Availability of adequate amount of tissues at the time of requirement was the biggest challenge that forced clinicians to find out techniques to preserve the living tissue for prolonged period of time for later use and thus the foundation of tissue banking was started in early twentieth century. Harvesting, processing, storage and transportation of human tissues for clinical use is the major activity of tissue banks. Low temperature storage of processed tissue is the best preservation technique at present. Tissue banking organization is a very complex system and needs high technical expertise and skilled personnel for proper functioning in a dedicated facility. A small lapse/deviation from the established protocol leads to loss of precious tissues and or harm to recipients as well as the risk of transmission of deadly diseases and tumors. Strict tissue transplant acts and stringent regulations help to streamline the whole process of tissue banking safe for recipients and to community as whole.

  14. Isolamento, fracionamento e caracterização de paredes celulares de raízes de mandioca (Manihot esculenta, Crantz Isolation, fractionation and characterization of cassava (Manihot esculenta, Crantz root cell walls

    Directory of Open Access Journals (Sweden)

    Lara Tschopoko Pedroso Pereira

    2004-03-01

    Full Text Available Durante a cocção de mandiocas o amido é gelatinizado e as paredes celulares sofrem alterações físicas e químicas que modificam a coesão das células e causam o amaciamento dos tecidos. Isolar, fracionar e caracterizar paredes celulares durante o envelhecimento de raízes, de duas cultivares, foram os objetivos deste trabalho. O amido foi eliminado por tamização e hidrólise enzimática e o material de paredes celulares foi fracionado em celulose, hemicelulose e pectina. Quantitativamente celulose foi a maior fração constituindo entre 57,2 e 70% do material inicial de paredes celulares isoladas, seguido por pectina e hemicelulose. O material isolado como paredes celulares diminuiu com o tempo de plantio das raízes e a concentração de celulose foi menor no material isolado de raízes mais velhas. A fração pectina diferiu em concentração de açúcares entre raízes de idades diferentes, sendo mais alta em raízes mais velhas enquanto a concentração de ácidos urônicos diferiu entre idades e cultivares.During cooking of cassava tubers starch gelatinizes and there are physical-chemical alterations in cell wall material, reducing intercellular cohesion and softening the tissue, playing an important role in cooking time. Cell wall material from tubers at two harvesting ages of two cultivars were isolated, fractionated and evaluated. Starch was eliminated by wet sieving and enzymatic hydrolysis and the cell wall material was fractionated into cellulose, hemicellulose and pectin. Quantitatively cellulose had the highest concentration varying from 57.2 to 70% of the initial isolated cell wall material, followed by pectin and hemicellulose. Cell wall material isolated decreased with the age of the roots and cellulose concentration decreased in the older roots. Pectin fraction differed in sugar concentration between roots of different ages, higher in older roots while for uronic acid content there were differences for age of roots and

  15. IL2RA genetic heterogeneity in multiple sclerosis and type 1 diabetes susceptibility and soluble interleukin-2 receptor production.

    Directory of Open Access Journals (Sweden)

    Lisa M Maier

    2009-01-01

    Full Text Available Multiple sclerosis (MS and type 1 diabetes (T1D are organ-specific autoimmune disorders with significant heritability, part of which is conferred by shared alleles. For decades, the Human Leukocyte Antigen (HLA complex was the only known susceptibility locus for both T1D and MS, but loci outside the HLA complex harboring risk alleles have been discovered and fully replicated. A genome-wide association scan for MS risk genes and candidate gene association studies have previously described the IL2RA gene region as a shared autoimmune locus. In order to investigate whether autoimmunity risk at IL2RA was due to distinct or shared alleles, we performed a genetic association study of three IL2RA variants in a DNA collection of up to 9,407 healthy controls, 2,420 MS, and 6,425 T1D subjects as well as 1,303 MS parent/child trios. Here, we report "allelic heterogeneity" at the IL2RA region between MS and T1D. We observe an allele associated with susceptibility to one disease and risk to the other, an allele that confers susceptibility to both diseases, and an allele that may only confer susceptibility to T1D. In addition, we tested the levels of soluble interleukin-2 receptor (sIL-2RA in the serum from up to 69 healthy control subjects, 285 MS, and 1,317 T1D subjects. We demonstrate that multiple variants independently correlate with sIL-2RA levels.

  16. Vitamin A Controls the Presence of RORγ+ Innate Lymphoid Cells and Lymphoid Tissue in the Small Intestine.

    Science.gov (United States)

    Goverse, Gera; Labao-Almeida, Carlos; Ferreira, Manuela; Molenaar, Rosalie; Wahlen, Sigrid; Konijn, Tanja; Koning, Jasper; Veiga-Fernandes, Henrique; Mebius, Reina E

    2016-06-15

    Changes in diet and microbiota have determining effects on the function of the mucosal immune system. For example, the active metabolite of vitamin A, retinoic acid (RA), has been described to maintain homeostasis in the intestine by its influence on both lymphocytes and myeloid cells. Additionally, innate lymphoid cells (ILCs), important producers of cytokines necessary for intestinal homeostasis, are also influenced by vitamin A in the small intestines. In this study, we show a reduction of both NCR(-) and NCR(+) ILC3 subsets in the small intestine of mice raised on a vitamin A-deficient diet. Additionally, the percentages of IL-22-producing ILCs were reduced in the absence of dietary vitamin A. Conversely, mice receiving additional RA had a specific increase in the NCR(-) ILC3 subset, which contains the lymphoid tissue inducer cells. The dependence of lymphoid tissue inducer cells on vitamin A was furthermore illustrated by impaired development of enteric lymphoid tissues in vitamin A-deficient mice. These effects were a direct consequence of ILC-intrinsic RA signaling, because retinoic acid-related orphan receptor γt-Cre × RARα-DN mice had reduced numbers of NCR(-) and NCR(+) ILC3 subsets within the small intestine. However, lymphoid tissue inducer cells were not affected in these mice nor was the formation of enteric lymphoid tissue, demonstrating that the onset of RA signaling might take place before retinoic acid-related orphan receptor γt is expressed on lymphoid tissue inducer cells. Taken together, our data show an important role for vitamin A in controlling innate lymphoid cells and, consequently, postnatal formed lymphoid tissues within the small intestines. Copyright © 2016 by The American Association of Immunologists, Inc.

  17. Dosimetry and radiobiology at the new RA-3 reactor boron neutron capture therapy (BNCT) facility: Application to the treatment of experimental oral cancer

    Energy Technology Data Exchange (ETDEWEB)

    Pozzi, E. [Research and Production Reactors, National Atomic Energy Commission, Ezeiza Atomic Center (Argentina); Department of Radiobiology, National Atomic Energy Commission, Constituyentes Atomic Center (Argentina)], E-mail: epozzi@cnea.gov.ar; Nigg, D.W. [Idaho National Laboratory, Idaho Falls (United States); Miller, M.; Thorp, S.I. [Instrumentation and Control Department, National Atomic Energy Commission, Ezeiza Atomic Center (Argentina); Heber, E.M. [Department of Radiobiology, National Atomic Energy Commission, Constituyentes Atomic Center (Argentina); Zarza, L.; Estryk, G. [Research and Production Reactors, National Atomic Energy Commission, Ezeiza Atomic Center (Argentina); Monti Hughes, A.; Molinari, A.J.; Garabalino, M. [Department of Radiobiology, National Atomic Energy Commission, Constituyentes Atomic Center (Argentina); Itoiz, M.E. [Department of Radiobiology, National Atomic Energy Commission, Constituyentes Atomic Center (Argentina); Department of Oral Pathology, Faculty of Dentistry, University of Buenos Aires (Argentina); Aromando, R.F. [Department of Oral Pathology, Faculty of Dentistry, University of Buenos Aires (Argentina); Quintana, J. [Research and Production Reactors, National Atomic Energy Commission, Ezeiza Atomic Center (Argentina); Trivillin, V.A.; Schwint, A.E. [Department of Radiobiology, National Atomic Energy Commission, Constituyentes Atomic Center (Argentina)

    2009-07-15

    The National Atomic Energy Commission of Argentina (CNEA) constructed a novel thermal neutron source for use in boron neutron capture therapy (BNCT) applications at the RA-3 research reactor facility located in Buenos Aires. The aim of the present study was to perform a dosimetric characterization of the facility and undertake radiobiological studies of BNCT in an experimental model of oral cancer in the hamster cheek pouch. The free-field thermal flux was 7.1x10{sup 9} n cm{sup -2} s{sup -1} and the fast neutron flux was 2.5x10{sup 6} n cm{sup -2} s{sup -1}, indicating a very well-thermalized neutron field with negligible fast neutron dose. For radiobiological studies it was necessary to shield the body of the hamster from the neutron flux while exposing the everted cheek pouch bearing the tumors. To that end we developed a lithium (enriched to 95% in {sup 6}Li) carbonate enclosure. Groups of tumor-bearing hamsters were submitted to BPA-BNCT, GB-10-BNCT, (GB-10+BPA)-BNCT or beam only treatments. Normal (non-cancerized) hamsters were treated similarly to evaluate normal tissue radiotoxicity. The total physical dose delivered to tumor with the BNCT treatments ranged from 6 to 8.5 Gy. Tumor control at 30 days ranged from 73% to 85%, with no normal tissue radiotoxicity. Significant but reversible mucositis in precancerous tissue surrounding tumors was associated to BPA-BNCT. The therapeutic success of different BNCT protocols in treating experimental oral cancer at this novel facility was unequivocally demonstrated.

  18. Dosimetry and radiobiology at the new RA-3 reactor boron neutron capture therapy (BNCT) facility: application to the treatment of experimental oral cancer.

    Science.gov (United States)

    Pozzi, E; Nigg, D W; Miller, M; Thorp, S I; Heber, E M; Zarza, L; Estryk, G; Monti Hughes, A; Molinari, A J; Garabalino, M; Itoiz, M E; Aromando, R F; Quintana, J; Trivillin, V A; Schwint, A E

    2009-07-01

    The National Atomic Energy Commission of Argentina (CNEA) constructed a novel thermal neutron source for use in boron neutron capture therapy (BNCT) applications at the RA-3 research reactor facility located in Buenos Aires. The aim of the present study was to perform a dosimetric characterization of the facility and undertake radiobiological studies of BNCT in an experimental model of oral cancer in the hamster cheek pouch. The free-field thermal flux was 7.1 x 10(9) n cm(-2)s(-1) and the fast neutron flux was 2.5 x 10(6) n cm(-2)s(-1), indicating a very well-thermalized neutron field with negligible fast neutron dose. For radiobiological studies it was necessary to shield the body of the hamster from the neutron flux while exposing the everted cheek pouch bearing the tumors. To that end we developed a lithium (enriched to 95% in (6)Li) carbonate enclosure. Groups of tumor-bearing hamsters were submitted to BPA-BNCT, GB-10-BNCT, (GB-10+BPA)-BNCT or beam only treatments. Normal (non-cancerized) hamsters were treated similarly to evaluate normal tissue radiotoxicity. The total physical dose delivered to tumor with the BNCT treatments ranged from 6 to 8.5 Gy. Tumor control at 30 days ranged from 73% to 85%, with no normal tissue radiotoxicity. Significant but reversible mucositis in precancerous tissue surrounding tumors was associated to BPA-BNCT. The therapeutic success of different BNCT protocols in treating experimental oral cancer at this novel facility was unequivocally demonstrated.

  19. Stromal cell markers are differentially expressed in the synovial tissue of patients with early arthritis.

    Science.gov (United States)

    Choi, Ivy Y; Karpus, Olga N; Turner, Jason D; Hardie, Debbie; Marshall, Jennifer L; de Hair, Maria J H; Maijer, Karen I; Tak, Paul P; Raza, Karim; Hamann, Jörg; Buckley, Christopher D; Gerlag, Danielle M; Filer, Andrew

    2017-01-01

    Previous studies have shown increased expression of stromal markers in synovial tissue (ST) of patients with established rheumatoid arthritis (RA). Here, ST expression of stromal markers in early arthritis in relationship to diagnosis and prognostic outcome was studied. ST from 56 patients included in two different early arthritis cohorts and 7 non-inflammatory controls was analysed using immunofluorescence to detect stromal markers CD55, CD248, fibroblast activation protein (FAP) and podoplanin. Diagnostic classification (gout, psoriatic arthritis, unclassified arthritis (UA), parvovirus associated arthritis, reactive arthritis and RA), disease outcome (resolving vs persistent) and clinical variables were determined at baseline and after follow-up, and related to the expression of stromal markers. We observed expression of all stromal markers in ST of early arthritis patients, independent of diagnosis or prognostic outcome. Synovial expression of FAP was significantly higher in patients developing early RA compared to other diagnostic groups and non-inflammatory controls. In RA FAP protein was expressed in both lining and sublining layers. Podoplanin expression was higher in all early inflammatory arthritis patients than controls, but did not differentiate diagnostic outcomes. Stromal marker expression was not associated with prognostic outcomes of disease persistence or resolution. There was no association with clinical or sonographic variables. Stromal cell markers CD55, CD248, FAP and podoplanin are expressed in ST in the earliest stage of arthritis. Baseline expression of FAP is higher in early synovitis patients who fulfil classification criteria for RA over time. These results suggest that significant fibroblast activation occurs in RA in the early window of disease.

  20. Stromal cell markers are differentially expressed in the synovial tissue of patients with early arthritis.

    Directory of Open Access Journals (Sweden)

    Ivy Y Choi

    Full Text Available Previous studies have shown increased expression of stromal markers in synovial tissue (ST of patients with established rheumatoid arthritis (RA. Here, ST expression of stromal markers in early arthritis in relationship to diagnosis and prognostic outcome was studied.ST from 56 patients included in two different early arthritis cohorts and 7 non-inflammatory controls was analysed using immunofluorescence to detect stromal markers CD55, CD248, fibroblast activation protein (FAP and podoplanin. Diagnostic classification (gout, psoriatic arthritis, unclassified arthritis (UA, parvovirus associated arthritis, reactive arthritis and RA, disease outcome (resolving vs persistent and clinical variables were determined at baseline and after follow-up, and related to the expression of stromal markers.We observed expression of all stromal markers in ST of early arthritis patients, independent of diagnosis or prognostic outcome. Synovial expression of FAP was significantly higher in patients developing early RA compared to other diagnostic groups and non-inflammatory controls. In RA FAP protein was expressed in both lining and sublining layers. Podoplanin expression was higher in all early inflammatory arthritis patients than controls, but did not differentiate diagnostic outcomes. Stromal marker expression was not associated with prognostic outcomes of disease persistence or resolution. There was no association with clinical or sonographic variables.Stromal cell markers CD55, CD248, FAP and podoplanin are expressed in ST in the earliest stage of arthritis. Baseline expression of FAP is higher in early synovitis patients who fulfil classification criteria for RA over time. These results suggest that significant fibroblast activation occurs in RA in the early window of disease.

  1. Identifying Preliminary Domains to Detect and Measure Rheumatoid Arthritis Flares: Report of the OMERACT 10 RA Flare Workshop

    DEFF Research Database (Denmark)

    Bingham, Clifton O; Alten, Rieke; Bartlett, Susan J

    2011-01-01

    an international research project to understand the specific characteristics and impact of episodic disease worsening, or "flare," so that outcome measures can be developed or modified to reflect this uncommonly measured, but very real and sometimes disabling RA disease feature. Patient research partners provided......, a preliminary list of key domains has been identified to evaluate flare. RESULTS: At OMERACT 10, consensus was achieved identifying features of flare in addition to the existing core set for RA, including fatigue, stiffness, symptom persistence, systemic features, and participation. Patient self-report of flare...

  2. Interference Measurements in the European 868 MHz ISM Band with Focus on LoRa and SigFox

    OpenAIRE

    Lauridsen, Mads; Vejlgaard, Benny; Kovács, István; Nguyen, Huan Cong; Mogensen, Preben Elgaard

    2017-01-01

    In this measurement study the signal activity and power levels are measured in the European Industrial, Scientific, and Medical band 863-870 MHz in the city of Aalborg, Denmark. The target is to determine if there is any interference, which may impact deployment of Internet of Things devices. The focus is on the Low Power Wide Area technologies LoRa and SigFox.The measurements show that there is a 22-33 % probability of interfering signals above -105 dBm within the mandatory LoRa and SigFox 8...

  3. Collaborative Physical and Biological Dosimetry Studies for Neutron Capture Therapy at the RA-1 Research Reactor Facility

    Energy Technology Data Exchange (ETDEWEB)

    Nigg, D.W.; Schwint, A.E.; Hartwell, J.K.; Heber, E.M.; Trivillin, V.; Castillo, J.; Wentzeis, L.; Sloan, P.; Wemple, C.A.

    2004-10-04

    Initial physical dosimetry measurements have been completed using activation spectrometry and thermoluminiscent dosimeters to characterize the BNCT irradiation facility developed at the RA-1 research reactor operated by the Argentine National Atomic Energy Commission in Buenos Aires. Some biological scoping irradiations have also been completed using a small-animal (hamster) oral mucosa tumor model. Results indicate that the RA-1 neutron source produces useful dose rates but that some improvements in the initial configuration will be needed to optimize the spectrum for thermal-neutron BNCT research applications.

  4. Collaborative Physical and Biological Dosimetry Studies for Neutron Capture Therapy at the RA-1 Research Reactor Facility

    Energy Technology Data Exchange (ETDEWEB)

    David W. Nigg; Amanda E. Schwint; John K. Hartwell; Elisa M. Heber; Veronica Trivillin; Jorge Castillo; Luis Wentzeis; Patrick Sloan; Charles A. Wemple

    2004-10-01

    Initial physical dosimetry measurements have been completed using activation spectrometry and thermoluminiscent dosimeters to characterize the BNCT irradiation facility developed at the RA-1 research reactor operated by the Argentine National Atomic Energy Commission in Buenos Aires. Some biological scoping irradiations have also been completed using a small-animal (hamster) oral mucosa tumor model. Results indicate that the RA-1 neutron source produces useful dose rates but that some improvements in the initial configuration will be needed to optimize the spectrum for thermal-neutron BNCT research applications.

  5. High-precision mass measurements of {sup 203-207}Rn and {sup 213}Ra with SHIPTRAP

    Energy Technology Data Exchange (ETDEWEB)

    Droese, C.; Marx, G.; Schweikhard, L. [Ernst-Moritz-Arndt-Universitaet, Greifswald (Germany); Ackermann, D.; Block, M.; Dworschak, M.; Herfurth, F.; Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Andersson, L.L. [University of Liverpool, Liverpool (United Kingdom); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Blaum, K. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Ruprecht-Karls-Universitaet Heidelberg, Heidelberg (Germany); Eibach, M. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Johannes Gutenberg-Universitaet Mainz, Mainz (Germany); Eliseev, S.; Ketelaer, J. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Forsberg, U.; Rudolph, D. [Lund University, Lund (Sweden); Haettner, E.; Plass, W.R.; Scheidenberger, C. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Justus-Liebig-Universitaet Giessen, Giessen (Germany); Hessberger, F.P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Minaya Ramirez, E. [Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Nesterenko, D.; Novikov, Yu.N. [NRC Kurchatov Institute, PNPI, Gatchina (Russian Federation); Rodriguez, D. [Universidad de Granada, Campus de Fuentenueva, Granada (Spain); Stolze, S. [University of Jyvaeskylae, Jyvaeskylae (Finland); Thirolf, P.G.; Weber, C. [Ludwig Maximilians-Universitaet Muenchen, Garching (Germany)

    2013-01-15

    The masses of the nuclides {sup 203-207}Rn and {sup 213}Ra were measured directly for the first time with the Penning-trap mass spectrometer SHIPTRAP at GSI Darmstadt. The results confirm the previously determined mass values. The mass uncertainties for {sup 205}Rn and {sup 213}Ra were significantly reduced. The results are relevant for the investigation of the nuclear shell structure between N=82 and N=126. As an indicator of structural changes the two-neutron separation energies S{sub 2n}(Z,N) have been studied. (orig.)

  6. ANTI-HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN B1 (ANTI-RA33 ANTIBODIES IN RHEUMATOID ARTHRITIS AND SYSTEMIC SCLEROSIS

    Directory of Open Access Journals (Sweden)

    P. A. Kuznetsova

    2017-01-01

    Full Text Available Anti-heterogeneous nuclear ribonucleoprotein (RNP autoantibodies (AAbs are encountered in many autoimmune rheumatic diseases (ARDs. The potential diagnostic value of the RA33 AAb complex consisting of RNP A2 and alternative domains of the splicing proteins RNP B1 and RNP B2 is now of interest to rheumatologists. Subjects and methods. The authors studied the frequency of anti-RNP B1 AAbs in 300 patients with systemic ARDs, including those with rheumatoid arthritis (RA, ankylosing spondylitis (AS, systemic lupus erythematosus (SLE, systemic sclerosis (SSc, and Sjö gren's syndrome (SS and in 53 people without ARDs, who constituted a control group. Serum anti-RNP B1 AAbs were assessed by enzyme immunoassay. Results and discussion. The frequency of anti-RNP B1 AAbs in patients with ARDs was much higher than that in the control group: 170/300 (56.6% and 8/53 (13% patients, respectively. Anti-RNP B1 AAbs were detected in 78.5% (113/144 of the patients with RA; 40.3% (23/57 of those with AS, in 67.5% (27/40 of those with SSc, in 36.4% (16/44 of those with SLE, and in 13.3% (2/15 of those with SS. The diagnostic sensitivity of the marker for RA was 78.5%, its diagnostic specificity was 84.9%; the likelihood ratio of positive and negative results was 5.24 and 0.24, respectively. In the patients with RA, the level of anti-RNP B1 AAbs significantly correlated with that of C-reactive protein and erythrocyte sedimentation rate, while in those with SSc the detection of anti-RNP B1 AAbs was related to the rigidity of the vascular wall and the presence of hypertension. The frequency of anti-RNP B1 AAbs among the RA patients seronegative for rheumatoid factor and anti-cyclic citrullinated peptide antibodies was 15.4%. Conclusion. Anti-RNP B1 AAs are a useful laboratory marker (with the upper limit of the normal range being 3.3 U/ml, but are of limited value in the diagnosis of RA. Anti-RNP B1 AAbs may be regarded as an additional diagnostic marker for RA.

  7. Efeito hipoglicêmico de rações à base de berinjela (Solanum melongena,L. em ratos

    Directory of Open Access Journals (Sweden)

    Derivi Sandra Casa Nova

    2002-01-01

    Full Text Available Os objetivos do presente trabalho foram verificar se dietas ricas em berinjela apresentam efeito hipoglicêmico, se contribuem para o retardamento de absorção da glicose pós-prandial e se a fração fibra solúvel está correlacionada com estes efeitos. Os experimentos foram realizados com ratos Wistar machos adultos, normais e diabéticos, que receberam rações à base de caseína, berinjela com casca e sem casca, e de casca de berinjela por um período de 42 dias. A glicose sangüínea foi determinada no início do experimento e aos 13, 21, 34 e 42 dias. Os testes orais de tolerância à glicose (TOTG foram realizados no final do experimento. Os resultados mostraram que as rações à base de farinha de berinjela com casca e de casca de berinjela apresentaram redução nos níveis de glicose. Este efeito não foi significativo para a ração à base de farinha de berinjela sem casca. Os animais do grupo diabético que receberam ração à base de berinjela com casca apresentaram menor área sob a curva de glicose, do que os dos grupos controle (ração à base de caseína e de berinjela com casca e do que o do grupo diabético que recebeu a ração de caseína. Este efeito não foi observado nos animais que receberam ração à base de berinjela sem casca e casca de berinjela. Estes resultados indicam a presença de um composto responsável pelo efeito hipoglicêmico na casca de berinjela e que a pectina solúvel da ração não foi suficiente para promover tal efeito, mas que a administração contínua de pectina solúvel contribuiu para a melhora da TOTG.

  8. Efficient Wide Range Converters (EWiRaC): A new family of high efficient AC-DC Converters

    DEFF Research Database (Denmark)

    Petersen, Lars; Andersen, Michael Andreas E.

    2006-01-01

    suffers a major penalty in efficiency when used at the low end of the voltage range (90VAC) in a universal voltage range application (90-270VAC). This paper addresses this problem by suggesting a new family of converters that effectively reduces the apparent voltage range with a factor of 2 by changing...... the converter topology according to the input voltage. This new converter type has been named: efficient wide range converter (EWiRaC). The performance of the EWiRaC is experimental verified in a universal input range (90-270VAC) application with an output voltage of 185VDC capable of 500W output power. The EWi...

  9. Incisivo lateral superior con dos raíces y dos conductos. Caso Clínico.

    OpenAIRE

    Martinez, P.; Boldo, M.; Corominola, P.; Sierra, L.(Universidad de Los Andes, Bogota, Colombia); Lenarduzzi, A.; Fernández Solari, Jose Javier; Rodriguez, P.

    2015-01-01

    Las anomalías en la morfología del incisivo lateral superior son de muy baja frecuencia. Las anomalías de desarrollo radicular pueden presentarse como alteraciones tanto en el número de conductos, como en el número de raíces, así como en ambas regiones a la vez. En el presente trabajo, se reporta el caso de un paciente que se presenta a la consulta con malestar en el incisivo lateral superior izquierdo. En la radiografía preoperatoria se detectó la presencia de dos conductos y dos raíces, sin...

  10. Human natural killer cell development in secondary lymphoid tissues

    Science.gov (United States)

    Freud, Aharon G.; Yu, Jianhua; Caligiuri, Michael A.

    2014-01-01

    For nearly a decade it has been appreciated that critical steps in human natural killer (NK) cell development likely occur outside of the bone marrow and potentially necessitate distinct microenvironments within extramedullary tissues. The latter include the liver and gravid uterus as well as secondary lymphoid tissues such as tonsils and lymph nodes. For as yet unknown reasons these tissues are naturally enriched with NK cell developmental intermediates (NKDI) that span a maturation continuum starting from an oligopotent CD34+CD45RA+ hematopoietic precursor cell to a cytolytic mature NK cell. Indeed despite the detection of NKDI within the aforementioned tissues, relatively little is known about how, why, and when these tissues may be most suited to support NK cell maturation and how this process fits in with other components of the human immune system. With the discovery of other innate lymphoid subsets whose immunophenotypes overlap with those of NKDI, there is also need to revisit and potentially re-characterize the basic immunophenotypes of the stages of the human NK cell developmental pathway in vivo. In this review, we provide an overview of human NK cell development in secondary lymphoid tissues and discuss the many questions that remain to be answered in this exciting field. PMID:24661538

  11. Adipose tissue fibrosis.

    Science.gov (United States)

    Buechler, Christa; Krautbauer, Sabrina; Eisinger, Kristina

    2015-05-15

    The increasing prevalence of obesity causes a major interest in white adipose tissue biology. Adipose tissue cells are surrounded by extracellular matrix proteins whose composition and remodeling is of crucial importance for cell function. The expansion of adipose tissue in obesity is linked to an inappropriate supply with oxygen and hypoxia development. Subsequent activation of hypoxia inducible factor 1 (HIF-1) inhibits preadipocyte differentiation and initiates adipose tissue fibrosis. Thereby adipose tissue growth is limited and excess triglycerides are stored in ectopic tissues. Stressed adipocytes and hypoxia contribute to immune cell immigration and activation which further aggravates adipose tissue fibrosis. There is substantial evidence that adipose tissue fibrosis is linked to metabolic dysfunction, both in rodent models and in the clinical setting. Peroxisome proliferator activated receptor gamma agonists and adiponectin both reduce adipose tissue fibrosis, inflammation and insulin resistance. Current knowledge suggests that antifibrotic drugs, increasing adipose tissue oxygen supply or HIF-1 antagonists will improve adipose tissue function and thereby ameliorate metabolic diseases.

  12. Cell and Tissue Engineering

    CERN Document Server

    2012-01-01

    “Cell and Tissue Engineering” introduces the principles and new approaches in cell and tissue engineering. It includes both the fundamentals and the current trends in cell and tissue engineering, in a way useful both to a novice and an expert in the field. The book is composed of 13 chapters all of which are written by the leading experts. It is organized to gradually assemble an insight in cell and tissue function starting form a molecular nano-level, extending to a cellular micro-level and finishing at the tissue macro-level. In specific, biological, physiological, biophysical, biochemical, medical, and engineering aspects are covered from the standpoint of the development of functional substitutes of biological tissues for potential clinical use. Topics in the area of cell engineering include cell membrane biophysics, structure and function of the cytoskeleton, cell-extracellular matrix interactions, and mechanotransduction. In the area of tissue engineering the focus is on the in vitro cultivation of ...

  13. 228Ra/226Ra ratio and 7Be concentration in the Sea of Japan as indicators for water transport: comparison with migration pattern of Fukushima Dai-ichi NPP-derived 134Cs and 137Cs.

    Science.gov (United States)

    Inoue, M; Furusawa, Y; Fujimoto, K; Minakawa, M; Kofuji, H; Nagao, S; Yamamoto, M; Hamajima, Y; Yoshida, K; Nakano, Y; Hayakawa, K; Oikawa, S; Misonoo, J; Isoda, Y

    2013-12-01

    To assess the migration patterns of radiocesium emitted from the Fukushima Dai-ichi Nuclear Power Plant (FDNPP), we analyzed (228)Ra/(226)Ra ratios and (7)Be concentrations and compared them with (134)Cs and (137)Cs concentrations in seawater samples collected within the Sea of Japan before and after the FDNPP accident (i.e., during the period 2007-2012) using low-background γ-spectrometry. The (228)Ra/(226)Ra ratios in surface waters exhibited lateral and seasonal variations, reflecting the flow patterns of surface water. This indicates the transport patterns of the FDNPP-derived radiocesium by surface water. Cosmogenic (7)Be (half-life: 53.3 d) exhibited markedly high concentrations (5-10 mBq/L) at depths shallower than 50 m, with concentrations decreasing steeply (0.2-2 mBq/L) at depths of 50-250 m. The distribution of (7)Be concentrations suggests that the downward delivery of the FDNPP-derived radiocesium to below 50 m depth was negligible for a few months prior to its removal from the Sea of Japan. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Retinoids and nuclear retinoid receptors in white and brown adipose tissues: physiopathologic aspects.

    Science.gov (United States)

    Flajollet, Sébastien; Staels, Bart; Lefebvre, Philippe

    2013-08-01

    Vitamin A, ingested either as retinol or β-carotene from animal- or plant-derived foods respectively, is a nutrient essential for many biological functions such as embryonic development, vision, immune response, tissue remodeling, and metabolism. Its main active metabolite is all trans-retinoic acid (atRA), which regulates gene expression through the activation of α, β, and γ isotypes of the nuclear atRA receptor (RAR). More recently, retinol derivatives were also shown to control the RAR activity, enlightening the interplay between vitamin A metabolism and RAR-mediated transcriptional control. The white and brown adipose tissues regulate the energy homeostasis by providing dynamic fatty acid storing and oxidizing capacities to the organism, in connection with the other fatty acid-consuming tissues. This concerted interorgan response to fatty acid fluxes is orchestrated, in part, by the endocrine activity of the adipose tissue depots. The adipose tissues are also sites for synthesizing and storing vitamin A derivatives, which will act as hormonal cues or intracellularly to regulate essential aspects of adipocyte biology. As agents that prevent adipocyte differentiation hence, expected to decrease fat mass, and inducers of uncoupling protein expression, thus, favoring energy expenditure, retinoids have prompted many investigations to decipher their roles in adipose tissue pathophysiology, which are summarized in this review.

  15. Retinoids and retinoid-metabolic gene expression in mouse adipose tissues.

    Science.gov (United States)

    Sima, Aurelia; Manolescu, Daniel-Constantin; Bhat, Pangala

    2011-12-01

    Vitamin A and its analogs (retinoids) regulate adipocyte differentiation. Recent investigations have demonstrated a relationship among retinoids, retinoid-binding-protein 4 (RBP4) synthesized in adipose tissues, and insulin-resistance status. In this study, we measured retinoid levels and analyzed the expression of retinoid homeostatic genes associated with retinol uptake, esterification, oxidation, and catabolism in subcutaneous (Sc) and visceral (Vis) mouse fat tissues. Both Sc and Vis depots were found to contain similar levels of all-trans retinol. A metabolite of retinol with characteristic ultraviolet absorption maxima for 9-cis retinol was observed in these 2 adipose depots, and its level was 2-fold higher in Sc than in Vis tissues. Vis adipose tissue expressed significantly higher levels of RBP4, CRBP1 (intracellular retinol-binding protein 1), RDH10 (retinol dehydrogenase), as well as CYP26A1 and B1 (retinoic acid (RA) hydroxylases). No differences in STRA6 (RBP4 receptor), LRAT (retinol esterification), CRABP1 and 2 (intracellular RA-binding proteins), and RALDH1 (retinal dehydrogenase) mRNA expressions were discerned in both fat depots. RALDH1 was identified as the only RALDH expressed in both Sc and Vis adipose tissues. These results indicate that Vis is more actively involved in retinoid metabolism than Sc adipose tissue.

  16. RAPIDARC (RA) in the uterine cervical cancer; dosimetric gain vs 3D-Crt; RAPIDARC (RA) en el cancer de cervix uterino; ganancia dosimetrica vs 3D-CRT

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez, J.; Garcia, B.; Quispe, K.; Gonzales, A.; Marquina, J., E-mail: jose.ramirez@aliada.com.pe [Clinica Aliada, Oncologia Integral, Av. Jose Galvez Barrenechea 1044, San Isidro, Lima (Peru)

    2014-08-15

    This work aims to quantitatively assess RAPIDARC (RA) treatments versus three dimensional-Conformal Radiation Therapy with field to field technique (3D-Crt-Fin F). 11 patients with cervical cancer treated at our institution radically or adjuvant clinical stages I-III B were evaluated. The prescribed dose was 50 Gy (2 Gy / Fr). The RA plans consisted of two isocentric complete arcs and conformational plans of 4 isocentric fields (previous, subsequent, right side and left side) with 3D-Crt-Fin F technique; both cases carried out ??in the Eclipse version 10 planner with calculation algorithm analytical anisotropic algorithm (AAA) and volumetric optimization software (for VMAT plans). Homogeneity indices (Hi), conformity indices (CI) Sigma indices (S-Index), monitor units (MU) and the time required for each treatment were compared. The mean age was 52 years (32-65) of the 11 patients 9 were clinical stages I-II B. The Hi varied from 0.052 for RA to 0.163 for 3D-Crt-Fin F (p = 0.009), and the CI between 1.005 and 1.35 (p = 0.26), the S-index from 1.2 to 3.7 (p = 0.001) and the H-index of 1.08 to 1.15 (p = 0.24). All dose limits in risk organs were met with a significant difference in the RA plans versus 3D-Crt-Fin F. In patients with cervical cancer the treatment plans quality with the indices aforementioned seems to be better with the RA technique, being observed a significant reduction of radiation to surrounding organs. (author)

  17. Como trabalhar com "raça" em sociologia How to work with "race" in sociology

    Directory of Open Access Journals (Sweden)

    Antonio Sérgio Alfredo Guimarães

    2003-06-01

    Full Text Available Numa exposição didática, de caráter teórico-metodológico, o autor explica o modo como utiliza em suas pesquisas a categoria "raça", em conexão com outras categorias como "cor", "etnia", "região", "classe", "nação", "povo", "estado", etc. A partir do pressuposto de que os conceitos, teóricos ou não, só podem ser aplicados e entendidos no seu contexto discursivo, o autor estabelece a distinção entre conceitos "analíticos" e "nativos", ou seja, entre categorias retiradas de um corpus teórico e categorias que compõem o próprio universo discursivo dos sujeitos que estão sendo analisados, mas que devem ser utilizados pelo sociólogo. Na parte central do texto, o autor esboça uma história dos significados da categoria "raça" no Brasil e das diversas explicações do caráter das relações entre brancos e negros avançadas pela Sociologia: desde o trabalho pioneiro de Donald Pierson, nos anos 1940, passando pelos estudos da Unesco, nos anos 1950, os trabalhos da chamada "escola paulista", nos anos 1960, e a retomada da teoria da "democracia racial" nos anos mais recentes, em estreito diálogo com os movimentos negros. O autor termina por fazer uma pequena discussão sobre os diversos estímulos, ou perguntas, dados em pesquisas tipo survey, para definição e mensuração da variável cor ou raça.In a didactic account of a theoretical-methodological nature the author explains how the category of "race" is used in his research, in connection with other categories such as "color", "ethnics", "class", "nation", "people", "state", etc. Assuming that concepts, theoretical or otherwise, can only be applied and understood within their discursive contexts, the author establishes the distinction between "analytical" and "native" concepts, that is, between categories extracted from a theoretical corpus, and those that comprise the discursive universe of the subjects being analyzed, but that must be employed by the sociologist. In the

  18. Regeneration of periodontal tissues: guided tissue regeneration.

    Science.gov (United States)

    Villar, Cristina C; Cochran, David L

    2010-01-01

    The concept that only fibroblasts from the periodontal ligament or undifferentiated mesenchymal cells have the potential to re-create the original periodontal attachment has been long recognized. Based on this concept, guided tissue regeneration has been applied with variable success to regenerate periodontal defects. Quantitative analysis of clinical outcomes after guided tissue regeneration suggests that this therapy is a successful and predictable procedure to treat narrow intrabony defects and class II mandibular furcations, but offers limited benefits in the treatment of other types of periodontal defects.

  19. Neuroprotective properties of ciliary neurotrophic factor on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells.

    Science.gov (United States)

    Wang, Ke; Zhou, Fanfan; Zhu, Xue; Zhang, Kai; Huang, Biao; Zhu, Lan; Zhu, Ling

    2014-01-01

    Ciliary neurotrophic factor (CNTF) is a neurocytokine, which could promote survival and/or differentiation in many cell types. In this study, the biological effects of CNTF on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells and the underlying molecular mechanism of this effect were investigated for the first time. The results showed that RA was able to increase cells susceptibility to CNTF via regulating the expression levels of CNTF receptors. A further study revealed that CNTF could induce phosphorylation of STAT3, Akt and ERK1/2 in RA-predifferentiated SH-SY5Y neuroblastoma cells, while the promoting activity of CNTF on survival and neurite growth of cells was attenuated by co-treatment with JAK2 inhibitor AG490 (25 μM), STAT3 inhibitor Curcumin (50 μM), PI3K inhibitor LY-294002 (50 µM), but not by co-treatment with MEK inhibitor PD98059 (50 μM). These findings suggested that JAK2/STAT3, as well as PI3K/Akt, play important roles in mediating the survival and neurite growth response of RA-predifferentiated cells to CNTF. Our study may be useful to further understand the functional role of CNTF and offer a convenient model to explore the therapeutic potential of CNTF in neurodegenerative diseases.

  20. Elimination of natural uranium and {sup 226}Ra from contaminated waters by rhizofiltration using Helianthus annuus L

    Energy Technology Data Exchange (ETDEWEB)

    Vera Tome, F. [Departamento de Fisica Aplicada, Facultad de Ciencias, Universidad de Extremadura, 06071 Badajoz (Spain)], E-mail: fvt@unex.es; Blanco Rodriguez, P. [Departamento de Fisica, Facultad de Ciencias, Universidad de Extremadura, 06071 Badajoz (Spain); Lozano, J.C. [Laboratorio de Radiactividad Ambiental, Facultad de Ciencias, Universidad de Salamanca, 37008 Salamanca (Spain)

    2008-04-15

    The elimination of natural uranium and {sup 226}Ra from contaminated waters by rhizofiltration was tested using Helianthus annuus L. (sunflower) seedlings growing in a hydroponic medium. Different experiments were designed to determine the optimum age of the seedlings for the remediation process, and also to study the principal way in which the radionuclides are removed from the solution by the sunflower roots. In every trial a precipitate appeared which contained a major fraction of the natural uranium and {sup 226}Ra. The results indicated that the seedlings themselves induced the formation of this precipitate. When four-week-old seedlings were exposed to contaminated water, a period of only 2 days was sufficient to remove the natural uranium and {sup 226}Ra from the solution: about 50% of the natural uranium and 70% of the {sup 226}Ra were fixed in the roots, and essentially the rest was found in the precipitate, with only very small percentages fixed in the shoots and left in solution.

  1. Ottawa Panel Evidence-Based Clinical Practice Guidelines for Patient Education in the Management of Rheumatoid Arthritis (RA)

    Science.gov (United States)

    Brosseau, Lucie; Wells, George A.; Tugwell, Peter; Egan, Mary; Dubouloz, Claire-Jehanne; Welch, Vivian A.; Trafford, Laura; Sredic, Danjiel; Pohran, Kathryn; Smoljanic, Jovana; Vukosavljevic, Ivan; De Angelis, Gino; Loew, Laurianne; McEwan, Jessica; Bell, Mary; Finestone, Hillel M.; Lineker, Sydney; King, Judy; Jelly, Wilma; Casimiro, Lynn; Haines-Wangda, Angela; Russell-Doreleyers, Marion; Laferriere, Lucie; Lambert, Kim

    2012-01-01

    Background and purpose: The objective of this article is to create guidelines for education interventions in the management of patients ([greater than] 18 years old) with rheumatoid arthritis (RA). Methods: The Ottawa Methods Group identified and synthesized evidence from comparative controlled trials using Cochrane Collaboration methods. The…

  2. Value of body mass index in the diagnosis of obesity according to DEXA in well-controlled RA patients.

    Science.gov (United States)

    Tello-Winniczuk, Nina; Vega-Morales, David; García-Hernandez, Pedro A; Esquivel-Valerio, Jorge A; Garza-Elizondo, Mario A; Arana-Guajardo, Ana C

    Rheumatoid arthritis (RA) has an indirect effect on body composition. Body mass index (BMI) is not a valid predictor of body fat in RA patients. To evaluate the accuracy of BMI in identifying obesity diagnosed according to dual energy X-ray absorptiometry (DXA) in well-controlled RA patients. An observational, cross-sectional, descriptive, analytical study. We used 3 different cutoffs for obesity as determined by DXA: >35% total fat, >40% total fat, and >35% central fat mass (central obesity). One hundred one patients were included. We found that 35% total fat corresponded to a BMI of 24kg/m2, with a sensitivity of 90% and specificity of 75% (area under the curve [AUC] 0.917); 40% total fat to a BMI of 25kg/m2, with a sensitivity of 86% and specificity of 39% (AUC 0.822); and 35% central fat mass to a BMI of 22kg/m2, with a sensitivity of 97% and specificity of 84% (AUC 0.951). Obesity according to DXA was underdiagnosed when the classic BMI cutoffs were used in well-controlled RA patients. Copyright © 2016 Elsevier España, S.L.U. and Sociedad Española de Reumatología y Colegio Mexicano de Reumatología. All rights reserved.

  3. Nitrogênio no crescimento da planta e na qualidade de raízes da mandioquinha-salsa

    Directory of Open Access Journals (Sweden)

    Amanda Rodrigues Alves Nunes

    2016-02-01

    Full Text Available RESUMO: O nitrogênio (N é o segundo nutriente mais absorvido pela mandioquinha-salsa. No entanto, ainda existem dúvidas sobre a influência que esse nutriente pode exercer sobre o crescimento da planta e a qualidade das raízes de reserva. Assim, objetivou-se com este trabalho avaliar a influência da adubação nitrogenada no crescimento da planta e na qualidade físico-química e nutricional das raízes de mandioquinha-salsa. O experimento foi conduzido em um Latossolo Vermelho distrófico de textura arenosa, no delineamento experimental de blocos ao acaso, com quatro repetições. Os tratamentos foram constituídos pelas doses de 0, 50, 100 e 200kg ha-1 de N. O crescimento das partes vegetativas da planta de mandioquinha-salsa aumentou linearmente com a adubação nitrogenada, mas a massa média e a produtividade das raízes de reserva aumentaram até as doses estimadas de 121 e 148kg ha-1 de N, respectivamente. A adubação nitrogenada aumentou os teores de amido e de proteína das raízes e diminuiu os teores de açúcares totais, porém, sem influenciar a qualidade nutricional delas.

  4. "Kuningas Oidipus" jääb vähese publiku tõttu ära / Neeme Korv

    Index Scriptorium Estoniae

    Korv, Neeme, 1974-

    2001-01-01

    24. augustil Haapsalu piiskopilinnuse vabaõhulaval toimuma pidanud suur suvelõpu kontsert, kus pidi ERSO esituses kõlama Eino Tambergi süit "Kuningas Oidipus" ning Igor Stravinski ooper-oratoorium "Oedipus Rex" jääb ära

  5. PiRaNhA: a server for the computational prediction of RNA-binding residues in protein sequences

    Science.gov (United States)

    Murakami, Yoichi; Spriggs, Ruth V.; Nakamura, Haruki; Jones, Susan

    2010-01-01

    The PiRaNhA web server is a publicly available online resource that automatically predicts the location of RNA-binding residues (RBRs) in protein sequences. The goal of functional annotation of sequences in the field of RNA binding is to provide predictions of high accuracy that require only small numbers of targeted mutations for verification. The PiRaNhA server uses a support vector machine (SVM), with position-specific scoring matrices, residue interface propensity, predicted residue accessibility and residue hydrophobicity as features. The server allows the submission of up to 10 protein sequences, and the predictions for each sequence are provided on a web page and via email. The prediction results are provided in sequence format with predicted RBRs highlighted, in text format with the SVM threshold score indicated and as a graph which enables users to quickly identify those residues above any specific SVM threshold. The graph effectively enables the increase or decrease of the false positive rate. When tested on a non-redundant data set of 42 protein sequences not used in training, the PiRaNhA server achieved an accuracy of 85%, specificity of 90% and a Matthews correlation coefficient of 0.41 and outperformed other publicly available servers. The PiRaNhA prediction server is freely available at http://www.bioinformatics.sussex.ac.uk/PIRANHA. PMID:20507911

  6. Jmjd2/Kdm4 demethylases are required for expression of Il3ra and survival of acute myeloid leukemia cells

    DEFF Research Database (Denmark)

    Agger, Karl; Miyagi, Satoru; Pedersen, Marianne Terndrup

    2016-01-01

    a mechanism involving removal of H3K9me3 from the promoter of the Il3ra gene. Importantly, ectopic expression of Il3ra in Jmjd2/Kdm4 knockout cells alleviates the requirement of Jmjd2/Kdm4 for the survival of AML cells, showing that Il3ra is a critical downstream target of Jmjd2/Kdm4 in leukemia......Acute myeloid leukemias (AMLs) with a rearrangement of the mixed-linage leukemia (MLL) gene are aggressive hematopoietic malignancies. Here, we explored the feasibility of using the H3K9- and H3K36-specific demethylases Jmjd2/Kdm4 as putative drug targets in MLL-AF9 translocated leukemia. Using...... Jmjd2a, Jmjd2b, and Jmjd2c conditional triple-knockout mice, we show that Jmjd2/Kdm4 activities are required for MLL-AF9 translocated AML in vivo and in vitro. We demonstrate that expression of the interleukin 3 receptor α (Il3ra also known as Cd123) subunit is dependent on Jmjd2/Kdm4 through...

  7. Ansambel Smilers esineb täna Kadrinas. Sex Pistolsi kontsert Tallinnas jääb ära

    Index Scriptorium Estoniae

    2008-01-01

    Ansambli Smilers kontserdist ETV Live raames 29. juulil Kadrinas. Briti punkansambli Sex Pistols kontsert 22. aug. Tallinnas Rocca al Mare suurhallis jääb ära, piletid kehtivad 20. aug. Riias toimuval kontserdil või ostetakse tagasi kuni 21. septembrini

  8. Transfer factor of 226Ra, 232Th and 40K from soil to Alpinia Galangal plant grown in northern Thailand

    Science.gov (United States)

    Kritsananuwat, R.; Chanyotha, S.; Kranrod, C.; Pengvanich, P.

    2017-06-01

    This paper reports the activity concentration of three natural radionuclides, 226Ra, 232Th and 40K, found in Alpinia Galangal plants which are widely used in various Asian cuisines and traditional medicine. The galangal plants and their relevant soils were collected from four provinces in the north of Thailand under natural field conditions. The activity concentration of radionuclides was determined using gamma-ray spectrometry. Soil-to-plant transfer factors (TFs) for 226Ra, 232Th and 40K were investigated in rhizome and aerial parts of the galangal plants. The activity concentration in the soils ranged from 22 to 88 Bq kg-1 for 226Ra, 27 to 157 Bq kg-1 for 232Th and 58 to 1157 Bq kg-1 for 40K. In Alpinia Galangal, the concentration ranged from radiation monitoring. The Annual effective ingestion dose due to ingestion of 226Ra, 232Th and 40K in galangals is significantly below the worldwide value reported by UNSCEAR 2000.

  9. An energy-efficient rate adaptive media access protocol (RA-MAC) for long-lived sensor networks.

    Science.gov (United States)

    Hu, Wen; Chen, Quanjun; Corke, Peter; O'Rourke, Damien

    2010-01-01

    We introduce an energy-efficient Rate Adaptive Media Access Control (RA-MAC) algorithm for long-lived Wireless Sensor Networks (WSNs). Previous research shows that the dynamic and lossy nature of wireless communications is one of the major challenges to reliable data delivery in WSNs. RA-MAC achieves high link reliability in such situations by dynamically trading off data rate for channel gain. The extra gain that can be achieved reduces the packet loss rate which contributes to reduced energy expenditure through a reduced numbers of retransmissions. We achieve this at the expense of raw bit rate which generally far exceeds the application's link requirement. To minimize communication energy consumption, RA-MAC selects the optimal data rate based on the estimated link quality at each data rate and an analytical model of the energy consumption. Our model shows how the selected data rate depends on different channel conditions in order to minimize energy consumption. We have implemented RA-MAC in TinyOS for an off-the-shelf sensor platform (the TinyNode) on top of a state-of-the-art WSN Media Access Control Protocol, SCP-MAC, and evaluated its performance by comparing our implementation with the original SCP-MAC using both simulation and experiment.

  10. ra vaata aknast välja..." : [luuletused] / =[Mesikepp, Indrek] François Serpent

    Index Scriptorium Estoniae

    Serpent, François, pseud., 1971-

    2002-01-01

    Sisu: "ära vaata aknast välja..." ; "toidukaupade osakond..." ; imelikke inimesi mõeldakse välja ; "öösel kolmveerand neli..." ; "ma ei karda liblikaid..." ; "pohmell me yhises kehas..." ; "mida ma teeksin Sinuta Ave..." ; "need ei olnudki mõõgad..."

  11. Crecimiento secundario inusual en raíz principal de Pfaffia gnaphalioides (L. Fil. Mart. (Amaranthaceae Secondary and unusual growth in main root of Pfaffia gnaphalioides (L. Fil. Mart. (Amaranthaceae

    Directory of Open Access Journals (Sweden)

    Mónica Alicia Grosso

    2007-03-01

    Full Text Available Raíces de Pfaffia se comercializan como "ginseng brasilero" y extractos crudos de raíces de Pfaffia glomerata tienen actividad analgésica y desinflamatoria. Pfaffia gnaphalioides es herbácea perenne y crece en el área serrana del sur de la Provincia de Córdoba, Argentina. El objetivo de este trabajo es estudiar el crecimiento secundario inusual en raíz principal de Pfaffia gnaphalioides. Se estudió en invernáculo la forma de crecimiento durante los dos primeros años relacionando la parte aérea y subterránea. Se realizaron calicatas in situ para analizar el sistema radical. La raíz principal desarrolla raíces laterales, plagiótropas, con yemas que forman brotes aéreos de innovación. En cortes transversales de raíz principal se observa desarrollo secundario inusual. Un meristema lateral produce corteza secundaria hacia afuera y tejido conjuntivo y una sucesión de cambia vascular hacia adentro. Cuando cada cambium vascular es producido, el meristema lateral que se encuentra hacia afuera de éste tiende a permanecer quiescente, retornando a la actividad cuando el cambium vascular interno a éste permanece menos activo. Los cordones vasculares secundarios están dispuestos en anillos concéntricos sin radios parenquimáticos. La presencia de abundante parénquima conteniendo almidón en la estructura inusual de raíz en Pfaffia gnaphalioides, constituye una buena adaptación a condiciones xéricas.Pfaffia roots have been commercialized as "brazilian ginseng" and crude extracts of Pfaffia glomerata roots have analgesic and disinflamatory activity. Pfaffia gnaphalioides is a perennial herb and grows in southern Córdoba, Argentina. The objective of this work is to analyze root systems in Pfaffia gnaphalioides. Growth of above and belowground organs was observed for two years in a greenhouse. Belowground organs were analyzed in situ in hillcountry shrublands, by digging soil pits. The root system is characterized by presence of a main

  12. Role of cathepsin B in regulating migration and invasion of fibroblast-like synoviocytes into inflamed tissue from patients with rheumatoid arthritis.

    Science.gov (United States)

    Tong, B; Wan, B; Wei, Z; Wang, T; Zhao, P; Dou, Y; Lv, Z; Xia, Y; Dai, Y

    2014-09-01

    Cathepsin B (CB), an important proteinase that participates in joint destruction in rheumatoid arthritis (RA), exhibits higher expression in fibroblast-like synoviocyte (FLS) of abnormal proliferative synovial tissues. Whether and how it affects the biological behaviours of RA-FLS, such as migration and invasion, are poorly understood. In the present study, CB expression in synovial tissues of patients with RA and ostearthritis (OA) were measured by quantitative polymerase chain reaction (qPCR) and immunohistochemistry (IHC), respectively. Stable depletion of endogenous CB was achieved by small interfering RNA (siRNA) transfection, and decrease of CB activity was acquired by using its specific inhibitor (CA074Me). The effects of CA074Me and RNA interference (RNAi) treatments on proliferation, migration, invasion, matrix metalloproteinase (MMP)-2/-9 expression, focal adhesion kinase (FAK) activation, and mitogen-activated protein kinases (MAPKs) phosphorylation of FLS were analysed. In RA synovial tissues, CB was expressed at elevated levels compared with OA synovial tissues. CA074Me could inhibit invasion of FLS obtained from RA patients in an ex-vivo invasion model. CA074Me and siRNA treatments suppressed the migration and invasion of FLS, reduced the activity, expression and mRNA level of MMP-2, restrained the activation of FAK and reduced the expression of F-actin. Moreover, CA074Me decreased the phosphorylation of P38 MAPK and c-Jun N-terminal kinase (JNK) in FLS, while siCB treatment reduced the phosphorylation of P38 but not JNK. CB substantially contributes to the invasive phenotype of FLS that leads to joint destruction in RA. This proteinase may show promise as a therapeutic target in inflammatory arthritis. © 2014 British Society for Immunology.

  13. A-type granites from the Guéra Massif, Central Chad: Petrology, geochemistry, geochronology, and petrogenesis.

    Science.gov (United States)

    Pham, Ngoc Ha T.; Shellnutt, J. Gregory; Yeh, Meng-Wan; Lee, Tung-Yi

    2017-04-01

    The poorly studied Saharan Metacraton of North-Central Africa is located between the Arabian-Nubian Shield in the east, the Tuareg Shield in the west and the Central African Orogenic Belt in the south. The Saharan Metacraton is composed of Neoproterozoic juvenile crust and the relics of pre-Neoproterozoic components reactivated during the Pan-African Orogeny. The Republic of Chad, constrained within the Saharan Metacraton, comprises a Phanerozoic cover overlying Precambrian basement outcroppings in four distinct massifs: the Mayo Kebbi, Tibesti, Ouaddaï, and the Guéra. The Guéra massif is the least studied of the four massifs but it likely preserves structures that were formed during the collision between Congo Craton and Saharan Metacraton. The Guéra Massif is composed of mostly granitic rocks. The granitoids have petrologic features that are consistent with A-type granite, such as micrographic intergrowth of sodic and potassic feldspar, the presence of sodic- and iron-rich amphibole, and iron-rich biotite. Compositionally, the granitic rocks of the Guéra Massif have high silica (SiO2 ≥ 68.9 wt.%) content and are metaluminous to marginally peraluminous. The rocks are classified as ferroan calc-alkalic to alkali-calcic with moderately high to very high Fe* ratios. The first zircon U/Pb geochronology of the silicic rocks from the Guéra Massif yielded three main age groups: 590 Ma, 570 Ma, 560 Ma, while a single gabbro yielded an intermediate age ( 580 Ma). A weakly foliated biotite granite yielded two populations, in which the emplacement age is interpreted to be 590 ± 10 Ma, whereas the younger age (550 ± 11 Ma) is considered to be a deformation age. Furthermore, inherited Meso- to Paleoproterozoic zircons are found in this sample. The geochemical and geochronology data indicate that there is a temporal evolution in the composition of rocks with the old, high Mg# granitoids shifting to young, low Mg# granitoids. This reveals that the A-type granites in

  14. Interleukin-4 (IL4 and Interleukin-4 receptor (IL4RA polymorphisms in asthma: a case control study

    Directory of Open Access Journals (Sweden)

    Lorente Félix

    2005-11-01

    Full Text Available Abstract Background IL4/IL4RA pathway plays an important role in atopy and asthma. Different polymorphisms in IL4 and IL4RA genes have been described. Particularly, -33C>TIL4 and 576Q>RIL4RA SNPs have been independently associated to atopy and asthma. The purpose of this study was to analyse these polymorphisms in a population of patients with a well-characterized asthma phenotype. Methods A total of 212 unrelated Caucasian individuals, 133 patients with asthma and 79 healthy subjects without symptoms or history of asthma or atopy and with negative skin prick tests were recruited. Lung function was measured by spirometry and asthma was specialist physician-diagnosed according to the ATS (American Thoracic Society criteria and classified following the GINA (Global Initiative for Asthma guidelines. Skin prick tests were performed according to EAACI recommendations. -33C>TIL4 was studied with TaqMan assay and 576Q>RIL4RA by PCR-RFLP technique. Hardy-Weinberg equilibrium was analysed in all groups. Dichotomous variables were analysed using χ2, Fisher exact test, Monte Carlo simulation test and odds ratio test. To model the effects of multiple covariates logistic regression was used. Results No statistically significant differences between the group of patients with asthma and the controls were found when the allele and genotype distribution of -33C>TIL4 and 576Q>RIL4RA polymorphisms were compared. However, the T allele of the -33C>TIL4 SNP was more frequent in patients with persistent asthma. Multivariate analysis adjusted for age and sex confirmed that carriers of allele T had an increased risk of persistent asthma (OR:2.77, 95%CI:1.18–6.49; p = 0.019. Analysis of combination of polymorphisms showed that patients carrying both the T allele of -33C>TIL4 and the A allele of 576Q>RIL4RA had an increased risk of asthma. This association was particularly observed in persistent asthma [Fisher's p value = 0.0021, Monte Carlo p value (after 104

  15. Preparation of (212)Pb-labeled monoclonal antibody using a novel (224)Ra-based generator solution.

    Science.gov (United States)

    Westrøm, Sara; Generalov, Roman; Bønsdorff, Tina B; Larsen, Roy H

    2017-08-01

    Alpha-emitting radionuclides have gained considerable attention as payloads for cancer targeting molecules due to their high cytotoxicity. One attractive radionuclide for this purpose is (212)Pb, which by itself is a β-emitter, but acts as an in vivo generator for its short-lived α-emitting daughters. The standard method of preparing (212)Pb-labeled antibodies requires handling and evaporation of strong acids containing high radioactivity levels by the end user. An operationally easier and more rapid process could be useful since the 10.6h half-life of (212)Pb puts time constraints on the preparation protocol. In this study, an in situ procedure for antibody labeling with (212)Pb, using a solution of the generator nuclide (224)Ra, is proposed as an alternative protocol for preparing (212)Pb-radioimmunoconjugates. Radium-224, the generator radionuclide of (212)Pb, was extracted from its parent nuclide, (228)Th. Lead-212-labeling of the TCMC-chelator conjugated monoclonal antibody trastuzumab was carried out in a solution containing (224)Ra in equilibrium with progeny. Subsequently, the efficiency of separating the (212)Pb-radioimmunoconjugate from (224)Ra and other unconjugated daughter nuclides in the solution using either centrifugal separation or a PD-10 desalting size exclusion column was evaluated and compared. Radiolabeling with (212)Pb in (224)Ra-solutions was more than 90% efficient after only 30min reaction time at TCMC-trastuzumab concentrations from 0.15mg/mL and higher. Separation of (212)Pb-labeled trastuzumab from (224)Ra using a PD-10 column was clearly superior to centrifugal separation. This method allowed recovery of approximately 75% of the (212)Pb-antibody-conjugate in the eluate, and the remaining amount of (224)Ra was only 0.9±0.8% (n=7). The current work demonstrates a novel method of producing (212)Pb-based radioimmunoconjugates from a (224)Ra-solution, which may be simpler and less time-consuming for the end user compared with the method

  16. DNA from keratinous tissue

    DEFF Research Database (Denmark)

    Bengtsson, Camilla F.; Olsen, Maja E.; Brandt, Luise Ørsted

    2011-01-01

    Keratinous tissues such as nail, hair, horn, scales and feather have been used as a source of DNA for over 20 years. Particular benefits of such tissues include the ease with which they can be sampled, the relative stability of DNA in such tissues once sampled, and, in the context of ancient...... genetic analyses, the fact that sampling generally causes minimal visual damage to valuable specimens. Even when freshly sampled, however, the DNA quantity and quality in the fully keratinized parts of such tissues is extremely poor in comparison to other tissues such as blood and muscle – although little...... systematic research has been undertaken to characterize how such degradation may relate to sample source. In this review paper we present the current understanding of the quality and limitations of DNA in two key keratinous tissues, nail and hair. The findings indicate that although some fragments of nuclear...

  17. Arthritic and non-arthritic synovial fluids modulate IL10 and IL1RA gene expression in differentially activated primary human monocytes.

    Science.gov (United States)

    Lopa, S; Leijs, M J C; Moretti, M; Lubberts, E; van Osch, G J V M; Bastiaansen-Jenniskens, Y M

    2015-11-01

    Synovitis with an increased presence of macrophages is observed in osteoarthritis (OA) and rheumatoid arthritis (RA). Given the important role of macrophages in arthritis, we investigated the influence of OA and RA synovial fluid (SF) on primary human monocytes (Mo), their lineage precursors. Adherent monocytes without any stimulation (Mo(-)) or stimulated with IFN-γ and TNF-α (Mo(IFN-γ/TNF-α)) or IL-4 (Mo(IL-4)) were exposed to SF from 6 donors without any known joint disease (SF-Ctrl), 10 OA donors (SF-OA), and 10 RA donors (SF-RA). The transcriptional expression of IL6, IL1B, TNFA, IL10, CCL18, CD206, and IL1RA was analyzed. Mo(-) exposed to SF-RA had a lower expression of IL10 and a higher expression of IL1RA than when exposed to SF-Ctrl. Mo(IL-4) exposed to SF-RA had a lower expression of IL10 and CCL18 than when exposed to SF-Ctrl and Mo(IFN-γ/TNF-α) were not affected by SF-RA. Mo exposed to SF-OA also expressed less IL10, but only upon stimulation with IL-4, and expressed more IL1RA than when exposed to SF-Ctrl in any condition. A lower expression of IL10 may be regarded as a response to less inflammatory conditions since IL10 expression is higher in response to IFN-γ/TNF-α stimulation, probably as a feedback mechanism. Therefore, the lower expression of IL10 and the higher expression of IL1RA in Mo exposed to arthritic than to non-arthritic SF suggest that arthritic SF is mainly reducing the inflammatory responses in Mo. This may mimic the response of monocytes/macrophages recruited to the joint, where feedback mechanisms counteract pro-inflammatory processes. Copyright © 2015 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  18. Plant cyclopeptide RA-V kills human breast cancer cells by inducing mitochondria-mediated apoptosis through blocking PDK1–AKT interaction

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Xian-Ying; Chen, Wei [State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, 22 Han Kou Road, Nanjing (China); Fan, Jun-Ting [State Key Laboratory of Phytochemistry and Plant Resources in West China, Kunming Institute of Botany, Chinese Academy of Sciences, Kunming (China); Song, Ran; Wang, Lu [State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, 22 Han Kou Road, Nanjing (China); Gu, Yan-Hong [Department of Clinical Oncology, The First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Zeng, Guang-Zhi [State Key Laboratory of Phytochemistry and Plant Resources in West China, Kunming Institute of Botany, Chinese Academy of Sciences, Kunming (China); Shen, Yan; Wu, Xue-Feng [State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, 22 Han Kou Road, Nanjing (China); Tan, Ning-Hua, E-mail: nhtan@mail.kib.ac.cn [State Key Laboratory of Phytochemistry and Plant Resources in West China, Kunming Institute of Botany, Chinese Academy of Sciences, Kunming (China); Xu, Qiang, E-mail: molpharm@163.com [State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, 22 Han Kou Road, Nanjing (China); Sun, Yang, E-mail: yangsun@nju.edu.cn [State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, 22 Han Kou Road, Nanjing (China)

    2013-02-15

    In the present paper, we examined the effects of a natural cyclopeptide RA-V on human breast cancer cells and the underlying mechanisms. RA-V significantly inhibited the growth of human breast cancer MCF-7, MDA-MB-231 cells and murine breast cancer 4T1 cells. In addition, RA-V triggered mitochondrial apoptotic pathway which was indicated by the loss of mitochondrial membrane potential, the release of cytochrome c, and the activation of caspase cascade. Further study showed that RA-V dramatically inhibited phosphorylation of AKT and 3-phosphoinositide dependent protein kinase 1 (PDK1) in MCF-7 cells. Moreover, RA-V disrupted the interaction between PDK1 and AKT in MCF-7 cells. Furthermore, RA-V-induced apoptosis could be enhanced by phosphatidylinositol 3-kinase inhibitor or attenuated by over-expression of AKT in all the three kinds of breast cancer cells. Taken together, this study shows that RA-V, which can induce mitochondria-mediated apoptosis, exerts strong anti-tumor activity against human breast cancer. The underlying anti-cancer mechanism of RA-V is related to the blockage of the interaction between PDK1 and AKT. - Highlights: ► Plant cyclopeptide RA-V kills human breast cancer cells. ► RA-V triggered mitochondrial apoptotic pathway in human breast cancer cells. ► RA-V inhibited phosphorylation of AKT and PDK1 in breast cancer MCF-7 cells. ► Its mechanism is related to the blockage of the interaction between PDK1 and AKT.

  19. TissueCypher(™): A systems biology approach to anatomic pathology.

    Science.gov (United States)

    Prichard, Jeffrey W; Davison, Jon M; Campbell, Bruce B; Repa, Kathleen A; Reese, Lia M; Nguyen, Xuan M; Li, Jinhong; Foxwell, Tyler; Taylor, D Lansing; Critchley-Thorne, Rebecca J

    2015-01-01

    Current histologic methods for diagnosis are limited by intra- and inter-observer variability. Immunohistochemistry (IHC) methods are frequently used to assess biomarkers to aid diagnoses, however, IHC staining is variable and nonlinear and the manual interpretation is subjective. Furthermore, the biomarkers assessed clinically are typically biomarkers of epithelial cell processes. Tumors and premalignant tissues are not composed only of epithelial cells but are interacting systems of multiple cell types, including various stromal cell types that are involved in cancer development. The complex network of the tissue system highlights the need for a systems biology approach to anatomic pathology, in which quantification of system processes is combined with informatics tools to produce actionable scores to aid clinical decision-making. Here, we describe a quantitative, multiplexed biomarker imaging approach termed TissueCypher™ that applies systems biology to anatomic pathology. Applications of TissueCypher™ in understanding the tissue system of Barrett's esophagus (BE) and the potential use as an adjunctive tool in the diagnosis of BE are described. The TissueCypher™ Image Analysis Platform was used to assess 14 epithelial and stromal biomarkers with known diagnostic significance in BE in a set of BE biopsies with nondysplastic BE with reactive atypia (RA, n = 22) and Barrett's with high-grade dysplasia (HGD, n = 17). Biomarker and morphology features were extracted and evaluated in the confirmed BE HGD cases versus the nondysplastic BE cases with RA. Multiple image analysis features derived from epithelial and stromal biomarkers, including immune biomarkers and morphology, showed significant differences between HGD and RA. The assessment of epithelial cell abnormalities combined with an assessment of cellular changes in the lamina propria may serve as an adjunct to conventional pathology in the assessment of BE.

  20. Tissue engineering in dentistry.

    Science.gov (United States)

    Abou Neel, Ensanya Ali; Chrzanowski, Wojciech; Salih, Vehid M; Kim, Hae-Won; Knowles, Jonathan C

    2014-08-01

    of this review is to inform practitioners with the most updated information on tissue engineering and its potential applications in dentistry. The authors used "PUBMED" to find relevant literature written in English and published from the beginning of tissue engineering until today. A combination of keywords was used as the search terms e.g., "tissue engineering", "approaches", "strategies" "dentistry", "dental stem cells", "dentino-pulp complex", "guided tissue regeneration", "whole tooth", "TMJ", "condyle", "salivary glands", and "oral mucosa". Abstracts and full text articles were used to identify causes of craniofacial tissue loss, different approaches for craniofacial reconstructions, how the tissue engineering emerges, different strategies of tissue engineering, biomaterials employed for this purpose, the major attempts to engineer different dental structures, finally challenges and future of tissue engineering in dentistry. Only those articles that dealt with the tissue engineering in dentistry were selected. There have been a recent surge in guided tissue engineering methods to manage periodontal diseases beyond the traditional approaches. However, the predictable reconstruction of the innate organisation and function of whole teeth as well as their periodontal structures remains challenging. Despite some limited progress and minor successes, there remain distinct and important challenges in the development of reproducible and clinically safe approaches for oral tissue repair and regeneration. Clearly, there is a convincing body of evidence which confirms the need for this type of treatment, and public health data worldwide indicates a more than adequate patient resource. The future of these therapies involving more biological approaches and the use of dental tissue stem cells is promising and advancing. Also there may be a significant interest of their application and wider potential to treat disorders beyond the craniofacial region. Considering the

  1. Bioprospecting of novel thermostable β-glucosidase from Bacillus subtilis RA10 and its application in biomass hydrolysis.

    Science.gov (United States)

    Tiwari, Rameshwar; Singh, Puneet Kumar; Singh, Surender; Nain, Pawan K S; Nain, Lata; Shukla, Pratyoosh

    2017-01-01

    Saccharification is the most crucial and cost-intensive process in second generation biofuel production. The deficiency of β-glucosidase in commercial enzyme leads to incomplete biomass hydrolysis. The decomposition of biomass at high temperature environments leads us to isolate thermotolerant microbes with β-glucosidase production potential. A total of 11 isolates were obtained from compost and cow dung samples that were able to grow at 50 °C. On the basis of qualitative and quantitative estimation of β-glucosidase enzyme production, Bacillus subtilis RA10 was selected for further studies. The medium components and growth conditions were optimized and β-glucosidase enzyme production was enhanced up to 19.8-fold. The β-glucosidase from B. subtilis RA10 retained 78% of activity at 80 °C temperature and 68.32% of enzyme activity was stable even at 50 °C after 48 h of incubation. The supplementation of β-glucosidase from B. subtilis RA10 into commercial cellulase enzyme resulted in 1.34-fold higher glucose release. Furthermore, β-glucosidase was also functionally elucidated by cloning and overexpression of full length GH1 family β-glucosidase gene from B. subtilis RA10. The purified protein was characterized as thermostable β-glucosidase enzyme. The thermostable β-glucosidase enzyme from B. subtilis RA10 would facilitate efficient saccharification of cellulosic biomass into fermentable sugar. Consequently, after saccharification, thermostable β-glucosidase enzyme would be recovered and reused to reduce the cost of overall bioethanol production process.

  2. Mercury flux from salt marsh sediments: Insights from a comparison between 224Ra/228Th disequilibrium and core incubation methods

    Science.gov (United States)

    Shi, Xiangming; Mason, Robert P.; Charette, Matthew A.; Mazrui, Nashaat M.; Cai, Pinghe

    2018-02-01

    In aquatic environments, sediments are the main location of mercury methylation. Thus, accurate quantification of methylmercury (MeHg) fluxes at the sediment-water interface is vital to understanding the biogeochemical cycling of mercury, especially the toxic MeHg species, and their bioaccumulation. Traditional approaches, such as core incubations, are difficult to maintain at in-situ conditions during assays, leading to over/underestimation of benthic fluxes. Alternatively, the 224Ra/228Th disequilibrium method for tracing the transfer of dissolved substances across the sediment-water interface, has proven to be a reliable approach for quantifying benthic fluxes. In this study, the 224Ra/228Th disequilibrium and core incubation methods were compared to examine the benthic fluxes of both 224Ra and MeHg in salt marsh sediments of Barn Island, Connecticut, USA from May to August, 2016. The two methods were comparable for 224Ra but contradictory for MeHg. The radiotracer approach indicated that sediments were always the dominant source of both total mercury (THg) and MeHg. The core incubation method for MeHg produced similar results in May and August, but an opposite pattern in June and July, which suggested sediments were a sink of MeHg, contrary to the evidence of significant MeHg gradients between overlying water and porewater at the sediment-water interface. The potential reasons for such differences are discussed. Overall, we conclude that the 224Ra/228Th disequilibrium approach is preferred for estimating the benthic flux of MeHg and that sediment is indeed an important MeHg source in this marshland, and likely in other shallow coastal waters.

  3. Evaluation of Ra, Th, K and radium equivalent activity in sand samples from Camburi Beach, Vitoria, Espirito Santos, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Barros, Livia F.; Pecequilo, Brigitte R.S., E-mail: lfbarros@ipen.br, E-mail: brigitte@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Camburi beach, in the city of Vitoria, Espirito Santo State. Brazil, is a naturally high background region in Brazil. The beach sands contain monazite, ilmenite and other accessory minerals rich in {sup 226}Ra, {sup 23}'2Th and {sup 40}K. As these radionuclides are the main natural contributors to external exposure from gamma rays, the knowledge of the sands radioactivity content plays an important role in radiation protection. In this work, {sup 226}Ra, {sup 232}Th and {sup 40}K activities concentrations, together with the radium equivalent activity, Ra{sub eq.} were determined in some selected sand samples from a single location at Camburi beach, known for the high level of radioactivity. The sand samples collected monthly from January to December 2011, were dried and sealed in standard 100 mL HPDE polyethylene flasks and measured by high resolution gamma-spectrometry after a 4 weeks ingrowth period, in order to allow the secular equilibrium in the {sup 238}U and {sup 23}'2Th series. Preliminary results, without considering samples self-attenuation, show activities concentrations in the range from 12 {+-} 1 Bq kg{sup -1} to 1022 {+-} 30 Bq kg{sup -1} for {sup 226}Ra, 35 {+-} 1 Bq kg{sup -1} to 5731 {+-} 134 Bq kg{sup -1} for {sup 232}Th and 18 {+-} 4 Bqkg{sup -1} to 430 {+-} 21 Bq kg{sup -1} for {sup 40}K. The Ra{sub eq}, presented values ranging from 63 Bq kg{sup -1} to 9250 Bq kg{sup -1}. (author)

  4. Variabilidade isoenzimática em oito raças de milho Isoenzyme variation among eight races of maize

    Directory of Open Access Journals (Sweden)

    SÉRGIO EMÍLIO DOS SANTOS VALENTE

    1999-01-01

    Full Text Available Com o objetivo de avaliar a variabilidade genética e as relações de afinidade entre dezenove populações de oito raças de milho (Zea mays L. - as comerciais antigas Cateto Sulino, Cateto Sulino Grosso, Cateto Nortista e Canario de Ocho, e as raças indígenas Moroti, Lenha, Entrelaçado e Caingang - analisaram-se os seguintes sistemas enzimáticos: glutamato oxalacetato transaminase (GOT, esterase (EST e malato desidrogenase (MDH. Observou-se maior semelhança entre as raças pertencentes a um mesmo grupo, mas as populações analisadas não se agruparam de acordo com as raças, classificadas anteriormente segundo caracteres morfológicos. Os sistemas enzimáticos utilizados não permitiram a caracterização individual de cada uma das raças analisadas. As indígenas apresentaram maior variabilidade do que as comerciais antigas quanto ao número de alelos por loco e à porcentagem de locos polimórficos.The objective of this study was to evaluate the genetic variability and affinity relationships among eight races of maize (Zea mays L.: four ancient varieties (Cateto Sulino, Cateto Sulino Grosso, Cateto Nortista and Canario de Ocho and four indigenous (Moroti, Lenha, Entrelaçado and Caingang, through isoenzymatic polymorphisms. The following isoenzymatic systems were evaluated: Glutamate Oxaloacetate Transaminase (GOT, Esterase (EST and Malate Dehydrogenase (MDH. It was observed a higher identity among races belonging to the same racial group; however, populations within each race were not grouped according, to previous morphological classification. Indigenous races showed higher average number of alleles per loci and percentage of polymorphic loci than the ancient varieties. This fact might be due to the selection the ancient varieties had been gone through.

  5. Transcriptional regulation of Tal2 gene by all-trans retinoic acid (atRA) in P19 cells.

    Science.gov (United States)

    Kobayashi, Takanobu; Suzuki, Masayo; Morikawa, Masayuki; Kino, Katsuhito; Tanuma, Sei-ichi; Miyazawa, Hiroshi

    2015-01-01

    TAL2 is a transcription factor required in the normal development of mouse brain. In a previous study, we demonstrated that the expression of Tal2 gene is induced by the complex of all-trans retinoic acid (atRA) and retinoic acid receptor α (RARα) in mouse embryonal carcinoma P19 cells. atRA is also known to be important in inducing P19 cells to differentiate into the neural lineage. Therefore, we believe that the function of TAL2 in neural differentiation may be clarified by utilizing P19 cells. As the atRA-RARα complex induced the expression of Tal2, we focused on the regulatory region that is involved in its transcription. The atRA-RARα complex occupies a characteristic retinoic acid response element (RARE) located in the promoter of target genes. Therefore, we searched for RARE on the mouse Tal2 and found that a RARE-like element was located in the intron. We also found that a TATA-box-like element was located in the 5'-region of Tal2. Involvement between transcriptional activity and the TATA-box-like element was confirmed in the luciferase assay, and TATA-box binding protein was bound to this element upstream of Tal2 in P19 cells. atRA signaling activated the transcription through the RARE-like element, and RARα was bound to this element on Tal2 in P19 cells. In addition, the interaction between these elements on Tal2 was shown in the chromatin immunoprecipitation assay. These results suggest that the transcription of Tal2 is coordinately mediated by two distal regulatory elements.

  6. Proposed Fuzzy-NN Algorithm with LoRaCommunication Protocol for Clustered Irrigation Systems

    Directory of Open Access Journals (Sweden)

    Sotirios Kontogiannis

    2017-11-01

    Full Text Available Modern irrigation systems utilize sensors and actuators, interconnected together as a single entity. In such entities, A.I. algorithms are implemented, which are responsible for the irrigation process. In this paper, the authors present an irrigation Open Watering System (OWS architecture that spatially clusters the irrigation process into autonomous irrigation sections. Authors’ OWS implementation includes a Neuro-Fuzzy decision algorithm called FITRA, which originates from the Greek word for seed. In this paper, the FITRA algorithm is described in detail, as are experimentation results that indicate significant water conservations from the use of the FITRA algorithm. Furthermore, the authors propose a new communication protocol over LoRa radio as an alternative low-energy and long-range OWS clusters communication mechanism. The experimental scenarios confirm that the FITRA algorithm provides more efficient irrigation on clustered areas than existing non-clustered, time scheduled or threshold adaptive algorithms. This is due to the FITRA algorithm’s frequent monitoring of environmental conditions, fuzzy and neural network adaptation as well as adherence to past irrigation preferences.

  7. Ultrassonografia testicular em bovinos jovens da raça Nelore criados em sistema extensivo

    Directory of Open Access Journals (Sweden)

    D.J. Cardilli

    2012-02-01

    Full Text Available Este estudo visou avaliar o padrão ultrassonográfico do parênquima testicular de touros jovens da raça Nelore, desde a fase peripuberal até a puberdade, estabelecer padrões fisiológicos e também verificar se existe diferença de ecogenicidade entre animais púberes e pré-púberes na mesma idade. Foram realizados exames ecográficos dos testículos de 19 bovinos aos 10, 12, 14, 16 e 18 meses de idade. O padrão ultrassonográfico do parênquima testicular mostrou-se homogêneo e com ecogenicidade moderada. A ecogenicidade testicular aumentou em proporção direta com a idade dos animais. Não houve diferença significativa entre a ecogenicidade testicular de animais púberes e pré-púberes na mesma idade.

  8. Socialdemocracia y capital: las raíces neoclásicas del modelo sueco

    Directory of Open Access Journals (Sweden)

    Mario del Rosal Crespo

    2016-05-01

    Full Text Available La socialdemocracia ha tenido en el Modelo Sueco su referente por antonomasia. Sin embargo, las raíces teóricas de esta experiencia histórica, lejos de implementar los principios típicos del keynesianismo, se asentaron sobre unas bases de marcado carácter neoclásico. A través del conocido como Modelo Rehn-Meidner, posteriormente afianzado por el llamado Modelo EFO, la socialdemocracia sueca estableció un marco de política fiscal y monetaria restrictiva en el que se desarrolló una política salarial solidaria cimentada en un poderoso sindicalismo y un sólido sistema corporativista de negociación colectiva centralizada. Así, mediante la paulatina igualación y la contención de los salarios, se buscaba estimular la productividad, mantener a raya los costes laborales y facilitar la concentración y la centralización del capital. El objetivo final era favorecer la competitividad del sector exportador sueco con el fin de asegurar una rentabilidad y un ritmo de acumulación adecuados.

  9. Organizar a Desordem: Raízes do Brasil em 1936

    Directory of Open Access Journals (Sweden)

    Luiz Feldman

    2015-12-01

    Full Text Available Este artigo procura reconstruir o dilema político enfrentado por Sergio Buarque de Holanda na primeira edição de Raízes do Brasil. Sustenta-se que, na montagem do argumento de seu livro de estreia, o autor entabulou diálogos intelectuais com dois importantes pensadores brasileiros, Oliveira Vianna e Gilberto Freyre. O engajamento com a obra desses autores ajudou Sergio Buarque a enunciar os aspectos negativos e positivos do tipo de sociabilidade legado pela colônia – a “cordialidade” –, a diagnosticar a incompatibilidade entre doutrinas políticas e realidade nacional e a procurar uma forma de superar essa disjunção. A ideia da “organização da desordem” reflete a dificuldade de fundar-se um Estado respeitável em uma sociedade eivada de elementos anárquicos sem reprimir o substrato cultural tradicional de sua população.

  10. Raça e gênero no Brasil Race, gender, and development in Brazil

    Directory of Open Access Journals (Sweden)

    Peggy Lowell

    1995-01-01

    Full Text Available Valendo-se de dados dos censos de 1960 e 1980, este estudo estima a magnitude das diferenças raciais segundo o gênero no que se refere a local de moradia, educação, distribuição ocupacional e salários. Contrariando previsões segundo as quais as divisões raciais e de gênero cederiam às forças homogeneizadoras da industrialização, demonstra-se que o mercado de trabalho urbano no Brasil continua a ser segregado por raça e gênero.Using sample data from the 1960 and 1980 demografic censuses (the most recent available, this study estimates the magnitude of racial differences by gender in place of residence, education, occupational distribution, and wages. Contrary to predictions that race and gender divisions in the workplace would yield to the homogenizing forces of industrialization, it is demonstrated that the modern urban labor market in Brazil continues to be segregated by race and gender.

  11. Meta-RaPS Algorithm for the Aerial Refueling Scheduling Problem

    Science.gov (United States)

    Kaplan, Sezgin; Arin, Arif; Rabadi, Ghaith

    2011-01-01

    The Aerial Refueling Scheduling Problem (ARSP) can be defined as determining the refueling completion times for each fighter aircraft (job) on multiple tankers (machines). ARSP assumes that jobs have different release times and due dates, The total weighted tardiness is used to evaluate schedule's quality. Therefore, ARSP can be modeled as a parallel machine scheduling with release limes and due dates to minimize the total weighted tardiness. Since ARSP is NP-hard, it will be more appropriate to develop a pproimate or heuristic algorithm to obtain solutions in reasonable computation limes. In this paper, Meta-Raps-ATC algorithm is implemented to create high quality solutions. Meta-RaPS (Meta-heuristic for Randomized Priority Search) is a recent and promising meta heuristic that is applied by introducing randomness to a construction heuristic. The Apparent Tardiness Rule (ATC), which is a good rule for scheduling problems with tardiness objective, is used to construct initial solutions which are improved by an exchanging operation. Results are presented for generated instances.

  12. Stimulation of tissue-type plasminogen activator expression by retinoic acid in human endothelial cells requires retinoic acid receptor β2 induction

    NARCIS (Netherlands)

    Lansink, M.; Kooistra, T.

    1996-01-01

    We previously showed the involvement of retinoic acid receptor α (RARα) in the induction of tissue-type plasminogen activator (t-PA) synthesis by RA in human umbilical vein endothelial cells (HUVECs). However, the rather slow onset of this induction of t-PA synthesis suggested an indirect role of

  13. OMERACT Rheumatoid Arthritis Magnetic Resonance Imaging Studies. Core set of MRI acquisitions, joint pathology definitions, and the OMERACT RA-MRI scoring system

    DEFF Research Database (Denmark)

    Østergaard, Mikkel; Peterfy, C; Conaghan, P

    2003-01-01

    This article describes the 2002 OMERACT rheumatoid arthritis magnetic resonance image scoring system (RAMRIS) for evaluation of inflammatory and destructive changes in RA hands and wrists, which was developed by an international MRI-OMERACT group. MRI definitions of important RA joint pathologies...

  14. 49 CFR Table 1 of Subpart B to... - Minimum Coefficient of Retroreflection (RA) (in Candela/Lux/Meter2) Requirement for...

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Minimum Coefficient of Retroreflection (RA) (in Candela/Lux/Meter2) Requirement for Retroreflective Sheeting (Minimum Photometric Performance Requirements... Retroreflection (RA) (in Candela/Lux/Meter2) Requirement for Retroreflective Sheeting (Minimum Photometric...

  15. Adipose tissue macrophages

    NARCIS (Netherlands)

    Boutens, Lily; Stienstra, Rinke

    2016-01-01

    Inflammation originating from the adipose tissue is considered to be one of the main driving forces for the development of insulin resistance and type 2 diabetes in obese individuals. Although a plethora of different immune cells shapes adipose tissue inflammation, this review is specifically

  16. Undifferentiated Connective Tissue Disease

    Science.gov (United States)

    ... Examples of connective tissue diseases include lupus , scleroderma , rheumatoid arthritis , Sjögren's syndrome , myositis and vasculitis . There are many people who have features of connective tissue disease, however, they do not fulfill the diagnostic criteria established for any one disease. In such ...

  17. Engineering Vascularized Adipose Tissue

    NARCIS (Netherlands)

    F. Verseijden (Femke)

    2011-01-01

    textabstractA large portion of the plastic and reconstructive surgical procedures performed each year is aimed at repairing soft tissue defects, which result for example from traumatic injury or tumor resections. Large soft tissue defects, lead to a change in function and ‘normal’ body contour,

  18. Tissue engineered aortic valve

    OpenAIRE

    Dohmen, P M

    2012-01-01

    Several prostheses are available to replace degenerative diseased aortic valves with unique advantages and disadvantages. Bioprotheses show excellent hemodynamic behavior and low risk of thromboembolic complications, but are limited by tissue deterioration. Mechanical heart valves have extended durability, but permanent anticoagulation is mandatory. Tissue engineering created a new generation heart valve, which overcome limitations of biological and mechanical heart valves due to remodelling,...

  19. Secretory activity of subcutaneous abdominal adipose tissue in male patients with rheumatoid arthritis and osteoarthritis – association with clinical and laboratory data

    Directory of Open Access Journals (Sweden)

    Ewa Kontny

    2016-11-01

    Full Text Available Introduction: Adipose tissue exerts widespread effects on the metabolism and immune system, but its activity differs between the genders. In the general population low-grade adipose tissue inflammation contributes to development of diseases of affluence. Little is known about the systemic impact of peripheral fat tissue in osteoarthritis (OA and rheumatoid arthritis (RA, characterized by chronic, low- and high-grade systemic inflammation, respectively. To clarify this we evaluated the secretory activity of subcutaneous abdominal adipose tissue (SAAT obtained from male patients affected with RA (n = 21 and OA (n = 13, and assessed its association with body mass and composition, demographic, clinical and laboratory data. Material and methods: Basal and interleukin (IL-1β-triggered secretion of selected adipocytokines from SAAT explants was measured by specific enzyme-linked immunosorbent assays (ELISA. Patients’ body composition was evaluated by bioelectric impendence technique. Results : Rheumatoid SAAT secreted more adiponectin and macrophage migration inhibitory factor (MIF than respective osteoarthritis tissue. In both RA and OA patient groups, stimulation of SAAT explants with IL-1β(1 ng/ml/100 mg tissue significantly up-regulated release of pro-(IL-6, IL-8, tumor necrosis factor – TNF and anti-inflammatory (IL-10 cytokines but had no effect on the secretion of adiponectin, leptin, MIF and hepatocyte growth factor (HGF. Compared with RA, patients with OA were more obese. In RA patients SAAT-released adiponectin and TNF inversely correlated with body mass index (BMI and visceral fat rating (FVSC. In addition, SAAT-secreted adiponectin and leptin positively correlated with DAS28 and disease duration, respectively. In the OA group tissue-released TNF positively correlated with patients’ age. Conclusions : We conclude that in RA male patients adipocytokines originating from SAAT are of clinical importance because: (i adiponectin and TNF

  20. Connective tissue markers of rheumatoid arthritis

    DEFF Research Database (Denmark)

    Møller, H J

    1998-01-01

    Rheumatoid arthritis (RA) is a common systemic autoimmune disorder of unknown aetiology. The most common outcome of RA is a progressive development of joint destruction and deformity. Early introduction of disease-modifying antirheumatic drugs seems important for prevention of the long term...... of rheumatoid factor contributes to the classification of arthritis as RA, and acute phase reactants are useful for quantifying and comparing the level of inflammatory activity in the course of a given patient. There is, however, a lack of sensitive and specific biochemical markers for RA, and frontline...

  1. IT-20OVEREXPRESSION OF IL13Ra2: ASSESSMENT OF PRO-AGGRESSIVE AND PRO-INVASIVE PHENOTYPES OF MALIGNANT GLIOMA IN A SYNGENEIC ANIMAL MODEL

    Science.gov (United States)

    Mangraviti, Antonella; Sengupta, Sadhak; Paldor, Iddo; Rowshanshad, David; Sampath, Prakash; Olivi, Alessandro; Tyler, Betty; Brem, Henry

    2014-01-01

    BACKGROUND: IL13Rα2 is a promising target for novel therapies in glioblastoma (GBM) due to its overexpression in tumor cells as well as glioma-initiating cells, which are responsible for the growth and recurrence of GBM. The role of IL13Ra2, found heterogeneously expressed in GBMs, is not fully understood and better targeting strategies are necessary for its clinical application. This study investigated the effectiveness of different patterns of IL13Rα2 expression on the survival of syngeneic rodent glioma models. This study also aims to act as a blueprint for further tests of the level of immune response to the target immunotherapy in immunocompetent mice bearing GBMs with different levels of IL13Rα2 expression. METHODS: G26 murine glioma cell line, with transfected to express hIL13Rα2 (G26-H2) and vector control (G26-V2) were intracranially injected in two groups of C57Bl/6 mice respectively. The metric analyzed for outcome was survival. Histological analysis were used to evaluate the level of IL13Ra2 expression in primary tissue obtained from patients with high gliomas. RESULTS: Two populations of G26 glioma cell lines were established per hIL13Rα2 expression: the hIL13Rα2+ and the hIL13Rα2−. In vivo, the cell lines showed a significant difference in survival: the group that received intracranial injection of G26-H2 cells (100% positive for hIL13Rα2) had a median survival of 29.5 days compared to 49 days for group receiving G26-V2 cells (100% negative for h IL13Rα2), p <0.0172. CONCLUSION: We assessed two different populations of G26 glioma cell lines: h IL13Rα2+ and h IL13Rα2−. In vivo, after intracranial implantation, the two populations showed a significant difference in survival. These results confirm the role of hIL13Rα2 overexpression in specific subtypes of GBMs, and most likely the most aggressive ones.

  2. A replication study confirms the association of dendritic cell immunoreceptor (DCIR polymorphisms with ACPA - negative RA in a large Asian cohort.

    Directory of Open Access Journals (Sweden)

    Jianping Guo

    Full Text Available Dendritic cell immunoreceptor (DCIR has been implicated in development of autoimmune disorders in rodent and DCIR polymorphisms were associated with anti-citrullinated proteins antibodies (ACPA-negative rheumatoid arthritis (RA in Swedish Caucasians. This study was undertaken to further investigate whether DCIR polymorphisms are also risk factors for the development of RA in four Asian populations originated from China and Malaysia.We genotyped two DCIR SNPs rs2377422 and rs10840759 in Han Chinese population (1,193 cases, 1,278 controls, to assess their association with RA. Subsequently, rs2377422 was further genotyped in three independent cohorts of Malaysian-Chinese subjects (MY_Chinese, 254 cases, 206 controls, Malay subjects (MY_ Malay, 515 cases, 986 controls, and Malaysian-Indian subjects (MY_Indian, 378 cases, 285 controls, to seek confirmation of association in various ethnic groups. Meta-analysis was preformed to evaluate the contribution of rs2377422 polymorphisms to the development of ACPA-negative RA in distinct ethnic groups. Finally, we carried out association analysis of rs2377422 polymorphisms with DCIR mRNA expression levels.DCIR rs2377422 was found to be significantly associated with ACPA -negative RA in Han Chinese (OR 1.92, 95% CI 1.27-2.90, P=0.0020. Meta-analysis confirms DCIR rs2377422 as a risk factor for ACPA-negative RA across distinct ethnic groups (OR(overall =1.17, 95% CI 1.06-1.30, P=0.003. The SNP rs2377422 polymorphism showed significant association with DCIR mRNA expression level, i.e. RA-risk CC genotype exhibit a significant increase in the expression of DCIR (P=0.0023, Kruskal-Wallis.Our data provide evidence for association between DCIR rs2377422 and RA in non-Caucasian populations and confirm the influence of DCIR polymorphisms on RA susceptibility, especially on ACPA-negative RA.

  3. Simultaneous determination of Ra-226, natural uranium and natural thorium by gamma-ray spectrometry INa(Ti), in solid samples.; Determinacion de U (Natural), Th (Natural) y Ra-226 en diversos materiales, mediante espectrometria con INa (TI)

    Energy Technology Data Exchange (ETDEWEB)

    Salvador, S.; Navarro, T.; Alvarez, A.

    1991-07-01

    A method has been developed to determine activities of Ra-226, natural uranium and natural thorium by gamma-ray spectrometry. The measurement system has been calibrated using standards specially prepared at the laboratory. It is necessary to assume secular equilibrium in the samples, between Ra-226 and Th-232 and its daughters nuclides, and between U-238 and its immediate daughter Th-234, as the photo peaks measured are those of the daughters. The results obtained indicate that this method can of ter replace the radiochemical techniques used to measure activities in this type of sample. The method has been successfully used to determine these natural isotopes in samples from uranium mills. (Author) 9 refs.

  4. Process based modeling of sedimentary basin properties - Peïra Cava Basin, SE France

    Science.gov (United States)

    Rouzairol, Romain; Basani, Riccardo; Hansen, Ernst; Aas, Tor Even; Howell, John

    2013-04-01

    Session SSP 3.2/GMPV46 The Eocene-Oligocene Grès d'Annot Formation which crops-out in the Peïra Cava region of south-eastern France is a 1200 m thick succession of sandstones and mudstones deposited in a confined, synclinal sub-basin plunging to the north. The Peïra Cava turbidite system is dominated by interceded high- and low-concentration turbidity deposits with several marker beds that can be correlated throughout the basin fill, providing a robust stratigraphic framework for analysis (Amy et al, 2007). Using deterministic process based simulations it is possible to recreate the flow events that deposited the basin fill. The aim of the present study to utilize this methodology and investigate the role of the confinement, relief, and the size of the turbidity currents events required to reproduce the observed stratigraphy. MassFLOW-3D is a 3D Computational Fluid Dynamic (CFD) software for the numerical simulation of the physical equations describing fluid flow and sediment transport for turbidity currents. Flows are simulated on a structural restored, back-stripped and decompacted palaeo-bathymetry. The sedimentary infilling was the results of 18 major events (the marker units of Amy et al, 2007) and many thousands of minor ones. Each stratigraphic package includes a major flow and numerous minor ones having similar characteristics (flow entry point, sediment species and concentration, velocity inlet). The numerical modelling aimed to reproduce these 10 major units as the result of 10 major gravity flows. The different boundary conditions, such as the turbidity current inflow dimensions, inlet velocity, grain size and sand concentration used were based on outcrop observations and analysis found in the literature. Comparison of the depositional results to the outcrop can highlight topographic issues but also validate the choice of palaeobathymetry. Overall good match were found with correct areas of erosion, bypass and deposition regarding outcrop observations

  5. Halophilic alkali- and thermostable amylase from a novel polyextremophilic Amphibacillus sp. NM-Ra2.

    Science.gov (United States)

    Mesbah, Noha M; Wiegel, Juergen

    2014-09-01

    Extracellular gluco-amylo-pullulanase from Amphibacillus sp. NM-Ra2 was purified to homogeneity by ethanol precipitation, anion exchange chromatography and gel filtration chromatography. Molecular mass of the enzyme was 50kDa (SDS-PAGE). The enzyme showed maximal activity at 1.9 M NaCl, pH50°C 8.0 and 54°C and was active from 0 to 4.3 M NaCl and 37 to 65°C. The enzyme was inhibited by EDTA and was stable and active in the presence of PMSF, DTT, H2O2, Triton-X-100, Tween 20 and Tween 80. Ca2+ is inessential for activity. The amylase was stimulated with K+ and inhibited with Cu2+ and Mg2+. Hg2+, Zn2+ and Fe2+ had no effect on activity. Amylase was stable and active in the presence of ethanol, methanol and benzene (25%, v/v). The enzyme hydrolyzed linear and branched polysaccharides including pullulan, glycogen and amylopectin, and hydrolyzed raw wheat starch and raw corn starch (14.6% and 13.5% over 2 h). Amylase activity was inhibited by soluble starch concentrations greater than 0.3%. The major products of soluble starch hydrolysis were maltose and maltotriose. The amylase, being halophilic and alkali-thermostable, in addition to being resistant to surfactants, oxidizing agents and organic solvents, can find applications in the starch processing, pharmaceutical, food and paper/pulp industries. Copyright © 2014 Elsevier B.V. All rights reserved.

  6. Raúl Serrano: dialéctica y creación teatral

    Directory of Open Access Journals (Sweden)

    Ana Cecilia Prenz

    1994-12-01

    Full Text Available Raúl Serrano estudioso de teatro, tiene una formación completamente diferente con respecto a la de los hombres de teatro argentino; es, con toda seguridad, la persona que más profunda y científicamente se ha dedicado al estudio de K. Stanislavskij en el ámbito del teatro de este país. La experiencia teatral adquirida en Europa influenciará profundamente sobre este autor en sus investigaciones, de tal modo que al regresar a su país de origen será profundamente crítico con respecto a la realidad stanislavskijana que vivía el teatro argentino en aquellos momentos. Recuerda Serrano que eran muchos los talleres donde cada maestro impartía lecciones siguiendo su propia interpretación del sistema. El panorama general se presentaba privo de coherencia y sistematicidad. El psicoanálisis, en aquellos años, reinaba en Argentina y la barrera que dividía la terapia y el teatro se presentaba por demás débil. Para Serrano el uso del instrumento del actor era utilizado para liberar las neurosis personales. Justamente esta falta de sistematicidad y esta interpretación psicoanalítica del trabajo del actor se encuentran en fuerte contraste con la formación prevalentemente sociológica de este estudioso argentino y por ende opuesta a una interpretación psicoanalítica.

  7. Monitoring of micro-deformations along Idrija and Raša faults in W Slovenia

    Directory of Open Access Journals (Sweden)

    Andrej Gosar

    2007-06-01

    Full Text Available Monitoring of tectonic movements along two active faults of Dinaric (NW-SE trending fault system in W Slovenia using TM 71 extensiometers was set up in 2004. After two years ob measurements some clear trends of displacement were developed. The average left-lateral displacement along a crack in the inner fault zone of the Idrija fault in Učja valley is 0.38 mm/year. Short term (10 months rates were even greater and reached the value of 0.54 mm/year. Since the Idrija fault is considered as dextral strike-slip, is the observedleft-lateral displacement explained by local permutation of principle stress axis. In the Ra{a fault monitoring site at the foot of Vremščica Mt. at Košana the average reverse uplift of hanging wall (SW block of 0.24 mm/years and left-lateral displacement of 0.16 mm/year were established. Short term (9 months vertical displacements reached the value of 0.53 mm/year. The oblique sense of displacement is in agreement with geological and seismological observations. Since there were no stronger earthquakes in the vicinity and time span of monitoring, no correlations were established with seismic activity. The observed displacement rates along monitored faults of up to 0.5 mm/year are consistent with the regional deformation rate in W Slovenia established from GPS measurements which is of the order of 2 mm/year.

  8. Determination of {sup 226}Ra by gamma spectrometry: study of packaging vial of sample for analysis; Determinacao de {sup 226}Ra por espectrometria gama: estudo do recipiente de acondicionamento de amostra para analise

    Energy Technology Data Exchange (ETDEWEB)

    Carneiro, Andre Cavalcanti

    2015-07-01

    Determination of radioactivity levels of {sup 226}Ra by gamma spectrometry in a sample is based on measurements of {sup 214}Pb and {sup 214}Bi, daughters of {sup 222}Rn. Because radon is a gas, it can leak from the sample vial or accumulate on the upper empty it. If the vial has any crack, there will be loss of gas, which will cause error in determining the {sup 226}Ra concentration. One possible cause of cracks in the vials, that houses standards and samples, is the radiolysis action in the vial material, usually a polymer. As the demand {sup 226}Ra analysis in different matrices (geological samples, food, plants, etc.) is increasing, it was decided to study some polymer vials available on the market, to verify the feasibility to be used when is applied the analysis method using gamma spectrometry. Four types of polymer vials have been studied. The radiation doses in walls of the vials caused by natural radionuclides present in the sample were simulated using gamma irradiation. Tests, such as compressive strength test and tightness, were applied to the irradiated and non-irradiated vials. First, to verify the effect of radiolysis on the vial material and also if there was {sup 222}Rn diffusion in their walls. These preliminary results pointed out that the acrylic vials are the best option of packaging samples for analysis. This study should be repeated in a larger number of samples for a better evaluation. (author)

  9. DENTAL PULP TISSUE ENGINEERING

    Science.gov (United States)

    Demarco, FF; Conde, MCM; Cavalcanti, B; Casagrande, L; Sakai, V; Nör, JE

    2013-01-01

    Dental pulp is a highly specialized mesenchymal tissue, which have a restrict regeneration capacity due to anatomical arrangement and post-mitotic nature of odontoblastic cells. Entire pulp amputation followed by pulp-space disinfection and filling with an artificial material cause loss of a significant amount of dentin leaving as life-lasting sequelae a non-vital and weakened tooth. However, regenerative endodontics is an emerging field of modern tissue engineering that demonstrated promising results using stem cells associated with scaffolds and responsive molecules. Thereby, this article will review the most recent endeavors to regenerate pulp tissue based on tissue engineering principles and providing insightful information to readers about the different aspects enrolled in tissue engineering. Here, we speculate that the search for the ideal combination of cells, scaffolds, and morphogenic factors for dental pulp tissue engineering may be extended over future years and result in significant advances in other areas of dental and craniofacial research. The finds collected in our review showed that we are now at a stage in which engineering a complex tissue, such as the dental pulp, is no longer an unachievable and the next decade will certainly be an exciting time for dental and craniofacial research. PMID:21519641

  10. Rapporteur report: other tissues.

    Science.gov (United States)

    Sienkiewicz, Z

    2003-01-01

    This report covers the session devoted to 'other tissues'. It considers the effects of internal electric fields such as those induced by exposure to weak, extremely low frequency (ELF) electromagnetic fields, on cardiac physiology, neuroendocrine (pineal) function and on the processes of tissue repair and embryonic development. Summaries are provided for each of the papers presented, and the major aspects of the plenary session are discussed. Overall, these tissues and processes were not considered to be sensitive to the direct effects of weak ELF fields, although indirect effects may occur via field induced changes to the central nervous system.

  11. Rapporteur report: Other tissues

    Energy Technology Data Exchange (ETDEWEB)

    Sienkiewicz, Z

    2003-07-01

    This report covers the session devoted to other tissues. It considers the effects of internal electric fields such as those induced by exposure to weak, extremely low frequency (ELF) electromagnetic fields, on cardiac physiology, neuroendocrine (pineal) function and on the processes of tissue repair and embryonic development. Summaries are provided for each of the papers presented, and the major aspects of the plenary session are discussed. Overall, these tissues and processes were not considered to be sensitive to the direct effects of weak ELF fields, although indirect effects may occur via field induced changes to the central nervous system. (author)

  12. O princípio de razão suficiente e suas raízes

    Directory of Open Access Journals (Sweden)

    Flora Bezerra da Rocha Fragoso

    2016-12-01

    Full Text Available Arthur Schopenhauer em sua tese de doutorado efetivamente ressignificou o princípio de razão suficiente e assentou sobre ele as fundações de sua filosofia. Na formulação schopenhaueriana tal princípio é constituído de quatro raízes que dariam conta de explicar os fenômenos do mundo e os objetos de natureza abstrata. O presente artigo propõe-se a expor cada uma dessas raízes e demonstrar de que maneira o princípio de razão suficiente está relacionado ao mundo como representação.

  13. Novos polimorfismos no gene da obesidade em raças divergentes de suínos

    OpenAIRE

    Soares,M.A.M.; Guimarães,S.E.F.; Euclydes,R.F.; Lopes,P.S.; Peixoto,J.O.; Guimarães,M.F.M.; Wenceslau,A.A.; Pires,A.V.; Benevenuto Júnior,A.A.

    2006-01-01

    Investigou-se a existência de polimorfismo no gene da leptina (gene da obesidade) entre varrões da raça nativa Piau (porco tipo banha) e matrizes mestiças de raças comerciais (Landrace/Large White e Landrace/Large White com Pietrain), selecionadas para peso e precocidade. Oito pares de primers foram desenhados a partir da seqüência disponível no GenBank (U66254), usada, neste trabalho, como seqüência de referência. Amostras de DNA foram extraídas de células sangüíneas brancas utilizando-se so...

  14. Estimates of fission barrier heights for neutron-deficient Po to Ra nuclei produced in fusion reactions

    Science.gov (United States)

    Sagaidak, Roman

    2017-09-01

    The cross section data for fission and evaporation residue production in fusion reactions leading to nuclei from Po to Ra have been considered in a systematic way in the framework of the conventional barrier-passing (fusion) model coupled with the statistical model. The cross section data obtained in very asymmetric projectile-target combinations can be described within these models rather well with the adjusted model parameters. In particular, one can scale and fix the macroscopic (liquid-drop) fission barrier heights (FBHs) for nuclei involved in the de-excitation of compound nuclei produced in the reactions. The macroscopic FBHs for nuclei from Po to Ra have been derived in the framework of such analysis and compared with the predictions of various theoretical models.

  15. Atrofia progressiva generalizada da retina em cães da raça Cocker Spaniel

    OpenAIRE

    Débora Gomes; Denise Aya Otsuki; Ricardo Lisak; Angélica de Mendonça Vaz Safatle

    2013-01-01

    Atrofia progressiva generalizada da retina (APGR) é uma doença frequente nos cães da raça Cocker Spaniel, caracterizada pela perda progressiva da função retiniana externa e desaparecimento dos fotorreceptores. A doença é bilateral, hereditária, autossômica recessiva, sem predisposição sexual e está frequentemente associada à catarata. Segundo estudos moleculares, a degeneração ocorre por mutação de diversos genes. Nos cães da raça Cocker Spaniel Americano, a doença é observada entre três e ci...

  16. Do nuclei go pear-shaped? Coulomb excitation of 220Rn and 224Ra at REX-ISOLDE (CERN

    Directory of Open Access Journals (Sweden)

    Scheck M.

    2015-01-01

    Full Text Available The IS475 collaboration conducted Coulomb-excitation experiments with post-accelerated radioactive 220Rn and 224Ra beams at the REX-ISOLDE facility. The beam particles (Ebeam: 2.83 MeV/u were Coulomb excited using 60Ni, 114Cd, and 120Sn scattering targets. De-excitation γ-rays were detected employing the Miniball array and scattered particles were detected in a silicon detector. Exploiting the Coulomb-excitation code GOSIA for each nucleus several matrix elements could be obtained from the measured γ-ray yields. The extracted ‹3−||E3||0+› matrix element allows for the conclusion that, while 220Rn represents an octupole vibrational system, 224Ra has already substantial octupole correlations in its ground state. This finding has implications for the search of CP-violating Schiff moments in the atomic systems of the adjacent odd-mass nuclei.

  17. Estimates of fission barrier heights for neutron-deficient Po to Ra nuclei produced in fusion reactions

    Directory of Open Access Journals (Sweden)

    Sagaidak Roman

    2017-01-01

    Full Text Available The cross section data for fission and evaporation residue production in fusion reactions leading to nuclei from Po to Ra have been considered in a systematic way in the framework of the conventional barrier-passing (fusion model coupled with the statistical model. The cross section data obtained in very asymmetric projectile-target combinations can be described within these models rather well with the adjusted model parameters. In particular, one can scale and fix the macroscopic (liquid-drop fission barrier heights (FBHs for nuclei involved in the de-excitation of compound nuclei produced in the reactions. The macroscopic FBHs for nuclei from Po to Ra have been derived in the framework of such analysis and compared with the predictions of various theoretical models.

  18. Magic wavelengths for the 7s1/2-6d3/2,5/2 transitions in Ra+

    Science.gov (United States)

    Wu, Xiao-Mei; Li, Cheng-Bin; Tang, Yong-Bo; Shi, Ting-Yun

    2016-09-01

    The dynamic polarizabilities of the 7s and 6d states of Ra+ are calculated using a relativistic core polarization potential method. The magic wavelengths of the 7s1/2-6d3/2,5/2 transitions are identified. Comparing to the common radio-frequency (RF) ion traps, using the laser field at the magic wavelength to trap the ion could suppress the frequency uncertainty caused by the micromotion of the ion, and would not affect the transition frequency measurements. The heating rates of the ion and the powers of the laser for the ion trapping are estimated, which would benefit the possible precision measurements based on all-optical trapped Ra+. Project supported by the National Basic Research Program of China (Grant No. 2012CB821305) and the National Natural Science Foundation of China (Grant Nos. 91336211 and 11504094).

  19. Field analyses of (238)U and (226)Ra in two uranium mill tailings piles from Niger using portable HPGe detector.

    Science.gov (United States)

    Déjeant, Adrien; Bourva, Ludovic; Sia, Radia; Galoisy, Laurence; Calas, Georges; Phrommavanh, Vannapha; Descostes, Michael

    2014-11-01

    The radioactivities of (238)U and (226)Ra in mill tailings from the U mines of COMINAK and SOMAÏR in Niger were measured and quantified using a portable High-Purity Germanium (HPGe) detector. The (238)U and (226)Ra activities were measured under field conditions on drilling cores with 600s measurements and without any sample preparation. Field results were compared with those obtained by Inductive Coupled Plasma Atomic Emission Spectroscopy (ICP-AES) and emanometry techniques. This comparison indicates that gamma-ray absorption by such geological samples does not cause significant deviations. This work shows the feasibility of using portable HPGe detector in the field as a preliminary method to observe variations of radionuclides concentration with the aim of identifying samples of interest. The HPGe is particularly useful for samples with strong secular disequilibrium such as mill tailings. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Exposure to (226)Ra from consumption of vegetables in the high level natural radiation area of Ramsar-Iran.

    Science.gov (United States)

    Ghiassi-Nejad, M; Beitollahi, M M; Asefi, M; Reza-Nejad, F

    2003-01-01

    The vegetable-to-soil concentration ratio (CR) for (226)Ra and the related effective dose were studied in Talesh Mahalleh, a district of the city of Ramsar in Iran with a high level of natural radiation (HLNR). Maximum and minimum CR were measured in leafy and root vegetables with average values of 1.6 x 10(-2) and 4.0 x 10(-3), respectively. The mean effective dose resulting from (226)Ra due to consumption of edible vegetables by adults in the critical group in this region was estimated to be 72.3 microSv a(-1). This value is about 12 times greater than the average of effective dose resulting from this radionuclide due to combined intake of all foods and drinking water in normal background areas.