WorldWideScience

Sample records for ra 333

  1. Oceanographic profile data collected from CTD casts aboard NOAA LAUNCHES (RAINIER) as part of project OPR-O333-RA-15 in the Coastal Waters of SE Alaska from 2015-05-04 to 2015-05-25 (NCEI Accession 0130936)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0130936 includes physical and profile data collected aboard NOAA LAUNCHES (RAINIER) during project OPR-O333-RA-15 in the Coastal Waters of SE Alaska...

  2. HCA 333 Ash Material-hca333dotcom

    OpenAIRE

    CarterOlivia8

    2015-01-01

    For more course tutorials visit www.hca333.com   HCA 333 Complete Class Health Care - General Health Care Subacute Care. Review the Subacute Care Case Pratt(2010) pp. 122-124 and develop a response to Question 8 a, b & c (located on the top of page 125 of the text) and post your response. In your response formulate a complete response to each component of Question 8. The response will provide evidence of critical thinking and problem solving applications. Incl...

  3. HCA 333(ASH) uop / uophelp

    OpenAIRE

    uophelp

    2015-01-01

    HCA 333 Complete Class Health Care - General Health Care Subacute Care. Review the Subacute Care Case Pratt(2010) pp. 122-124 and develop a response to Question 8 a, b & c (located on the top of page 125 of the text) and post your response. In your response formulate a complete response to each component of Question 8. The response will provide evidence of critical thinking and problem solving applications. Include one reference in addition to the course text to support your respo...

  4. 10 CFR 4.333 - Mediation.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Mediation. 4.333 Section 4.333 Energy NUCLEAR REGULATORY... Investigation, Conciliation, and Enforcement Procedures § 4.333 Mediation. (a) Referral of complaints for mediation. NRC will refer to a mediation agency designated by the Secretary of the Department of Health...

  5. 47 CFR 73.333 - Engineering charts.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Engineering charts. 73.333 Section 73.333 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES FM Broadcast Stations § 73.333 Engineering charts. This section consists of the following Figures 1, 1a, 2, and...

  6. 14 CFR 23.333 - Flight envelope.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight envelope. 23.333 Section 23.333... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Structure Flight Loads § 23.333 Flight envelope. (a) General. Compliance with the strength requirements of this subpart must be shown...

  7. 7 CFR 33.3 - Secretary.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Secretary. 33.3 Section 33.3 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... ISSUED UNDER AUTHORITY OF THE EXPORT APPLE ACT Definitions § 33.3 Secretary. Secretary means...

  8. 31 CFR 29.333 - Military service.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Military service. 29.333 Section 29... Satisfied by June 30, 1997 § 29.333 Military service. (a) For employees who entered on duty on or before June 30, 1997, and whose military service was performed prior to that date, credit for military...

  9. Chôra

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2009-01-01

    , for whom "il y a khôra" (there is chôra), Sallis keeps the definite article (the chôra) as an index of certain differentiation in chôra. This article takes as a point of departure Sallis' thesis regarding the manifestation of the chôra, grounded in the manner in which the chôra is apprehended, that is...

  10. Dicty_cDB: SHF333 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF333 (Link to dictyBase) - - - - SHF333P (Link to Original site) SHF333F 663 SHF...333Z 745 SHF333P 1388 - - Show SHF333 Library SH (Link to library) Clone ID SHF333 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHF...3-B/SHF333Q.Seq.d/ Representative seq. ID SHF333P (Link to... Original site) Representative DNA sequence >SHF333 (SHF333Q) /CSM/SH/SHF3-B/SHF333Q.Seq.d/ ATTGTATATAATATTT

  11. Dicty_cDB: VSI333 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSI333 (Link to dictyBase) - - - Contig-U15331-1 VSI333P (Link to Original site) VSI...333P (Link to Original site) Representative DNA sequence >VSI333 (VSI333Q) /CSM/VS/VSI3-B/VSI...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VSI333 (VSI333Q) /CSM/VS/VSI3-B/VSI...333F 586 VSI333Z 478 VSI333P 1064 - - Show VSI333 Library VS (Link to library) Clone ID VSI...333 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15331-1 Original sit

  12. Dicty_cDB: CHR333 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR333 (Link to dictyBase) - - - Contig-U15792-1 - (Link to Original site) CHR...333F 382 - - - - - - Show CHR333 Library CH (Link to library) Clone ID CHR333 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHR3-B/CHR333Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHR333 (CHR333Q) /CSM/CH/CHR3-B/CHR333Q.Seq.d/ ATTTTCCACTTTCCCAT...tpsapxglts*gisnxyxxpslxxvkvsftx tdl--- Frame B: fstfpffhfffxisflffkq*rpkfxypqrfx*hykxxiqlyhrxxnx*yvpfsllp*vk

  13. "Redefining RA": The RA Tool Kit

    Science.gov (United States)

    Wyatt, Neal

    2008-01-01

    No one likes being two steps behind, and the fastest way to fall off the pace is by not keeping up with major titles and hot authors. Fortunately, there are numerous resources, both prepublication and postpublication, that can help. It is best when readers' advisory (RA) librarians know what is coming out months ahead of time--in order to think…

  14. Chôra

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2009-01-01

    , as in a dream. Sallis' interpretation opens up the possibility for a new reading of the dialogue, and offers a tool to examine phenomena occurred in the aftermath of the Platonic cosmogony. One of the most fascinating episodes of the afterlife of the Platonic chôra is the Byzantine chôra, presented...

  15. 7 CFR 1205.333 - Research and promotion.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Research and promotion. 1205.333 Section 1205.333... AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE COTTON RESEARCH AND PROMOTION Cotton Research and Promotion Order Research and Promotion § 1205.333 Research and promotion. The...

  16. 25 CFR 700.333 - Determination of disability.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Determination of disability. 700.333 Section 700.333... Life Estate Leases § 700.333 Determination of disability. The Commission shall determine disability... estate lease by virture of a disability shall be examined by a physician selected by the Commission or...

  17. 46 CFR 109.333 - Fire main cutoff valves.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fire main cutoff valves. 109.333 Section 109.333... OPERATIONS Operation and Stowage of Safety Equipment § 109.333 Fire main cutoff valves. The master or person in charge shall insure that each fire main cutoff valve is open and sealed to prevent closing,...

  18. 8 CFR 333.2 - Attachment of photographs to documents.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Attachment of photographs to documents. 333.2 Section 333.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY NATIONALITY REGULATIONS PHOTOGRAPHS § 333.2 Attachment of photographs to documents. A signed photograph of the applicant must...

  19. 9 CFR 3.33 - Classification and separation.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Classification and separation. 3.33 Section 3.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment,...

  20. 20 CFR 404.333 - Wife's and husband's benefit amounts.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Wife's and husband's benefit amounts. 404.333... Disability Benefits for Spouses and Divorced Spouses § 404.333 Wife's and husband's benefit amounts. Your wife's or husband's monthly benefit is equal to one-half the insured person's primary insurance...

  1. 42 CFR 136.333 - Distribution of scholarships.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Distribution of scholarships. 136.333 Section 136... J-4-Indian Health Scholarship Program § 136.333 Distribution of scholarships. The Secretary, acting through the Service, shall determine the distribution of Indian Health Scholarships among the...

  2. Ra-228, Ra-226 and Ra-228/Ra-226 Activity Ratio in the Northern South China Sea

    Science.gov (United States)

    Yu-Chia, C.

    2004-05-01

    We report for the first time the surface water distributions of Ra-228 and Ra-226 in the northern South China Sea (SCS) and vertical profiles in the central deep basin of the SCS. Being a marginal sea, the SCS displays activities of both nuclides much higher than the open oceans. The surface water Ra-228 varies between 22 and 33 dpm/100L with higher values at stations adjacent to the landmass. The surface water Ra-226 varies from 10 to 15 dpm/100L with a distribution pattern similar to that of Ra-228. The Ra-228/Ra-226 activity ratio is fairly constant at about 2 or slightly higher. Ra-228 decreases rapidly from a surface maximum of about 22 dpm/100L to about 12 dpm/100L at and below 300m depth in the deep central basin. The deep water values are much higher than those of the open oceans. Ra-226, on the other hand, shows a surface activity of 14 dpm/100L, decreases to 10 dpm/100L at 200m, and then increases monotonically with depth to about 35 dpm/100L at and below 3000m. This distribution pattern is similar to that observed in the western North Pacific but the activity is higher by about 5 dpm/100L for the entire water column. The resulting Ra-228/Ra-226 is greater than one above 250m and becomes less than one below this depth with the ratio decreasing to about 0.35 in the deep water below 3000m. This ratio remains much greater than that in the open oceans, implying a strong Ra-228 input relative to Ra-226 into the SCS deep water.

  3. 7 CFR 1940.333 - Applicability to planning assistance.

    Science.gov (United States)

    2010-01-01

    ... of the plan as well as the alternative planning strategies that were reviewed. ... 7 Agriculture 13 2010-01-01 2009-01-01 true Applicability to planning assistance. 1940.333 Section... to planning assistance. The award of FmHA or its successor agency under Public Law 103-354 funds for...

  4. Phenotype abnormality: 333 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 333 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u838i increased mass ...rt day length regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u40i whole plant ... increased mass ... vascular leaf ...

  5. 32 CFR 644.333 - Screening for defense needs.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 4 2010-07-01 2010-07-01 true Screening for defense needs. 644.333 Section 644... Screening for defense needs. Real property which becomes excess to the needs of any element of the Army or... the property is excess to the needs of the using command, without screening for other requirements....

  6. 21 CFR 333.310 - Acne active ingredients.

    Science.gov (United States)

    2010-04-01

    ...) Salicylic acid 0.5 to 2 percent. (d) Sulfur 3 to 10 percent. (e) Sulfur 3 to 8 percent when combined in... § 333.320(b). (d) Salicylic acid, 0.5 to 2 percent. (e) Sulfur, 3 to 10 percent. (f) Sulfur, 3 to...

  7. Understanding Rheumatoid Arthritis (RA): Research

    Science.gov (United States)

    ... page please turn JavaScript on. Feature: Understanding Rheumatoid Arthritis (RA) Research Past Issues / Summer 2014 Table of ... project plan to address relevant challenges for rheumatoid arthritis. Read Part 1 on Lupus in MedlinePlus magazine, ...

  8. 21 CFR 333.350 - Labeling of acne drug products.

    Science.gov (United States)

    2010-04-01

    ... stated: (select one of the following: ‘elsewhere on this label,’ ‘above,’ or ‘below.’)” (e) The word “physician” may be substituted for the word “doctor” in any of the labeling statements in this section. § 333..., and mouth avoid contact with hair and dyed fabrics, which may be bleached by this product...

  9. VeVeRa-IV

    NARCIS (Netherlands)

    Evelien Eggink; Debbie Oudijk; Klarita Sadiraj

    2012-01-01

    Original title: VeVeRa-IV The Dutch population is set to age rapidly in the coming years. More and more people will also attain a very great age. This means that the need for home care and care provided in nursing or residential care homes will also increase. As part of the Long-term Care Programme

  10. 14 CFR 21.333 - Issue of export airworthiness approval tags for Class III products.

    Science.gov (United States)

    2010-01-01

    ... for Class III products. 21.333 Section 21.333 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... Approvals § 21.333 Issue of export airworthiness approval tags for Class III products. (a) An applicant is entitled to an export airworthiness approval tag for Class III products if that applicant shows, except...

  11. 28 CFR 33.3 - OMB approval of information collection requirements.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false OMB approval of information collection requirements. 33.3 Section 33.3 Judicial Administration DEPARTMENT OF JUSTICE BUREAU OF JUSTICE ASSISTANCE GRANT PROGRAMS Criminal Justice Block Grants General Provisions § 33.3 OMB approval of...

  12. Compilation of Spectroscopic Data of Radium (Ra I and Ra II)

    NARCIS (Netherlands)

    Dammalapati, U.; Jungmann, K.; Willmann, L.

    2016-01-01

    Energy levels, wavelengths, lifetimes, and hyperfine structure constants for the isotopes of the first and second spectra of radium, Ra I and Ra II, have been compiled. Wavelengths and wavenumbers are tabulated for 226Ra and for other Ra isotopes. Isotope shifts and hyperfine structure constants of

  13. Compilation of spectroscopic data of Radium (Ra I and Ra II)

    CERN Document Server

    Dammalapati, U; Willmann, L

    2016-01-01

    Energy levels, wavelengths, lifetimes and hyperfine structure constants for the isotopes of the first and second spectra of radium, Ra I and Ra II have been compiled. Wavelengths and wave numbers are tabulated for 226Ra and for other Ra isotopes. Isotope shifts and hyperfine structure constants of even and odd-A isotopes of neutral radium atom and singly ionized radium are included. Experimental lifetimes of the states for both neutral and ionic Ra are also added, where available. The information is beneficial for present and future experiments aimed at different physics motivations using neutral Ra and singly ionized Ra.

  14. VELoCiRaPTORS.

    Science.gov (United States)

    Lundgren, J.; Esham, B.; Padalino, S. J.; Sangster, T. C.; Glebov, V.

    2007-11-01

    The Venting and Exhausting of Low Level Air Contaminants in the Rapid Pneumatic Transport of Radioactive Samples (VELoCiRaPTORS) system is constructed to transport radioactive materials quickly and safely at the NIF. A radioactive sample will be placed inside a carrier that is transported via an airflow system produced by controlled differential pressure. Midway through the transportation process, the carrier will be stopped and vented by a powered exhaust blower which will remove radioactive gases within the transport carrier. A Geiger counter will monitor the activity of the exhaust gas to ensure that it is below acceptable levels. If the radiation level is sufficient, the carrier will pass through the remainder of the system, pneumatically braking at the counting station. The complete design will run manually or automatically with control software. Tests were performed using an inactive carrier to determine possible transportation problems. The system underwent many consecutive trials without failure. VELoCiRaPTORS is a prototype of a system that could be installed at both the Laboratory for Laser Energetics at the University of Rochester and the National Ignition Facility at LLNL.

  15. 哈氏合金SB333材料的机械加工%Machine work of Hastelloy SB-333 material

    Institute of Scientific and Technical Information of China (English)

    史玉生

    2007-01-01

    从哈氏合金SB-333材料的化学成分、机械性能入手,分析了哈氏合金SB-333材料的机械加工性能,并从刀具的选材、刀具角度的确定、切削用量的选择等方面介绍了哈氏合金SB-333材料的机械加工方法.

  16. Digital ulcers in a cohort of 333 scleroderma patients

    Directory of Open Access Journals (Sweden)

    A. Ruffatti

    2011-09-01

    Full Text Available Digital ulcers (DU at the hands are one of the more frequent and severe complications in systemic sclerosis. Data on their prevalence and distribution in the different subsets of disease are variable in the literature. We studied the frequency of DU in a cohort of 333 scleroderma patients followed in the last 10 years in our Unit. DU have been recorded in 133 patients (39,9%, more frequently in males, in patients with cutaneous diffuse form of disease and in patients with anti-Scl70 ANA specificity. Complications of DU have been observed in 12,3% of cases. Surgery of the hands has been required in 8,7% of patients. The more effective treatment of DU are i.v. prostanoids, performed usually in day hospital, with high costs for the National Health Service. Recently the efficacy of bosentan, an oral receptor antagonist of endothelin, has been demonstrated, thus opening new perspectives in the treatment of DU in systemic sclerosis.

  17. LCA versus RA - an introduction

    DEFF Research Database (Denmark)

    Olsen, Stig Irving

    2000-01-01

    Risk Assessment (RA) of chemicals is an environmental management tool used to assess the risk of specific chemicals, which are harmful to man or the environment under certain circumstances of use or in certain environmental recipients. Life Cycle Assessment (LCA) or environmental assessment...... of products is another environmental management tool that gains more and more ground, and which is often thought of as universal due to its basic holistic philosophy. As the environmental impacts of one product can only be seen in relation to the impacts of other products providing the same functions, LCA...... is a comparative tool. The primary purpose of this article is to identify harmonies, discrepancies and relations between the two tools, exemplified by the risk assessment principles of the European Commission (EC) as stated in 'Technical Guidance Document' (EC, 1996) and the LCA method 'EDIP' (Environmental Design...

  18. Računalom potpomognute tehnike revizije

    OpenAIRE

    2008-01-01

    Namjera ovoga rada je ukazati na mogućnosti učinkovitijeg revidiranja u okruženju sve intenzivnijega korištenja računalnih tehnika koje pomažu reviziji CAAT, jer sveukupni ciljevi i opseg revizije ne mijenjaju se kada se revizija obavlja u računalno-informatičkom okruženju. CAATs mogu poboljšati učinkovitost i produktivnost revizijskih procedura. Računalom potpomognute tehnike revizije (CAATs) jesu načini na koje, u kompjuteriziranom sustavu informacija, revizor može koristiti rač...

  19. Classifying Finitely Generated Indecomposable RA Loops

    CERN Document Server

    Cornelissen, Mariana

    2012-01-01

    In 1995, E. Jespers, G. Leal and C. Polcino Milies classified all finite ring alternative loops (RA loops for short) which are not direct products of proper subloops. In this paper we extend this result to finitely generated RA loops and provide an explicit description of all such loops.

  20. Cardiovascular risk factor management in patients with RA compared to matched non-RA patients

    NARCIS (Netherlands)

    E. Alemao (Evo); H. Cawston (Helene); F. Bourhis (Francois); M.J. Al (Maiwenn); M.P.M.H. Rutten-van Mölken (Maureen); K. Liao (Katherine); D.H. Solomon (Daniel)

    2015-01-01

    markdownabstractObjective. RA is associated with a 50-60% increase in risk of cardiovascular (CV) death. This study aimed to compare management of CV risk factors in RA and matched non-RA patients. Methods. A retrospective cohort study was conducted using UK clinical practice data. Patients presen

  1. 13 CFR 120.333 - Are there any special credit criteria?

    Science.gov (United States)

    2010-01-01

    ... addition to regular credit evaluation criteria, SBA shall weigh the greater risk associated with energy... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Are there any special credit criteria? 120.333 Section 120.333 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION...

  2. 25 CFR 20.333 - How do I apply for Adult Care Assistance?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How do I apply for Adult Care Assistance? 20.333 Section... ASSISTANCE AND SOCIAL SERVICES PROGRAMS Direct Assistance Adult Care Assistance § 20.333 How do I apply for Adult Care Assistance? To apply for adult care assistance, you or someone acting on your behalf...

  3. General-form 3-3-3 interpolation kernel and its simplified frequency-response derivation

    Science.gov (United States)

    Deng, Tian-Bo

    2016-11-01

    An interpolation kernel is required in a wide variety of signal processing applications such as image interpolation and timing adjustment in digital communications. This article presents a general-form interpolation kernel called 3-3-3 interpolation kernel and derives its frequency response in a closed-form by using a simple derivation method. This closed-form formula is preliminary to designing various 3-3-3 interpolation kernels subject to a set of design constraints. The 3-3-3 interpolation kernel is formed through utilising the third-degree piecewise polynomials, and it is an even-symmetric function. Thus, it will suffice to consider only its right-hand side when deriving its frequency response. Since the right-hand side of the interpolation kernel contains three piecewise polynomials of the third degree, i.e. the degrees of the three piecewise polynomials are (3,3,3), we call it the 3-3-3 interpolation kernel. Once the general-form frequency-response formula is derived, we can systematically formulate the design of various 3-3-3 interpolation kernels subject to a set of design constraints, which are targeted for different interpolation applications. Therefore, the closed-form frequency-response expression is preliminary to the optimal design of various 3-3-3 interpolation kernels. We will use an example to show the optimal design of a 3-3-3 interpolation kernel based on the closed-form frequency-response expression.

  4. 226Ra and 228Ra in the Seawater of the Western Yellow Sea

    Institute of Scientific and Technical Information of China (English)

    MEN Wu; WEI Hao; LIU Guangshan

    2006-01-01

    Radium isotopes 226Ra and 228Ra in seawater of the western Yellow Sea were measured by using the Mn-fiber adsorption- HPGe γ spectrum method.The distribution features of the two isotopes have been studied.The activities of 226Ra and 228Ra are 2.72-5.57 Bq m-3 and 7.51-34.3 Bq m-3, respectively.The activities of 226Ra and 228Ra from surface to bottom for each depth profile station are comparable within the experimental error, but the mean activities decrease with distance from the shore.From the distribution data of 228Ra, the horizontal eddy diffusion coefficient was estimated at 29 × 106 cm2 s 1.

  5. Cardiovascular risk factor management in patients with RA compared to matched non-RA patients

    Science.gov (United States)

    Cawston, Helene; Bourhis, Francois; Al, Maiwenn; Rutten-van Mölken, Maureen P. M. H.; Liao, Katherine P.; Solomon, Daniel H.

    2016-01-01

    Objective. RA is associated with a 50–60% increase in risk of cardiovascular (CV) death. This study aimed to compare management of CV risk factors in RA and matched non-RA patients. Methods. A retrospective cohort study was conducted using UK clinical practice data. Patients presenting with an incident RA diagnosis were matched 1:4 to non-RA patients based on a propensity score for RA, entry year, CV risk category and treatment received at index date (date of RA diagnosis). Patients tested and treated for CV risk factors as well as those attaining CV risk factor management goals were evaluated in both groups. Results. Between 1987 and 2010, 24 859 RA patients were identified and matched to 87 304 non-RA patients. At index date, groups had similar baseline characteristics. Annual blood pressure, lipids and diabetes-related testing were similar in both groups, although CRP and ESR were higher in RA patients at diagnosis and decreased over time. RA patients prescribed antihypertensives increased from 38.2% at diagnosis to 45.7% at 5 years, from 14.0 to 20.6% for lipid-lowering treatments and from 5.1 to 6.4% for antidiabetics. Similar treatment percentages were observed in non-RA patients, although slightly lower for antihypertensives. Modest (2%) but significantly lower attainment of lipid and diabetes goals at 1 year was observed in RA patients. Conclusion. There were no differences between groups in the frequency of testing and treatment of CV risk factors. Higher CV risk in RA patients seems unlikely to be driven by differences in traditional CV risk factor management. PMID:26705329

  6. Effects of PP333 on Growth and Physiology of Carnation%PP333对香石竹生长及生理的影响

    Institute of Scientific and Technical Information of China (English)

    马智宏; 贾瑞智; 关军锋

    2000-01-01

    以香石竹幼苗为试材,进行叶面喷施PP333试验,结果表明,与对照相比叶面喷施PP333使植株生长速率下降,叶片过氧化物酶活性显著提高,在香石竹幼苗生长后期植株体的叶绿素、可溶性蛋白质含量及超氧物歧化酶活性升高。%The carnation seedlings were used in this experiment. The determinafion results showed that in contrast to control, the fo liar spraying PP333 decreased growth rate, increased significantly peroxidase activity of leaves at all stage, and increased content of chlorophyll and protein, as well as the activity of superoxide dismatuse in carnation leaves only at late growth stage.

  7. Star formation in W3 - AFGL333: Young stellar content, properties and roles of external feedback

    CERN Document Server

    Jose, Jessy; Herczeg, Gregory J; Samal, Manash R; Bieging, John H; Meyer, Michael R; Sherry, William H

    2016-01-01

    One of the key questions in the field of star formation is the role of stellar feedback on subsequent star formation process. The W3 giant molecular cloud complex at the western border of the W4 super bubble is thought to be influenced by the stellar winds of the massive stars in W4. AFGL333 is a ~10^4 Msun cloud within W3. This paper presents a study of the star formation activity within AFGL333 using deep JHKs photometry obtained from the NOAO Extremely Wide-Field Infrared Imager combined with Spitzer-IRAC-MIPS photometry. Based on the infrared excess, we identify 812 candidate young stellar objects in the complex, of which 99 are classified as Class I and 713 are classified as Class II sources. The stellar density analysis of young stellar objects reveals three major stellar aggregates within AFGL333, named here AFGL333-main, AFGL333-NW1 and AFGL333-NW2. The disk fraction within AFGL333 is estimated to be ~50-60%. We use the extinction map made from the H-Ks colors of the background stars to understand the...

  8. Phosphorylation of threonine 333 regulates trafficking of the human sst5 somatostatin receptor.

    Science.gov (United States)

    Petrich, Aline; Mann, Anika; Kliewer, Andrea; Nagel, Falko; Strigli, Anne; Märtens, Jan Carlo; Pöll, Florian; Schulz, Stefan

    2013-04-01

    The frequent overexpression of the somatostatin receptors sst2 and sst5 in neuroendocrine tumors provides the molecular basis for therapeutic application of novel multireceptor somatostatin analogs. Although the phosphorylation of the carboxyl-terminal region of the sst2 receptor has been studied in detail, little is known about the agonist-induced regulation of the human sst5 receptor. Here, we have generated phosphosite-specific antibodies for the carboxyl-terminal threonines 333 (T333) and 347 (T347), which enabled us to selectively detect either the T333-phosphorylated or the T347-phosphorylated form of sst5. We show that agonist-mediated phosphorylation occurs at T333, whereas T347 is constitutively phosphorylated in the absence of agonist. We further demonstrate that the multireceptor somatostatin analog pasireotide and the sst5-selective ligand L-817,818 but not octreotide or KE108 were able to promote a detectable T333 phosphorylation. Interestingly, BIM-23268 was the only sst5 agonist that was able to stimulate T333 phosphorylation to the same extent as natural somatostatin. Agonist-induced T333 phosphorylation was dose-dependent and selectively mediated by G protein-coupled receptor kinase 2. Similar to that observed for the sst2 receptor, phosphorylation of sst5 occurred within seconds. However, unlike that seen for the sst2 receptor, dephosphorylation and recycling of sst5 were rapidly completed within minutes. We also identify protein phosphatase 1γ as G protein-coupled receptor phosphatase for the sst5 receptor. Together, we provide direct evidence for agonist-selective phosphorylation of carboxyl-terminal T333. In addition, we identify G protein-coupled receptor kinase 2-mediated phosphorylation and protein phosphatase 1γ-mediated dephosphorylation of T333 as key regulators of rapid internalization and recycling of the human sst5 receptor.

  9. Understanding Rheumatoid Arthritis (RA): Treatment and Causes

    Science.gov (United States)

    ... this page please turn JavaScript on. Feature: Understanding Rheumatoid Arthritis (RA) Treatment and Causes Past Issues / Summer 2014 Table of Contents How Is Rheumatoid Arthritis Treated? Doctors have many ways to treat this ...

  10. RA Construction KC, LLC Information Sheet

    Science.gov (United States)

    RA Construction KC, LLC (the Company) is located in Gladstone, Missouri. The settlement involves renovation activities conducted at a property constructed prior to 1978, located in Kansas City, Missouri.

  11. Removal of 226Ra and 228Ra from TENORM sludge waste using surfactants solutions.

    Science.gov (United States)

    Attallah, M F; Hamed, Mostafa M; El Afifi, E M; Aly, H F

    2015-01-01

    The feasibility of using surfactants as extracting agent for the removal of radium species from TENORM sludge produced from petroleum industry is evaluated. In this investigation cationic and nonionic surfactants were used as extracting agents for the removal of radium radionuclides from the sludge waste. Two surfactants namely cetyltrimethylammonium bromide (CTAB) and Triton X-100 (TX100) were investigated as the extracting agents. Different parameters affecting the removal of both (226)Ra and (228)Ra by the two surfactants as well as their admixture were studied by the batch technique. These parameters include effect of shaking time, surfactants concentration and temperature as well as the effect of surfactants admixture. It was found that, higher solution temperature improves the removal efficiency of radium species. Combined extraction of nonionic and cationic surfactants produces synergistic effect in removal both (226)Ra and (228)Ra, where the removals reached 84% and 80% for (226)Ra and (228)Ra, respectively, were obtained using surfactants admixture.

  12. Determination of {sup 226}Ra and {sup 228}Ra in water by using liquid scintillation spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Mingote, Raquel Maia; Gomes, Nilton Carlos [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Servico de Quimica e Radioquimica], E-mail: mingote@cdtn.br; Gomes, Lorena Pedrosa; Menezes, Maria Angela de B.C. [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Servico de Reator e Irradiacoes

    2007-07-01

    A procedure for the determination of {sup 226}Ra and {sup 228}Ra in water samples by using liquid scintillation spectrometry was applied. The chemical separation of radium as Ba(Ra)SO{sub 4} was performed by the usual method of coprecipitation with barium carrier. The precipitated was mixed with water, Instagel{sup TM} and Ultima Gold AB{sup TM} scintillation cocktails after the delay time for {sup 226}Ra/{sup 222}Rn radioactive equilibrium. Activities of {sup 226}Ra and {sup 228}Ra were inferred from the alpha and beta counting respectively. It was used the pulse shape analyzer and correction factors for minimizing mutual radiometric interferences. The combined standard uncertainties were evaluated using the law of uncertainty propagation by partial derivatives method. The difficulties of method are discussed. (author)

  13. Laser trapping of Ra-225 and Ra-226 and progress towards an electric dipole moment measurement

    Science.gov (United States)

    Guest, J. R.; Scielzo, N. D.; Ahmad, I.; Bailey, K.; Greene, J. P.; Holt, R. J.; Lu, Z.-T.; O'Connor, T. P.; Potterveld, D. H.

    2006-10-01

    Permanent electric dipole moments (EDMs) in atoms or molecules are signatures of Time (T)-and Parity (P)-violation and represent an important window onto physics beyond the Standard Model. We are developing a next generation EDM search around laser-cooled and trapped Ra-225 (t1/2 = 15 d). Due to octupole deformation of the nucleus, Ra-225 is predicted to be two to three orders of magnitude more sensitive to T-violating interactions than Hg-199, which currently sets the most stringent limits in the nuclear sector. We will discuss our progress, including the successful laser cooling and trapping of Ra-225 and Ra-226 atoms. We have demonstrated transverse cooling, Zeeman slowing, and capture of Ra-225 and Ra-226 atoms in a magneto-optical trap (MOT). By driving a second atomic transition, we have extended the lifetime of the trap from milliseconds to seconds and performed necessary spectroscopic measurements.

  14. 47 CFR 80.333 - Stations in the maritime mobile-satellite service.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Stations in the maritime mobile-satellite..., Alarm, Urgency and Safety Procedures § 80.333 Stations in the maritime mobile-satellite service. The...-satellite service....

  15. Ra-226 and Pb-210/Ra-226 Activity Ratio in the Northern South China Sea

    Science.gov (United States)

    Chi-Ju, L.; Yu-Chia, C.; Tsung-En, W.

    2004-05-01

    The surface water distributions and vertical profiles of Ra-226 in the northern South China Sea (SCS) have been measured. Surface water Ra-226 varies between 10 and 16 dpm/100 kg with higher values at stations adjacent to the landmass. Each Ra-226 profile shows an increase from the surface toward the bottom. Above 1000m depth Ra-226 is systematically about 5 dpm/100kg higher in the northern South China Sea than in the western North Pacific. This difference may be attributed to a strong Ra-226 source from the shelf and slope area of the SCS. Below this depth Ra-226 displays large variation within some of the profiles with lower limits being comparable to the activities of the western North Pacific but higher limits being systematically about 5 dpm/100kg higher. These high Ra-226 activities may reflect effects of the longer isolation time for the deep water in the SCS basin and strong Ra input from the underlying sediments. The Pb-210/Ra-226 activity ratio ranges between 1.4 and 2.7 in the surface water with higher activity ratio at the station closer to the Luzon Strait. The Pb-210 in excess over Ra-226 in the surface water due to atmospheric input may penetrate to a depth of about 200 to 500m. Below this depth, Pb-210/Ra-226 activity ratio ranges between 0.5 and 0.7 because Pb-210 is scavenged by settling particulates. Box model calculations within a mixed layer of 50m in the area yield a mean residence time of about 1 yr for Pb-210 if an atmospheric Pb-210 flux of 1 dpm/cm2/y is adopted. The activity ratio of about 0.5 to 0.7 in the deep water corresponds to a Pb-210 mean residence time of about 30 to 70 yrs with respect to particulate scavenging.

  16. 228Ra, 226Ra, 224Ra and 223Ra in potential sources and sinks of land-derived material in the German Bight of the North Sea: implications for the use of radium as a tracer

    NARCIS (Netherlands)

    Schmidt, C.; Hanfland, C.; Regnier, P.; Van Cappellen, P.; Schlüter, M.; Knauthe, U.; Stimac, I.; Geibert, W.

    2011-01-01

    Activities of the naturally occurring radium nuclides 228Ra, 226Ra, 224Ra and 223Ra were determined in waters of the open German Bight and adjacent nearshore areas in the North Sea, in order to explore the potential use of radium isotopes as natural tracers of land–ocean interaction in an environmen

  17. ICMPv6 RA Flooding Vulnerability Research

    Directory of Open Access Journals (Sweden)

    Linas Jočys

    2016-06-01

    Full Text Available ICMPv6 is the newest version of internet control message protocol, whose main purpose is to send error message indicating packet processing failure. It is know that ICMPv6 is technologically vulnerable. One of those vulnerabilities is the ICMPv6 RA flooding vulnerability, which can lead to systems in Local Area Network slow down or full stop. This paper will discuss Windows (XP, 7, 8.1 and Linux Ubuntu 14 operating systems resistance to RA flooding attack research and countermeasures to minimize this vulnerability.

  18. 高职“333式”专业课程体系的构建思考%Towards Constructing "333" Syllabus in Vocational College

    Institute of Scientific and Technical Information of China (English)

    程凌

    2011-01-01

    高职"333式"专业课程体系是指"专业技术知识"、"专业核心技能"、"专业技术实践三大课程结构并存;"知识传授"、"技能训练"、"打造专长"三条教学活动主线并行以及"理论考试教师主导"、"核心技能操作主导"、"技术实践企业主导"的三元课程评价模式并举。"333式"专业课程体系的构建最终能实现课程内容职业化、课程模式多样化、课程实施阶段化、课程管理多元化的目标。%The"333" Syllabus is a system of curriculum involving the first three coexisting course structures of "professional technical knowledge","professional crucial skill" and"professional technical practice",the second three equally important teaching activities of "knowledge impartation","skill practice" and"special skill training" and the third three course evaluation models of "teacher-guided theory exam","operation-guided skill training" and "enterprise-guided practice".The "333" Syllabus aims at guaranteeing the vocational quality of course content,diversifying course models,phrase-timing the course implementation and multiplying the course management.

  19. Isolation of immune-relating 185/333-1 gene from Sea Urchin ( Strongylocentrotus intermedius) and Its expression analysis

    Science.gov (United States)

    Wang, Yinan; Ding, Jun; Liu, Yang; Liu, Xuewei; Chang, Yaqing

    2016-02-01

    The 185/333 gene family involved in the immune response of sea urchin. One 185/333 cDNA was isolated from Strongylocentrotus intermedius, and named as Si185/333-1. Its full-length cDNA was 1246 bp in length with a 906 bp open reading frame encoding a protein of 301 aa. The molecular weight of the deduced protein was approximately 33.1 kD with an estimated PI of pH 6.26. Si185/333-1 had high identities (70%-86%) to most of Sp185/333. An extraordinary identity of 92% was found between Si185/333-1 and Sp185/333 C5 alpha (ABR22474). Moderate identities (63%-64%) were displayed between Si185/333-1 and He185/333. Si185/333-1 had similar structure to Sp185/333. A signal-peptide, a gly-rich region and a his-rich region were found in its secondary structure. RGD motif was found in gly-rich region at position 116-118aa. There was no transmembrane region in Si185/333-1. The element pattern of Si185/333-1 is different from any available pattern that identified in Sp185/333. Si185/333-1 clustered together with pattern C Sp185/333 in phylogenetic tree. The Si185/333-1 mRNA could be detected in tißsues including peristomial membrane, coelomocytes, muscle of Aristotles lantern, gut and tube feet, with the highest expression level detected in peristomial membrane and a relatively low expression in ovary and testis. The temporal expression of Si185/333-1 in peristomial membrane and coelomocytes were up-regulated after bacterial, ß-D-glucan and dsRNA challenges, reaching the maximum at 12 h post-stimulation. The up-regulation was more obvious in coelomocytes, and bacterial challenge triggered the highest response. These results proved that 185/333-1 gene was involved in the immune defense of S. intermedius, while more studies were necessary for its function in S. intermedius immunity.

  20. Preverjanje znanja računalništva, pridobljenega z aktivnostmi za učenje računalništva brez računalnika

    OpenAIRE

    Zaviršek, Manca

    2015-01-01

    V magistrskem delu obravnavamo ugotavljanje računalniškega znanja, ki ga učenci pridobijo z aktivnostmi Računalništvo brez računalnika. Najprej opredelimo, kaj sploh je računalniško znanje in kaj so računalniški koncepti, ter se posvetimo sodobnim pristopom k poučevanju računalništva, kjer je v ospredju reševanje problemov, uresničujemo pa jih lahko z aktivnostmi Računalništvo brez računalniki in z nalogami s tekmovanja Bober. V empiričnem delu nas zanima, ali je ugotavljanje znanja, pridoblj...

  1. A rotating target for Ra production

    NARCIS (Netherlands)

    Sohani, M.; Wilschut, H. W.

    2012-01-01

    A target wheel with pyrolytic graphite targets is designed and constructed at the TRI mu P facility to boost the production rate of Ra isotopes. Simulation, design properties and production results are discussed. (C) 2012 Elsevier B.V. All rights reserved.

  2. Neutron Resonance Parameters for Ra-226 (Radium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Volume 24 `Neutron Resonance Parameters' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms'. It provides the neutron resonance parameters for the isotope Ra-226 (Radium).

  3. Ultrastructural localization of highly variable 185/333 immune response proteins in the coelomocytes of the sea urchin, Heliocidaris erythrogramma.

    Science.gov (United States)

    Dheilly, Nolwenn M; Birch, Debra; Nair, Sham V; Raftos, David A

    2011-11-01

    The 185/333 proteins of sea urchins represent a family of highly variable immune response molecules with unknown functions. In this study, we show that 185/333 proteins are expressed by three cell types: amoebocytes, colourless spherule cells and gut-associated amoebocytes. A sub-population of amoebocytes express 185/333 proteins on the membranes of vesicles emanating from the trans-Golgi and which later fuse with the plasma membranes of the cells. The previously uncharacterized gut-associated amoebocytes also show a high level of 185/333 protein expression on their internal vesicles and plasma membranes. Colourless spherule cells contain 185/333 proteins within large spherules (specialized intracellular vesicles). In the presence of bacteria and yeast, the ultrastucture of colourless spherule cells changes and 185/333 proteins disappear. In contrast, 185/333 proteins were not found in the phagosomes of coelomocytes. The 185/333-positive gut amoebocytes were often associated with anuclear bodies, which appeared to incorporate material of microbial origin that was surrounded by 185/333 proteins. The association between 185/333 proteins on gut amoebocytes and anuclear bodies suggests that these proteins may be involved in the phagocytosis of microbes in the gut epithelium.

  4. Ideological Analysis on Legislative Flaw of Article No.333 in Criminal Law%刑法第333条立法缺陷的理论分析

    Institute of Scientific and Technical Information of China (English)

    周少华; 李霞

    2003-01-01

    转化犯是轻罪向重罪的转化,转化以后的犯罪的法定刑应当高于基础犯罪的法定刑才能体现罪刑相当原则.我国现行刑法第333条在法定刑的设置上,与其转化犯相关条款的法定刑之间存在矛盾,不相协调,应予修改.

  5. Draft Genome Sequence of Se(IV)-Reducing Bacterium Pseudomonas migulae ES3-33

    DEFF Research Database (Denmark)

    Li, Xuanji; Kot, Witold; Wang, Dan;

    2015-01-01

    Pseudomonas migulae ES3-33 is a Gram-negative strain that strongly reduces Se(IV) and was isolated from a selenium mining area in Enshi, southwest China. Here we present the draft genome of this strain containing potential genes involved in selenite reduction and a large number of genes encoding...

  6. 50 CFR 660.333 - Open access non-groundfish trawl fishery-management measures.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Open access non-groundfish trawl fishery... COAST STATES West Coast Groundfish-Open Access Fisheries § 660.333 Open access non-groundfish trawl... the open access trip limit table, Table 3 (South) of this subpart. Trip limits for groundfish...

  7. Genetics of RA susceptibility, what comes next?

    Science.gov (United States)

    Ding, James; Eyre, Stephen; Worthington, Jane

    2015-01-01

    Summary Genome-wide association studies (GWASs) have been used to great effect to identify genetic susceptibility loci for complex disease. A series of GWAS and meta-analyses have informed the discovery of over 100 loci for rheumatoid arthritis (RA). In common with findings in other autoimmune diseases the lead signals for the majority of these loci do not map to known gene sequences. In order to realise the benefit of investment in GWAS studies it is vital we determine how disease associated alleles function to influence disease processes. This is leading to rapid development in our knowledge as to the function of non-coding regions of the genome. Here we consider possible functional mechanisms for intergenic RA-associated variants which lie within lncRNA sequences. PMID:26509058

  8. Characterization of the Highly Variable Immune Response Gene Family, He185/333, in the Sea Urchin, Heliocidaris erythrogramma

    OpenAIRE

    Roth, Mattias O.; Wilkins, Adam G.; Cooke, Georgina M.; Raftos, David A; Nair, Sham V.

    2014-01-01

    This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleoti...

  9. Entrevista a Raúl Gagliardi.

    Directory of Open Access Journals (Sweden)

    Diego Campos (Pagina 1-7

    2008-10-01

    Full Text Available En el V encuentro de Enseñanza de la Biología y Educación Ambiental, celebrado los días 17, 18 y 19 de Junio del año en curso, los miembros del comité editorial de la revista del Departamento de Biología de la Universidad Pedagógica Nacional entrevistaron al conferencista internacional Raúl Galgliardi.

  10. Chôra : Creation and Pathology

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2009-01-01

    Plato's dialogue the Timaeus describes not only the making of the cosmos (order), but also the condition of what is not order, neither for the human body nor for the universe. What is disorder in cosmogonic terms it is disease for the human body. Timaeus applies to the concept chôra in discussing....... http://www.ejop.org/archives/2009/05/chara_creation.html...

  11. The Geography of the ta-ra-si-ja

    DEFF Research Database (Denmark)

    Nosch, Marie-Louise Bech

    2000-01-01

    Thies paper demonstrates how ta-ra-si-ja is connected to a fixed series of toponyms in Crete, and concludes that ta-ra-si-ja is a duty limited to certain places......Thies paper demonstrates how ta-ra-si-ja is connected to a fixed series of toponyms in Crete, and concludes that ta-ra-si-ja is a duty limited to certain places...

  12. Characterization of the highly variable immune response gene family, He185/333, in the sea urchin, Heliocidaris erythrogramma.

    Science.gov (United States)

    Roth, Mattias O; Wilkins, Adam G; Cooke, Georgina M; Raftos, David A; Nair, Sham V

    2014-01-01

    This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleotide polymorphisms, indels and sequence repeats and are subjected to diversification analyses. The sequence elements that compose He185/333 are different to those identified for Sp185/333. Differences between Sp185/333 and He185/333 genes are also evident in the complexity of the sequences of the introns. He185/333 proteins show a diverse range of molecular weights on Western blots. The observed sizes and pIs of the proteins differ from predicted values, suggesting post-translational modifications and oligomerization. Immunofluorescence microscopy shows that He185/333 proteins are mainly located on the surface of coelomocyte subpopulations. Our data demonstrate that He185/333 bears the same substantial characteristics as their S. purpuratus homologues. However, we also identify several unique characteristics of He185/333 (such as novel element patterns, sequence repeats, distribution of positively-selected codons and introns), suggesting species-specific adaptations. All sequences in this publication have been submitted to Genbank (accession numbers JQ780171-JQ780321) and are listed in table S1.

  13. Characterization of the highly variable immune response gene family, He185/333, in the sea urchin, Heliocidaris erythrogramma.

    Directory of Open Access Journals (Sweden)

    Mattias O Roth

    Full Text Available This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleotide polymorphisms, indels and sequence repeats and are subjected to diversification analyses. The sequence elements that compose He185/333 are different to those identified for Sp185/333. Differences between Sp185/333 and He185/333 genes are also evident in the complexity of the sequences of the introns. He185/333 proteins show a diverse range of molecular weights on Western blots. The observed sizes and pIs of the proteins differ from predicted values, suggesting post-translational modifications and oligomerization. Immunofluorescence microscopy shows that He185/333 proteins are mainly located on the surface of coelomocyte subpopulations. Our data demonstrate that He185/333 bears the same substantial characteristics as their S. purpuratus homologues. However, we also identify several unique characteristics of He185/333 (such as novel element patterns, sequence repeats, distribution of positively-selected codons and introns, suggesting species-specific adaptations. All sequences in this publication have been submitted to Genbank (accession numbers JQ780171-JQ780321 and are listed in table S1.

  14. Dual Exchange in PCN-333: A Facile Strategy to Chemically Robust Mesoporous Chromium Metal-Organic Framework with Functional Groups.

    Science.gov (United States)

    Park, Jihye; Feng, Dawei; Zhou, Hong-Cai

    2015-09-16

    A facile preparation of a mesoporous Cr-MOF, PCN-333(Cr) with functional group, has been demonstrated through a dual exchange strategy, involving a sequential ligand exchange and metal metathesis process. After optimization of the exchange system, the functionalized PCN-333(Cr), N3-PCN-333(Cr) shows well maintained crystallinity, porosity, as well as much improved chemical stability. Because of the exceptionally large pores (∼5.5 nm) in PCN-333(Cr), a secondary functional moiety, Zn-TEPP with a size of 18 Å × 18 Å, has been successfully clicked into the framework. In this article, we have also analyzed kinetics and thermodynamics during dual exchange process, showing our attempts to interpret the exchange event in the PCN-333. Our findings not only provide a highly stable mesoporous Cr-MOF platform for expanding MOF-based applications, but also suggest a route to functionalized Cr-MOF which may have not been achievable through conventional approaches.

  15. High-Speed RaPToRS

    Science.gov (United States)

    Henchen, Robert; Esham, Benjamin; Becker, William; Pogozelski, Edward; Padalino, Stephen; Sangster, Thomas; Glebov, Vladimir

    2008-11-01

    The High-Speed Rapid Pneumatic Transport of Radioactive Samples (HS-RaPToRS) system, designed to quickly and safely move radioactive materials, was assembled and tested at the Mercury facility of the Naval Research Laboratory (NRL) in Washington D.C. A sample, which is placed inside a four-inch-diameter carrier, is activated before being transported through a PVC tube via airflow. The carrier travels from the reaction chamber to the end station where it pneumatically brakes prior to the gate. A magnetic latch releases the gate when the carrier arrives and comes to rest. The airflow, optical carrier-monitoring devices, and end gate are controlled manually or automatically with LabView software. The installation and testing of the RaPToRS system at NRL was successfully completed with transport times of less than 3 seconds. The speed of the carrier averaged 16 m/s. Prospective facilities for similar systems include the Laboratory for Laser Energetics and the National Ignition Facility.

  16. Biotransformation of trans-1-chloro-3,3,3-trifluoropropene (trans-HCFO-1233zd)

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Tobias [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany); Bertermann, Rüdiger [Institut für Anorganische Chemie, Universität Würzburg, Am Hubland, 97074 Würzburg (Germany); Rusch, George M.; Tveit, Ann [Honeywell, P.O. Box 1057, Morristown, NJ 07962-1057 (United States); Dekant, Wolfgang, E-mail: dekant@toxi.uni-wuerzburg.de [Institut für Toxikologie, Universität Würzburg, Versbacher Str. 9, 97078 Würzburg (Germany)

    2013-05-01

    trans-1-Chloro-3,3,3-trifluoropropene (trans-HCFO-1233zd) is a novel foam blowing and precision cleaning agent with a very low impact for global warming and ozone depletion. trans-HCFO-1233zd also has a low potential for toxicity in rodents and is negative in genotoxicity testing. The biotransformation of trans-HCFO-1233zd and kinetics of metabolite excretion with urine were assessed in vitro and in animals after inhalation exposures. For in vitro characterization, liver microsomes from rats, rabbits and humans were incubated with trans-HCFO-1233zd. Male Sprague Dawley rats and female New Zealand White rabbits were exposed to 2,000, 5,000 and 10,000 ppm for 6 h and urine was collected for 48 h after the end of the exposure. Study specimens were analyzed for metabolites using {sup 19}F NMR, LC-MS/MS and GC/MS. S-(3,3,3-trifluoro-trans-propenyl)-glutathione was identified as predominant metabolite of trans-HCFO-1233zd in all microsomal incubation experiments in the presence of glutathione. Products of the oxidative biotransformation of trans-HCFO-1233zd were only minor metabolites when glutathione was present. In rats, both 3,3,3-trifluorolactic acid and N-acetyl-(3,3,3-trifluoro-trans-propenyl)-L-cysteine were observed as major urinary metabolites. 3,3,3-Trifluorolactic acid was not detected in the urine of rabbits. Quantitation showed rapid excretion of both metabolites in both species (t{sub 1/2} < 6 h) and the extent of biotransformation of trans-HCFO-1233zd was determined as approximately 0.01% of received dose in rabbits and approximately 0.002% in rats. trans-HCFO-1233zd undergoes both oxidative biotransformation and glutathione conjugation at very low rates. The low extent of biotransformation and the rapid excretion of metabolites formed are consistent with the very low potential for toxicity of trans-HCFO-1233zd in mammals. - Highlights: ► No lethality and clinical signs were observed. ► Glutathione S-transferase and cytochrome P-450 dependent

  17. Ra-224 and Ra-226: A New Method for Measuring Groundwater Seepage in Lake Michigan

    Science.gov (United States)

    Stevens, K. R.; Buyan, A. C.; Waples, J. T.

    2008-12-01

    Radium isotopes have been used to estimate groundwater discharge (GWD) in coastal marine waters for decades, but this technique has never before been used in the Laurentian Great Lakes. In this study, we used a RAD7 radon-in-air monitor to measure naturally-occurring radium isotopes Ra-224 (half-life= 3.64 d) and Ra-226 (half-life = 1600 a) in groundwater and three shallow water sites along Lake Michigan's Wisconsin coastline. Radium-224 activities in groundwater ranged from 1153 dpm m-3 in a deep aquifer (New Berlin well no.7) to 31 dpm m-3 in a shallow aquifer (Pryor well). Nearshore Lake Michigan measurements of Ra-224 were lowest at Red Arrow Beach (0.2 dpm m-3), higher in the Milwaukee harbor (GLWI slip, 1.1 dpm m-3) and highest at Harrington Beach (4.1 dpm m-3) and correspond well with groundwater seepage estimates made by Cherkauer et al. (1990) using alternate methods (i.e., where higher radium activity is indicative of higher GWD). These Ra-224 measurements are the first ever made in Lake Michigan (and presumably any of the Great Lakes) and we conclude that, by sampling offshore radium activity gradients, this RAD7 technique is a viable method for directly measuring GWD in Lake Michigan and other freshwater systems.

  18. C333H, a novel PPARα/γ dual agonist, has beneficial effects on insulin resistance and lipid metabolism

    Institute of Scientific and Technical Information of China (English)

    Cheng XU; Li-li WANG; Hong-ying LIU; Xing-bo ZHOU; Ying-lin CAO; Song LI

    2006-01-01

    Aim: To examine the effects of novel peroxisome proliferator-activated receptor (PPAR) α/γdual agonist C333H on insulin resistance and lipid metabolism.Methods: An established dual-luciferase reporter gene assay system was used in vitro to test the activity of C333H with respect to the transcription of human PPARα and PPARγ. A preadipocyte differentiation assay and reverse transcription-polymerase chain reaction were used to detect the functional activities of C333H. In db/db mice, the effects of C333H were investigated with respect to lowering of blood glucose and lipid levels. Results: C333H was determined to be a novel PPARα/γ dual agonist because it strongly induced luciferase activity on human PPARα and PPARγ, promoting the differentiation of preadipocytes to adipocytes, and functioning in upregulating the expression of some glucose and lipid metabolic target genes of the PPAR. In addition, C333H efficiently reduced blood lipid and glucose concentrations in db/db diabetic mice. Conclusion: C333H has dual action on both PPARα and PPARγ, and might be of interest for the amelioration of lipid metabolic disorders and insulin resistance associated with type 2 diabetes.

  19. Star Formation in W3—AFGL 333: Young Stellar Content, Properties, and Roles of External Feedback

    Science.gov (United States)

    Jose, Jessy; Kim, Jinyoung S.; Herczeg, Gregory J.; Samal, Manash R.; Bieging, John H.; Meyer, Michael R.; Sherry, William H.

    2016-05-01

    One of the key questions in the field of star formation is the role of stellar feedback on the subsequent star formation process. The W3 giant molecular cloud complex at the western border of the W4 super bubble is thought to be influenced by the massive stars in W4. This paper presents a study of the star formation activity within AFGL 333, a ˜104 M ⊙ cloud within W3, using deep JHK s photometry obtained from the NOAO Extremely Wide Field Infrared Imager combined with Spitzer IRAC and MIPS photometry. Based on the infrared excess, we identify 812 candidate young stellar objects (YSOs) in the complex, of which 99 are Class I and 713 are Class II sources. The stellar density analysis of YSOs reveals three major stellar aggregates within AFGL 333, namely AFGL 333 Main, AFGL 333 NW1 and AFGL 333 NW2. The disk fraction within AFGL 333 is estimated to be ˜50%-60%. We use the extinction map made from the H-{K}s colors of the background stars and CO data to understand the cloud structure and to estimate the cloud mass. From the stellar and cloud mass associated with AFGL 333, we infer that the region is currently forming stars with an efficiency of ˜4.5% and at a rate of ˜2-3 M ⊙ Myr-1 pc-2. In general, the star formation activity within AFGL 333 is comparable to that of nearby low mass star-forming regions. We do not find any strong evidence to suggest that the stellar feedback from the massive stars of nearby W4 super bubble has affected the global star formation properties of the AFGL 333 region.

  20. Requirement of tyrosine residues 333 and 338 of the growth hormone (GH) receptor for selected GH-stimulated function

    DEFF Research Database (Denmark)

    Lobie, P E; Allevato, G; Norstedt, G

    1995-01-01

    We have examined the involvement of tyrosine residues 333 and 338 of the growth hormone (GH) receptor in the cellular response to GH. Stable Chinese hamster ovary (CHO) cell clones expressing a receptor with tyrosine residues at position 333 and 338 of the receptor substituted for phenylalanine (...... acetyltransferase cDNA expression driven by the GH-responsive region of the SPI 2.1 gene) was not affected by Y333F,Y338F substitution. Thus we provide the first experimental evidence that specific tyrosine residues of the GH receptor are required for selected cellular responses to GH....

  1. Effects of PP333 on the Ornamental Effect of Potted Pelargonium odoratissmum%PP333对盆栽蚊净香草观赏效果的影响

    Institute of Scientific and Technical Information of China (English)

    王彬; 郑伟; 李兴忠

    2005-01-01

    为了解PP333对盆栽蚊净香草观赏效果的影响,采用不同浓度的PP333对盆栽蚊净香草进行了盆土浇施和叶面喷施处理,结果表明,盆土浇施50~200mg/L,叶面喷施250~500mg/L的PP333能有效地提高盆栽蚊净香昌的观赏效果,而盆土浇施400mg/L以上,叶面喷施1000mg/L以上的PP333会造成不同程度的药害.在适宜的浓度下,盆土浇施效果优于叶面喷施.

  2. IL-1Ra: its role in rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    M. Cutolo

    2011-09-01

    Full Text Available Interleukin-1 (IL-1 is one of the pivotal cytokines in initiating and driving the processes of rheumatoid arthritis (RA, and the body’s natural response, IL-1 receptor antagonist (IL-1Ra, has been shown conclusively to block its effects. IL-1 mediate several clinical symptoms of the inflammatory reaction (i.e. fever, pain, sleep disturbances. IL-1 is considered a key mediator in RA joint damage because of its greater capacity (greater than TNF of increasing matrix degradation by inducing the production of MMPs and PGE2 in synovial cells, as well by its role as mediator of bone and cartilage destruction. In addition, IL-1 decreases the repair process by suppressing matrix synthesis and shows a strong synergism with TNF in inducing many inflammatory genes at both local and systemic level. The induced endogenous production of IL-1Ra, in presence of the RA synovitis, is too low to contrast the high affinity of IL-1 for the cell receptors. Therefore, IL-1Ra presence should result in very effective prevention of IL-1 signal transduction particularly in the inflammatory site. In laboratory and animal studies inhibition of IL-1 by either antibodies to IL-1 or IL-1Ra proved beneficial to the outcome. IL-1Ra is a member of the IL-1 superfamily. The effects of different DMARDs on IL-1Ra levels in RA patients support the important role that selected anticytokine treatments might exert in the pathophysiology of the disease. However, since anti TNFα therapy it is not effective in all RA patients, nor does it fully control the arthritic process in affected joints of good responders and complete TNF suppression should be avoided, the combined treatment with intermediate doses of TNF and IL-1 blockers, reaching synergistic suppression of arthritis, seems warranted in RA.

  3. The Detection of Shocked Co/ Emission from G333.6-0.2

    Science.gov (United States)

    Storey, J. W. V.

    This paper is published as a 38 stanza poem. The main results are:In 1980, from the plane, hefound it in Orion,but no more CO could he finddespite long hours of flyin'.And so, he searched for southern sourcesof this shocked H2and found it, in G 333point six, minus, nought point two.Intensity is really weak:it's two point nought by tento the minus eighteenth power(in watts per square cm).That's thirty times as weak as wedetected in Orion.No wonder it took several yearsof concentrated tryin'.

  4. Interaction between the H II region and AFGL 333-Ridge: Implications for the star formation scenario

    Science.gov (United States)

    Nakano, Makoto; Soejima, Takashi; Chibueze, James O.; Nagayama, Takumi; Omodaka, Toshihiro; Handa, Toshihiro; Sunada, Kazuyoshi; Kamezaki, Tatsuya; Burns, Ross A.

    2017-02-01

    We investigated the star formation activities in the AFGL 333 region, which is in the vicinity of the W 4 expanding bubble, by conducting NH3 (1,1), (2,2), and (3,3) mapping observations with the 45 m Nobeyama Radio Telescope an angular resolution of 75″. The morphology of the NH3 (1,1) map shows a bow-shaped structure with the size of 2.0 × 0.6 pc as seen in the dust continuum. At the interface between the W 4 bubble and the dense NH3 cloud, the compact H II region G134.2+0.8, associated with IRAS 02245+6115, is located. Interestingly, just at the north and south of G134.2+0.8 we found NH3 emission exhibiting large velocity widths of ˜2.8 km s-1, compared to 1.8 km s-1 at the other positions. As the possibility of mechanical energy injection through the activity of young stellar objects (YSOs) is low, we considered the origin of the large turbulent gas motion as an indication of interaction between the compact H II region and the periphery of the dense molecular cloud. We also found expanding motion of the CO emission associated with G134.2+0.8. The overall structure of the AFGL 333-Ridge might have been formed by the expanding bubble of W 4. However, the small velocity widths observed to the west of IRAS 02245+6115, around the center of the dense molecular cloud, suggest that interaction with the compact H II region is limited. Therefore the YSOs (dominantly Class 0/I) in the core of the AFGL 333-Ridge dense molecular cloud most likely formed in quiescent mode. As previously suggested for the large-scale star formation in the W 3 giant molecular cloud, our results show an apparent coexistence of induced and quiescent star formations in this region. It appears that star formation in the AFGL 333 region has proceeded without significant external triggers, but accompanying stellar feedback environment.

  5. Conformational analysis of 3,3,3-trifluoro-2-(trifluoromethyl)propanoic acid

    Science.gov (United States)

    Thomas, Javix; Carrillo, Michael J.; Serrato, Agapito; Schnitzler, Elijah G.; Jäger, Wolfgang; Xu, Yunjie; Lin, Wei

    2016-09-01

    Partially fluorinated carboxylic acids exhibit rich conformational landscapes. We report the first high-resolution spectroscopic study of 3,3,3-trifluoro-2-(trifluoromethyl)propanoic acid. Its rotational spectrum was measured using both broadband chirped-pulse and narrow-band cavity-based Fourier transform microwave spectrometers. Two dominant conformers were observed, and their structures confirmed with the aid of quantum chemical calculations. Both conformers take on the Z form of the carboxylic acid group. Similarities and differences between this and other fluorinated carboxylic acids are discussed.

  6. LoRA: A Loudspeaker-Based Room Auralization System

    DEFF Research Database (Denmark)

    Favrot, Sylvain Emmanuel; Buchholz, Jörg

    2010-01-01

    In order to study basic human perception in reverberant environments, a novel loudspeaker-based room auralization (LoRA) system is proposed in this paper. The LoRA system efficiently combines modern room acoustic models with high-order Ambisonic auralization. An objective evaluation has been...... carried out demonstrating the applicability of the LoRA system. Room acoustic parameters (reverberation time, clarity, speech transmission index and inter-aural cross correlation coefficients) of room impulse responses were compared at the input and the simulated output of the LoRA system. Results show...

  7. Drugs or disease: evaluating salivary function in RA patients

    Directory of Open Access Journals (Sweden)

    Sandra Regina TORRES

    Full Text Available Abstract Oral complications of RA may include temporomandibular joint disorders, mucosa alterations and symptoms of dry mouth. The aim of this study was to evaluate the salivary gland function of subjects with rheumatoid arthritis (RA comparing it to healthy controls. Subjects with other systemic conditions known to affect salivary functions were excluded. A questionnaire was applied for the evaluation of xerostomia. Resting and chewing-stimulated salivary flow rates (SFR were obtained under standard conditions. There were 145 subjects included of the study (104 RA and 38 controls. About 66.7% of the RA subjects and 2.4% in control group presented xerostomia. The median resting SFR were 0.24 ml/min for RA subjects and 0.40 mL/min for controls (p = 0.04. The median stimulated SFR were 1.31 mL/min for RA subjects and 1.52 ml/min for controls (p = 0.33. No significant differences were found between resting and stimulated SFR of RA subjects not using xerogenic medications and controls. There was significantly higher number of subjects presenting hyposalivation in the RA group than among controls, even when subjects using xerogenic medications were eliminated from the analysis. In conclusion, hyposalivation and xerostomia were more frequent among RA subjects not using xerogenic medication than among controls, although there were no significant differences in the median SFR between groups.

  8. Separation of Ra/Ca by ion exchange; Separacion de Ra/Ca por intercambio ionico

    Energy Technology Data Exchange (ETDEWEB)

    Iturbe, J.L.; Jimenez R, M.; Flores M, J

    1991-04-15

    The radium and the calcium belong to the same group in the periodic classification and as consequence both they present very similar chemical properties, that makes difficult its separation. Both elements are also frequently associate in the nature, the calcium is very abundant, the radium is not it and for that reason it is indispensable its separation to analyze to this last one. The alpha spectroscopy is very appropriate to analyze to the {sup 226} Ra, however to achieve a good resolution of the spectra, the samples should contain small quantities of calcium. The purposes of this work were to know the chromatographic behavior of the alkaline-earthy cations: calcium, barium and radium and to apply these knowledge to the separation of the {sup 226} Ra and its analysis by means of alpha spectroscopy. (Author)

  9. Doses from 222Rn, 226Ra, and 228Ra in groundwater from Guarani aquifer, South America.

    Science.gov (United States)

    Bonotto, D M

    2004-01-01

    Groundwater samples were analysed for 222Rn, 226Ra, and 228Ra in Guarani aquifer spreading around 1 million km2 within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay.

  10. Laser-trapping of Ra-225 and Ra-226 with repumping by room temperature blackbody radiation

    CERN Document Server

    Guest, J R; Bailey, K; Greene, J P; Holt, R J; Lu, Z T; O'Connor, T P; Potterveld, D H; Scielzo, N D

    2007-01-01

    We have demonstrated Zeeman slowing and capture of neutral Ra-225 and Ra-226 atoms in a magneto-optical trap (MOT). The intercombination transition 1S0-3P1 is the only quasi-cycling transition in radium and was used for laser-cooling and trapping. Repumping along the 3D1-1P1 transition extended the lifetime of the trap from milliseconds to seconds. Room-temperature blackbody radiation was demonstrated to provide repumping from the metastable 3P0 level. We measured the isotope shift and hyperfine splittings on the 3D1-1P1 transition with the laser-cooled atoms, and set a limit on the lifetime of the 3D1 level based on the measured blackbody repumping rate. Laser-cooled and trapped radium is an attractive system for studying fundamental symmetries.

  11. Determination of {sup 226}Ra and {sup 224}Ra in sediments samples by liquid scintillation counting

    Energy Technology Data Exchange (ETDEWEB)

    Villa, M. [Facultad de Fisica. Av. Reina Mercedes s/n, apdo 1065, Departamento de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, 41080-Sevilla (Spain)]. E-mail: mvilla@us.es; Moreno, H.P. [E.T.S. Arquitectura. Av. Reina Mercedes, 2, Departamento de Fisica Aplicada II, Universidad de Sevilla, 41012-Sevilla (Spain); Manjon, G. [E.T.S. Arquitectura. Av. Reina Mercedes, 2, Departamento de Fisica Aplicada II, Universidad de Sevilla, 41012-Sevilla (Spain)

    2005-10-01

    An experimental procedure has been developed for a rapid determination of the activity concentration of {sup 226}Ra and {sup 224}Ra in sediments by liquid scintillation counting. The importance of the method lies in its application to the measurement of sediments where the Ra-isotopes activity concentration has been increased due to an anthropomorphic enhancement based on releases of naturally occurring radioactive material (NORM). A sample pre-treatment, including a digestion with aqua regia and a precipitation of hydroxides, was applied to samples before the radium extraction, which was made by co-precipitation with barium. Measurements were done in a low background scintillation spectrometer Quantulus 1220, which can separate and detect simultaneously {alpha} and {beta} particles. Additionally, some improvements are suggested for a better {alpha} and {beta} interference correction of the results. The obtaining of radiochemical yields is also improved using {sup 133}Ba as tracer, which decays by emission of conversion electrons and {gamma}-rays; the wide range of radiochemical yields obtained confirms the need of this analyses. The procedure has been applied to the measurement of riverbed sediments from an estuary in the south-west of Spain, affected in the past by direct and indirect phosphogypsum discharges.

  12. NH$_3$(3,3) and CH$_3$OH near Supernova Remnants: GBT and VLA Observations

    CERN Document Server

    McEwen, Bridget; Sjouwerman, Loránt

    2016-01-01

    We report on Green Bank Telescope 23.87 GHz NH$_3$(3,3), emission observations in five supernova remnants interacting with molecular clouds (G1.4$-$0.1, IC443, W44, W51C, and G5.7$-$0.0). The observations show a clumpy gas density distribution, and in most cases the narrow line widths of $\\sim3-4$\\,km\\,s$^{-1}$ are suggestive of maser emission. Very Large Array observations reveal 36~GHz and/or 44~GHz CH$_3$OH, maser emission in a majority (72\\%) of the NH$_3$, peak positions towards three of these SNRs. This good positional correlation is in agreement with the high densities required for the excitation of each line. Through these observations we have shown that CH$_3$OH, and NH$_3$, maser emission can be used as indicators of high density clumps of gas shocked by supernova remnants, and provide density estimates thereof. Modeling of the optical depth of the NH$_3$(3,3) emission is compared to that of CH$_3$OH, constraining the densities of the clumps to a typical density of the order of $10^5$~cm$^{-3}$ for ...

  13. Determination of gross alpha, 224Ra, 226Ra, and 228Ra activities in drinking water using a single sample preparation procedure.

    Science.gov (United States)

    Parsa, Bahman; Obed, Reynaldo N; Nemeth, William K; Suozzo, Gail P

    2005-12-01

    The current federal and New Jersey State regulations have greatly increased the number of gross alpha and radium tests for public and private drinking water supplies. The determination of radium isotopes in water generally involves lengthy and complicated processes. In this study, a new approach is presented for the determination of gross alpha, 224Ra, 226Ra, and 228Ra activities in water samples. The method includes a single sample preparation procedure followed by alpha counting and gamma-ray spectroscopy. The sample preparation technique incorporates an EPA-approved co-precipitation methodology for gross alpha determination with a few alterations and improvements. Using 3-L aliquots of sample, spiked with 133Ba tracer, the alpha-emitting radionuclides are isolated by a BaSO4 and Fe(OH)3 co-precipitation scheme. First the gross alpha-particle activity of the sample is measured with a low-background gas-flow proportional counter, followed by radium isotopes assay by gamma-ray spectroscopy, using the same prepared sample. Gamma-ray determination of 133Ba tracer is used to assess the radium chemical recovery. The 224Ra, 226Ra, and 228Ra activities in the sample are measured through their gamma-ray-emitting decay products, 212Pb, 214Pb/214Bi, and 228Ac, respectively. In cases where 224Ra determination is required, the gamma-ray counting should be performed within 2-4 d from sample collection. To measure 226Ra activity in the sample, the gamma-ray spectroscopy can be repeated 21 d after sample preparation to ensure that 226Ra and its progeny have reached the equilibrium state. At this point, the 228Ac equilibration with parent 228Ra is already established. Analysis of aliquots of de-ionized water spiked with NIST-traceable 230Th, 224Ra, 226Ra, and 228Ra standards demonstrated the accuracy and precision of this method. Various performance evaluation samples were also assayed for gross alpha as well as radium isotope activity determination using this procedure and the

  14. Raúl Pepe Verano Montesinos

    Directory of Open Access Journals (Sweden)

    José Luis Luque

    2013-05-01

    Full Text Available El 31 de enero de 2005 falleció en Lima el doctor Raúl Verano. Nacido el 12 de julio de 1940 en Cajatambo, realizó sus estudios superiores en la Universidad Nacional Mayor de San Marcos, graduándose en 1971 de bachiller en Educación y en 1972 obtuvo el grado de bachiller en Biología con la tesis Foraminíferos del litoral del departamento de Lima; optando la profesión de Biólogo en 1973. Empezó sus actividades docentes en 1965 como Ayudante de Prácticas en las cá- tedras de zoología y desde 1971 fue Jefe de Prácticas. Ascendiendo a Auxiliar en 1974, para luego ocupar diversos cargos en la administración universitaria, siendo los más destacados el de Director del Instituto de Investigaciones Antonio Raimondi entre 1981 y 1985 y Decano de la Facultad de Ciencias Biológicas de la Universidad Nacional Mayor de San Marcos en el período 1988 a 1991. Sus actividades de investigación estuvieron alrededor de la ictioparasitología, obteniendo el grado de Doctor en Ciencias Biológicas en 1987 con la tesis Kudoa peruviana Mateo, 1972, redescripción y ultraestructura; Kudoa sarmientae sp. n y Kudoa estela sp. n en peces de la costa peruana

  15. Rheumatoid Arthritis (RA) associated interstitial lung disease (ILD).

    LENUS (Irish Health Repository)

    O'Dwyer, David N

    2013-10-01

    Rheumatoid Arthritis (RA) is the most common Connective Tissue Disease (CTD) and represents an increasing burden on global health resources. Interstitial lung disease (ILD) has been recognised as a complication of RA but its potential for mortality and morbidity has arguably been under appreciated for decades. New studies have underscored a significant lifetime risk of ILD development in RA. Contemporary work has identified an increased risk of mortality associated with the Usual Interstitial Pneumonia (UIP) pattern which shares similarity with the most devastating of the interstitial pulmonary diseases, namely Idiopathic Pulmonary Fibrosis (IPF). In this paper, we discuss recent studies highlighting the associated increase in mortality in RA-UIP. We explore associations between radiological and histopathological features of RA-ILD and the prognostic implications of same. We emphasise the need for translational research in this area given the growing burden of RA-ILD. We highlight the importance of the respiratory physician as a key stakeholder in the multidisciplinary management of this disorder. RA-ILD focused research offers the opportunity to identify early asymptomatic disease and define the natural history of this extra articular manifestation. This may provide a unique opportunity to define key regulatory fibrotic events driving progressive disease. We also discuss some of the more challenging and novel aspects of therapy for RA-ILD.

  16. MRI comes of age in RA clinical trials

    DEFF Research Database (Denmark)

    Peterfy, Charles; Østergaard, Mikkel; Conaghan, Philip G

    2013-01-01

    The success of modern rheumatoid arthritis (RA) therapies and treatment strategies has led to extended placebo phases being unethical in RA randomised controlled trials (RCTs). Modern trials therefore increasingly involve active comparator designs, and this together with some technical issues has...

  17. Gene expression analysis in RA: towards personalized medicine

    NARCIS (Netherlands)

    Burska, A.N.; Roget, K.; Blits, M.; Gomez, L.; Loo, F.A.J. van de; Hazelwood, L.D.; Verweij, C.L.; Rowe, A.; Goulielmos, G.N.; Baarsen, L.G. van; Ponchel, F.

    2014-01-01

    Gene expression has recently been at the forefront of advance in personalized medicine, notably in the field of cancer and transplantation, providing a rational for a similar approach in rheumatoid arthritis (RA). RA is a prototypic inflammatory autoimmune disease with a poorly understood etiopathog

  18. RA – beskeden genetisk disposition - resultater fra nyt dansk tvillingstudie

    DEFF Research Database (Denmark)

    Svendsen, Anders Jørgen

    2010-01-01

    Vi har nu indsamlet data fra en velkarakteriseret kohorte af danske tvillinger med RA, og med den tilhørende biobank-data åbner det mulighed for videre forskning i både genetiske, epigenetiske og miljømæssige forholds betydning for udvikling af RA. De første resultater fra denne udvidede danske u...

  19. 226Ra determination in phosphogypsum by alpha-particle spectrometry

    Science.gov (United States)

    Aguado, J. L.; Bolívar, J. P.; García-Tenorio, R.

    1999-01-01

    A radiochemical method for226Ra determination by alpha-particle spectrometry in environmental samples has been developed in our laboratory. The method has been validated by measurements in samples with known concentrations of this radionuclide and it has been applied in studies related to226Ra behaviour in phosphogypsum (the main by-product of producing phosphoric acid from phosphate rocks).

  20. An Sp185/333 gene cluster from the purple sea urchin and putative microsatellite-mediated gene diversification

    Directory of Open Access Journals (Sweden)

    Buckley Katherine M

    2010-10-01

    Full Text Available Abstract Background The immune system of the purple sea urchin, Strongylocentrotus purpuratus, is complex and sophisticated. An important component of sea urchin immunity is the Sp185/333 gene family, which is significantly upregulated in immunologically challenged animals. The Sp185/333 genes are less than 2 kb with two exons and are members of a large diverse family composed of greater than 40 genes. The S. purpuratus genome assembly, however, contains only six Sp185/333 genes. This underrepresentation could be due to the difficulties that large gene families present in shotgun assembly, where multiple similar genes can be collapsed into a single consensus gene. Results To understand the genomic organization of the Sp185/333 gene family, a BAC insert containing Sp185/333 genes was assembled, with careful attention to avoiding artifacts resulting from collapse or artificial duplication/expansion of very similar genes. Twelve candidate BAC assemblies were generated with varying parameters and the optimal assembly was identified by PCR, restriction digests, and subclone sequencing. The validated assembly contained six Sp185/333 genes that were clustered in a 34 kb region at one end of the BAC with five of the six genes tightly clustered within 20 kb. The Sp185/333 genes in this cluster were no more similar to each other than to previously sequenced Sp185/333 genes isolated from three different animals. This was unexpected given their proximity and putative effects of gene homogenization in closely linked, similar genes. All six genes displayed significant similarity including both 5' and 3' flanking regions, which were bounded by microsatellites. Three of the Sp185/333 genes and their flanking regions were tandemly duplicated such that each repeated segment consisted of a gene plus 0.7 kb 5' and 2.4 kb 3' of the gene (4.5 kb total. Both edges of the segmental duplications were bounded by different microsatellites. Conclusions The high sequence

  1. Radium Ra 223 dichloride in castration-resistant prostate cancer.

    Science.gov (United States)

    Joung, J Y; Ha, Y S; Kim, I Y

    2013-08-01

    Radium Ra 223 dichloride (Xofigo®, formerly Alpharadin) is one of the representative α-particle-emitting isotopes that delivers radiation with a higher biological effect to a more localized area. Preclinical studies in mouse, rat and canine models have demonstrated that radium Ra 223 dichloride has a definite skeletal affinity and antitumor effect with a relatively low toxicity on bone marrow. More recently, in a large randomized phase III trial (ALSYMPCA), patients with bone metastasis and castration-resistant prostate cancer (CRPC) received six cycles of 50 kBq/kg of radium Ra 223 dichloride in 4-week intervals. In these men, radium Ra 223 dichloride improved the median overall survival by 3.6 months when compared to the placebo group. Collectively, these results suggest that radium Ra 223 dichloride is a promising candidate for managing bone metastases in patients with CRPC. Copyright 2013 Prous Science, S.A.U. or its licensors. All rights reserved.

  2. THE IMMUNOLOGICAL CHARACTERISTIC OF RA PATIENTS WITH ANAEMIA

    Directory of Open Access Journals (Sweden)

    A. E. Sizikov

    2014-07-01

    Full Text Available Abstract. The aim of the investigation was to study the immunological characteristics of RA patients with anaemia. Clinical and laboratory data including the percentage of the main lymphocyte subclasses, phagocyte and DTH-effector activity, serum concentration of immunoglobulins, the percentage of cells producing IFNγ and/or IL-4 and percent of monocytes producing TNF. We revealed some significant clinical, laboratory and immunological differences between RA patients and healthy donors and between patients with and without anaemia. Our data demonstrate RA anemic patients to have more severe disorders than patients without anaemia. We also revealed some significant immunological differences between RA patients and healthy donors and between patients with and without anaemia, including percent of cells producing IFNγ and/or IL-4. Our data permit to conclude that RA patients have many different immunological disturbances, more severe in anaemic patients.

  3. Recovery of Ra-223 from natural thorium irradiated by protons

    Energy Technology Data Exchange (ETDEWEB)

    Vasiliev, Aleksandr N.; Ostapenko, Valentina S. [Lomonosov Moscow State Univ. (Russian Federation); Russian Academy of Sciences, Moscow-Troitsk (Russian Federation). Inst. for Nuclear Research; Lapshina, Elena V.; Ermolaev, Stanislav V.; Zhuikov, Boris L. [Russian Academy of Sciences, Moscow-Troitsk (Russian Federation). Inst. for Nuclear Research; Danilov, Sergey S. [Lomonosov Moscow State Univ. (Russian Federation); Kalmykov, Stepan N. [Lomonosov Moscow State Univ. (Russian Federation); National Research Center ' Kurchatov Institute' (NRC ' Kurchatov Institute' ), Moscow (Russian Federation)

    2016-11-01

    Irradiation of natural thorium with medium-energy protons is considered to be a prospective approach to large-scale production of {sup 225}Ac and {sup 223}Ra. In addition to the earlier-developed method of {sup 225}Ac isolation, the present work focuses on the simultaneous recovery of {sup 223}Ra from the same thorium target. Radiochemical procedure is based on liquid-liquid extraction, cation exchange and extraction chromatography. The procedure provides separation of radium from spallation and fission products generated in the thorium target. High chemical yield (85-90%) and radionuclide purity of {sup 223}Ra (> 99.8% except {sup 224}Ra and {sup 225}Ra isotopes) have been achieved.

  4. G333.466-0.164, An EGO That Is Not Aligned With Its Disk Axis

    Science.gov (United States)

    Simpson, Janet P.; Burton, Michael; Cotera, Angela; Cunningham, Maria; Lo, Nadia

    2015-08-01

    The infrared source G333.466-0.164 (IRAS 16175-5002) was discovered to contain a 4.5 micron emission feature (extended green object, EGO) in images taken with Spitzer's Infrared Array Camera in 2004. EGOs appear to define the location of outflows from massive young stellar objects (MYSOs) and have been attributed to both emission from molecular hydrogen or CO in the shocked outflow and to scattered light from the outflow cavity. We confirmed that there is a MYSO at the south end of the 15'' long, thin EGO from spectra taken with Spitzer's Infrared Spectrograph in 2009 (Simpson et al. 2012, MNRAS, 419, 211). To further characterize G333.466-0.164 we obtained 12.3 and 24.5 micron images with T-ReCS on Gemini South. Although the MYSO itself is not detected at 12.3 micron, we clearly resolve an elongated source at the location of the MYSO at 24.5 micron with the 0.76" FWHM resolution of Gemini. The elongated region has major and minor axes 2.5'' and 1.5'', respectively, where the position angle of the major axis is 147 pm 5 degrees east of north. For a distance of 3.6 kpc, this corresponds to a size of 9000 AU by 5400 AU. We contrast the position angle of the source to that of the EGO, which is approximately -10 degrees east of north measured from the MYSO. Methanol masers have been measured in G333.466-0.164 by Caswell et al. (2011, MNRAS, 417, 1964) and Voronkov et al. (2014, MNRAS, 439, 258). The 6.7 GHz Class II maser is found at the position of the MYSO and the 36 and 44 GHz Class I masers, which are excited by shocks, are found in positions coinciding with the EGO and also in a line perpendicular to the EGO, in an area obscured by an optically thick dust lane. Voronkov et al. suggest that the actual outflow lies between the two lines of Class I masers in the northeast direction; this is in excellent agreement with the northeast-oriented minor axis of the elongated feature that we observe at 24.5 micron. Thus we identify the 24.5 micron source as the disk of the

  5. Geochemical Speciation of Soil 7Be,137Cs,226Ra and 228Ra as Tracers to Particle Trnsport

    Institute of Scientific and Technical Information of China (English)

    BALZHANGUO; WANGUOJIANG; 等

    1997-01-01

    A brunisolic soil collected from an erosive forest land(HF-1-1) and a yellow soil from and accumulative shallow basin(HF-6-1) in the watershed of Lake Hongfeng (HF) were used for activity measurements of 7Be,137Cs,226Ra and 228Ra in different geochemical speciation.More than 85% of 7Be,137Cs,226Ra and 228Ra in the soils were bound to organic Fe-Mn oxy-hydroxide and residual fractions.They could move with soil particlesw and be used as tracers for the erosion and /or accumulation of soil particles.7Be gohemical specition in the soils agreed with its trace for seasonal particle transport.137Cs geohemial speciaiton was suitable for tracing soil particle accumulation and for sediment aating.226Ra and 228Ra were ombined in crystalline skeleton of clay minerals and mainly remained as residues in the soils and little was bound to the soluble,exchangeable and carbonate fractions.The differentiation of 226 Ra/228Ra activity ratios in different geoheical fractions in the soils could be used as a parameter to trace accumulation and /or erosion of soil particles.

  6. DISTRIBUITION OF 226Ra AND 228Ra IN UNDERGROUND WATER INTO THE SOUTH REGION OF SAO PAULO STATE

    Directory of Open Access Journals (Sweden)

    CARVALHO DE JESUS, Sueli; CHIRINOS, Hugo;

    2011-08-01

    Full Text Available Monitor of natural radionuclides in aquatic raw is very important to guaranty the normal control level inthe environmental medium and the human. In this report were available the concentration of 226Ra and 228Ra inCananeia’s underground water, Iguape and Comprida Island into the south region of Sao Paulo state, by grossalpha and beta counting method. The concentration of 226Ra was variety into the interval 0.80 to 23 mBqL-1 inApril/2009 (rain period and into the interval 0.63 to 12 mBqL -1in August/2009 (dried period. The concentrationof 228Ra was variety into the interval 18 to 39 mBqL-1 in April/2009 and into the interval 15 to 72 mBqL-1 inAugust/2009. The Activities ratio of 228Ra/226Ra was variety into the interval 3.3 to 31.7 at rain period and 1.1 to26.7 at dried period. To compare the yield values of 226Ra and 228Ra these show high activity of the 228Raisotope. The calculate dose no arising the reference of effective dose level available by WHO.

  7. Tumor type resulting in upgrade: An analysis based on 333 low grade soft tissue sarcoma

    Directory of Open Access Journals (Sweden)

    Langer, Stefan

    2014-11-01

    Full Text Available [english] Introduction: Soft tissue sarcomas (STS are rare tumors. Based on histopathological criteria, three grades are distinguished from low (G1 to intermediate (G2 and high grade (G3. After complete initial surgical resection, some G1 STS recur as lesions with an upgrade of a previous G1 STS to a recurrent G2 STS. This upgrade indicates higher malignancy of the STS. Our aim was to find possible risk factors for these upgrades including age, localization of tumor and tumor type. Methods: This retrospective case-control study evaluated 333 patients. Of these 333, 54.7% were male and 45.3% female. All patients underwent R0 resections and among these, 10% subsequently upgraded. The processed data include age, gender, tumor type, tumor localization, local recurrence and upgrade. Results: Patients with upgrades have a higher mean age of 5.5 years than our reference collective. The tumor type has a significant effect on upgrades. Patients with fibrosarcomas are at a threefold risk of an upgrade compared to patients with other G1 STS.Conclusion: Our results indicate that age and tumor type play a key role in upgrades in G1 STS. Patients, age 60 and above and diagnosed with G1 fibrosarcomas, are three times as likely to upgrade compared to patients younger than 60 with other G1 STS. We discuss the significance of these risk factors and whether aside from complete tumor resection, additional therapies (e.g. irradiation may be applied to improve therapeutic outcome.

  8. Paracoccidioidomicosis Diagnóstico por el laboratorio de 333 casos

    Directory of Open Access Journals (Sweden)

    J. Castillo

    1994-12-01

    Full Text Available La frecuencia con la que se diagnostica la paracoccidioidomicosis en nuestro país sigue apoyando la consideración de que esta entidad constituye la micosis sistémica más importante en nuestro medio. En el presente trabajo se informan 333 casos de pacientes con paracoccidioidomicosis, diagnosticados por los cuatro laboratorios del programa de micosis pulmonares del lnstituto Nacional de Salud y por el laboratorio de micología médica del Grupo de Microbiología del mismo instituto, durante un período de 12 años (1981-1992. El diagnóstico fue establecido con la sospecha clínica y una combinación de pruebas de laboratorio con diferentes sensibilidades y especificidades. De los 333 pacientes estudiados, 31 6 (95% eran hombres y 17 (5% mujeres; relación hombre:mujer 18,5:1. El 55,5% de los pacientes se encontraba en el grupo de edad de 41 a 60 años. La forma clínica predominante fue la forma crónica del adulto (99% con 50,7% de presentación unifocal. La distribución geográfica fue muy amplia y señaló la importancia de los centros de diagnóstico. Las sensibilidades del 97% para la inmunodifusión y del 90% para la fijación del complemento confirmaron su importante valor diagnóstico.

  9. 333 Cases of Blood Pressure Observation Analysis in Eye Surgery%眼科手术333例血压观察分析

    Institute of Scientific and Technical Information of China (English)

    赵秀芸; 李兆芝; 易任德

    2014-01-01

    目的:通过对眼科手术患者围手术前期及手术中血压变化的观察,了解眼科手术中血压变化的情况,并探讨眼科围手术前期血压应控制的安全范围。方法随机选取2013年05~08月我院住院手术患者共333例,分为高血压合并糖尿病组、高血压不合并糖尿病组及无高血压病组共三组患者,对其围手术期术前、手术中血压进行比较。并用 t检验作统计学分析。结果三组患者收缩压与舒张压在手术中较手术前均显著升高,且收缩压的升高明显高于舒张压。无高血压组手术中舒张压升高较明显;升高的最大值为收缩压61~63mmHg,舒张压32~48mmHg,部分患者(10.25%~18.87%)术中血压低于手术前。高血压是否合并糖尿病对于术中血压升高程度影响无统计学意义。结论眼科手术使患者收缩压与舒张压都有显著升高,而对于收缩压的影响明显高于舒张压。根据升高的最大均值,结合文献资料得出:高血压患者的眼科围手术前期血压定在160/90mmHg较为安全适宜。%Objective By observing the eye surgery patients blood pressure changes in the preoperative and perioperative operation, to understand the blood pressure change rules in eye surgery, to explore the safe ranges of the blood pressure in the preoperative operation. Methods We selected 333 surgery patients randomly from May to August in 2013, these patients were divided into three groups,The first with hypertension and diabetes mel itus, The second only with hypertension, and the third without hypertension nor diabetes.We compared the blood pressure changes in the preoperative and perioperative operation, the T test for statistical analysis. Results The systolic blood pressure and diastolic blood pressure of three groups in the perioperative operation increased significantly than in the preoperative operation, and systolic blood pressure increased significantly higher than diastolic

  10. Ra: The Sun for Science and Humanity

    Science.gov (United States)

    1996-01-01

    To guide the development of the Ra Strategic Framework, we defined scientific and applications objectives. For our primary areas of scientific interest, we choose the corona, the solar wind, the Sun's effect on the Earth, and solar theory and model development. For secondary areas of scientific interest, we selected sunspots, the solar constant, the Sun's gravitational field, helioseismology and the galactic cosmic rays. We stress the importance of stereoscopic imaging, observations at high spatial, spectral, and temporal resolutions, as well as of long duration measurements. Further exploration of the Sun's polar regions is also important, as shown already by the Ulysses mission. From an applications perspective, we adopted three broad objectives that would derive complementary inputs for the Strategic Framework. These were to identify and investigate: possible application spin-offs from science missions, possible solar-terrestrial missions dedicated to a particular application, and possible future applications that require technology development. The Sun can be viewed as both a source of resources and of threats. Our principal applications focus was that of threat mitigation, by examining ways to improve solar threat monitoring and early warning systems. We compared these objectives to the mission objectives of past, current, and planned international solar missions. Past missions (1962-1980) seem to have been focused on improvement of scientific knowledge, using multiple instrument spacecraft. A ten year gap followed this period, during which the results from previous missions were analyzed and solar study programmes were prepared in international organizations. Current missions (1990-1996) focus on particular topics such as the corona, solar flares, and coronal mass ejections. In planned missions, Sun/Earth interactions and environmental effects of solar activity are becoming more important. The corona is the centre of interest of almost all planned missions

  11. Leaching of 226Ra from components of uranium mill tailings

    Science.gov (United States)

    Landa, E.R.

    1991-01-01

    A sequential extraction procedure was used to characterize the geochemical forms of 226Ra retained by mixtures of quartz sand and a variety of fine-grained rock and mineral species. These mixtures had previously been exposed to the sulfuric acid milling liquor of a simulated acid-leach uranium milling circuit. For most test cases, the major fraction of the 226Ra was extracted with 1 mol/1 NH4Cl and was deemed to be exchangeable. However, 226Ra retained by the barite-containing mixture was resistant to both 1 mol/1 NH4Cl and 1 mol/HCHCl extraction. ?? 1991.

  12. Pulmonary cryptococcosis in rheumatoid arthritis (RA) patients: Comparison of imaging characteristics among RA, acquired immunodeficiency syndrome, and immunocompetent patients

    Energy Technology Data Exchange (ETDEWEB)

    Yanagawa, Noriyo, E-mail: noriyo_yana@ybb.ne.jp [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Sakai, Fumikazu [Department of Diagnostic Radiology, Saitama Medical University International Medical Center, 1397-1 Yamane, Hidaka-shi, Saitama 350-1298 (Japan); Takemura, Tamiko [Department of Pathology, Japanese Red Cross Medical Center, 4-1-22 Hiroo, Shibuya-ku, Tokyo 150-8935 (Japan); Ishikawa, Satoru [Department of Respiratory Medicine, National Hospital Organization Chiba-East-Hospital, 673 Nitona-cho, Chuo-ku, Chiba-shi, Chiba 260-8712 (Japan); Takaki, Yasunobu [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Hishima, Tsunekazu [Department of Pathology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan); Kamata, Noriko [Departments of Radiology, Tokyo Metropolitan Cancer and Infectious Diseases Center Komagome Hospital, 3-8-22, Honkomagome, Bunkyo-ku, Tokyo 113-8677 (Japan)

    2013-11-01

    Purpose: The imaging characteristics of cryptococcosis in rheumatoid arthritis (RA) patients were analyzed by comparing them with those of acquired immunodeficiency syndrome (AIDS) and immunocompetent patients, and the imaging findings were correlated with pathological findings. Methods: Two radiologists retrospectively compared the computed tomographic (CT) findings of 35 episodes of pulmonary cryptococcosis in 31 patients with 3 kinds of underlying states (10 RA, 12 AIDS, 13 immunocompetent), focusing on the nature, number, and distribution of lesions. The pathological findings of 18 patients (8 RA, 2 AIDS, 8 immunocompetent) were analyzed by two pathologists, and then correlated with imaging findings. Results: The frequencies of consolidation and ground glass attenuation (GGA) were significantly higher, and the frequency of peripheral distribution was significantly lower in the RA group than in the immunocompetent group. Peripheral distribution was less common and generalized distribution was more frequent in the RA group than in the AIDS group. The pathological findings of the AIDS and immunocompetent groups reflected their immune status: There was lack of a granuloma reaction in the AIDS group, and a complete granuloma reaction in the immunocompetent group, while the findings of the RA group varied, including a complete granuloma reaction, a loose granuloma reaction and a hyper-immune reaction. Cases with the last two pathologic findings were symptomatic and showed generalized or central distribution on CT. Conclusion: Cryptococcosis in the RA group showed characteristic radiological and pathological findings compared with the other 2 groups.

  13. The truncated metabolite GLP-2 (3-33) interacts with the GLP-2 receptor as a partial agonist

    DEFF Research Database (Denmark)

    Thulesen, Jesper; Knudsen, Lotte Bjerre; Hartmann, Bolette

    2002-01-01

    . Functional (cAMP) and binding in vitro studies were carried out in cells expressing the transfected human GLP-2 receptor. Furthermore, a biologic response of GLP-2 (3-33) was tested in vivo. Mice were allocated to groups treated for 10 days (twice daily) with: (1) 5 microg GLP-2 (1-33), (2) 25 microg GLP-2...... responses in both the small and large intestines, but the response induced by GLP-2 (3-33) was much smaller. Co-administration of 500 microg of GLP-2 (3-33) and 5 microg GLP-2 (1-33) resulted in a growth response that was smaller than that of 5 microg GLP-2 (1-33) alone. Consistent with the observed in vivo...

  14. Seasonal changes in submarine groundwater discharge to coastal salt ponds estimated using 226Ra and 228Ra as tracers

    Science.gov (United States)

    Hougham, A.L.; Moran, S.B.; Masterson, J.P.; Kelly, R.P.

    2008-01-01

    Submarine groundwater discharge (SGD) to coastal southern Rhode Island was estimated from measurements of the naturally-occurring radioisotopes 226Ra (t1/2 = 1600??y) and 228Ra (t1/2 = 5.75??y). Surface water and porewater samples were collected quarterly in Winnapaug, Quonochontaug, Ninigret, Green Hill, and Pt. Judith-Potter Ponds, as well as nearly monthly in the surface water of Rhode Island Sound, from January 2002 to August 2003; additional porewater samples were collected in August 2005. Surface water activities ranged from 12-83??dpm 100??L- 1 (60??dpm = 1??Bq) and 21-256??dpm 100??L- 1 for 226Ra and 228Ra, respectively. Porewater 226Ra activities ranged from 16-736??dpm 100??L- 1 (2002-2003) and 95-815??dpm 100??L- 1 (2005), while porewater 228Ra activities ranged from 23-1265??dpm 100??L- 1. Combining these data with a simple box model provided average 226Ra-based submarine groundwater fluxes ranging from 11-159??L m- 2 d- 1 and average 228Ra-derived fluxes of 15-259??L m- 2 d- 1. Seasonal changes in Ra-derived SGD were apparent in all ponds as well as between ponds, with SGD values of 30-472??L m- 2 d- 1 (Winnapaug Pond), 6-20??L m- 2 d- 1 (Quonochontaug Pond), 36-273??L m- 2 d- 1 (Ninigret Pond), 29-76??L m- 2 d- 1 (Green Hill Pond), and 19-83??L m- 2 d- 1 (Pt. Judith-Potter Pond). These Ra-derived fluxes are up to two orders of magnitude higher than results predicted by a numerical model of groundwater flow, estimates of aquifer recharge for the study period, and values published in previous Ra-based SGD studies in Rhode Island. This disparity may result from differences in the type of flow (recirculated seawater versus fresh groundwater) determined using each technique, as well as variability in porewater Ra activity. ?? 2007 Elsevier B.V. All rights reserved.

  15. Giver lave Ra-værdier bedre hygiejne?

    DEFF Research Database (Denmark)

    Gram, Lone; Bagge-Ravn, Dorthe; Kold, John;

    2004-01-01

    Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm.......Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm....

  16. Tehnikaromud saab peagi tasuta ära anda / Urmas Tooming

    Index Scriptorium Estoniae

    Tooming, Urmas

    2005-01-01

    13. augustist saab vana elektroonikat tasuta ära anda. MTÜ Eesti Elektroonikaromu on juba loonud selleks üle Eesti 44 kogumispunkti, EES-Ringlus ühingus endale konkurenti ei näe. Lisa: Vana tehnika

  17. Cumulative Production Per Township - SaMiRa

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains a selected township grid within the Sagebrush Mineral Resource Assessment project (SaMiRa) study area attributed with cumulative oil and gas...

  18. Giver lave Ra-værdier bedre hygiejne?

    DEFF Research Database (Denmark)

    Gram, Lone; Bagge-Ravn, Dorthe; Kold, John

    2004-01-01

    Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm.......Ifølge vore undersøgelser er der ingen grund til at ændre på den generelle anbefaling om, at Ra bør være mindre end 0,8 µm. Muligvis kan man dog i særlige tilfælde opnå hygiejnemæssige gevinster ved at bruge meget fine poleringer, dvs. Ra mindre end 0,8 µm....

  19. Tehnikaromud saab peagi tasuta ära anda / Urmas Tooming

    Index Scriptorium Estoniae

    Tooming, Urmas

    2005-01-01

    13. augustist saab vana elektroonikat tasuta ära anda. MTÜ Eesti Elektroonikaromu on juba loonud selleks üle Eesti 44 kogumispunkti, EES-Ringlus ühingus endale konkurenti ei näe. Lisa: Vana tehnika

  20. An early "Atkins' Diet": RA Fisher analyses a medical "experiment".

    Science.gov (United States)

    Senn, Stephen

    2006-04-01

    A study on vitamin absorption which RA Fisher analysed for WRG Atkins and co-authored with him is critically examined. The historical background as well as correspondence between Atkins and Fisher is presented.

  1. Research of RA Coding Algorithm Based on AWGN Channel

    Directory of Open Access Journals (Sweden)

    Xianzhong Chen

    2012-04-01

    Full Text Available In order to study the performance of RA, and the impacts of iterations and code length to the compiled code characteristics, we respectively made simulation analysis on RA, LDPC and TURBO with different parameters. We did it by designing code length, rate and iterations to analyze signals to noise ratio changes. With three patterns comparing the simulation analysis, it turned out that volume reaches the limit of Shannon when RA is in the condition of maximum likelihood decoding. The bit error ratio reduces as the message length goes up, and the performance comes near channel capacity. As the iterations increase, and bit error ratio reduces, and the performance will be better. Research shows that RA has more advantages and wide application propects whether in complexity or in performance.

  2. Electrochemical performance of alloys Ho_5Fe_3Co_(12) and Ho_(33.3)Co_(66.7)

    Institute of Scientific and Technical Information of China (English)

    赵允红; 何维; 张永志; 曾令民

    2010-01-01

    Alloys with composition Ho5Fe3Co12 and Ho33.3Co66.7 were prepared and examined by X-ray diffractometer and automatic battery testing instrument. The electrochemical properties of these alloys such as discharge capacity, cycling performance and high rate dischargeability were investigated by battery testing instruments in alkaline electrolyte. A comparison of the electrochemical performance of the Ho5Fe3Co12 and Ho33.3Co66.7 alloys revealed that alloy Ho5Fe3Co12 possessed a better electrochemical performance...

  3. O pensamento desenvolvimentista de Raúl Prebisch Raúl Prebisch's thought on development

    Directory of Open Access Journals (Sweden)

    Joaquim Miguel Couto

    2007-04-01

    Full Text Available As idéias do economista argentino Raúl Prebisch (1901-1986 sempre estiveram voltadas para a ação. As dificuldades encontradas diante de problemas concretos (durante a crise dos anos 1930, tornaram Prebisch um homem prático. Assim, suas teorias sobre a substituição de importações, o sistema centro-periferia e a criação de um mercado comum latino-americano, possuíam um grande sentido de influenciar a realidade. A única exceção coube a sua "Teoria da Transformação", construída no último decênio de sua vida. Nesta, Prebisch se afasta da realidade e teoriza sobre a criação de um novo sistema econômico, através de uma síntese entre socialismo e liberalismo.The Argentinean economist Raúl Prebisch’s (1901-1986 ideas were always gone back to the action. Difficulties facing concrete problems made him a pragmatic man. Thus, his theories about import substitution, core-periphery system and the creation of a common Latin-American market, were embodied in a great purpose of influencing the reality. The only exception was the "Theory of Transformation", which was built in the last decade of this life. There, Prebisch moves off practical matters and speculates about the creation of a new economic system, through a synthesis of socialism and liberalism.

  4. Pharmacologic and economic differentiation of drugs for RA in Italy

    Directory of Open Access Journals (Sweden)

    Patrizia Berto

    2012-07-01

    Full Text Available Rheumatoid arthritis (RA is a chronic, progressive and degenerative illness, which affects about 0.5% of the adult population with significant social costs. In Italy there are approximately 300,000 people with RA, with twice as many women than men. RA causes progressive deformity and disability and is associated with numerous co-morbid conditions that reduce the life expectancy of 5-10 years. The costs of RA have a serious impact on the entire community, especially in terms of disability, hospitalization and medical care. In Italy has been estimated that cost of illness could reach about 1,600 million euros, of which over two thirds are represented by indirect costs. The treatment of RA is evolving and the introduction of biological drugs has resulted in a significant progress in terms of therapeutic possibilities. Etanercept, the only soluble receptor of TNF-alfa currently approved appears to be cost-effective and it is recommended by major guidelines for the treatment of RA.  http://dx.doi.org/10.7175/rhc.v3i3.201

  5. Investigation of $\\alpha$-decay rates of $^{221}$Fr, $^{224}$Ra and $^{226}$Ra in different environments

    CERN Multimedia

    2007-01-01

    It has recently been suggested, and indicated experimentally, that $\\alpha$- decay half-lives are modified by solid state effects in the surrounding environment. We propose here to measure with high accuracy the $\\alpha$-decay half-life of $^{221}$Fr, $^{224}$Ra and $^{226}$Ra in insulators and metals. Furthermore we plan to investigate the temperature dependency of the half-life in these materials (room temperature, 4 K and 10 mK).

  6. Interaction Between HII Region and AFGL333-Ridge: Implications to the Star Formation Scenario

    CERN Document Server

    Nakano, Makoto; Chibueze, James O; Nagayama, Takumi; Omodaka, Toshihiro; Handa, Toshihiro; Sunada, Kazuyuki; Kamezaki, Tatsuya; Burns, Ross A

    2016-01-01

    We investigated the star formation activities in the AFGL333 region, which is in the vicinity of the W4 expanding bubble, by conducting NH3 (1,1), (2,2), and (3,3) mapping observations with the 45 m Nobeyama Radio Telescope at an angular resolution of 75". The morphology of the NH3 (1,1) map shows a bow-shape structure with the size of 2.0 x 0.6 pc as seen in the dust continuum. At the interface between the W4 bubble and the dense NH3 cloud, the compact HII region G134.2+0.8, associated with IRAS02245+6115, is located. Interestingly, just north and south of G134.2+0.8 we found NH3 emission exhibiting large velocity widths of ~ 2.8 km/s, compared to 1.8 km/s at the other positions. As the possibility of mechanical energy injection through the activity of YSO(s) is low, we considered the origin of the large turbulent gas motion as indication of interaction between the compact HII region and the periphery of the dense molecular cloud. We also found expanding motion of the CO emission associated with G134.2+0.8. ...

  7. QUALITY OF GROUNDWATER AND AQUATIC HUMIC SUBSTANCES FROM MAIN RESERVOIRE OF GROUND WATER No. 333

    Directory of Open Access Journals (Sweden)

    Izabella Pisarek

    2015-11-01

    Full Text Available The conducted research included the estimation of the quality of groundwater from the Main Reservoir of Ground Water No. 333 area in Opole District, Poland. The groundwater in the analyzed region shows high diversity in quality. The main threat for the quality of water in this region is the human household activity. The main pollutants of groundwater are: dissolved phosphorus, nitrate and ammonium. The quality and quantity of dissolved humic substances in groundwater were also investigated. The results showed that the contents of water-extractable organic carbon varied. Presently, the analyzed groundwater is characterized by large differences in dissolved forms of organic carbon. During migration of the soil solution through the soil profile to groundwater, dissolved humic substances undergo qualitative and quantitative changes. Correlation analysis between the quantity of carbon in soil and aquatic humic substances, especially fulvic acids, indicates the possibility of their translocation in soil profiles and their transformation and migration to groundwater. This conclusion can be confirmed by FT-IR-analysis.

  8. Evidence of polymorphous amorphous-to-quasicrystalline phase transformation in Zr66.7Pd33.3 metallic glass

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Saksl, K.; Saida, J.

    2002-01-01

    The amorphous-to-quasicrystalline phase transformation and the pressure effect on the transformation in a Zr66.7Pd33.3 metallic glass have been investigated by in situ x-ray diffraction measurements using synchrotron radiation. It is found that the transformation is a polymorphous reaction...

  9. Tuning the host-pathogen relationship through evolution with a special focus on the echinoid Sp185/333 system

    Directory of Open Access Journals (Sweden)

    LC Smith

    2016-11-01

    Full Text Available Diversification of immune genes in host organisms that are in deadly arms races with pathogens has resulted in a wide range of approaches by which the host survives. Well known examples of adaptive immunity in vertebrates include somatic recombination of the immunoglobulin gene family and assembly of the variable lymphocyte receptors. The CRISPR-Cas system in bacteria and archaea is also considered adaptive. For invertebrates that survive in the absence of adaptive immunity, innate immune diversity is accomplished based on functions of clusters of immune genes such as FREPs, VCBPs, C1qs, TLRs, and R genes. Single copy gene diversity can be accomplished through extensive alternative splicing or increases in alleles in populations. The Sp185/333 gene family in the purple sea urchin has multiple levels in which to generate immune diversity. These include clustered Sp185/333 genes, genomic instability in regions harboring the genes, predicted mRNA editing, expression of broad repertoires of Sp185/333 proteins, and post translational modifications. The Sp185/333 proteins have anti-pathogen activities and an individual recombinant protein can bind to multiple foreign cells and molecular patterns. The underlying characteristics of gene clusters, many with repeats, that are present in unstable genomic regions is common to a number of these examples, and is likely of central importance for organisms that survive solely on innate immunity.

  10. A role for glutamate-333 of Saccharomyces cerevisiae cystathionine γ-lyase as a determinant of specificity.

    Science.gov (United States)

    Hopwood, Emily M S; Ahmed, Duale; Aitken, Susan M

    2014-02-01

    Cystathionine γ-lyase (CGL) catalyzes the hydrolysis of l-cystathionine (l-Cth), producing l-cysteine (l-Cys), α-ketobutyrate and ammonia, in the second step of the reverse transsulfuration pathway, which converts l-homocysteine (l-Hcys) to l-Cys. Site-directed variants substituting residues E48 and E333 with alanine, aspartate and glutamine were characterized to probe the roles of these acidic residues, conserved in fungal and mammalian CGL sequences, in the active-site of CGL from Saccharomyces cerevisiae (yCGL). The pH optimum of variants containing the alanine or glutamine substitutions of E333 is increased by 0.4-1.2 pH units, likely due to repositioning of the cofactor and modification of the pKa of the pyridinium nitrogen. The pH profile of yCGL-E48A/E333A resembles that of Escherichia coli cystathionine β-lyase. The effect of substituting E48, E333 or both residues is the 1.3-3, 26-58 and 124-568-fold reduction, respectively, of the catalytic efficiency of l-Cth hydrolysis. The Km(l-Cth) of E333 substitution variants is increased ~17-fold, while Km(l-OAS) is within 2.5-fold of the wild-type enzyme, indicating that residue E333 interacts with the distal amine moiety of l-Cth, which is not present in the alternative substrate O-acetyl-l-serine. The catalytic efficiency of yCGL for α,γ-elimination of O-succinyl-l-homoserine (kcat/Km(l-OSHS)=7±2), which possesses a distal carboxylate, but lacks an amino group, is 300-fold lower than that of the physiological l-Cth substrate (kcat/Km(l-Cth)=2100±100) and 260-fold higher than that of l-Hcys (kcat/Km(l-Hcys)=0.027±0.005), which lacks both distal polar moieties. The results of this study suggest that the glutamate residue at position 333 is a determinant of specificity.

  11. Ra-226 and Ra-226/Ba Signatures of Intermediate and Deep Water Masses of the Labrador Sea

    Science.gov (United States)

    Pons-Branchu, E.; Hillaire-Marcel, C.; Ghaleb, B.

    2004-05-01

    The Labrador sea plays an important role in the formation of intermediate North Atlantic water, (cf. Labrador Sea Water -LSW) and subsequently, in the general thermohaline circulation of the ocean. In addition, water masses originating from the Norwegian and Greenland seas are present below the LSW, in the deeper part of the basin. Investigations on the geochemistry of radium have been undertaken as a mean to document these deep and intermediate circulation processes. The vertical distribution of Ra-226 and Ba contents has been established for 8 stations located along 2 sections from 48°44 N; 52°58W to 52°23 N 45°17W and from 53.59°N to 60.34°N, 48.13°W. Thermo-Ionization Mass Spectrometry coupled with a new radium extraction and purification technique permitted the measurement of Ra-226 using 200 ml samples (i.e., appr. 10 femtograms of Ra). In parallel, Ba contents were determined using M-C-ICP-MS in order to normalize Ra-226 concentrations, since Ba is often seen as a subrogate stable isotope of Ra, due to their almost similar geochemical behaviour. Large variations in Ra-226 concentrations are observed. They range from 51 fg/g in intermediate and deep water samples to 31 fg/g in surface waters. When normalised to a salinity of 35 or to the Ba contents large discrepancies are still observed. They suggest a specific Ra-signature for each of the major water masses present in the basin. Particular attention has been paid to Ra-226 contents in the LSW in relation to its production rate as well as to the influence of the Western Boundary Under Current (WBUC), which carries the North Atlantic Deep water masses into their gyre along the lower slopes of the Labrador sea. Based on the presently available data set, a peak in Ra-226 and Ba contents seems to characterise the high velocity axis of the WBUC. These data suggest moreover a lower Ra-226 content for the LSW than for the deeper water masses.

  12. Interstitial deletion of 5q33.3q35.1 in a boy with severe mental retardation.

    Science.gov (United States)

    Lee, Jin Hwan; Kim, Hyo Jeong; Yoon, Jung Min; Cheon, Eun Jung; Lim, Jae Woo; Ko, Kyong Og; Lee, Gyung Min

    2016-11-01

    Constitutional interstitial deletions of the long arm of chromosome 5 (5q) are quite rare, and the corresponding phenotype is not yet clearly delineated. Severe mental retardation has been described in most patients who present 5q deletions. Specifically, the interstitial deletion of chromosome 5q33.3q35.1, an extremely rare chromosomal aberration, is characterized by mental retardation, developmental delay, and facial dysmorphism. Although the severity of mental retardation varies across cases, it is the most common feature described in patients who present the 5q33.3q35.1 deletion. Here, we report a case of a de novo deletion of 5q33.3q35.1, 46,XY,del(5)(q33.3q35.1) in an 11-year-old boy with mental retardation; to the best of our knowledge this is the first case in Korea to be reported. He was diagnosed with severe mental retardation, developmental delay, facial dysmorphisms, dental anomalies, and epilepsy. Chromosomal microarray analysis using the comparative genomic hybridization array method revealed a 16-Mb-long deletion of 5q33. 3q35.1(156,409,412-172,584,708)x1. Understanding this deletion may help draw a rough phenotypic map of 5q and correlate the phenotypes with specific chromosomal regions. The 5q33.3q35.1 deletion is a rare condition; however, accurate diagnosis of the associated mental retardation is important to ensure proper genetic counseling and to guide patients as part of long-term management.

  13. A Locus at 5q33.3 Confers Resistance to Tuberculosis in Highly Susceptible Individuals

    Science.gov (United States)

    Sobota, Rafal S.; Stein, Catherine M.; Kodaman, Nuri; Scheinfeldt, Laura B.; Maro, Isaac; Wieland-Alter, Wendy; Igo, Robert P.; Magohe, Albert; Malone, LaShaunda L.; Chervenak, Keith; Hall, Noemi B.; Modongo, Chawangwa; Zetola, Nicola; Matee, Mecky; Joloba, Moses; Froment, Alain; Nyambo, Thomas B.; Moore, Jason H.; Scott, William K.; Lahey, Timothy; Boom, W. Henry; von Reyn, C. Fordham; Tishkoff, Sarah A.; Sirugo, Giorgio; Williams, Scott M.

    2016-01-01

    Immunosuppression resulting from HIV infection increases the risk of progression to active tuberculosis (TB) both in individuals newly exposed to Mycobacterium tuberculosis (MTB) and in those with latent infections. We hypothesized that HIV-positive individuals who do not develop TB, despite living in areas where it is hyperendemic, provide a model of natural resistance. We performed a genome-wide association study of TB resistance by using 581 HIV-positive Ugandans and Tanzanians enrolled in prospective cohort studies of TB; 267 of these individuals developed active TB, and 314 did not. A common variant, rs4921437 at 5q33.3, was significantly associated with TB (odds ratio = 0.37, p = 2.11 × 10−8). This variant lies within a genomic region that includes IL12B and is embedded in an H3K27Ac histone mark. The locus also displays consistent patterns of linkage disequilibrium across African populations and has signals of strong selection in populations from equatorial Africa. Along with prior studies demonstrating that therapy with IL-12 (the cytokine encoded in part by IL12B, associated with longer survival following MTB infection in mice deficient in CD4 T cells), our results suggest that this pathway might be an excellent target for the development of new modalities for treating TB, especially for HIV-positive individuals. Our results also indicate that studying extreme disease resistance in the face of extensive exposure can increase the power to detect associations in complex infectious disease. PMID:26942285

  14. Purification and biological evaluation of the metabolites produced by Streptomyces sp. TK-VL_333.

    Science.gov (United States)

    Kavitha, Alapati; Prabhakar, Peddikotla; Vijayalakshmi, Muvva; Venkateswarlu, Yenamandra

    2010-06-01

    An Actinobacterium strain isolated from laterite soils of the Guntur region was identified as Streptomyces sp. TK-VL_333 by 16S rRNA analysis. Cultural, morphological and physiological characteristics of the strain were recorded. The secondary metabolites produced by the strain cultured on galactose-tyrosine broth were extracted and concentrated followed by defatting of the crude extract with cyclohexane to afford polar and non-polar residues. Purification of the two residues by column chromatography led to isolation of five polar and one non-polar fraction. Bioactivity- guided fractions were rechromatographed on a silica gel column to obtain four compounds, namely 1H-indole-3-carboxylic acid, 2,3-dihydroxy-5-(hydroxymethyl) benzaldehyde, 4-(4-hydroxyphenoxy) butan-2-one and acetic acid-2-hydroxy-6-(3-oxo-butyl)-phenyl ester from three active polar fractions and 8-methyl decanoic acid from one non-polar fraction. The structure of the compounds was elucidated on the basis of FT-IR, mass and NMR spectroscopy. The antimicrobial activity of the bioactive compounds produced by the strain was tested against the bacteria and fungi and expressed in terms of minimum inhibitory concentration. Antifungal activity of indole-3-carboxylic acid was further evaluated under in vitro and in vivo conditions. This is the first report of 2,3-dihydroxy-5-(hydroxymethyl) benzaldehyde, 4-(4-hydroxyphenoxy) butan-2-one, acetic acid-2-hydroxy-6-(3-oxo-butyl)-phenyl ester and 8-methyl decanoic acid from the genus Streptomyces.

  15. The "RA" Expeditions: The Archaeological and Anthropological Background. The "RA" Expeditions: The Coriolis Effect. The "RA" Expeditions: The Papyrus Reed. Learning Experiences for Coastal and Oceanic Awareness Studies, Nos. 211, 212, 213. [Project COAST].

    Science.gov (United States)

    Delaware Univ., Newark. Coll. of Education.

    Included are three units related to coastal and oceanic awareness. These are: (1) The "RA" Expeditions: The Archaeological and Anthropological Background; (2) The "RA" Expeditions: The Coriolis Effect; and (3) The "RA" Expeditions: The Papyrus Reed. Each of the three units are designed for students in grades 6-12. Each unit contains teacher…

  16. The "RA" Expeditions: The Archaeological and Anthropological Background. The "RA" Expeditions: The Coriolis Effect. The "RA" Expeditions: The Papyrus Reed. Learning Experiences for Coastal and Oceanic Awareness Studies, Nos. 211, 212, 213. [Project COAST].

    Science.gov (United States)

    Delaware Univ., Newark. Coll. of Education.

    Included are three units related to coastal and oceanic awareness. These are: (1) The "RA" Expeditions: The Archaeological and Anthropological Background; (2) The "RA" Expeditions: The Coriolis Effect; and (3) The "RA" Expeditions: The Papyrus Reed. Each of the three units are designed for students in grades 6-12.…

  17. Rapid determination of 226Ra in environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, Sherrod L.; Culligan, Brian K.

    2012-02-04

    A new rapid method for the determination of {sup 228}Ra in natural water samples has been developed at the SRNL/EBL (Savannah River National Lab/ Environmental Bioassay Laboratory) that can be used for emergency response or routine samples. While gamma spectrometry can be employed with sufficient detection limits to determine {sup 228}Ra in solid samples (via {sup 228}Ac) , radiochemical methods that employ gas flow proportional counting techniques typically provide lower MDA (Minimal Detectable Activity) levels for the determination of {sup 228}Ra in water samples. Most radiochemical methods for {sup 228}Ra collect and purify {sup 228}Ra and allow for {sup 228}Ac daughter ingrowth for ~36 hours. In this new SRNL/EBL approach, {sup 228}Ac is collected and purified from the water sample without waiting to eliminate this delay. The sample preparation requires only about 4 hours so that {sup 228}Ra assay results on water samples can be achieved in < 6 hours. The method uses a rapid calcium carbonate precipitation enhanced with a small amount of phosphate added to enhance chemical yields (typically >90%), followed by rapid cation exchange removal of calcium. Lead, bismuth, uranium, thorium and protactinium isotopes are also removed by the cation exchange separation. {sup 228}Ac is eluted from the cation resin directly onto a DGA Resin cartridge attached to the bottom of the cation column to purify {sup 228}Ac. DGA Resin also removes lead and bismuth isotopes, along with Sr isotopes and {sup 90}Y. La is used to determine {sup 228}Ac chemical yield via ICP-MS, but {sup 133}Ba can also be used instead if ICP-MS assay is not available. Unlike some older methods, no lead or strontium holdback carriers or continual readjustment of sample pH is required.

  18. [Update on Current Care Guidelines. Rheumatoid Arthritis (RA)].

    Science.gov (United States)

    2015-01-01

    Patients with signs and symptoms of early rheumatoid arthritis (RA) should be referred to a multidisciplinary rheumatology clinic. The ACR-EULAR criteria help in identification of patients with risk for erosive RA. Treatment should aim at early remission. Start with the combination of methotrexate, hydroxychloroquine, sulfasalazine, and low-dose glucocorticoid is recommended if contraindications exist. Methotrexate has better bioavailability as injection. Glucocorticoids are injected into active joints. Patient education with shared decision is essential. Exercise training is recommended. If treatment target is not achieved by the DMARD combination, a biological drug is added.

  19. Process waste assessment: Color print processing (RA-4)

    Energy Technology Data Exchange (ETDEWEB)

    Catlett, P.

    1994-05-01

    The Kodak RA-4 process is used to develop prints and overhead transparencies from photographic negatives. The assessment was based on usage, effluent discharge, and final disposition of waste generated by the process. Two options explored were bleach-fix regeneration and the conversion to a digital image processing system. The RA-4 process is process is environmentally sound and generates a relatively small amount of waste. The bleach-fix option would provide only a small effluent reduction. The digital imaging conversion option, if fully implemented, could greatly reduce waste generated in the photo lab.

  20. RAPID DETERMINATION OF RA-226 IN ENVIRONMENTAL SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, S.

    2012-01-03

    A new rapid method for the determination of {sup 226}Ra in environmental samples has been developed at the Savannah River Site Environmental Lab (Aiken, SC, USA) that can be used for emergency response or routine sample analyses. The need for rapid analyses in the event of a Radiological Dispersive Device or Improvised Nuclear Device event is well-known. In addition, the recent accident at Fukushima Nuclear Power Plant in March, 2011 reinforces the need to have rapid analyses for radionuclides in environmental samples in the event of a nuclear accident. {sup 226}Ra (T1/2 = 1,620 years) is one of the most toxic of the long-lived alpha-emitters present in the environment due to its long life and its tendency to concentrate in bones, which increases the internal radiation dose of individuals. The new method to determine {sup 226}Ra in environmental samples utilizes a rapid sodium hydroxide fusion method for solid samples, calcium carbonate precipitation to preconcentrate Ra, and rapid column separation steps to remove interferences. The column separation process uses cation exchange resin to remove large amounts of calcium, Sr Resin to remove barium and Ln Resin as a final purification step to remove {sup 225}Ac and potential interferences. The purified {sup 226}Ra sample test sources are prepared using barium sulfate microprecipitation in the presence of isopropanol for counting by alpha spectrometry. The method showed good chemical recoveries and effective removal of interferences. The determination of {sup 226}Ra in environmental samples can be performed in less than 16 h for vegetation, concrete, brick, soil, and air filter samples with excellent quality for emergency or routine analyses. The sample preparation work takes less than 6 h. {sup 225}Ra (T1/2 = 14.9 day) tracer is used and the {sup 225}Ra progeny {sup 217}At is used to determine chemical yield via alpha spectrometry. The rapid fusion technique is a rugged sample digestion method that ensures that any

  1. Multimodalinė transporto infrastruktūra turizmo paslaugoje

    OpenAIRE

    Simanavičius, Egidijus

    2013-01-01

    Darbo pavadinimas: Multimodalinė transporto infrastruktūra turizmo paslaugoje. Darbo tikslas: įvertinti multimodalinės transporto infrastruktūros turizmo paslaugoje situaciją. Darbo objektas: multimodalinė transporto infrastruktūra turizmo paslaugoje. Tyrimo uždaviniai: 1. Atskleisti multimodalinės transporto infrastruktūros turizmo paslaugoje esmę; 2. Pristatyti Lietuvos transporto infrastruktūros turizmo paslaugoje situaciją; 3. Ištirti multimodalinę infrastruktūrą geležin...

  2. {sup 226}Ra, {sup 228}Ra and {sup 40}K in scales formed in boilers of industrial installations

    Energy Technology Data Exchange (ETDEWEB)

    Poggi, Claudia M. Braga; Farias, Emerson Emiliano G. de; Hazin, Clovis A., E-mail: hazin@cnen.gov.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Energia Nuclear; Centro Regional de Ciencias Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Gazineu, Maria Helena P., E-mail: helena@unicap.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Energia Nuclear; Universidade Catolica de Pernambuco (UNICAP), Recife, PE (Brazil). Centro de Ciencias e Tecnologia

    2011-07-01

    Many industrial processes involve the production of steam in boilers, which is sent through pipes to machines and other equipment used in different sectors of the installations. The water commonly used in these processes is groundwater, which generally has high concentrations of calcium and magnesium salts, that can co-precipitate with naturally occurring radioactive elements such as {sup 226}Ra and {sup 228}Ra creating radioactive scales, which are deposited in pipes, thus decreasing the efficiency of steam production. In addition, {sup 40}K that is present in all soils and rocks with a concentration of about 0.012% of natural potassium can also be concentrated in these scales. No data was found in literature relating to radionuclides present in the scales formed on boilers in general. In this context, the purpose of this work was to determine concentrations of {sup 226}Ra, {sup 228}Ra and {sup 40}K, in scales generated inside boilers from different industries in the cities of Caruaru, Paulista and Goiana, Pernambuco. Determination of the radionuclides concentration was performed by gamma spectrometry with an HPGe detector, calculating their specific activities. Activity concentrations of {sup 226}Ra were in the range of < 1.4 (Detection Limit) to 1,328.0 {+-} 23.0 Bq.kg{sup -1} and {sup 228}Ra activity concentrations varied from < 1.8 (Detection Limit) to 265.5 {+-} 8.0 Bq.kg{sup 1}. Activity concentrations of {sup 40}K were in the range of < 14.6 (Detection Limit) to 288.1 {+-} 11.5 Bq.kg{sup -1}. All these activity concentrations were lower than the limits established by the Brazilian Nuclear Energy Commission of for this type of matrix. (author)

  3. Effect of Paclobutrazol on Micropropagation of Prunus humilis%PP333对欧李微体快繁的影响

    Institute of Scientific and Technical Information of China (English)

    钟士传

    2006-01-01

    研究了不同质量浓度的PP333对欧李试管苗生长及生根的影响.试结果表明:PP333可抑制欧李试管苗的生长,使繁殖系数和嫩梢长度都受到影响.在继代培养时,培养基中加入0.1 mg·L-1PP333有利于形成壮苗.当PP333质量浓度超过0.5 mg·L-1L时,在常温下能达到种质保存的目的.生根培养基中加入0.10~0.05mg·L-1PP333能明显诱导生根.

  4. Interstitial deletion of 5q33.3q35.1 in a boy with severe mental retardation

    OpenAIRE

    Lee, Jin Hwan; Kim, Hyo Jeong; Yoon, Jung Min; Cheon, Eun Jung; Lim, Jae Woo; Ko, Kyong Og; Lee, Gyung Min

    2016-01-01

    Constitutional interstitial deletions of the long arm of chromosome 5 (5q) are quite rare, and the corresponding phenotype is not yet clearly delineated. Severe mental retardation has been described in most patients who present 5q deletions. Specifically, the interstitial deletion of chromosome 5q33.3q35.1, an extremely rare chromosomal aberration, is characterized by mental retardation, developmental delay, and facial dysmorphism. Although the severity of mental retardation varies across cas...

  5. 333入主AMD 技嘉GA-790XTA-UD4主板

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    在“333”金子树立了Intel平台的新旗帜后,很多人都疑惑是不是此套技术唯P55平台独有?但今天我们带来的技嘉GR-790XTR—UD4EE板打破了这个谣言,RMD平台的3333来了……

  6. Applying Model-Based Techniques for Aerospace Projects in Accordance with DO-178C, DO-331, and DO-333

    OpenAIRE

    Eisemann, Ulrich

    2016-01-01

    International audience; The new standard for software development in civil aviation, DO-178C, mainly differs from its predecessor DO-178B, in that it has standard supplements to provide greater scope for using new software development methods. The most important standard supplements are DO-331 on the methods of model-based development and model-based verification and DO-333 on the use of formal methods such as model checking and abstract interpretation. These key software design techniques of...

  7. Kui ei taha, ära õpi? / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2003-01-01

    Autor leiab, et viimase 10 aasta jooksul levinud arusaam - kui ei taha, ära õpi - on tegelikult väga negatiivsete tagajärgedega seisukoht. Haridus ei ole vaid individuaalne hüve ja selle puudumine individuaalne õnnetus, see on kogu ühiskonna probleem

  8. On RA Abstracts: From Rhetorical Structure to Thematic Organisation

    Science.gov (United States)

    Lores, Rosa

    2004-01-01

    This paper reports an analysis of research article (RA) abstracts from linguistics journals from two related angles: rhetorical organisation and thematic structure. Based on a small scale study it reveals two major types of rhetorical organisation, here called the IMRD type and the CARS type. When thematic analysis, in terms of thematic…

  9. Eesti kasutas ära kõik NATO lennutunnid

    Index Scriptorium Estoniae

    2014-01-01

    Eesti on tänavu ära kasutanud kõik NATO strateegilises õhutranspordiprogrammis (SAC) ette nähtud 35 lennutundi, millega Eesti sai kasutada transpordilennukit Boeing C-17 Globemaster. Lennutunnid kulusid Eesti jalaväeüksuse tagasitoomiseks Afganistanist

  10. Improved limit on the $^{225}$Ra electric dipole moment

    CERN Document Server

    Bishof, Michael; Bailey, Kevin G; Greene, John P; Holt, Roy J; Kalita, Mukut R; Korsch, Wolfgang; Lemke, Nathan D; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Thomas P; Singh, Jaideep T; Dietrich, Matthew R

    2016-01-01

    Background: Octupole-deformed nuclei, such as that of $^{225}$Ra, are expected to amplify observable atomic electric dipole moments (EDMs) that arise from time-reversal and parity-violating interactions in the nuclear medium. In 2015, we reported the first "proof-of-principle" measurement of the $^{225}$Ra atomic EDM. Purpose: This work reports on the first of several experimental upgrades to improve the statistical sensitivity of our $^{225}$Ra EDM measurements by orders of magnitude and evaluates systematic effects that contribute to current and future levels of experimental sensitivity. Method: Laser-cooled and trapped $^{225}$Ra atoms are held between two high voltage electrodes in an ultra high vacuum chamber at the center of a magnetically shielded environment. We observe Larmor precession in a uniform magnetic field using nuclear-spin-dependent laser light scattering and look for a phase shift proportional to the applied electric field, which indicates the existence of an EDM. The main improvement to o...

  11. Improved experimental limit on the EDM of 225Ra

    Science.gov (United States)

    Bishof, Michael; Bailey, Kevin; Dietrich, Matthew R.; Greene, John P.; Holt, Roy J.; Kalita, Mukut R.; Korsch, Wolfgang; Lemke, Nathan D.; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Tom P.; Parker, Richard H.; Rabga, Tenzin; Singh, Jaideep T.

    2015-10-01

    Searches for permanent electric dipole moments (EDMs) in fundamental and composite particles are sensitive probes of beyond-standard-model symmetry violation that could explain the dominance of matter over anti-matter. The 225Ra (t1/2 = 15d, I = 1/2) atom is a particularly attractive system to use for an EDM measurement because its large nuclear octupole deformation, closely spaced ground-state parity doublet, and large atomic mass make 225Ra uniquely sensitive to symmetry-violating interactions in the nuclear medium. We have developed an experiment to measure the EDM of 225Ra and demonstrated the first ``proof-of-principle'' measurement, giving a 95% confidence upper limit of 5E-22 e-cm. After implementing a vacuum upgrade, we have observed nuclear spin coherence after 20 s of free evolution - a factor of ten improvement over our earlier results - and have lowered the 225Ra EDM limit by over an order of magnitude. Upcoming experimental upgrades have the potential to further improve our EDM sensitivity by many orders of magnitude, allowing us to test symmetry violation at an unprecedented level. This work is supported by U.S. DOE, Office of Science, Office of Nuclear Physics, under Contract DE-AC02-06CH11357.

  12. Diapycnal nutrient fluxes across the benthic boundary layers at the continental slopes off Peru and Mauritania based on 224Ra/223Ra-ratios

    Science.gov (United States)

    Reichert, P.; Scholten, J. C.; Eisenhauer, A.; Miquel, J. C.; Gasser, B.; Liebetrau, V.; Sommer, S.; Dengler, M.; Bryant, L. D.

    2014-12-01

    Marine sediments may act as sources and/or sinks of nutrients in oxygen minimum zones (OMZs) where solute fluxes between sediments and the above water column are believed to be an important component for the bioproductivity in the mixed layer. However, solute fluxes between sediments and the water column above are difficult to obtain. We determined the diapycnal nutrient fluxes across the benthic boundary layer at the OMZs off Peru and Mauritania using nutrient concentration profiles and vertical diffusion coefficients derived from 224Ra/223Ra isotope ratios. The radium isotopes 223Ra (half-life: 11.4 days) and 224Ra (half-life: 3.66 days) are produced in sediments by radioactive decay of 227Th and 228Th ,respectively: Diffusion of radium out of the sediments results in gradients of 224Ra/223Ra above the sediments; and these gradients may be used to estimate vertical diffusion coefficients. We determined 224Ra/223Ra along two transects at the continental slopes off Peru (12° S) and off Mauritania (18° N) in water depths between 65m - 1000mand 53m - 1100m, respectively. For the 223Ra/224Ra sampling we used acrylic fibers/cartridges coated with MnO2. The Mn-fibers were attached to benthic landers (moored for ~ 24 hours at the sea floor) and the Mn-cartridges were placed in series on several in-situ filtration pumps (Challenger Oceanic and McLane pumps). 223Ra and 224Ra were measured on-board using a delayed coincidence counting system (RaDeCC). In our presentation we will present the 224Ra/223Ra distribution along these transects investigated and we will compare the diapycnal radium-derived nutrient fluxes with those determined using benthic chambers and microstructure measurements.

  13. Canino mandibular con dos raíces

    Directory of Open Access Journals (Sweden)

    Laura Ricardina Ramírez-Sotelo

    Full Text Available El canino inferior es un diente con raíz larga y ancha que le permite una adecuada implantación en el arco dentario. Es considerado un pilar valioso en muchos tratamientos rehabilitadores. Con la finalidad de mantener este elemento dentario es necesario realizar un correcto diagnóstico, para lo que se tendrá en cuenta el conocimiento de las variaciones anatómicas. El objetivo del artículo es presentar un caso de canino mandibular con dos raíces con sus respectivos canales radiculares .Paciente femenina de 21 años, que acudió a la Clínica de Radiología de la Facultad de Odontología de Piracicaba con indicación de una radiografía panorámica para valorar cirugía de terceros molares. Llamó la atención una configuración inusual de las raíces de los caninos mandibulares. En el examen de tomografía computarizada de haz cónico se observó que el canino mandibular del lado derecho presentaba dos raíces separadas, cada una con sus respectivos canales radiculares. Se concluyó que a pesar de la baja prevalencia de las variaciones anatómicas, estas pueden ocurrir en el número de raíces y canales de los caninos mandibulares, tal como se presenta en este reporte de caso.

  14. Improved limit on the 225Ra electric dipole moment

    Science.gov (United States)

    Bishof, Michael; Parker, Richard H.; Bailey, Kevin G.; Greene, John P.; Holt, Roy J.; Kalita, Mukut R.; Korsch, Wolfgang; Lemke, Nathan D.; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Thomas P.; Singh, Jaideep T.; Dietrich, Matthew R.

    2016-08-01

    Background: Octupole-deformed nuclei, such as that of 225Ra, are expected to amplify observable atomic electric dipole moments (EDMs) that arise from time-reversal and parity-violating interactions in the nuclear medium. In 2015 we reported the first "proof-of-principle" measurement of the 225Ra atomic EDM. Purpose: This work reports on the first of several experimental upgrades to improve the statistical sensitivity of our 225Ra EDM measurements by orders of magnitude and evaluates systematic effects that contribute to current and future levels of experimental sensitivity. Method: Laser-cooled and trapped 225Ra atoms are held between two high-voltage electrodes in an ultrahigh-vacuum chamber at the center of a magnetically-shielded environment. We observe Larmor precession in a uniform magnetic field using nuclear-spin-dependent laser light scattering and look for a phase shift proportional to the applied electric field, which indicates the existence of an EDM. The main improvement to our measurement technique is an order-of-magnitude increase in spin-precession time, which is enabled by an improved vacuum system and a reduction in trap-induced heating. Results: We have measured the 225Ra atomic EDM to be less than 1.4 ×10-23e cm (95 % confidence upper limit), which is a factor of 36 improvement over our previous result. Conclusions: Our evaluation of systematic effects shows that this measurement is completely limited by statistical uncertainty. Combining this measurement technique with planned experimental upgrades, we project a statistical sensitivity at the 1 ×10-28e cm level and a total systematic uncertainty at the 4 ×10-29e cm level.

  15. Determination of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb in mushroom from a naturally high radioactive region

    Energy Technology Data Exchange (ETDEWEB)

    Rosa, Mychelle M.L.; Custodio, Luis Gustavo; Cheberle, Luan T.V.; Taddei, Maria Helena T., E-mail: mychelle@cnen.gov.br, E-mail: lgcustodio@hotmail.com, E-mail: lt.cheberle@bol.com.br, E-mail: mhtaddei@cnen.gov.br [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas; Maihara, Vera A., E-mail: vmaihara@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (CNEN/IPEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Many studies have shown that mushrooms are organisms which efficiently accumulate radionuclides and can be used as indicators of environmental contamination and ecosystem quality. The Pocos de Caldas plateau, in Minas Gerais, is a region that has elevated natural radioactivity due to the presence of radiological anomalies of volcanic origin. Seventy areas of radioactive anomalies have been identified in this region. From the radiological point of view the determination of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb is relevant because they are decay products of the natural series of {sup 238}U and {sup 232}Th, mainly responsible for natural radioactive exposures of man. The present paper is part of a broader study conducted in the Pocos de Caldas plateau, in which the concentration activities of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb in mushroom samples were determined. The mushrooms were collected at different points of the plateau under the influence of radioactive anomalies and away from the influence of anomalies. From statistical studies a correlation between the accumulation of radionuclides in mushrooms and anomalies was established and it was possible to confirm the efficiency that the mushrooms present as environmental contamination indicators. (author)

  16. Inventory of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in marine sediments cores of Southwest Atlantic Ocean

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Alice M.R.; Oliveira, Joselene de, E-mail: alice.costa@usp.br, E-mail: jolivei@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Gerencia de Metrologia das Radiacoes. Lab. de Radiometria Ambiental; Figueira, Rubens C.L.; Mahiques, Michel M.; Sousa, Silvia H.M., E-mail: rfigueira@usp.br, E-mail: mahiques@usp.br, E-mail: smsousa@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Instituto Oceanografico

    2015-07-01

    {sup 210}Pb (22.3 y) is a radioactive isotope successfully applied as tracer of sediment dating of the last 100-150 years. The application of {sup 226}Ra and {sup 228}Ra as paleoceanographic tracers (half-lives of 1,600 y and 5.7 y, respectively) also gives some information of ocean's role in past climate change. In this work, it was analyzed 2 sediment cores collect at Southwest Atlantic Ocean. The sediments samples were freeze-dried and acid digested in microwave. It was carried out a radiochemical separation of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb and performed a gross alpha and gross beta measurement of both precipitates Ba(Ra)SO{sub 4} and PbCrO{sub 4} in a low background gas-flow proportional counter. Activity concentrations of {sup 226}Ra ranged from 45 Bq kg{sup -1} to 70 Bq kg{sup -1} in NAP-62 and from 57 Bq kg{sup -1} to 82 Bq kg{sup -1} in NAP-63 samples. The concentration of {sup 228}Ra varied between 37 Bq kg{sup -1} and 150 Bq kg{sup -1} in NAP-62 and between 23 Bq kg{sup -1} and 111 Bq kg{sup -1} in NAP-63 samples. The concentration of total {sup 210}Pb ranged from 126 Bq kg{sup -1} to 256 Bq kg{sup -1} in NAP-62 and from 63 Bq kg{sup -1} to 945 Bq kg{sup -1} in NAP-63 samples. Results of {sup 210}Pb{sub uns} varied from 68 Bq kg{sup -1} to 192 Bq kg{sup -1} for NAP-62, while varied from <4.9 Bq kg{sup -1} to 870 Bq kg{sup -1} in NAP-63 profile. Increased values of {sup 210}Pb{sub uns} were found on the top of both NAP-62 and NAP- 63 sediment profile. (author)

  17. Radiation exposure of relatives of patients treated with Ra-223 dichloride; Strahlenexposition von Angehoerigen bei Therapie mit Ra-223-Dichlorid

    Energy Technology Data Exchange (ETDEWEB)

    Wanke, C.; Szermerski, B.; Solle, A.; Geworski, L. [Medizinische Hochschule Hannover (Germany). Stabsstelle Strahlenschutz und Abt. Medizinische Physik; Pinkert, J. [Bayer Vital GmbH, Leverkusen (Germany); Kranert, W.T. [Frankfurt Univ. (Germany). Klinik fuer Nuklearmedizin; Andreeff, M. [Universitaetsklinikum ' ' Carl Gustav Carus' ' TU Dresden (Germany). Klinik fuer Nuklearmedizin

    2015-07-01

    Since November 2013, a radiopharmaceutical containing Ra-223 dichloride as active substance is approved in the European Union for patients with castration resistant prostate cancer with symptomatic bone metastases and no known visceral metastases. Ra-223 (T{sub 1/2} = 11.43 d) decays via a chain of 4 alpha and 2 beta decays. This therapy is presently the only application of an alpha emitter in clinical routine therapy. To show that the exposure of relatives and caregivers of patients treated with Ra-223 dichloride in an outpatient setting does not exceed a value of 1 mSv, the multicenter study ''RAPSODY'' was conducted. As Ra-223 and most of its progeny emit alpha particles, the internal exposure had to be evaluated in particular. Within this study, measurements of the radiation emitted from the patient were performed using standard dose-rate meters. Wipe-tests were taken in the patients' homes to identify significant contaminations and evaluated by liquid scintillation counting. Samples of saliva and sweat were taken and measured using gamma spectrometry. Ra-223 disintegrates to the noble gas Rn-219 and was measured in the exhaled breath from the patients using conventional Radon Monitors. Furthermore, a computational fluid dynamics simulation (CFD) was performed to assess the radioactivity in the air, which could be inhaled by persons close to the patient. Conclusions: The potential exposure of relatives and caregivers by external irradiation and incorporation of radioactivity exhaled or excreted by the patient with saliva or sweat is well below 1 mSv. No objections are seen regarding outpatient treatment. This paper summarizes contents of a poster presented at the Annual Meeting of the Society of Nuclear Medicine and Molecular Imaging.

  18. Measurement of 223Ra and 224Ra via RaDeCC and its application at Liaohe River Estuary%辽河口水体中223Ra、224Ra的RaDeCC法测定及应用

    Institute of Scientific and Technical Information of China (English)

    许博超; 姚庆祯; 江雪艳; 于志刚

    2012-01-01

    介绍了同步延时计数法,并应用其对辽河口水体中的223 Ra和224 Ra进行了测定,结合pH、DO、COD、叶绿素、营养盐等参数对223 Ra和224 Ra的放射性活度及其比值随盐度的变化和影响因素进行了讨论,继而以“镭同位素表观年龄模型”计算了辽河口水体的停留时间.结果表明:2010年4月,辽河口调查水域水体中的224 Ra、223 Ra随盐度变化趋势不保守,在盐度为10和26的海域出现了放射性活度高峰值,可能分别由悬浮颗粒物解吸和滨岸咸化的地下水排放等因素造成.水体停留时间随着离开河口距离的增大而增大,最大值出现在盐度为14的海域,达到8.34 d.%Radium delayed coincidence countering system has become the state-of-the-art technique for short-lived radium isotopes (223Ra, 224Ra) measurement. In this paper, we described this system, and used it to measure 223Ra, 224Ra activities at the Liaohe River Estuary. Other parameters, like pH, DO, COD, petroleum hydrocarbon, chlorophyll and nutrients, were used to demonstrate the distribution and impact factors of isotopes activity and ratio versus salinity. Furthermore, the "Apparent Radium Age" model was applied to assess the water residence time at this area. Ra and Ra were not conservative with salinity at the studying area in A-pril, 2010. Two peak activities at salinity 10 and 26 were caused by suspended particles desorption and submarine groundwater discharge , respectively. Water residence time increased with the distance. The oldest age was 8. 34 days at the area with salinity of 14.

  19. Visible light induced degradation of methyl orange using β-Ag0.333V2O5 nanorod catalysts by facile thermal decomposition method

    Directory of Open Access Journals (Sweden)

    R. Saravanan

    2015-09-01

    Full Text Available One dimensional nanorods of β-Ag0.333V2O5 have been synthesized by facile thermal decomposition method without using any additives. The prepared sample was characterized by different physical and chemical techniques such as XRD, FE-SEM, TEM, DRS and XPS. The photocatalytic activity of β-Ag0.333V2O5 catalyst was investigated by studying the degradation of methyl orange (MO in aqueous medium under visible light exposure. The result shows β-Ag0.333V2O5 exhibits outstanding photocatalytic activity under visible light illumination.

  20. Most přes Račí potok

    OpenAIRE

    Novotný, Matěj

    2014-01-01

    Bakalářská práce řeší most na komunikaci I/60 přes Račí potok. Konstrukce je navrhovaná ve třech variantách. Vybraná byla předpjatá desková konstrukce délky 18,2 metrů uvažovaná jako prostý nosník. Výpočet zatížení je proveden programem SCIA. Konstrukce je posuzována podle platných norem. The Bachelor thesis deals with the road bridge on tfe road I/60 across the "Račí" brook. Construction is proposed in three variants. The selected design was prestressed board length18,2 meters, intended a...

  1. Nuclear structure of 216Ra at high spin

    Indian Academy of Sciences (India)

    S Muralithar; G Rodrigues; R P Singh; R K Bhowmik; P Mukherjee; B Sethi; I Mukherjee

    2012-09-01

    High-spin states of 216Ra ( = 88, = 128) have been investigated through 209Bi(10B, 3n) reaction at an incident beam energy of 55 MeV and 209Bi(11B, 4n) reaction at incident beam energies ranging from 65 to 78 MeV. Based on coincidence data, the level scheme for 216Ra has been considerably extended up to $∼ 33\\hbar$ spin and 7.2 MeV excitation energy in the present experiment with placement of 28 new -transitions over what has been reported earlier. Tentative spin-parity assignments are done for the newly proposed levels on the basis of the DCO ratios corresponding to strong gates. Empirical shell model calculations were carried out to provide an understanding of the underlying nuclear structure.

  2. Enrichment of Vitamin D response elements in RA associated loci supports a role for vitamin D in the pathogenesis of RA

    Science.gov (United States)

    Yarwood, Annie; Martin, Paul; Bowes, John; Lunt, Mark; Worthington, Jane; Barton, Anne; Eyre, Steve

    2013-01-01

    The aim of this study was to explore the role of vitamin-D in rheumatoid arthritis (RA) pathogenesis by investigating enrichment of vitamin-D response elements (VDREs) in confirmed RA susceptibility loci and testing variants associated with vitamin-D levels for association with RA. Bioinformatically, VDRE genomic positions were overlaid with non HLA confirmed RA susceptibility regions. The number of VDREs at RA loci was compared to a randomly selected set of genomic loci to calculate an average relative risk (RR). SNPs in the DHCR7/NADSYN1 and CYP2R1 loci, previously associated with circulating vitamin-D levels, were tested in UK RA cases (n = 3870) and controls (n = 8430). Significant enrichment of VDREs was seen at RA loci (p=9.23×10−8) when regions were defined either by gene (RR 5.50) or position (RR 5.86). SNPs in the DHCR7/NADSYN1 locus showed evidence of positive association with RA, rs4944076 (p=0.008, OR 1.14 95% CI 1.03-1.24). The significant enrichment of VDREs at RA associated loci and the modest association of variants in loci controlling levels of circulating vitamin-D, supports the hypothesis that vitamin-D plays a role in the development of RA. PMID:23636220

  3. Characterization of the CpxRA regulon in Haemophilus ducreyi.

    Science.gov (United States)

    Labandeira-Rey, Maria; Brautigam, Chad A; Hansen, Eric J

    2010-11-01

    The Haemophilus ducreyi 35000HP genome encodes a homolog of the CpxRA two-component cell envelope stress response system originally characterized in Escherichia coli. CpxR, the cytoplasmic response regulator, was shown previously to be involved in repression of the expression of the lspB-lspA2 operon (M. Labandeira-Rey, J. R. Mock, and E. J. Hansen, Infect. Immun. 77:3402-3411, 2009). In the present study, the H. ducreyi CpxR and CpxA proteins were shown to closely resemble those of other well-studied bacterial species. A cpxA deletion mutant and a CpxR-overexpressing strain were used to explore the extent of the CpxRA regulon. DNA microarray and real-time reverse transcriptase (RT) PCR analyses indicated several potential regulatory targets for the H. ducreyi CpxRA two-component regulatory system. Electrophoretic mobility shift assays (EMSAs) were used to prove that H. ducreyi CpxR interacted with the promoter regions of genes encoding both known and putative virulence factors of H. ducreyi, including the lspB-lspA2 operon, the flp operon, and dsrA. Interestingly, the use of EMSAs also indicated that H. ducreyi CpxR did not bind to the promoter regions of several genes predicted to encode factors involved in the cell envelope stress response. Taken together, these data suggest that the CpxRA system in H. ducreyi, in contrast to that in E. coli, may be involved primarily in controlling expression of genes not involved in the cell envelope stress response.

  4. LoRa for the Internet of Things

    OpenAIRE

    Bor, Martin; Vidler, John Edward; Roedig, Utz

    2016-01-01

    New transceiver technologies have emerged which enable power efficient communication over very long distances. Examples of such Low-Power Wide-Area Network (LPWAN)technologies are LoRa, Sigfox and Weightless. A typicalapplication scenario for these technologies is city wide meter reading collection where devices send readings at very low frequency over a long distance to a data concentrator (one-hop networks). We argue that these transceiversare potentially very useful to construct more gener...

  5. Treatment of ankylosing spondylitis with [{sup 224}Ra]-Radiumchloride; Therapie der Spondylitis ankylosans mit [{sup 224}Ra]-Radiumchlorid

    Energy Technology Data Exchange (ETDEWEB)

    Reiners, C. [Klinik und Poliklinik fuer Nuklearmedizin der Univ. Wuerzburg (Germany); Braun, J. [Rheumazentrum Ruhrgebiet Herne (Germany)

    2001-07-01

    Ankylosing spondylitis (AS) is a chronic disease which in 30-50% of the patients leads to considerable episodes of pain, a remarkable reduction of quality of life and disablement. For treatment mostly nonsteroidal antiphlogistic drugs are used which are able to reduce pain in approximately 80% of the patients only. Those drugs however, have to be withdrawn in approximately 30% of the patients due to its known toxicity (mainly in the gastrointestinal tract). Basis medication (DMARDs) is helpful in a minority of AS patients only. Recently [{sup 224}Ra]-Radiumchloride, which has been used previously between 1955 and 1990, has been made available again for treatment of AS. Whereas biokinetics, radiation exposure and the risk-profile of [{sup 224}Ra]-Radiumchloride are documented well by experimental and clinical data, most of the historical studies about the efficacy of this radiopharmaceutical do not fulfill the requirements of modern therapy studies. Therefore as many patients as possible should be recruited for a prospective long-time Phase IV study. A close and well-coordinated cooperation between rheumatologists and nuclear medicine physicians is needed, when [{sup 224}Ra]-Radiumchloride is used for treatment of AS. (orig.) [German] Die meist chronisch, oft auch in Schueben verlaufende Spondylitis ankylosans (AS) fuehrt bei 30-50% der Patienten zu betraechtlichen Schmerzen und einer nicht selten erheblichen Einschraenkung der Lebensqualitaet und Behinderung. Die am haeufigsten zur Therapie verwendeten nichtsteroidalen Antiphlogistika koennen nur bei etwa 80% der Patienten die Schmerzen lindern. Allerdings muessen diese Medikamente bei 20-30% der AS-Patienten wegen ihrer bekannten Toxizitaet - vor allem im Gastrointestinaltrakt - abgesetzt werden. Basistherapeutika (DMARDs) helfen bei der AS nur sehr begrenzt. Mit [{sup 224}Ra]-Radiumchlorid steht seit kurzem ein bereits in den Jahren 1945-1990 fuer die Behandlung der AS verwendetes Radiopharmakon wieder zur

  6. Octupole collectivity in $^{220}$Rn and $^{224}$Ra

    CERN Document Server

    Gaffney, Liam Paul

    Collective properties of the radioactive nuclei $^{220}$Rn and $^{224}$Ra have been studied via Coulomb excitation of a 2.8$\\,$A.MeV radioactive ion beam (RIB) incident upon $^{60}$Ni, $^{112,114}$Cd and $^{120}$Sn targets. The experiments took place at the REX-ISOLDE RIB facility, CERN. De-excitation $\\gamma$-ray yields following multiple-step Coulomb excitation were detected in coincidence with recoiling target nuclei in the Miniball spectrometer. For the first time, B(E3;3$^+ \\rightarrow 0^+$) values have been directly measured with a radioactive ion beam. In the process, $^{224}$Ra becomes the heaviest post-accelerated RIB to date at ISOLDE (with the possible exception of the quasi-stable $^{238}$U). The measurements presented in this thesis represent a tripling of the number of nuclei around Z$\\simeq88$ and N$\\simeq134$, for which direct measurements of the octupole collectivity have been performed. The only previous measurements being for the relatively long-lived $^{226}$Ra. The $\\gamma$-ray yields, in...

  7. 223Ra levels fed in the 223Fr β decay

    Science.gov (United States)

    Abdul-Hadi, A.; Barci, V.; Weiss, B.; Maria, H.; Ardisson, G.; Hussonnois, M.; Constantinescu, O.

    1993-01-01

    The 223Fr β decay was reinvestigated using high-resolution single γ spectrometry as well as γ-γ coincidence techniques. For single γ-spectra measurements, radiochemically pure 223Fr sources were obtained by chromatographic separation from a 75 MBq activity 227Ac parent source and continuously purified of 223Ra and daughters. The analysis of the γ spectra of 30 sources showed the existence of 131 γ lines, of which 87 are reported for the first time in the 223Fr β decay although many of them are observed following the 227Th α decay. The 223Fr half-life was remeasured and found to be T1/2=22.00+/-0.07 min. γ-γ-t coincidence measurements were also carried out with 223Fr purified sources. The 223Ra level scheme was built on the basis of our γ data, as well as 227Th α-decay data. Among the 32 excited 223Ra levels, of which 22 were also known from 227Th α decay, 13 are newly reported from 223Fr β decay. Low energy levels (E<400 keV) may be classified as parity doublet bands according to the predictions of the reflection asymmetric rotor model. Above a 700 keV gap, a coexistence of symmetric and asymmetric shapes including both static and dynamic octupole correlations is suggested.

  8. Trapping of short lived Ra{sup +} ions

    Energy Technology Data Exchange (ETDEWEB)

    Bekker, H.; Nunes Portela, M.; Seelen, D.; Dermois, O.; Jungmann, K.; Onderwater, C.J.G.; Timmermans, R.G.E.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen, NL (Germany)

    2012-07-01

    A precision measurement of atomic parity violation in order to determine electroweak mixing angle at low energy scale is underway at the KVI, University of Groningen. The experiment exploits the large sensitivity of a single trapped Ra{sup +} ion. It requires the trapping of short lived radium ions in a Paul trap. Our first laser spectroscopy on an ensemble of trapped short-lived {sup 209-214}Ra{sup +} isotopes employed buffer gas cooled ions in a linear Paul trap. It provided hyperfine structure of the 6d {sup 2}D{sub 3/2} states and isotope shift of the 6d {sup 2}D{sub 3/2}-7p {sup 2}P{sub 1/2} transition. In a next step the buffer gas cooled Ra ions are extracted from the trap and transported in an electrostatic transport system towards a small Paul trap in an UHV environment. Here the ion can be cooled and subsequently microwave transitions between hyperfine states in the 6d {sup 2}D{sub 3/2} manifold can be driven in order to yield high precision results on the hyperfine constants. These results provide input for the ongoing precision atomic structure calculations.

  9. Raízes e estruturas da sociedade brasileira

    Directory of Open Access Journals (Sweden)

    Leonor Natividade de Campos Medeiros

    2014-05-01

    Full Text Available Este estudo teve como objetivo conhecer e refletir as raízes e estruturas da sociedade brasileira, na visão de dois grandes pensadores: Sérgio Buarque de Holanda com Raízes do Brasil e Gilberto Freyre com Casa-Grande & Senzala. Holanda dividiu o Brasil em duas fases a primeira da colonização portuguesa e a segunda uma critica ao Estado Novo. Freyre mostra a organização social, política e econômica da época da colonização e desenvolve seus estudos ao final da década de 1920, época em que o ambiente intelectual brasileiro está sob a força do modernismo. Conclui-se que o pensamento de Holanda e Freyre se assemelha em alguns aspectos e diverge em outros.   Sociologia de Freyre; Sociologia de Holanda; Raízes da sociedade brasileira

  10. An improved limit on the EDM of 225 Ra

    Science.gov (United States)

    Bishof, Michael; Bailey, Kevin; Dietrich, Matthew R.; Greene, John P.; Holt, Roy J.; Kalita, Mukut R.; Korsch, Wolfgang; Lemke, Nathan D.; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Thomas P.; Parker, Richard H.; Rabga, Tenzin; Singh, Jaideep T.

    2016-05-01

    Searches for permanent electric dipole moments (EDMs) are sensitive probes of symmetry violation that could explain the dominance of matter over anti-matter. The 225 Ra (t1/2 = 15 days, I = 1/2) atom is a particularly attractive system to use for an EDM measurement because its octupole-deformed nucleus, closely spaced ground-state parity doublet, and large nuclear charge make 225 Ra uniquely sensitive to symmetry-violating interactions in the nuclear medium. In 2015, we reported the first ``proof of principle'' measurement of the 225 Ra EDM, giving a 95% confidence upper limit of 5* 10-22 e-cm; representing the first EDM measurement using laser-trapped atoms as well as the first EDM measurement of an atom with an octupole-deformed nucleus. After implementing upgrades to our apparatus, we now observe nuclear spin coherence after 20 s of free evolution - a factor of ten improvement. A new EDM measurement based on the upgraded system improved the 95% confidence upper limit by a factor of 36. We also report on the progress of current experimental upgrades that have the potential to further improve our EDM sensitivity by many orders of magnitude, allowing us to test symmetry violation at an unprecedented level. This work is supported by U.S. DOE, Office of Science, Office of Nuclear Physics, under Contract DE-AC02-06CH11357.

  11. Synthesis of poly[methyl(3,3,3-trinuoropropyl)siloxane]b-poly(ethylene oxide)block copolymers

    Institute of Scientific and Technical Information of China (English)

    Xiao-li ZHAN; Bi CHEN; Qing-hua ZHANG; Ling-min YI; Bo JIANG; Feng-qiu CHEN

    2008-01-01

    A series of new amphiphilic poly[methyl(3,3,3-trifluoropropyl)siloxane]-b -poly(ethylene oxide)(PMTFPS-b-PEO)diblock copolymers with different ratios of hydrophobic segment to hydrophilic segment were prepared by coupling reactions of end-functional PMTFPS and PEO homopolymers.Copolymers were shown to be well defined and narrow molecular weight distribution(MWD)(1.07~1.3)by characterizations such as gel permeation chromatography(GPC)and 1H-nudear magnetic resonance(1H-NMR).

  12. Doses from {sup 222}Rn, {sup 226}Ra, and {sup 228}Ra in groundwater from Guarani aquifer, South America

    Energy Technology Data Exchange (ETDEWEB)

    Bonotto, D.M. E-mail: dbonotto@rc.unesp.br

    2004-07-01

    Groundwater samples were analysed for {sup 222}Rn, {sup 226}Ra, and {sup 228}Ra in Guarani aquifer spreading around 1 million km{sup 2} within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay.

  13. Possibility of rapidly reporting 226Ra activity in 226Ra-222Rn samples with unknown equilibrium factor by γ spectrometer

    Institute of Scientific and Technical Information of China (English)

    SU Qiong; ZHENG Rui; CHEN Yong; CHENG Jian-Ping

    2004-01-01

    This paper reports the observed changes for equilibrium factors between 226Ra and 222Rn with sealing time of the samples. The samples include soil, raw coal, mineral water, cement, rock, etc. Especially the conceptions of "pre-equilibrium time" and "pre-equilibrium factor" have been put forward and methods of measuring and processing data have been given which can be used for rapidly reporting activity of 226Ra in samples with unknown equilibrium factor. It is definitely concluded that, using methods given in the paper, a test report will be completed in 3~7days, instead of one month, after receiving the sample whose activity is not lower than LLD of the spectrometer.

  14. U-Th-Ra disequilibria at the Masaya (Nicaragua); Desequilibres U-Th-Ra au Masaya (Nicaragua)

    Energy Technology Data Exchange (ETDEWEB)

    Sigmarsson, O.; Condomines, M. [Centre de Recherches Volcanologiques, CNRS URA-10, 63 - Clermont Ferrand (France)

    1996-12-31

    {sup 238}U-{sup 230}Th-{sup 226}Ra radioactive disequilibria were measured in several basalt samples of the post-caldera flows of the Masaya volcano (Nicaragua). {sup 230}Th/{sup 232}Th ratios are from the highest known in the world (about 2.53) with {sup 230}Th/{sup 238}U ratios close to 1. These exceptionally high isotopic thorium ratios from the Masaya and other neighboring volcanoes (Conception, Cerro Negro, Momotombo) are followed by very high {sup 10}Be/{sup 9}Be ratios (60 10{sup -11} for the 1722 flow). These geochemical characteristics with {delta}{sup 18}O of typical mantle origin (5.55) suggest an influence of the subducted sediments fluids in the magma source. The age of the metasomatism ranges from 10 to 0.3 Ma. Initial {sup 226}Ra/{sup 230}Th ratios measured in four historical flows vary from 1.3 to 1.4 and are anti-correlated with the Th content. These variations are probably linked to the fractionated crystallisation of plagioclase minerals. The initial {sup 226}Ra/Ba ratio remains constant and suggests the existence of a huge stationary magmatic reservoir. This hypothesis is also confirmed by the disproportion between the SO{sub 2} quantity emitted by the volcano and by the degassing of lavas on the ground. The {sup 226}Ra excess observed in the Masaya lavas can be the result of a second stage of metasomatism which occurred less than 8000 years B.P. during partial fusion. Abstract only. (J.S.).

  15. An evaluation of ²²⁶Ra and ²²⁸Ra in drinking water in several counties in Texas, USA.

    Science.gov (United States)

    Landsberger, S G; George, G

    2013-11-01

    Naturally Occurring Radioactive Material (NORM) or Technology Enhanced Naturally Occurring Radioactive Material (TENORM) can be a potential health risk. It is now well known that the underlying geology in many parts of Texas has given rise to levels of (226)Ra and (228)Ra that often exceed the limits set by the US Environmental Protection Agency. A detailed literature search was undertaken to assess the levels of (226)Ra and (228)Ra in all of the Texas counties. Several statistical evaluations of the data were performed. The Hickory aquifer in the Llano Uplift region of Texas has consistently had the highest number of (226)Ra and (228)Ra concentrations above the legal limit. As well many of the affected rural communities may not have the financial resources to rectify the problem.

  16. Radiochemical determination and separation or total radium, 226Ra and 224Ra; Analisis Radioquimico de Radio total, Radio-226 y Radio-224

    Energy Technology Data Exchange (ETDEWEB)

    Suarez, J. A.; Gonzalez, J. A.; Pablo, M. A. de

    1987-07-01

    Radiochemical purification and separation of radium has been carried out and the determination of total radium solubilized in aqueous samples has been studied assuming that all the alpha emitters of the sample have their origin in the 226Ra and elements of its desintegration chain. Also, the activities of 22Ra and 226 Ra have been evaluated separately doing a measurement after the chemical separation of the radium and another one 10 days after. (Author) 9 refs.

  17. Determination of Ra natural isotopes in marine samples from Itamaraca coastal regions; Determinacao de isotopos naturais de Ra em amostras costeiras da regiao de Itamaraca (PE)

    Energy Technology Data Exchange (ETDEWEB)

    Silveira, Patricia B.; Valentim, Eliane; Lima, Ricardo A. [Centro Regional de Ciencias Nucleares (CRCN), Recife, PE (Brazil)]. E-mail: pbrandao@cnen.gov.br; Medeiros, Carmem [Pernambuco Univ., Recife, PE (Brazil). Dept. de Oceanografia; Oliveira, Joselene [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    2005-07-01

    Groundwater plays an important role in the transport of nutrients and pollutants to the coastal marine environment s and other surfaces water. Concentrations of {sup 223}Ra, {sup 224}Ra and {sup 226}Ra in marine water of the Itamaraca coastal region, PE, were measured during the winter of 2004, aiming to investigate the presence of radionuclides as a tracer of submarine groundwater discharges (SGD) in the environment studied. Measurements of temperature, salinity and nutrients were also carried out. (author)

  18. Selective extraction of naturally occurring radioactive Ra2+ from aqueous waste streams

    NARCIS (Netherlands)

    van Leeuwen, F.W.B.

    2005-01-01

    This thesis describes the design and selectivity of new Ra2+ extractants. The results presented provide insight in both the requirements needed to give Ra2+ selectivity and in the achievable Ra2+/Mn+ (Mn+ = alkali(ne earth) cation) separations.

  19. Extraordinary Diversity of Immune Response Proteins among Sea Urchins: Nickel-Isolated Sp185/333 Proteins Show Broad Variations in Size and Charge.

    Science.gov (United States)

    Sherman, Lauren S; Schrankel, Catherine S; Brown, Kristy J; Smith, L Courtney

    2015-01-01

    Effective protection against pathogens requires the host to produce a wide range of immune effector proteins. The Sp185/333 gene family, which is expressed by the California purple sea urchin Strongylocentrotus purpuratus in response to bacterial infection, encodes a highly diverse repertoire of anti-pathogen proteins. A subset of these proteins can be isolated by affinity to metal ions based on multiple histidines, resulting in one to four bands of unique molecular weight on standard Western blots, which vary depending on the individual sea urchin. Two dimensional gel electrophoresis (2DE) of nickel-isolated protein samples followed by Western blot was employed to detect nickel-isolated Sp185/333 (Ni-Sp185/333) proteins and to evaluate protein diversity in animals before and after immune challenge with marine bacteria. Ni-Sp185/333 proteins of the same molecular weight on standard Western blots appear as a broad complex of variants that differ in pI on 2DE Western blots. The Ni-Sp185/333 protein repertoire is variable among animals, and shows a variety of changes among individual sea urchins in response to immune challenges with both the same and different species of bacteria. The extraordinary diversity of the Ni-Sp185/333 proteins may provide significant anti-pathogen capabilities for sea urchins that survive solely on innate immunity.

  20. Extraordinary Diversity of Immune Response Proteins among Sea Urchins: Nickel-Isolated Sp185/333 Proteins Show Broad Variations in Size and Charge

    Science.gov (United States)

    Sherman, Lauren S.; Schrankel, Catherine S.; Brown, Kristy J.; Smith, L. Courtney

    2015-01-01

    Effective protection against pathogens requires the host to produce a wide range of immune effector proteins. The Sp185/333 gene family, which is expressed by the California purple sea urchin Strongylocentrotus purpuratus in response to bacterial infection, encodes a highly diverse repertoire of anti-pathogen proteins. A subset of these proteins can be isolated by affinity to metal ions based on multiple histidines, resulting in one to four bands of unique molecular weight on standard Western blots, which vary depending on the individual sea urchin. Two dimensional gel electrophoresis (2DE) of nickel-isolated protein samples followed by Western blot was employed to detect nickel-isolated Sp185/333 (Ni-Sp185/333) proteins and to evaluate protein diversity in animals before and after immune challenge with marine bacteria. Ni-Sp185/333 proteins of the same molecular weight on standard Western blots appear as a broad complex of variants that differ in pI on 2DE Western blots. The Ni-Sp185/333 protein repertoire is variable among animals, and shows a variety of changes among individual sea urchins in response to immune challenges with both the same and different species of bacteria. The extraordinary diversity of the Ni-Sp185/333 proteins may provide significant anti-pathogen capabilities for sea urchins that survive solely on innate immunity. PMID:26406912

  1. 226Ra or 226Ra/Ba dating of Holocene volcanic rocks: application to Mt. Etna and Merapi volcanoes

    Science.gov (United States)

    Condomines, M.; Gauthier, P. J.; Tanguy, J. C.; Gertisser, R.; Thouret, J. C.; Berthommier, P.; Camus, G.

    2005-02-01

    This paper shows how 226Ra- 230Th disequilibria can be used to date Holocene volcanic rocks from some well selected volcanoes. A systematic study of these disequilibria on historical or well-dated volcanic samples is indeed first required to test the applicability of this method. Two examples are described here to illustrate its potential. In the case of Mt. Etna, the good correlation observed between ( 226Ra) 0 activities at the time of eruption and Th contents in lava flows from the last two millennia [M. Condomines, J.C. Tanguy, V. Michaud, Magma dynamics at Mt. Etna: constraints from U-Th-Ra-Pb radioactive disequilibria and Sr isotopes in historical lavas, Earth Planet. Sci. Lett. 132 (1995) 25-41] is used to infer the ages of several newly analysed lava flows. The calculated ages are in good agreement with those deduced from the archaeomagnetic curve describing the variation of the geomagnetic field direction in southern Italy [J.C. Tanguy, I. Bucur, J.F.C. Thompson, Geomagnetic secular variation in Sicily and revised ages of historic lavas from Mt. Etna, Nature 318 (1985) 453-455, J.C. Tanguy, M. Le Goff, V. Chillemi, A. Paiotti, C. Principe, S. La Delfa, G. Patane, Variation séculaire de la direction du champ géomagnétique enregistrée par les laves de l'Etna et du Vésuve pendant les deux derniers millénaires, C. R. Acad. Sci. Paris 329 (1999) 557-564, J.C. Tanguy, M. Le Goff, C. Principe, S. Arrighi, V. Chillemi, A. Paiotti, S. La Delfa, G. Patane, Archaeomagnetic dating of Mediterranean volcanics of the last 2100 years: validity and limits. Earth Planet. Sci. Lett. 211 (2003) 111-124]. We also present a whole set of new U-series data on historical, recent, and older samples from Merapi (Indonesia), and show that the ( 226Ra)/Ba ratio has probably maintained a quasi-steady state value during at least the past four millennia, and can be used to infer the ( 226Ra) 0/Ba ratio of old volcanics at the time of eruption, and thus their ages. Comparison with

  2. The analysis of serum specific allergen test results among 333 cases of children’s with allergic diseases%333例儿童血清特异性过敏原检测结果分析

    Institute of Scientific and Technical Information of China (English)

    陈铮铮; 吴潇; 虞国其

    2014-01-01

    To determine the allergen of the children in different age groups with allergic diseases in Tongxiang re-gion .[Method] 20 allergen specific IgE (10 kinds of common inhalation allergens and common food allergens ) and total IgE were determined in 333 children with allergic diseases .[Result] The positive rate of total IgE was 65 .2% .The highest positive rate of slgE tested inhalation allergens was dust mites group (47 .6% ) .The highest positive rate of slgE tested food allergens was egg white (30 .5% ) .The highest positive rate of inhalation allergens was 7 14 years old age group (46 .2% ) .[Conclu-sion] Dust mites group was the main inhalant allergens ,and egg white was the main food allergens .Positive rate of allergen was different in different age group of allergic diseases children .%目的:了解本地区不同年龄段过敏性疾病儿童过敏原的致敏情况。方法:对333例患儿进行10种常见吸入性和10种常见食入性过敏原特异性IgE (slgE )和总IgE抗体检测。结果:333例过敏性疾病儿童总IgE检出率为65.2%。吸入性过敏原最高为尘螨组合,占阳性例数的47.6%。食入组最高为鸡蛋白,占阳性例数的30.5%。吸入性过敏原阳性率7~14岁组最高,为46.2%。结论:吸入性过敏原以尘螨组合为主,食入性过敏原以鸡蛋白为主。不同年龄组患儿对过敏原的阳性率存在差异。

  3. The clinical significance of the anti-RA33 level in patients with rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Mehmet Türkmen

    2016-12-01

    Full Text Available Objective: The early diagnosis of Rheumatoid Arthritis (RA is of due significance for the prevention of possible damage to the joint tissue by means of treatment. Laboratory tests are very important for monitoring RA activity and for the evaluation of the patients’ response to the treatment. Rheumatoid factor, so far the most commonly used test for the cases with suspected RA, is not a specific parameter despite its sensitivity to RA. The measurement of other autoantibodies might be helpful to the diagnosis particularly for the cases with low RF titer or with suspected diagnosis. The measurement of anti-RA33 autoantibodies is one of the tests used in the diagnosis of the RA cases. The present study was conducted to compare anti-RA33 levels of healthy individuals with long-term RA cases and to evaluate the value of anti-RA33 test for the RA diagnosis. Method: Total 40 patients (28 female and 12 male identified with RA at least for the last five years according to the classification criteria of American College of Rheumatology (ACR reviewed in 1987 and 40 healthy controls included in the present study. Results: AntiRA-33 level was determined as 12.47±4.97 U/mL for the patients with RA and as 1.96±1.82 U/mL for the healthy controls, and there is no statistically significant difference between the groups. Conclusions: As a result AntiRA-33 level was evaluated in RA patients and no difference was found compared to control group.

  4. High Resolution Study of the 222Ra Exotic Decay

    Science.gov (United States)

    Hussonnois, M.; Le Du, J. F.; Brillard, L.; Dalmasso, J.; Ardisson, G.

    1991-10-01

    The 14C-decay of 222Ra has been reinvestigated using a strong 230U source and the magnetic superconducting spectrometer SOLENO in view of looking for a possible feeding of the first 208Pb excited state. 210 14C-events were recorded in a single peak of (30.930±0.090) MeV energy; the 14C branching ratio values b=(2.31±0.31)×10-10 and <1×10-12 to the respective 208Pb ground and Iπ=3- octupole state were deduced.

  5. Endoparasitismo gastrintestinal em cabras da raça Anglonubiana

    OpenAIRE

    Batista,Joilson Ferreira; Campelo,José Elivalto Guimarães; Morais,Marcyele Ferreira; Silva,Pollyana Oliveira; Magalhães,Pâmela Cristina; Barçante,Felipe Pereira da Silva; Mendonça,Ivete Lopes

    2014-01-01

    A dificuldade de manutenção do rebanho em condições sanitárias adequada compromete a eficiência da criação de caprinos, principalmente em relação ao controle de endoparasitas. O objetivo com este trabalho foi avaliar a sensibilidade de matrizes da raça Anglonubiana a nematoides gastrintestinais, considerando as cabras estratificadas por estágio fisiológico (lactantes e não lactantes) dentro de três classes de idade. Utilizou-se as características: Ovos por grama de fezes (OPG), Grau de anemia...

  6. Bedside etiology of childhood cancer. [X radiation, /sup 224/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Miller, R.W.

    1977-01-01

    The following topics are discussed: adenocarcinomas of the vagina in young women exposed prenatally to diethylstilbestrol; neuroblastoma in children exposed prenatally to hydantoin; increased frequency of leukemia in Japanese children surviving the atomic bomb; cancer in adults following administration of /sup 224/Ra during childhood; increased risk of lung cancer following environmental exposure of children to asbestos; lung cancer in adults following exposure to lead, copper, zinc, and arsenic; association of chromosomal aberrations with leukemia in children exposed to x radiation and benzene; immunosuppression in lymphoma patients; renal dysplasia in patients with Wilms' tumor; and aggregation of neoplasms in families. (HLW)

  7. Atomic Mass and Nuclear Binding Energy for Ra-226 (Radium)

    Science.gov (United States)

    Sukhoruchkin, S. I.; Soroko, Z. N.

    This document is part of the Supplement containing the complete sets of data of Subvolume B `Nuclei with Z = 55 - 100' of Volume 22 `Nuclear Binding Energies and Atomic Masses' of Landolt-Börnstein - Group I `Elementary Particles, Nuclei and Atoms', and additionally including data for nuclei with Z = 101 - 130. It provides atomic mass, mass excess, nuclear binding energy, nucleon separation energies, Q-values, and nucleon residual interaction parameters for atomic nuclei of the isotope Ra-226 (Radium, atomic number Z = 88, mass number A = 226).

  8. Raça ovina Merino da Beira Baixa

    OpenAIRE

    Andrade, C.S.C.R.; Pires, T. H. S.

    2012-01-01

    O Merino da Beira Baixa é um animal cujas características fenotípicas estão estabelecidas e que se fixaram após um período evolutivo de cruzamentos das raças autóctones existentes a quando do Recenseamento Geral de Gados de 1870, bordaleiro churro e comum, com o Merino Espanhol introduzido em Portugal em 1920, o Merino Fonte Boa em 1929/30 e devido a transumâncias com os churros Mondegueiro e Serra da Estrela (6). A sua substituição por outras, teoricamente mais produtivas mas ...

  9. Ra and the average effective strain of surface asperities deformed in metal-working processes

    DEFF Research Database (Denmark)

    Bay, Niels; Wanheim, Tarras; Petersen, A. S

    1975-01-01

    Based upon a slip-line analysis of the plastic deformation of surface asperities, a theory is developed determining the Ra-value (c.l.a.) and the average effective strain in the surface layer when deforming asperities in metal-working processes. The ratio between Ra and Ra0, the Ra-value after...... and before deformation, is a function of the nominal normal pressure and the initial slope γ0 of the surface asperities. The last parameter does not influence Ra significantly. The average effective strain View the MathML sourcege in the deformed surface layer is a function of the nominal normal pressure...

  10. The solubilities and solubility products of zirconium hydroxide and oxide after aging at 278, 313, and 333 K

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Taishi; Uemura, Takuya; Sasaki, Takayuki; Takagi, Ikuji [Kyoto Univ. (Japan). Dept. of Nuclear Engineering; Moriyama, Hirotake [Kyoto Univ. (Japan). Research Reactor Inst.

    2016-07-01

    The solubilities of zirconium hydroxide and oxide after aging at 278, 313, and 333 K were measured at 278, 298, 313, and 333 K in the pH{sub c} range of 0.3-7 in a 0.5 M ionic strength solution of NaClO{sub 4} and HClO{sub 4}. Size distributions of the colloidal species were investigated by ultrafiltration using membranes with different pore sizes, and the solid phases were examined by X-ray diffraction. The apparent solubility of zirconium amorphous hydroxide (Zr(OH){sub 4}(am)), prepared by the oversaturation method, decreased with increasing aging temperature (T{sub a}), and the size distributions obtained after aging at elevated temperatures indicated the growth of the colloidal species. We, therefore, suggested that agglomeration of the colloidal species and dehydration and crystallization of Zr(OH){sub 4}(am) as the solubility-limiting solid phase occurred over the course of aging at elevated temperatures. For sample solutions of the crystalline oxide (ZrO{sub 2}(cr)), the aging temperature had no significant effect on the solubility, but the solubility data at lower temperatures were found to be slightly higher than those at higher temperatures, implying a small fraction of the amorphous components. In the analysis of different solid phases (Zr(OH){sub 4}(s,T{sub a}), T{sub a} = 278, 313, and 333 K) depending on the aging temperatures, the solubility products (K{sub sp}, T{sub a}) were determined at different measurement temperatures, and the enthalpy change (Δ{sub r}H {sup circle}) for Zr{sup 4+} 4OH{sup -} <=> Zr(OH){sub 4}(s,T{sub a}) was calculated using the van't Hoff equation. The solid-phase-transformation process at elevated temperatures was also analyzed based on the obtained K{sub sp}, T{sub a} and Δ{sub r}H {sup circle} values.

  11. [ICO-166 monoclonal antibodies against the CD45RA antigen].

    Science.gov (United States)

    Frolova, E A; Baryshnikov, A Iu; Novikov, V V; Syrkin, A B

    1993-07-01

    Monoclonal antibodies (MCA) ICO-166 against CD45RA antigen were generated and characterized. In the indirect IFA, MCA ICO-166 reacted with 54.1 +/- 1.9% lymphocytes of human peripheral blood and 15.2 +/- 2.3% monocytes but not with granulocytes or thrombocytes. The method of double labelling of cells demonstrated that MCA ICO-166 detected all B-lymphocytes, all NK-cells and 31% of mature T-lymphocytes but only 55% of CD8 suppressor cells and only 21% of CDA helper cells carried this antigen on the surface. Experiments were carried out to block binding of FITC-labeled MCA ALB11 against CD45RA antigen with human lymphocytes by pretreatment of cells with different concentrations of MCA ICO-166. Treatment of cells with MCA ALB11 blocked binding of MCA ALB11-FITC by 85% on the average. MCA ICO-166 blocked binding of MCA ALB11-FITC by 66% on the average. When different dilutions of MCA ICO-166 were used, the dose-dependent effect of blocking of MCA ALB11-FITC binding was observed. MCA ICO-166 immunoprecipitated a protein band of molecular weight 220 kDa from lysates of mononuclear cells of the human peripheral blood.

  12. Early electroretinografic changes in elderly RA patients treated with hydroxychloroquine

    Directory of Open Access Journals (Sweden)

    C. Gelmi

    2011-09-01

    Full Text Available Objective: to evaluate the effectiveness of fundoscopy, electrooculography, electroretinogram and visually evoked potentials in early detection of hydroxychloroquine retinal toxicity in RA patients and to evaluate the influence of patients’ age, drug dosage, concomitant therapy (prednisone and methotrexate and serum creatinine levels in the development of this side effect. Methods: from september to december 1999, we have enrolled 32 RA patients (13 males, 19 females starting hydroxichlorochine treatment. The patients underwent regular ophthalmological examination (fundoscopy, electro-oculography, electro-retinogram and visually evoked potentials every 4 months. Disease activity was evaluated every two months by clinical and routine serological examination. Results: no patients developed retinopathy during 1 year’s follow-up; fundoscopy, electrooculography, and visually evoked potentials did not vary from the baseline. On the other hand, electroretinogram showed early alterations of scotopic and photopic response; moreover a significant statistical correlation between patients’ age (more than 65 years and b1 photopic wave increase (p < 0,05 was observed. No correlation was found between the developement of electro- retinographic alterations and hydroxychloroquine dosage, concomitant therapy and serum creatinine levels Conclusion: our data show the inefficacy of fundoscopy, electrooculography and visually evoked potentials in early detection of hydroxychloroquine retinopathy. On the other hand electroretinogram allows early detection of retinal alterations during hydroxychloroquine treatment, in patients older than 65 years.

  13. Atomic parity violation in a single Ra ion

    Energy Technology Data Exchange (ETDEWEB)

    Nunes Portela, M.; Beker, H.; Giri, G.; Jungmann, K.; Onderwater, C.J.G.; Schlesser, S.; Timmermans, R.G.E.; Versolato, O.O.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen, NL (Germany)

    2012-07-01

    Precision measurements of atomic parity violation is the only path to determine the electroweak mixing angle in the Standard Model of particle physics at low energy scale. A single trapped Ra{sup +} ion is the most promising candidate for such an experiment. The system combines the advantages of large parity violation amplitudes due to the faster than Z{sup 3} scaling, the possibility to perform accurate atomic structure calculation on this one valence electron system and the ability to precision frequency measurements on trapped ion. Our first laser spectroscopy on an ensemble of trapped short-lived {sup 209-214}Ra{sup +} isotopes in a linear Paul trap provided hyperfine structure of the 6d {sup 2}D{sub 3/2} states and isotope shift of the 6d {sup 2}D{sub 3/2} - 7p {sup 2}P{sub 1/2} transition. These results provide input for the ongoing precision atomic structure calculations. The next step of the experiments towards laser cooling of a single trapped radium ion. The experimental setup is being commissioned with Ba ions.

  14. Raúl Castro a la hora de las decisiones

    Directory of Open Access Journals (Sweden)

    Janette HABEL

    2010-01-01

    Full Text Available Este artículo trata sobre el nuevo rol político de Raúl Castro en Cuba. Su misión no es fácil. Debe redefinir un proyecto de desarrollo viable en condiciones históricas y geopolíticas nuevas; garantizar la estabilidad del país; organizar el relevo entre los antiguos dirigentes históricos y las nuevas generaciones; y, además, iniciar negociaciones con la administración Obama. ¿Se podrá hablar en adelante de un «raulismo» o se seguirá imponiendo el «fidelismo»? Asimismo, ¿cómo salvaguardar la soberanía e independencia, junto a las principales conquistas sociales desde hace cincuenta años, mientras al mismo tiempo se llevan a cabo las reformas «estructurales » y se intenta normalizar relaciones con el continente, específicamente con Estados Unidos? Esa respuesta, que no es obvia, la debe dar Raúl Castro.

  15. Radio and infrared recombination studies of the southern massive star-forming region G333.6-0.2

    CERN Document Server

    Fujiyoshi, T; Caswell, J L; Moore, T J T; Lumsden, S L; Aitken, D K; Roche, P F; Fujiyoshi, Takuya; Smith, Craig H.; Caswell, James L.; Moore, Toby J. T.; Lumsden, Stuart L.; Aitken, David K.; Roche, Patrick F.

    2006-01-01

    We present high spatial resolution radio and near-infrared hydrogen recombination line observations of the southern massive star-forming region G333.6-0.2. The 3.4-cm continuum peak is found slightly offset from the infrared source. The H90alpha spectra show for the first time a double peak profile at some positions. The complex velocity structure may be accounted for by champagne outflows, which may also explain the offset between the radio and infrared sources. The 2.17-um Brackett gamma image and H90alpha map are combined to construct an extinction map which shows a trend probably set by the blister nature of the HII region. The total number of Lyman continuum photons in the central 50-arcsec is estimated to be equivalent to that emitted by up to 19 O7V stars.

  16. Properties of an alkali-thermo stable xylanase from Geobacillus thermodenitrificans A333 and applicability in xylooligosaccharides generation.

    Science.gov (United States)

    Marcolongo, Loredana; La Cara, Francesco; Morana, Alessandra; Di Salle, Anna; Del Monaco, Giovanni; Paixão, Susana M; Alves, Luis; Ionata, Elena

    2015-04-01

    An extracellular thermo-alkali-stable and cellulase-free xylanase from Geobacillus thermodenitrificans A333 was purified to homogeneity by ion exchange and size exclusion chromatography. Its molecular mass was 44 kDa as estimated in native and denaturing conditions by gel filtration and SDS-PAGE analysis, respectively. The xylanase (GtXyn) exhibited maximum activity at 70 °C and pH 7.5. It was stable over broad ranges of temperature and pH retaining 88 % of activity at 60 °C and up to 97 % in the pH range 7.5-10.0 after 24 h. Moreover, the enzyme was active up to 3.0 M sodium chloride concentration, exhibiting at that value 70 % residual activity after 1 h. The presence of other metal ions did not affect the activity with the sole exceptions of K(+) that showed a stimulating effect, and Fe(2+), Co(2+) and Hg(2+), which inhibited the enzyme. The xylanase was activated by non-ionic surfactants and was stable in organic solvents remaining fully active over 24 h of incubation in 40 % ethanol at 25 °C. Furthermore, the enzyme was resistant to most of the neutral and alkaline proteases tested. The enzyme was active only on xylan, showing no marked preference towards xylans from different origins. The hydrolysis of beechwood xylan and agriculture-based biomass materials yielded xylooligosaccharides with a polymerization degree ranging from 2 to 6 units and xylobiose and xylotriose as main products. These properties indicate G. thermodenitrificans A333 xylanase as a promising candidate for several biotechnological applications, such as xylooligosaccharides preparation.

  17. A recombinant Sp185/333 protein from the purple sea urchin has multitasking binding activities towards certain microbes and PAMPs.

    Science.gov (United States)

    Lun, Cheng Man; Schrankel, Catherine S; Chou, Hung-Yen; Sacchi, Sandro; Smith, L Courtney

    2016-08-01

    The purple sea urchin, Strongylocentrotus purpuratus, possesses a sophisticated innate immune system that responds to microbes effectively by swift expression of the highly diverse Sp185/333 gene family. The Sp185/333 proteins are predicted to have anti-pathogen functions based on inducible gene expression and their significant sequence diversity. Sp185/333 proteins are all predicted to be intrinsically disordered and do not exhibit sequence similarities to other known proteins. To test the anti-pathogen hypothesis, a recombinant Sp185/333 protein, rSp0032, was evaluated and found to exhibit specific binding to marine Vibrio diazotrophicus and to Saccharomyces cerevisiae, but not to two Bacillus species. rSp0032 also binds to LPS, β-1,3-glucan and flagellin but not to peptidoglycan. rSp0032 binding to LPS can be competed by LPS, β-1,3-glucan and flagellin but not by peptidoglycan. We speculate that the predicted intrinsically disordered structure of rSp0032 may adapt to different conformations in binding to a limited number of PAMPs and pathogens. Given that rSp0032 binds to a range of targets, and that up to 260 different Sp185/333 proteins can be expressed per individual sea urchin, this family of immune response proteins may facilitate effective host protection against a broad array of potential pathogens encountered in the marine environment.

  18. C333H ameliorated insulin resistance through selectively modulating peroxisome proliferator-activated receptor γ in brown adipose tissue of db/db mice.

    Science.gov (United States)

    Zhang, Ning; Chen, Wei; Zhou, Xinbo; Zhou, Xiaolin; Xie, Xinni; Meng, Aimin; Li, Song; Wang, Lili

    2013-01-01

    Peroxisome proliferator-activated receptor γ (PPARγ) is a unique target for insulin sensitizer agents. These drugs have been used for the clinical treatment of type 2 diabetes for almost twenty years. However, serious safety issues are associated with the PPARγ agonist thiazolidinediones (TZDs). Selective PPARγ modulators (SPPARMs) which retain insulin sensitization without TZDs-like side effects are emerging as a promising new generation of insulin sensitizers. C333H is a novel structure compound synthesized by our laboratory. In diabetic rodent models, C333H has insulin-sensitizing and glucose-lowering activity comparable to that of TZDs, and causes no significant increase in body weight or adipose tissue weight in db/db mice. In diabetic db/db mice, C333H elevated circulating high molecular weight adiponectin isoforms, decreased PPARγ 273 serine phosphorylation in brown adipose tissue and selectively modulated the expression of a subset of PPARγ target genes in adipose tissue. In vitro, C333H weakly recruited coactivator and weakly dissociated corepressor activity. These findings suggest that C333H has similar properties to SPPARMs and may be a potential therapeutic agent for the treatment of type 2 diabetes.

  19. Bioavailability pf radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb present in Brazilian phosphogypsum and phosphate fertilizers

    Energy Technology Data Exchange (ETDEWEB)

    Russo, Ana Carolina; Saueia, Catia H.R.; Mazzilli, Barbara P., E-mail: chsaueia@ipen.br [Instituto de Pesquisas Energeticas e Nucleares(IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Phosphogypsum (PG) is a by-product of phosphate fertilizers industries. The USEPA classified PG as a - Technologically Enhanced Naturally Occurring Radioactive Material (TENORM). Its worldwide production on 2006 was estimated in 150 million tons. Annually the three main phosphate industries in Brazil are responsible for 5.5x106 tons of phosphogypsum, which is stored in stacks. The level of radionuclides present in phosphogypsum is well-known and makes its disposal or reutilization an environmental concern. Part of this byproduct can be reused, for example, to improve fertility of agricultural soils. To assess the long term environmental impact of radioactive contamination of ecosystems, information on source term including radionuclide speciation, mobility and biological uptakes have high importance. This paper intends to evaluate the bioavailability of the radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb to the environment by following a procedure established by the EC (European Community), which includes a single EDTA-NH{sub 4} 0.05M extraction at pH 7.0 prior to the analyses. These results is compared with the total activity concentration of these radionuclides in Brazilian PG and the most used phosphate fertilizers (SSP, TSP, MAP and DAP). This procedure intends to represent on a more realistic way the leaching of radionuclides from PG and fertilizers to soil and agricultural products. (author)

  20. Distribution of 226Ra in the Arctic Ocean and the Bering Sea and its hydrologic implications

    Institute of Scientific and Technical Information of China (English)

    邢娜; 陈敏; 黄奕普; 蔡平河; 邱雨生

    2003-01-01

    Radium-226 (226Ra) activities were measured in the surface water samples collected from the Arctic Ocean and the Bering Sea during the First Chinese National Arctic Research Expedition. The results showed that 226Ra concentrations in the surface water ranged from 0.28 to 1.56 Bq/m3 with an average of 0.76 Bq/m3 in the Arctic Ocean, and from 0.25 to 1.26 Bq/m3 with an average of 0.71 Bq/m3 in the Bering Sea. The values were obviously lower than those from open oceans in middle and low latitudes, indicating that the study area may be partly influenced by sea ice meltwater. In the Bering Sea, 226Ra in the surface water decreased northward, probably as a result of the exchange between the 226Ra-deficientsea ice meltwater and the 226Ra-rich Pacific water. In the Arctic Ocean, 226Ra in the surface water increased northward and eastward. This spatial distributionof 226Ra reflected the variation of the 226Ra-enriched river component in the water mass of the Arctic Ocean. The vertical profiles of 226Ra in the Canadian Basin showed a concentration maximum at 200 m, which could be attributed to the inputs of the Pacific water or/and the bottom shelf water with high 226Ra concentration. This conclusion was consistent with the results from 2H, 18O tracers.

  1. The Paran\\'a Ra'anga expedition

    CERN Document Server

    Gangui, Alejandro; Vena, Pablo

    2013-01-01

    Paran\\'a Ra'anga (the image of Paran\\'a, in Guaran\\'i) is the name of a cultural and scientific expedition that traveled the rivers: R\\'io de la Plata, Paran\\'a and Paraguay, from Buenos Aires to Asunci\\'on, during March 2010. The project brought together some forty scientists and artists from three countries in a slow and enriching cruise, putting in active contact actors from different backgrounds and disciplines -which usually run separately- in the framework of an unusual space-time experience. The project recovers the historical tradition of the trip as an instrument of knowledge and collaboration between the arts and sciences, necessary to build new ways of seeing and understanding the river and its banks. This article reports on the motivations of this project and its projection.

  2. Loe-ära-loe! Eesti lastekirjandus 2007 / Jaanika Palm

    Index Scriptorium Estoniae

    Palm, Jaanika

    2008-01-01

    Hainsalu, Lehte. Rõõmuratas (TEA Kirjastus) ; Vilep, Heiki. Katus sõidab (Vilep & Vallik) ; Vaiksoo, Jaanus. Onu Heino eksis ära (Koolibri) ; Vallik, Aidi. Tirtsti ja turtsti (TEA Kirjastus) ; Trull, Ilmar. Järvevaht ja joogivesi (Eesti Ekspressi Kirjastus) ; Kassel, Riina. Kalliralli (Ilo) ; Kumberg, Krista. Autopõnn Anto lemmiktoit (Koolibri) ; Ojar, Triinu. Suur must koer = Suur must pini (Päike ja Pilv) ; Pervik, Aino. Suleline, Puhuja ja must Munk (Tänapäev) ; Tomusk, Ilmar. Tere, Volli! (Tänapäev) ; Ausman, Piia. Tähtsad asjad (Haus Galerii) ; Ulman, Mihkel. Võlur taskust (Elmatar) ; Tangsoo, Jaan. Kotermann Juko imeline reis läbi Eestimaa (Varrak) ; Made, Reet. Tuhin tiibades (Koolibri) ; Vallik, Aidi. Mis sinuga juhtus, Ann? (Tänapäev)

  3. Search for psipp\\ra\\rho\\pi at BESII

    CERN Document Server

    Ablikim, M

    2005-01-01

    Non-$D\\bar{D}$ decay $\\psppto \\rhopi$ is searched for using a data sample of $(17.3\\pm 0.5)~pb^{-1}$ taken at the center-of-mass energy of 3.773 GeV by the BESII detector at the BEPC. No $\\rhopi$ signal is observed, and the upper limit of the cross section is measured to be $\\sigma(\\EETO \\rhopi)<6.0~pb$ at 90% C. L. Considering the interference between the continuum amplitude and the $\\pspp$ resonance amplitude, the branching fraction of $\\pspp$ decays to $\\rho\\pi$ is determined to be $\\BR(\\pspp\\ra\\rho\\pi)\\in(6.0\\times10^{-6},~2.4\\times10^{-3})$ at 90% C. L. This is in agreement with the prediction of the $S$- and $D$-wave mixing scheme of the charmonium states for solving the ``$\\rhopi$ puzzle'' between $\\jpsi$ and $\\psp$ decays.

  4. Loe-ära-loe! Eesti lastekirjandus 2007 / Jaanika Palm

    Index Scriptorium Estoniae

    Palm, Jaanika

    2008-01-01

    Hainsalu, Lehte. Rõõmuratas (TEA Kirjastus) ; Vilep, Heiki. Katus sõidab (Vilep & Vallik) ; Vaiksoo, Jaanus. Onu Heino eksis ära (Koolibri) ; Vallik, Aidi. Tirtsti ja turtsti (TEA Kirjastus) ; Trull, Ilmar. Järvevaht ja joogivesi (Eesti Ekspressi Kirjastus) ; Kassel, Riina. Kalliralli (Ilo) ; Kumberg, Krista. Autopõnn Anto lemmiktoit (Koolibri) ; Ojar, Triinu. Suur must koer = Suur must pini (Päike ja Pilv) ; Pervik, Aino. Suleline, Puhuja ja must Munk (Tänapäev) ; Tomusk, Ilmar. Tere, Volli! (Tänapäev) ; Ausman, Piia. Tähtsad asjad (Haus Galerii) ; Ulman, Mihkel. Võlur taskust (Elmatar) ; Tangsoo, Jaan. Kotermann Juko imeline reis läbi Eestimaa (Varrak) ; Made, Reet. Tuhin tiibades (Koolibri) ; Vallik, Aidi. Mis sinuga juhtus, Ann? (Tänapäev)

  5. An implanted $^{228}$Ra source for response characterization of bolometers

    CERN Multimedia

    TeO$_{2}$ crystals are used as bolometers in experiments searching for Double $\\beta$ Decay without emission of neutrinos. One of the most important issues in this extremely delicate kind of experiments is the discrimination of the background from the real signal. A deep knowledge of the bolometric response to $\\alpha$-particles is therefore needed to recognize and discard them, since it has been proven that $\\alpha$ surface contamination could be a major contribution in our background budget. We would like to use ISOLDE’s capability of implanting $^{228}$Ra to make a long-lived source feeding several monochromatic $\\alpha$- and recoiling nuclei, with little or no $\\alpha$-peak broadening due to the source itself, for tests of our detectors in Milano and Gran Sasso INFN National Lab.

  6. Raíces griegas: tan lejanas y tan cercanas

    Directory of Open Access Journals (Sweden)

    Ana María Gispert-Sauch Colls

    2011-05-01

    Full Text Available Isidoro de Sevilla en su obra maestra Etimologías, supo unir el “origen”, o sea, de dónde viene un vocablo y la “etimología”, que sería el “por qué” se aplica este vocablo a una realidad concreta. Hizo, pues, una distinción entre etimologías ex causa (según lo que es y etimologías ex origine (según de dónde viene. Y, como de lo que se trataba era decaptar el valor esencial de una palabra, dice Isidoro, “cuando se ha visto de dónde viene un nombre, se comprende más rápidamente su valor, porque el estudio de las realidades es más fácil una vez conocida la etimología” (Etimologías, I, 19, 2. Siguiendo en parte esta orientación, presentamos algunas raíces de verbos griegos, lejanos en referencia al tiempo de su origen, pero presentes en nuestro tiempo a través de sus derivaciones. Y, sobre todo persistentes, porque nos transmiten la esencia de significado, ladensidad semántica, a la que he aludido en varias ocasiones1.De esta forma, el hoy de muchas de nuestras palabras está impregnado de este pasado clásico que nos invita a recuperar permanentemente su esencia. No en vano y refiriéndonos a Sócrates, podríamos decir que la etimología tiene una función “mayéutica”, la de sacar a la luz el núcleofecundo de las palabras. Veamos algunas de dichas raíces.

  7. Estrutura populacional da raça Nelore Mocho

    Directory of Open Access Journals (Sweden)

    Faria F.J.C.

    2002-01-01

    Full Text Available Descreveu-se a estrutura populacional da raça Nelore Mocho utilizando dados do registro genealógico de animais nascidos entre 1969 e 1998. O banco de dados foi separado em quatro períodos de 1979-1983, 1984-1988, 1989-1993 e 1994-1998. Calcularam-se as estatísticas descritivas do número de criadores, de reprodutores e de reprodutrizes. A endogamia total aumentou de 0,55% para 0,98%, a esperada sob acasalamento ao acaso aumentou de 0,11% para 0,56% e a endogamia devido à subdivisão populacional permaneceu constante, ao redor de 0,45%, indicando que a subdivisão genética da raça Nelore Mocho é próxima a zero e praticamente inexistente. O tamanho efetivo populacional foi estimado pelo coeficiente total de endogamia e permaneceu ao redor de 120. A inclusão de animais no livro genealógico aumentou de 4.630 para 13.907, entretanto, esta ação não foi suficiente para incrementar o tamanho efetivo. Baseado na probabilidade de origem do gene foram calculados o número efetivo de fundadores, de ancestrais e de genomas remanescentes. Esses parâmetros decresceram ao longo do período, atingindo valores de 144, 98 e 64. Todas as estimativas foram análogas na descrição da estrutura genética populacional e devem ser consideradas no futuro para o desenvolvimento de programas de seleção.

  8. 230Th, 226Ra and 222Rn in abyssal sediments

    Science.gov (United States)

    Kadko, David

    1980-09-01

    A model that predicts the flux of 222Rn out of deep-sea sediment is presented. The radon is ultimately generated by 230Th which is stripped from the overlying water into the sediment. Data from many authors are compared with the model predictions. It is shown that the continental contribution of ionium is not significant, and that at low sedimentation rates, biological mixing and erosional processes strongly affect the surface concentration of the ionium. Two cores from areas of slow sediment accumulation, one from a manganese nodule region of the central Pacific and one from the Rio Grande Rise in the Atlantic were analyzed at closely spaced intervals for 230Th, 226Ra, and 210Pb. The Pacific core displayed evidence of biological mixing down to 12 cm and had a sedimentation rate of only 0.04 cm/kyr. The Atlantic core seemed to be mixed to 8 cm and had a sedimentation rate of 0.07 cm/kyr. Both cores had less total excess 230Th than predicted. Radium sediment profiles are generated from the 230Th model. Adsorbed, dissolved, and solid-phase radium is considered. According to the model, diffusional losses of radium are especially important at low sedimentation rates. Any particulate, or excess radium input is ignored in this model. The model fits the two analyzed cores if the fraction of total radium available for adsorption-desorption is about 0.5-0.7, and if K, the distribution coefficient, is about 1000. Finally, the flux of radon out of the sediments is derived from the model-generated radium profiles. It is shown that the resulting standing crop of 222Rn in the overlying water may be considered as an added constraint in budgeting 230Th and 226Ra in deep-sea sediments.

  9. The influence of source heterogeneity on the U-Th-Pa-Ra disequilibria in post-glacial tholeiites from Iceland

    Science.gov (United States)

    Koornneef, J. M.; Stracke, A.; Bourdon, B.; Grönvold, K.

    2012-06-01

    We investigate the relative influence of mantle upwelling velocity and source heterogeneity on the melting rates recorded by 230Th-238U, 231Pa-235U and 226Ra-230Th disequilibria in post-glacial tholeiites from Iceland's main rift areas. The measured (230Th/238U) ratios range from 1.085 to 1.247, the (231Pa/235U) ratios from 1.333 to 1.925, and the (226Ra/230Th) ratios from 0.801 to 1.218. A general positive correlation between 230Th excesses and distance from the inferred plume centre is consistent with a model of decreasing mantle upwelling velocity with increasing distance from the plume axis. However, the model is not substantiated by the (231Pa/235U) data as the correlation with distance from the plume centre is weak. On the scale of individual eruption centres, the observed U-series are influenced by variations in melt transport time, source porosity, and local variations in mantle upwelling velocity. Broad correlations between (230Th/238U) and (231Pa/235U) and highly incompatible trace element ratios for samples from the Western Volcanic Zone provide, however, evidence for a significant underlying effect of source heterogeneity on the U-series data. Low 230Th and 231Pa excesses in enriched samples from the Western Volcanic Zone with high U/Th, Nb/U and Nb/La indicate that partial melts from an enriched source component, characterised by high melt productivity but low bulk DU/DTh, influence the U-series systematics of the erupted melts. These results re-affirm the presence of comparatively larger abundances of enriched material in the mantle source beneath the South Western Rift of Iceland, which has been suggested based on relationships between highly incompatible element and Pb isotope ratios in Icelandic basalts. Overall, our results highlight the importance of lithological heterogeneity on the melting behaviour of the upper mantle and the composition of oceanic basalts.

  10. Development of a liquid scintillation method for in vitro determination of {sup 226}Ra and {sup 228} Ra in bioassay samples

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Paulo Cesar P.; Sousa, Wanderson O.; Juliao, Ligia M.Q.C.; Dantas, Bernardo M., E-mail: pcesar@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2011-07-01

    Radium isotopes are dispersed in the environment according to their physicochemical characteristics. The intake of {sup 226}Ra and {sup 228}Ra in humans can occur by inhalation and ingestion and the risk of internal exposure are related to their long half-lives, characteristics of the emission and biokinetics of the isotopes in the human body. The goal of this work is to develop a methodology for the analysis of {sup 226}Ra and {sup 228}Ra in excreta samples (urine and feces), using liquid scintillation technique. Excreta samples were provided by non-exposed humans for the purpose of standardizing the methodology and the establishment of a background level of radium excretion. Radium isotopes were concentrated and separated from the constituents of the sample by co-precipitation with barium sulphate. The precipitate of Ba(Ra)SO{sub 4} was filtrated and weighted for the determination of the chemical yield. The filter containing the precipitate was transferred to a scintillation vial. In the scintillation vial, 8 mL of water, 8 mL of Instagel XF and 4 mL of UltimaGold were added, forming a gel suspension, after stirring the solution. The {sup 226}Ra and {sup 228}Ra activities were determined 21 days after the precipitation of samples. The samples were counted in a liquid scintillation spectrometer. The technique presented adequate sensitivity and reproducibility for the analysis of urine and feces. The activities of {sup 226}Ra and {sup 228}Ra in excreta samples provide useful information for the identification of the main route of intake and for the assessment of the internal exposure of occupationally exposed workers and inhabitants of high background areas. (author)

  11. Evaluation of Lama5 as a candidate for the mouse ragged (Ra) mutation

    DEFF Research Database (Denmark)

    Durkin, M E; Albrechtsen, R; Chambers, D M;

    1998-01-01

    The laminin alpha5 chain is a component of the basement membranes of many developing and adult tissues. The mouse laminin alpha5 chain gene (Lama5) has been mapped close to the locus of the semidominant ragged (Ra) mutation on distal chromosome 2. The cause of the Ra mutation, which is usually...... lethal in the homozygous state, has not been determined. We have investigated whether a defect in Lama5 is responsible for the ragged mutation, using the RaJ strain. No differences in the level of the laminin alpha5 chain transcript were found in placental RNA from homozygous RaJ mutant embryos compared...... to normal littermates. Antiserum raised against a recombinant laminin alpha5 chain polypeptide stained the basement membranes of both normal and homozygous mutant embryos to a similar extent. More precise mapping of Lama5 on an interspecific Ra backcross indicated that Lama5 is proximal to the Ra locus...

  12. EXPRESSION OF IL-13Ra2 GENE IN HUMAN BRAIN TUMORS

    Institute of Scientific and Technical Information of China (English)

    WU An-hua; TIE Xin-xin; WANG Yun-jie; YANG Guo-rui

    2005-01-01

    Objective: To investigate the expression of IL-13Ra2 gene in brain tumors. Methods: Seventy-nine human brain tumors were obtained from the department of Neurosurgery of China Medical University. Human IL-13Ra2 expression was evaluated by reverse transcriptase polymerase chain reaction and immunohistochemical analysis. Results: IL-13Ra2 gene was highly expressed in glioblastoma, medulloblastoma, malignant meningioma and benign meningioma. Conclusion:Human IL-13Ra2 gene is expressed in brain tumors in addition to gliomas, and our result indicates that the IL-13Ra2 gene promoter based gene therapy method can be used to treat brain tumors in addition to gliomas. Further studies involving larger numbers of samples are necessary to fully understand the expression profile of IL-13Ra2 gene in the brain tumors.

  13. Ionizable (Thia)calix[4]crowns as Highly Selective 226Ra2+ Ionophores

    NARCIS (Netherlands)

    Leeuwen, van Fijs W.B.; Beijleveld, Hans; Miermans, Cornelis J.H.; Huskens, Jurriaan; Verboom, Willem; Reinhoudt, David N.

    2005-01-01

    The 226Ra2+ selectivity of the ionizable (thia)calix[4]crowns 1-4 was determined in the presence of a large excess of the most common alkali and alkaline earth cations. Selective 226Ra2+ (2.9 × 10-8 M) extraction occurs even at extremely high Mn+/226Ra2+ ratios of 3.5 × 107 [Mn+ = Na+, K+, Rb+, Cs+,

  14. Cell therapy centered on IL-1Ra is neuroprotective in experimental stroke

    DEFF Research Database (Denmark)

    Clausen, Bettina Hjelm; Lambertsen, Kate Lykke; Dagnæs-Hansen, Frederik;

    2016-01-01

    Cell-based therapies are emerging as new promising treatments in stroke. However, their functional mechanism and therapeutic potential during early infarct maturation has so far received little attention. Here, we asked if cell-based delivery of the interleukin-1 receptor antagonist (IL-1Ra...... production of IL-1Ra and IL-1α/β identifies microglia, not infiltrating leukocytes, as the major sources of IL-1Ra after experimental stroke, and shows IL-1Ra and IL-1β to be produced by segregated subsets of microglia with a small proportion of these cells co-expressing IL-1α. Reconstitution of whole body...

  15. First Measurement of the Atomic Electric Dipole Moment of (225)Ra.

    Science.gov (United States)

    Parker, R H; Dietrich, M R; Kalita, M R; Lemke, N D; Bailey, K G; Bishof, M; Greene, J P; Holt, R J; Korsch, W; Lu, Z-T; Mueller, P; O'Connor, T P; Singh, J T

    2015-06-12

    The radioactive radium-225 ((225)Ra) atom is a favorable case to search for a permanent electric dipole moment. Because of its strong nuclear octupole deformation and large atomic mass, (225)Ra is particularly sensitive to interactions in the nuclear medium that violate both time-reversal symmetry and parity. We have developed a cold-atom technique to study the spin precession of (225)Ra atoms held in an optical dipole trap, and demonstrated the principle of this method by completing the first measurement of its atomic electric dipole moment, reaching an upper limit of |d((225)Ra)|<5.0×10(-22)  e cm (95% confidence).

  16. Data of evolutionary structure change: 1E1RA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RA-2HLDT 1E1R 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bChain>T 2HLDT ALKQVAGSLKLFL

  17. First Measurement of the Atomic Electric Dipole Moment of $^{225}$Ra

    CERN Document Server

    Parker, R H; Kalita, M R; Lemke, N D; Bailey, K G; Bishof, M N; Greene, J P; Holt, R J; Korsch, W; Lu, Z -T; Mueller, P; O'Connor, T P; Singh, J T

    2015-01-01

    The radioactive radium-225 ($^{225}$Ra) atom is a favorable case to search for a permanent electric dipole moment (EDM). Due to its strong nuclear octupole deformation and large atomic mass, $^{225}$Ra is particularly sensitive to interactions in the nuclear medium that violate both time-reversal symmetry and parity. We have developed a cold-atom technique to study the spin precession of $^{225}$Ra atoms held in an optical dipole trap, and demonstrated the principle of this method by completing the first measurement of its atomic EDM, reaching an upper limit of $|$$d$($^{225}$Ra)$|$ $<$ $5.0\\!\\times\\!10^{-22}$ $e \\cdot$cm (95$\\%$ confidence).

  18. Neuroprotective actions of endogenous interleukin-1 receptor antagonist (IL-1ra) are mediated by glia.

    Science.gov (United States)

    Pinteaux, Emmanuel; Rothwell, Nancy J; Boutin, Herve

    2006-04-01

    The pro-inflammatory cytokine interleukin-1 (IL-1), contributes to neuronal inflammation and cell death induced by ischemia, excitotoxicity, or trauma, while administration of IL-1 receptor antagonist (IL-1ra) reduces neuronal injury. The aim of the present study was to test the hypothesis that endogenous IL-1ra is neuroprotective in vivo and in vitro, and to identify its mechanism of actions. Mice lacking IL-1ra (IL-1ra knock-out (KO]) exhibited a dramatic increase in neuronal injury (3.6-fold increase in infarct size) induced by transient cerebral ischemia compared to wild-type (WT) animals. Basal cell death of cultured cortical neurons from WT and IL-1ra KO was identical, and treatment with NMDA or AMPA (20 microM) increased cell death to the same extent in WT and IL-1ra KO neurons. However, basal and NMDA- or AMPA-induced cells death was significantly higher in glial-neuronal co-cultures from IL-1ra KO than from WT mice. We further showed that pure microglial cultures, but not pure astrocytes cultures, released IL-1ra in response to treatment with conditioned medium from NMDA- or AMPA-treated primary neurons. These results demonstrate that endogenous IL-1ra produced by microglia is neuroprotective in cerebral ischemia or excitotoxicity.

  19. Association between anti-Porphyromonas gingivalis or anti-α-enolase antibody and severity of periodontitis or rheumatoid arthritis (RA) disease activity in RA.

    Science.gov (United States)

    Lee, Joo Youn; Choi, In Ah; Kim, Jin-Hee; Kim, Kyoung-Hwa; Lee, Eun Young; Lee, Eun Bong; Lee, Yong-Moo; Song, Yeong Wook

    2015-08-12

    Periodontitis (PD) has been reported to be associated with rheumatoid arthritis (RA). Porphyromonas gingivalis (P. gingivalis) is a gram-negative anaerobic bacterium that is recognized as one of the major pathogenic organisms in PD and is the only bacterium known to express peptidylarginine deiminase (PAD). Antibody against human α-enolase (ENO1) is one of the autoantibodies in RA. ENO1 is a highly conserved protein, and could be a candidate molecule for molecular mimicry between bacterial and human proteins. In the present study, we measured serum antibody against P. gingivalis and human ENO1 in patients with RA and investigated their association with the severity of PD or disease activity of RA. Two hundred, forty-eight patients with RA and 85 age- and sex-matched healthy controls were evaluated by rheumatologic and periodontal examinations. The serum levels of anti-P. gingivalis and anti-ENO1 antibodies were measured by an enzyme-linked immunosorbent assay (ELISA). Patients with RA had significantly higher levels of anti-P. gingivalis and anti-ENO1 antibody titers than the controls (p = 0.002 and 0.0001, respectively). Anti-P. gingivalis antibody titers significantly correlated with anti-ENO1 antibody titers in RA patients (r = 0.30, p < 0.0001). There were significant correlations between anti-P. gingivalis antibody titers and the gingival index (GI), probing pocket depth (PPD), bleeding on probing (BOP) and clinical attachment level (CAL) (p = 0.038, 0.004, 0.004 and 0.002, respectively) in RA. Anti-P. gingivalis antibody titers were not correlated with disease activity score 28 (DAS28) or anti-CCP titer. However, anti-ENO1 antibody titers were significantly correlated not only with the periodontal indices, such as PPD, BOP, and CAL (p = 0.013, 0.023 and 0.017, respectively), but also RA clinical characteristics, such as DAS28, anti-CCP titer, and ESR (p = 0.009, 0.015 and 0.001, respectively). Anti-P. gingivalis and anti-ENO1 antibody

  20. Evaluation of the activity concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in sediments from Antarctica in the Admiralty Bay region

    Energy Technology Data Exchange (ETDEWEB)

    Mora, Tamires de A.; Oliveira, Joselene de, E-mail: tamires.mora@usp.br, E-mail: jolivei@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Figueira, Rubens C.L.; Mahiques, Michel M.; Sousa, Silvia H.M., E-mail: rfigueira@usp.br, E-mail: mahiques@usp.br, E-mail: smsousa@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Instituto Oceanografico

    2015-07-01

    In this study, we performed the radiochemical characterization of a sedimentary record (1B profile), collected in the vicinity of Admiralty Bay, King George Island in Antarctic Operation XXXI (January/2013). The activities of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb were determined by the counting of gross alpha and gross beta activities in the precipitates of Ba(Ra)SO{sub 4} and PbCrO{sub 4}. Those measurements were carried out in a low background gas flow proportional detector. The {sup 226}Ra and {sup 228}Ra were measured after 21 days of the final precipitation. The {sup 210}Pb activity was determined after 10 days of the precipitation date by gross beta counting of its {sup 210}Bi decay product. The activity concentration of {sup 226}Ra ranged from 11±1 (mBq g-1) to 54±3 (mBq g{sup -1}), and the {sup 228}Ra ranged from 48±5 (mBq g{sup -1}) to 155±16 (mBq g{sup -1}). The activity concentration of {sup 210}Pb varied from 8±1 (mBq g{sup -1}) to 458±46 (mBq g{sup -1}), while unsupported {sup 210}Pb ranged from 6±1 (mBq g{sup -1}) to 434±65 (mBq g{sup -1}). The {sup 210}Pb concentrations in sediments have often been used to dating events like deposition and accumulation in various marine environments. Taking into account the results of {sup 210}Pb and {sup 226}Ra activities obtained in testimony-1B it was estimated the unsupported {sup 210}Pb activity which was applied to the CIC geochronological dating model (Constant Initial Concentration). Based in these data, the sedimentation rate obtained was 0.63±0.02 cm year{sup -1}. (author)

  1. Factors Controlling the Groundwater Transport of U, Th, Ra, and Rn

    Indian Academy of Sciences (India)

    A Tricca; D Porcelli; G J Wasserburg

    2000-03-01

    A model for the groundwater transport of naturally occurring U, Th, Ra, and Rn nuclides in the 238U and 232Th decay series is discussed. The model developed here takes into account transport by advection and the physico-chemical processes of weathering, decay, -recoil, and sorption at the water-rock interface. It describes the evolution along a flowline of the activities of the 238U and 232Th decay series nuclides in groundwater. Simple sets of relationships governing the activities of the various species in solution are derived, and these can be used both to calculate effective retardation factors and to interpret groundwater data. For the activities of each nuclide, a general solution to the transport equation has been obtained, which shows that the activities reach a constant value after a distance $\\bar{x}_i$, characteristic of each nuclide. Where $\\bar{x}_i$ is much longer than the aquifer length, (for 238U, 234U, and 232Th), the activities grow linearly with distance. Where $\\bar{x}_i$ is short compared to the aquifer length, (for 234Th, 230Th, 228Th, 228Ra, and 224Ra), the activities rapidly reach a constant or quasi-constant activity value. For 226Ra and 222Rn, the limiting activity is reached after 1 km. High 234U values (proportional to the ratio 234Th/W238U) can be obtained through high recoil fraction and/or low weathering rates. The activity ratios 230Th/232Th, 228Ra/226Ra and 224Ra/226Ra have been considered in the cases where either weathering or recoil is the predominant process of input from the mineral grain. Typical values for weathering rates and recoil fractions for a sandy aquifer indicate that recoil is the dominant process for Th isotopic ratios in the water. Measured data for Ra isotope activity ratios indicate that recoil is the process generally controlling the Ra isotopic composition in water. Higher isotopic ratios can be explained by different desorption kinetics of Ra. However, the model does not provide an explanation for 228Ra

  2. A unique 970kb microdeletion in 9q33.3, including the NR5A1 gene in a 46,XY female

    NARCIS (Netherlands)

    Van Silfhout, Anneke; Boot, Annemieke M.; Dijkhuizen, Trijnie; Hoek, Annemieke; Nijman, Rien; Sikkema-Raddatz, Birgit; van Ravenswaaij-Arts, Conny M. A.

    2009-01-01

    We report on a female patient with XY sex reversal with clitoromegaly, neonatal male testosterone and AMH levels, and a normal urine steroid profile. Array CGH revealed a de novo microdeletion of chromosome 9q33.3, including the NR5A1 gene. NR5A1 encodes for the steroidogenic factor-1 (SF-1) and

  3. The influence of SiO2 Addition on 2MgO-Al2O3-3.3P2O5 Glass

    DEFF Research Database (Denmark)

    Larsen, P.H.; Poulsen, F.W.; Berg, Rolf W.

    1999-01-01

    2MgO-Al2O3-3.3P2O5 glasses with increasing amounts of SiO2 are considered for sealing applications in Solid Oxide Fuel Cells (SOFC). The change in chemical durability under SOFC anode conditions and the linear thermal expansion is measured as functions of the SiO2 concentration. Raman spectroscopy...

  4. Impossible cartographies: approaching Raúl Ruiz’s cinema

    Directory of Open Access Journals (Sweden)

    Michael Goddard

    2013-06-01

    Full Text Available Raúl Ruiz (1931-2011, while considered one of the world’s most significant filmmakers by several film critics, is yet to be the subject of any thorough academic engagement with his work in English. My book Impossible Cartographies sets out on this task by mapping, as fully as possible, Ruiz’s cinematic trajectory across more than five decades of prolific work ranging from his earliest work in Chile to high budget ‘European’ costume dramas culminating in the recent Mysteries of Lisbon (2010. It does this by treating Ruiz’s work, with its surrealist, magic realist, popular cultural and neo-Baroque sources, as a type of ‘impossible’ cinematic cartography, mapping real, imaginary and virtual spaces, and crossing between different cultural contexts, aesthetic strategies, and technical media. In argues that across the different phases of Ruiz’s work identified, there are key continuities such as the invention of singular cinematic images and the interrogation of their possible and impossible combinations. This article will present some of the key themes of Ruiz’s cinema and use ideas of virtual cartography, tableaux vivants and the neo-baroque to illuminate a range of Ruiz’s films from the Hypothesis of the Stolen Painting (1978 to Mysteries of Lisbon, his last major project.

  5. A novel angiotensin I-converting enzyme mutation (S333W impairs N-domain enzymatic cleavage of the anti-fibrotic peptide, AcSDKP.

    Directory of Open Access Journals (Sweden)

    Sergei M Danilov

    Full Text Available BACKGROUND: Angiotensin I-converting enzyme (ACE has two functional N- and C-domain active centers that display differences in the metabolism of biologically-active peptides including the hemoregulatory tetrapeptide, Ac-SDKP, hydrolysed preferentially by the N domain active center. Elevated Ac-SDKP concentrations are associated with reduced tissue fibrosis. RESULTS: We identified a patient of African descent exhibiting unusual blood ACE kinetics with reduced relative hydrolysis of two synthetic ACE substrates (ZPHL/HHL ratio suggestive of the ACE N domain center inactivation. Inhibition of blood ACE activity by anti-catalytic mAbs and ACE inhibitors and conformational fingerprint of blood ACE suggested overall conformational changes in the ACE molecule and sequencing identified Ser333Trp substitution in the N domain of ACE. In silico analysis demonstrated S333W localized in the S1 pocket of the active site of the N domain with the bulky Trp adversely affecting binding of ACE substrates due to steric hindrance. Expression of mutant ACE (S333W in CHO cells confirmed altered kinetic properties of mutant ACE and conformational changes in the N domain. Further, the S333W mutant displayed decreased ability (5-fold to cleave the physiological substrate AcSDKP compared to wild-type ACE. CONCLUSIONS AND SIGNIFICANCE: A novel Ser333Trp ACE mutation results in dramatic changes in ACE kinetic properties and lowered clearance of Ac-SDKP. Individuals with this mutation (likely with significantly increased levels of the hemoregulatory tetrapeptide in blood and tissues, may confer protection against fibrosis.

  6. Specificities of anti-neutrophil autoantibodies in patients with rheumatoid arthritis (RA)

    DEFF Research Database (Denmark)

    Brimnes, J; Halberg, P; Jacobsen, Søren;

    1997-01-01

    The objective of this study was to characterize antigens recognized by neutrophil-specific autoantibodies from patients with RA. Sera from 62 RA patients were screened by indirect immunofluorescence (IIF). Positive sera were further tested by ELISAs for antibodies against various granule proteins...

  7. Role of CCR5 Delta 32 bp deletion in RA and SLE

    NARCIS (Netherlands)

    Martens, H. A.; Kallenberg, C. G. M.; Bijl, M.

    2009-01-01

    CCR5 and its ligands play important roles in rheumatoid arthritis (RA) and systemic lupus erythematosus (SLE). A deletion of 32 bp in its gene leads to the production of a non-functional receptor. Although a protective effect of CCR5 Delta 32 for the development of RA has been suggested, future stud

  8. Towards a Precise Measurement of Atomic Parity Violation in a Single Ra+ Ion

    NARCIS (Netherlands)

    Jungmann, K.; Giri, G. S.; Versolato, O. O.; Steadman, SG; Stephans, GSF; Taylor, FE

    2012-01-01

    In the singly charged Ra+ ion the contributions of the weak interactions to the atomic level energies are some 50 times larger than in the Cs atom. We report the results of laser spectroscopy experiments on Ra-209-214(+) isotopes in preparation of a precision atomic parity violation experiment. Expe

  9. Data of evolutionary structure change: 1EOTA-2RA4B [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EOTA-2RA4B 1EOT 2RA4 A B GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAV...ine>PRO CA 148 1EOT A 1EOTA...23633 0.1720000058412552 -0.8870000243186951 0.42500001192092896...05 0.460999995470047 0.7990000247955322 0.38499999046325684

  10. Data of evolutionary structure change: 1EOTA-2RA4A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EOTA-2RA4A 1EOT 2RA4 A A GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAV...ine> PRO CA 155 1EOT A 1EOTA...0198364258 21.238000869750977 tion> 0.04600000008940697 0.976999998092...7935 -0.8989999890327454 -0.05000000074505806 -0.4350000023841858

  11. Comparative Genre Analysis on RA Introductions of Computer Science Using CARS Model

    Institute of Scientific and Technical Information of China (English)

    杨文静

    2013-01-01

    Using Swales’CARS model, the present study combines the methods of quantitative analysis and qualitative analysis and makes a comparative analysis on the moves and steps of RA introductions between Chinese English journals and international English journals, which will benefit researchers in RA writing and publishing in core English journals.

  12. 76 FR 63701 - Culturally Significant Objects Imported for Exhibition Determinations: “Johan Zoffany RA: Society...

    Science.gov (United States)

    2011-10-13

    ... Culturally Significant Objects Imported for Exhibition Determinations: ``Johan Zoffany RA: Society Observed... determine that the objects to be included in the exhibition ``Johan Zoffany RA: Society Observed,'' imported... that the exhibition or display of the exhibit objects at the Yale Center for British Art, New...

  13. Persistence of octupole correlations in sup 2 sup 3 sup 1 Ra

    CERN Document Server

    Fraile-Prieto, L M; Mach, H; Boutami, R; Aas, A J; Fogelberg, B; García-Raffi, L M; Grant, I S; Gulda, K; Hageboe, E; Kurcewicz, W; Kvasil, J; López, M J; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2001-01-01

    The structure of sup 2 sup 3 sup 1 Ra, the heaviest odd Ra nucleus currently accessible for detailed spectroscopic investigation, has been studied in the beta sup - decay of sup 2 sup 3 sup 1 Fr. The main purpose has been to verify whether fast B(E1) rates and significant octupole correlations recently established in sup 2 sup 2 sup 9 Ra persist in sup 2 sup 3 sup 1 Ra. The excited states in sup 2 sup 3 sup 1 Ra have been determined for the first time. Spins and parities have been deduced from conversion electron measurements, while level half-lives in the ps and ns ranges have been measured with the Advanced Time Delayed beta gamma gamma(t) method. The moderately fast B(E1) rates found for transitions connecting the lowest-lying K suppi=5/2 sup+- and K suppi=1/2 sup+- bands, reveal the persistence of octupole collective effects in sup 2 sup 3 sup 1 Ra, although the B(E1) rates are lower than in sup 2 sup 2 sup 9 Ra. These findings reinforce the differences in the B(E1) systematics between isotonic Ra and Th ...

  14. Determination of {sup 226}Ra Isotope in the Leachate around Phosphogypsum Stack Using Ethylenediaminetetraacetic Acid (EDTA)

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Geun Ho; Kim, Yong Jae; Chang, Byung Uck [University of Science and Tecknology, Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)

    2011-12-15

    Ba is the most useful element to get the Ba(Ra)SO{sub 4} precipitate. However, when the high concentrations of ions such as sulfate, calcium are existed in the leachate of phosphogypsum stack, it is difficult to get the Ba(Ra)SO{sub 4} precipitate. Since this reason, the developed method for the Ba coprecipitate using EDTA was performed to determine the {sup 226}Ra concentration in the high sulfate sample. The average concentration of {sup 226}Ra in a leachate of phosphogypsum using this method was 0.102 Bq{center_dot}kg{sup -1} and the minimal detectable activity is 3.4 mBq{center_dot}kg{sup -1}. The mBq{center_dot}kg{sup -1} method was 0.102 Bq{center_dot}kg{sup -1} and the minimal detectable activity is 3.4 mBq{center_dot}kg{sup -1}. The {sup 226}Ra stock solution and the CRM (Certified Reference Material) were analyzed to verify this method. In analyzed {sup 226}Ra stock solution, bias with added concentration was approximately 1% and the correlation curve between {sup 226}Ra concentration in simulated standard sample and measured {sup 226}Ra concentration showed good agreement with a correlation coefficient (R{sup 2}) of 0.99. In analyzed CRM, maximum bias with reference value was 5.8% (k=1) and the analytical results were in good agreement with the reference value.

  15. Isolated EWiRaC: A New Low-Stress Single-Stage Isolated PFC Converter

    DEFF Research Database (Denmark)

    Schneider, Henrik; Bergendorff, Stefan Pihl; Petersen, Lars;

    2007-01-01

    A new PFC-family of Efficient Wide Range Converters named EWiRaC was recently introduced. EWiRaC has a major advantage in terms of efficiency at low-line and handles challenges like inrush current limiting as an integrated part of the conversion scheme. The main objective of this paper...

  16. Gender, body mass index and rheumatoid arthritis disease activity: results from the QUEST-RA Study

    DEFF Research Database (Denmark)

    Jawaheer, D; Olsen, J; Lahiff, M

    2010-01-01

    To investigate whether body mass index (BMI), as a proxy for body fat, influences rheumatoid arthritis (RA) disease activity in a gender-specific manner.......To investigate whether body mass index (BMI), as a proxy for body fat, influences rheumatoid arthritis (RA) disease activity in a gender-specific manner....

  17. Leachable 226Ra in Philippine phosphogypsum and its implication in groundwater contamination in Isabel, Leyte, Philippines.

    Science.gov (United States)

    Cañete, Socrates Jose P; Palad, Lorna Jean H; Enriquez, Eliza B; Garcia, Teofilo Y; Yulo-Nazarea, Teresa

    2008-07-01

    Phosphogypsum (PG), the major waste material in phosphate fertilizer processing, has been known to contain enhanced levels of naturally-occurring radionuclides especially (226)Ra. The lack of radioactivity data regarding Philippine phosphogypsum and its environmental behavior in the Philippine setting has brought concern on possible contamination of groundwater beneath the phosphogypsum ponds in Isabel, Leyte, Philippines. The radioactivity of Philippine phosphogypsum was determined and the leaching of (226)Ra from phosphogypsum and through local soil was quantified. Level of (226)Ra in groundwater samples in Isabel, Leyte, Philippines was also quantified to address the primary concern. It was found that the (226)Ra activity in Philippine phosphogypsum is distributed in a wide range from 91.5 to 935 Bq/kg. As much as 5% of (226)Ra can be leached from Philippine PG with deionized water. In vitro soil leach experiments suggest that the soil in the phosphate fertilizer plant area would be able to deter the intrusion of (226)Ra into the water table. Compared to reported values of natural groundwater levels of (226)Ra, the concentration of this radionuclide in Isabel, Leyte groundwater suggest that there is no (226)Ra intrusion brought about by the presence of phosphogypsum ponds in the area.

  18. Ion neutralisation mass-spectrometry route to radium monofluoride (RaF)

    CERN Document Server

    Isaev, T A; Willmann, L; Berger, R

    2013-01-01

    The diatomic molecule radium monofluoride (RaF) has recently been proposed as a versatile probe for physics beyond the current standard model. Herein, a route towards production of a RaF molecular beam via radium ions is proposed. It takes advantage of the special electronic structure expected for group 2 halides and group 2 hydrides: The electronic ground state of neutral RaF and its monocation differ in occupation of a non-bonding orbital of $\\sigma$ symmetry. This implies similar equilibrium distances and harmonic vibrational wavenumbers in the two charge states and thus favourable Franck--Condon factors for neutralisation without dissociation in neutralising collisions. According to the calculated ionisation energy of RaF, charge exchange collisions of RaF$^+$ with sodium atoms are almost iso-enthalpic, resulting in large cross-sections for the production of neutral radium monofluoride.

  19. Systematic study of heavy cluster emission from {210-226}^Ra isotopes

    CERN Document Server

    Santhosh, K P; Priyanka, B; Unnikrishnan, M S

    2012-01-01

    The half lives for various clusters lying in the cold reaction valleys of {210-226}^Ra isotopes are computed using our Coulomb and proximity potential model (CPPM). The computed half lives of 4^He and 14^C clusters from {210-226}^Ra isotopes are in good agreement with experimental data. Half lives are also computed using the Universal formula for cluster decay (UNIV) of Poenaru et al., and are found to be in agreement with CPPM values. Our study reveals the role of doubly magic 208^Pb daughter in cluster decay process. Geiger - Nuttall plots for all clusters up to 62^Fe are studied and are found to be linear with different slopes and intercepts. {12,14}^C emission from 220^Ra; 14^C emission from {222,224}^Ra; 14^C and 20^O emission from 226^Ra are found to be most favourable for measurement and this observation will serve as a guide to the future experiments.

  20. Adenovirus-mediated transfer of RA538 gene and its antitumor effect

    Institute of Scientific and Technical Information of China (English)

    程金科; 林晨; 隗玥; 张雪艳; 邢嵘; 牟巨伟; 王秀琴; 吴旻

    1999-01-01

    The RA538 cDNA was transferred into human ovarian cancer cell line SK-OV-3 and human melanoma cell line WM-983A by its recombinant adenoviral vector constructed through homologous recombination. It was demonstrated that the recombinant adenovirus could transfer RA538 gene with high efficiency, and could obviously inhibit tumor growth, with the inhibiting rates of 85% and 73% respectively, at the same time greatly repress the colony forming ability of the cells. The therapeutic experiments on transplanted subcutaneous tumor model in nude mice demonstrated that RA538 could significantly inhibit tumor growth. Flow cytometry and DNA fragmentation analysis indicated that RA538 could induce the cell cycle G1 arrest/apoptosis of the tumor cells. The expression of cmyc gene was found pronouncedly reduced by Western blot analysis. These results suggest that the RA538 recombinant adenovirus could be a promising drug in cancer gene therapy.

  1. Geochemistry of Sediment from IODP Expeditions 322 and 333: Terrigenous Provenance, Dispersed Ash, and the Nankai 'Subduction Factory'

    Science.gov (United States)

    Scudder, R.; Murray, R. W.; Schindlbeck, J.; Kutterolf, S.

    2013-12-01

    Terrigenous material and volcanic ash play important roles in the IODP Seismogenic Zone and 'Subduction Factory' initiatives. Particularly relevant to these projects are studies of geochemical budgets including how fluids within subducting sediment will be affected by hydration/dehydration reactions. Of great importance is the volcanic component, which occurs both as discrete ash layers and as ash dispersed throughout the sediment column and their related altered products in the down-going plate. Based on bulk sedimentary geochemical studies of IODP Sites C0011 and C0012 drilled during Expeditions 322 and 333, we will show the importance of dispersed ash to the Nankai subduction zone and document important changes in terrigenous provenance to these locations. The major elemental characteristics of the hemipelagic mudstones are remarkably consistent both downcore and between Site C0011 and Site C0012. For example, the average Si/Al ratio at both sites C0011 and C0012 is 3.3 × 0.2. This is observed in other key major elemental indicators as well (e.g., Fe2O3). Alkali elements, Trace elements and REEs exhibit greater downcore variability while remaining consistent between the sites. Ternary diagrams such as La-Th-Sc and Sc-Cr-Th as well as other geochemical plots (i.e., Sm/Al vs. Th/Al) show that Site C0011 and Site C0012 are fairly clustered, derived primarily from a continental arc source, and that distal sources to the sediment are important in addition to a modest and varying component from the proximal Izu-Bonin Island Arc. Multivariate statistical treatments are further being applied to the datasets from these sites to allow a better determination of the number of sources that make up the bulk sediment (and their provenance). Q-mode Factor Analysis was performed in order to determine the composition of potential end member contributions to these sites. The multivariate statistics indicate Site C0011 and C0012 each have 4-5 end members that explain 98% of the

  2. Linkage to chromosome 2q32.2-q33.3 in familial serrated neoplasia (Jass syndrome).

    Science.gov (United States)

    Roberts, Aedan; Nancarrow, Derek; Clendenning, Mark; Buchanan, Daniel D; Jenkins, Mark A; Duggan, David; Taverna, Darin; McKeone, Diane; Walters, Rhiannon; Walsh, Michael D; Young, Bruce W; Jass, Jeremy R; Rosty, Christophe; Gattas, Michael; Pelzer, Elise; Hopper, John L; Goldblatt, Jack; George, Jill; Suthers, Graeme K; Phillips, Kerry; Parry, Susan; Woodall, Sonja; Arnold, Julie; Tucker, Kathy; Muir, Amanda; Drini, Musa; Macrae, Finlay; Newcomb, Polly; Potter, John D; Pavluk, Erika; Lindblom, Annika; Young, Joanne P

    2011-06-01

    Causative genetic variants have to date been identified for only a small proportion of familial colorectal cancer (CRC). While conditions such as Familial Adenomatous Polyposis and Lynch syndrome have well defined genetic causes, the search for variants underlying the remainder of familial CRC is plagued by genetic heterogeneity. The recent identification of families with a heritable predisposition to malignancies arising through the serrated pathway (familial serrated neoplasia or Jass syndrome) provides an opportunity to study a subset of familial CRC in which heterogeneity may be greatly reduced. A genome-wide linkage screen was performed on a large family displaying a dominantly-inherited predisposition to serrated neoplasia genotyped using the Affymetrix GeneChip Human Mapping 10 K SNP Array. Parametric and nonparametric analyses were performed and resulting regions of interest, as well as previously reported CRC susceptibility loci at 3q22, 7q31 and 9q22, were followed up by finemapping in 10 serrated neoplasia families. Genome-wide linkage analysis revealed regions of interest at 2p25.2-p25.1, 2q24.3-q37.1 and 8p21.2-q12.1. Finemapping linkage and haplotype analyses identified 2q32.2-q33.3 as the region most likely to harbour linkage, with heterogeneity logarithm of the odds (HLOD) 2.09 and nonparametric linkage (NPL) score 2.36 (P = 0.004). Five primary candidate genes (CFLAR, CASP10, CASP8, FZD7 and BMPR2) were sequenced and no segregating variants identified. There was no evidence of linkage to previously reported loci on chromosomes 3, 7 and 9.

  3. Tree-ring-width-based PDSI reconstruction for central Inner Mongolia, China over the past 333 years

    Science.gov (United States)

    Liu, Yu; Zhang, Xinjia; Song, Huiming; Cai, Qiufang; Li, Qiang; Zhao, Boyang; Liu, Han; Mei, Ruochen

    2016-04-01

    A tree-ring-width chronology was developed from Pinus tabulaeformis aged up to 333 years from central Inner Mongolia, China. The chronology was significantly correlated with the local Palmer Drought Severity Index (PDSI). We therefore reconstructed the first PDSI reconstruction from March to June based on the local tree ring data from 1680 to 2012 AD. The reconstruction explained 40.7 % of the variance (39.7 % after adjusted the degrees of freedom) of the actual PDSI during the calibration period (1951-2012 AD). The reconstructed PDSI series captured the severe drought event of the late 1920s, which occurred extensively in northern China. Running variance analyses indicated that the variability of drought increased sharply after 1960, indicating more drought years, which may imply anthropogenic related global warming effects in the region. In the entire reconstruction, there were five dry periods: 1730-1814 AD, 1849-1869 AD, 1886-1942 AD (including severe drought in late 1920s), 1963-1978 AD and 2004-2007 AD; and five wet periods: 1685-1729 AD, 1815-1848 AD, 1870-1885 AD, 1943-1962 AD and 1979-2003 AD. Conditions turned dry after 2003 AD, and the PDSI from March to June (PDSI36) captured many interannual extreme drought events since then, such as 2005-2008 AD. The reconstruction is comparable to other tree-ring-width-based PDSI series from the neighboring regions, indicating that our reconstruction has good regional representativeness. Significant relationships were found between our PDSI reconstruction and the solar radiation cycle and the sun spot cycle, North Atlantic Oscillation, the El Niño-Southern Oscillation, as well as the Pacific Decadal Oscillation. Power spectral analyses detected 147.0-, 128.2-, 46.5-, 6.5-, 6.3-, 2.6-, 2.2- and 2.0-year quasi-cycles in the reconstructed series.

  4. Secondary amides of (R)-3,3,3-trifluoro-2-hydroxy-2-methylpropionic acid as inhibitors of pyruvate dehydrogenase kinase.

    Science.gov (United States)

    Aicher, T D; Anderson, R C; Gao, J; Shetty, S S; Coppola, G M; Stanton, J L; Knorr, D C; Sperbeck, D M; Brand, L J; Vinluan, C C; Kaplan, E L; Dragland, C J; Tomaselli, H C; Islam, A; Lozito, R J; Liu, X; Maniara, W M; Fillers, W S; DelGrande, D; Walter, R E; Mann, W R

    2000-01-27

    N'-methyl-N-(4-tert-butyl-1,2,5,6-tetrahydropyridine)thiourea, SDZ048-619 (1), is a modest inhibitor (IC(50) = 180 microM) of pyruvate dehydrogenase kinase (PDHK). In an optimization of the N-methylcarbothioamide moiety of 1, it was discovered that amides with a small acyl group, in particular appropriately substituted amides of (R)-3,3,3-trifluoro-2-hydroxy-2-methylpropionic acid, are inhibitors of PDHK. Utilizing this acyl moiety, herein is reported the rationale leading to the optimization of a series of acylated piperazine derivatives. Methyl substitution of the piperazine at the 2- and 5-positions (with S and R absolute stereochemistry) markedly increased the potency of the lead compound (>1,000-fold). Oral bioavailability of the compounds in this series is good and is optimal (as measured by AUC) when the 4-position of the piperazine is substituted with an electron-poor benzoyl moiety. (+)-1-N-[2,5-(S, R)-Dimethyl-4-N-(4-cyanobenzoyl)piperazine]-(R)-3,3, 3-trifluoro-2-hydroxy-2-methylpropanamide (14e) inhibits PDHK in the primary enzymatic assay with an IC(50) of 16 +/- 2 nM, enhances the oxidation of [(14)C]lactate into (14)CO(2) in human fibroblasts with an EC(50) of 57 +/- 13 nM, diminishes lactate significantly 2.5 h post-oral-dose at doses as low as 1 micromol/kg, and increases the ex vivo activity of PDH in muscle, liver, and fat tissues in normal Sprague-Dawley rats. These PDHK inhibitors, however, do not lower glucose in diabetic animal models.

  5. Tree-ring-width-based PDSI reconstruction for central Inner Mongolia, China over the past 333 years

    Science.gov (United States)

    Liu, Yu; Zhang, Xinjia; Song, Huiming; Cai, Qiufang; Li, Qiang; Zhao, Boyang; Liu, Han; Mei, Ruochen

    2017-02-01

    A tree-ring-width chronology was developed from Pinus tabulaeformis aged up to 333 years from central Inner Mongolia, China. The chronology was significantly correlated with the local Palmer Drought Severity Index (PDSI). We therefore reconstructed the first PDSI reconstruction from March to June based on the local tree ring data from 1680 to 2012 AD. The reconstruction explained 40.7 % of the variance (39.7 % after adjusted the degrees of freedom) of the actual PDSI during the calibration period (1951-2012 AD). The reconstructed PDSI series captured the severe drought event of the late 1920s, which occurred extensively in northern China. Running variance analyses indicated that the variability of drought increased sharply after 1960, indicating more drought years, which may imply anthropogenic related global warming effects in the region. In the entire reconstruction, there were five dry periods: 1730-1814 AD, 1849-1869 AD, 1886-1942 AD (including severe drought in late 1920s), 1963-1978 AD and 2004-2007 AD; and five wet periods: 1685-1729 AD, 1815-1848 AD, 1870-1885 AD, 1943-1962 AD and 1979-2003 AD. Conditions turned dry after 2003 AD, and the PDSI from March to June (PDSI36) captured many interannual extreme drought events since then, such as 2005-2008 AD. The reconstruction is comparable to other tree-ring-width-based PDSI series from the neighboring regions, indicating that our reconstruction has good regional representativeness. Significant relationships were found between our PDSI reconstruction and the solar radiation cycle and the sun spot cycle, North Atlantic Oscillation, the El Niño-Southern Oscillation, as well as the Pacific Decadal Oscillation. Power spectral analyses detected 147.0-, 128.2-, 46.5-, 6.5-, 6.3-, 2.6-, 2.2- and 2.0-year quasi-cycles in the reconstructed series.

  6. Distribution of 226Ra Radionuclide in Upwelling Event Off Ulsan, Gampo and Pohang, Korea

    Directory of Open Access Journals (Sweden)

    Muslim

    2009-07-01

    Full Text Available Upwelling is an important event in the sea for it makes the area to become more productive. The objective of this study is to determine the distribution of radium-226 as radiotoxic in the upwelling area in the summer season. Measurements of the horizontal and vertical activities of 226Ra in the Ulsan, Gampo and Pohang waters were conducted in June, August 1999 and June 2000 when the upwelling event was expected to occur. Water temperature, salinity and dissolved oxygen (DO were also measured concurrently. The thermocline layer or the layer where the temperature decreased drastically occurred at a depth between 30 m to 100 m for samples dated June 1999 and 30 m to more than 100 m for samples dated August 1999 and June 2000. The salinity decreased with depth but the DO concentration increased in this layer. The condition affected the vertical distribution of 226Ra in the study area, where the 226Ra activities showed to be relatively homogeneous vertically in each station. This indicates that the upwelling which occurred in the study area was capable to distribute the 226Ra activities from the bottom to the surface. Thus, the 226Ra distribution at that time did not increase with depth, opposite to what usually occurs in the ocean at normal condition. The 226Ra activities also did not decrease after elapsed time of one year, in fact, it increased. However, horizontally the 226Ra activities decreased with increasing distance from the coastal zone. Based on these results, it can be concluded that the upwelling event in the Ulsan, Gampo and Pohang was effective for increasing the 226Ra activities and was capable to create homogeneous 226Ra activities from the bottom to the surface in the water column, and the source of 226Ra was likely to originate from outside area (i.e. coastal zone and bottom area.

  7. The CpxRA two-component system is essential for Citrobacter rodentium virulence.

    Science.gov (United States)

    Thomassin, Jenny-Lee; Giannakopoulou, Natalia; Zhu, Lei; Gross, Jeremy; Salmon, Kristiana; Leclerc, Jean-Mathieu; Daigle, France; Le Moual, Hervé; Gruenheid, Samantha

    2015-05-01

    Citrobacter rodentium is a murine intestinal pathogen used as a model for the foodborne human pathogens enterohemorrhagic Escherichia coli and enteropathogenic E. coli. During infection, these pathogens use two-component signal transduction systems to detect and adapt to changing environmental conditions. In E. coli, the CpxRA two-component signal transduction system responds to envelope stress by modulating the expression of a myriad of genes. Quantitative real-time PCR showed that cpxRA was expressed in the colon of C57BL/6J mice infected with C. rodentium. To determine whether CpxRA plays a role during C. rodentium infection, a cpxRA deletion strain was generated and found to have a colonization defect during infection. This defect was independent of an altered growth rate or a defective type III secretion system, and single-copy chromosomal complementation of cpxRA restored virulence. The C. rodentium strains were then tested in C3H/HeJ mice, a lethal intestinal infection model. Mice infected with the ΔcpxRA strain survived infection, whereas mice infected with the wild-type or complemented strains succumbed to infection. Furthermore, we found that the cpxRA expression level was higher during early infection than at a later time point. Taken together, these data demonstrate that the CpxRA two-component signal transduction system is essential for the in vivo virulence of C. rodentium. In addition, these data suggest that fine-tuned cpxRA expression is important for infection. This is the first study that identifies a C. rodentium two-component transduction system required for pathogenesis. This study further indicates that CpxRA is an interesting target for therapeutics against enteric pathogens.

  8. POLITIK ETIS KEPAHLAWANAN RA KARTINI: MENGUAK SPIRITUALISME KARTINI YANG DIGELAPKAN

    Directory of Open Access Journals (Sweden)

    Nur Said

    2016-03-01

    Full Text Available Artikel ini membahas tiga isu utama terkait kepahlawanan RA Kartini di Indonesia: (1 Apa saja pertimbangan politikpemerintah dalam menetapkan Kartini sebagai pahlawanannasional?; (2 Bagaimana arkeologi pemikiran Kartiniterbentuk sehingga dikenal sebagai tokoh emansipasiwanita di Indonesia?, (3 Mengapa spiritualisme Kartinicenderung tersembunyi?, Makalah ini ditulis berdasarkanpenelitian perpustakaan dengan pendekatan filosofis.Kesimpulan dari artikel ini adalah: (1 Penentuan Kartinisebagai pahlawan tak lepas dari kepentingan politik. (2Telah terjadi intervensi dari orientalis yang mengesankanKartini sebagai seorang sekuler dan penganut feminis Barat.(3 Kartini adalah seorang Muslim yang kritis bahkan diatidak ragu-ragu untuk memberikan gugatan dan kritik tajamdari fenomena keagamaan yang kurang mendidik, termasukdalam pembelajaran dari Al-Qur’an. Hal ini telah benar benar mencapai tingkat tertinggi kesadaran Kartini sebagai “hambaAllah” yang anti-feodalisme dan kolonialisme. kata kunci: Kepahlawanan Kartini, Spiritualisme, kolonialisme, politik etis   This article discusses three focus issues: (1 What kindsof political interest in deciding behind the heroism ofKartini?; (2 What is the archaeological thought of  Kartinidespite his heroic figure?, (3 Why does the spiritualismof Kartini inclined hidden behind the frenzied heroismKartini that tends to make it as an object of ethical politics of dutch colonialism? This paper was writtenbased on library research with philosophical approaches.Conclusions of this article are: (1 the determinationof Kartini as an hero could not be separated from thepolitical intrigues. (2 Due to the intervention of theOrientalist writer has impressed Kartini be secular andWestern feminist adherents. (3 Kartini is a Muslimcritical even she did not hesitate to give the lawsuit andsharp criticism of the religious phenomenon which doesnot educate, including the learning of the Qur’an. It hasactually reached the

  9. High sensitivity measurement of 224Ra and 226Ra in water with an improved hydrous titanium oxide technique at the Sudbury Neutrino Observatory

    CERN Document Server

    Aharmim, B; Dai, X; Doucas, G; Farine, J; Fergani, H; Ford, R; Hahn, R L; Hallman, E D; Jelley, N A; Lange, R; Majerus, S; Mifflin, C; Noble, A J; O'Keeffe, H M; Rodriguez-Jimenez, R; Sinclair, D; Yeh, M

    2008-01-01

    The existing hydrous titanium oxide (HTiO) technique for the measurement of 224Ra and 226Ra in the water at the Sudbury Neutrino Observatory (SNO) has been changed to make it faster and less sensitive to trace impurities in the HTiO eluate. Using HTiO-loaded filters followed by cation exchange adsorption and HTiO co-precipitation, Ra isotopes from 200-450 tonnes of heavy water can be extracted and concentrated into a single sample of a few millilitres with a total chemical efficiency of 50%. Combined with beta-alpha coincidence counting, this method is capable of measuring 2.0x10^3 uBq/kg of 224Ra and 3.7x10^3 uBq/kg of 226Ra from the 232Th and 238U decay chains, respectively, for a 275 tonne D2O assay, which are equivalent to 5x10^16 g Th/g and 3x10^16 g U/g in heavy water.

  10. Ra-228, Ra-226, Pb-210 and Po-210 variations in the water columns and the surface water plankton in the Luzon Strait and northern South China Sea

    Science.gov (United States)

    Chung, Y.; Lin, C.; Wang, P.; Su, Y.

    2006-12-01

    Profiles of Ra-228, Ra-226, Pb-210 and Po-210 were measured in the Luzon Strait (LS) and northern South China Sea (SCS) areas to delineate the exchanges between the western Philippine Sea (WPS) and the northern SCS waters across the LS. Plankton samples were also collected for Po-210 and Pb-210 measurements to assess the balance between the Po-210 excess over Pb-210 in the plankton and the deficit in the surface water. Profiles of Ra-228 and Ra-226 seem to indicate the out flow of the SCS water below the salinity minimum and above around 1500m depth, below which the WPS water flows into the SCS through the LS above a sill depth of about 2600m. This is consistent with previous studies conducted in the area. All the Pb-210 profiles show a strong subsurface maximum with higher activity in the LS area. This maximum is in large excess over its parent, Ra-226 due to atmospheric input. Po-210 profiles generally follow the associated Pb-210 profiles but with lower activities, showing Po-210 deficiency. Po-210 is strongly enriched over Pb-210 in the plankton samples with an activity ratio generally over 10 and up to 40. Both nuclides in the plankton are higher in the LS area, a trend similar to the surface water. The Po-210 excess in the plankton can account for at least 70 percent of the surface water deficit, part of which may be removed by sinking particles.

  11. 226Ra and 228Ra tracer study on material transport in the east coast of Hainan Island, China: a case of nutrients

    Directory of Open Access Journals (Sweden)

    Ni SU

    2011-06-01

    Full Text Available Material fluxes (e.g. nutrients from coast to offshore play an important role in controlling the water quality in the concerned adjacent sea not only by the increase of nutrient concentration but by the change of nutrient structure. In the present work, naturally occurring isotopes (226Ra and 228Ra had been measured by alpha spectrometry in Wenjiao/Wenchang and Wanquan river estuaries and adjacent sea water of the east coast of Hainan Island. The excess dissolved 226Ra and 228Ra activities were observed in comparison with the values expected from the conservative mixing of freshwater and seawater end-members in both estuaries. Using 1-Dimensional Diffusion model, the estimated horizontal eddy diffusion coefficients (Kh derived from 228Ra activities away from its sources was 3.16?105 cm2 s-1. Furthermore, the corresponding nutrient fluxes into the coastal area were assessed. The results can provide useful information for the processes of mixing and exchange of coastal water as well as the transportation of dissoluble pollutants in this sea area.

  12. De-repression of RaRF-mediated RAR repression by adenovirus E1A in the nucleolus.

    Science.gov (United States)

    Um, Soo-Jong; Youn, Hye Sook; Kim, Eun-Joo

    2014-02-21

    Transcriptional activity of the retinoic acid receptor (RAR) is regulated by diverse binding partners, including classical corepressors and coactivators, in response to its ligand retinoic acid (RA). Recently, we identified a novel corepressor of RAR called the retinoic acid resistance factor (RaRF) (manuscript submitted). Here, we report how adenovirus E1A stimulates RAR activity by associating with RaRF. Based on immunoprecipitation (IP) assays, E1A interacts with RaRF through the conserved region 2 (CR2), which is also responsible for pRb binding. The first coiled-coil domain of RaRF was sufficient for this interaction. An in vitro glutathione-S-transferase (GST) pull-down assay was used to confirm the direct interaction between E1A and RaRF. Further fluorescence microscopy indicated that E1A and RaRF were located in the nucleoplasm and nucleolus, respectively. However, RaRF overexpression promoted nucleolar translocation of E1A from the nucleoplasm. Both the RA-dependent interaction of RAR with RaRF and RAR translocation to the nucleolus were disrupted by E1A. RaRF-mediated RAR repression was impaired by wild-type E1A, but not by the RaRF binding-defective E1A mutant. Taken together, our data suggest that E1A is sequestered to the nucleolus by RaRF through a specific interaction, thereby leaving RAR in the nucleoplasm for transcriptional activation.

  13. Studies on sup(226) Ra and sup(210) Pb activities and the concentration factors of sup(226) Ra in the surface organic layers of the estuarine sediments of Mindola and Purna rivers in India

    Digital Repository Service at National Institute of Oceanography (India)

    Joshi, L.U.; Zingde, M.D.; Desai, B.N.

    consumed by humans The sampling techniques, experimental procedures and the distribution of the isotopes of sup(226) Ra and sup(210) Pb in the estuarine regions and the concentration factors of sup(226) Ra in the region are detailed....

  14. Early administration of IL-6RA does not prevent radiation-induced lung injury in mice

    Directory of Open Access Journals (Sweden)

    Inoue Takehiro

    2010-04-01

    Full Text Available Abstract Background Radiation pneumonia and subsequent radiation lung fibrosis are major dose-limiting complications for patients undergoing thoracic radiotherapy. Interleukin-6 (IL-6 is a pleiotropic cytokine and plays important roles in the regulation of immune response and inflammation. The purpose of this study was to investigate whether anti-IL-6 monoclonal receptor antibody (IL-6RA could ameliorate radiation-induced lung injury in mice. Methods BALB/cAnNCrj mice having received thoracic irradiation of 21 Gy were injected intraperitoneally with IL-6RA (MR16-1 or control rat IgG twice, immediately and seven days after irradiation. Enzyme-linked immunosorbent assay was used to examine the plasma level of IL-6 and serum amyloid A (SAA. Lung injury was assessed by histological staining with haematoxylin and eosin or Azan, measuring lung weight, and hydroxyproline. Results The mice treated with IL-6RA did not survive significantly longer than the rat IgG control. We observed marked up-regulation of IL-6 in mice treated with IL-6RA 150 days after irradiation, whereas IL-6RA temporarily suppressed early radiation-induced increase in the IL-6 release level. Histopathologic assessment showed no differences in lung section or lung weight between mice treated with IL-6RA and control. Conclusions Our findings suggest that early treatment with IL-6RA after irradiation alone does not protect against radiation-induced lung injury.

  15. Early administration of IL-6RA does not prevent radiation-induced lung injury in mice.

    Science.gov (United States)

    Ogata, Toshiyuki; Yamazaki, Hideya; Teshima, Teruki; Kihara, Ayaka; Suzumoto, Yuko; Inoue, Takehiro; Nishimoto, Norihiro; Matsuura, Nariaki

    2010-04-07

    Radiation pneumonia and subsequent radiation lung fibrosis are major dose-limiting complications for patients undergoing thoracic radiotherapy. Interleukin-6 (IL-6) is a pleiotropic cytokine and plays important roles in the regulation of immune response and inflammation. The purpose of this study was to investigate whether anti-IL-6 monoclonal receptor antibody (IL-6RA) could ameliorate radiation-induced lung injury in mice. BALB/cAnNCrj mice having received thoracic irradiation of 21 Gy were injected intraperitoneally with IL-6RA (MR16-1) or control rat IgG twice, immediately and seven days after irradiation. Enzyme-linked immunosorbent assay was used to examine the plasma level of IL-6 and serum amyloid A (SAA). Lung injury was assessed by histological staining with haematoxylin and eosin or Azan, measuring lung weight, and hydroxyproline. The mice treated with IL-6RA did not survive significantly longer than the rat IgG control. We observed marked up-regulation of IL-6 in mice treated with IL-6RA 150 days after irradiation, whereas IL-6RA temporarily suppressed early radiation-induced increase in the IL-6 release level. Histopathologic assessment showed no differences in lung section or lung weight between mice treated with IL-6RA and control. Our findings suggest that early treatment with IL-6RA after irradiation alone does not protect against radiation-induced lung injury.

  16. U-238 - Th-230 - Ra-226 disequilibria in volcanics: A new insight into melting conditions

    Science.gov (United States)

    Chabaux, Francois; Allegre, Claude J.

    1994-08-01

    Using new mass spectrometry techniques developed for the analysis of Ra isotopes, we present U-238 - Th-230 - Ra-226 disequilibria data from a variety of volcanic settings, and compare them with previously published data. Two correlations are observed with alkali volcanic data, one between (Th-230/U-238) and (Th-230/Ra-226) and another between the intensity of the disequilibria and the buoyancy flux of the underlying plume. These two correlations prove that partial melting is the major cause of U-Th-Ra fractionations in this volcanic context. The U-238 - Th-230 - Ra-226 disequilibria then place new constraints on some parameters of the classical melting models (batch melting and dynamic melting). The comparison of U-238 - Th-230 - Ra-226 disequilibria in alkali volcanics, carbonatites and subduction zones shows a clear parallel between the disequilibria value and the type of volcanic context. Such a parallel reflects the diversity of the conditions of magma generation, and shows that the U-238 - Th-230 - Ra-226 disequilibria systematics are very dependent on the chemical composition of liquids produced during magmatic processes. A systematic difference is observed between disequilibria in MORB and in alkali volcanics, which could indicate that the melting processes in these two volcanic contexts are very different.

  17. Sanshool on The Fingertip Interferes with Vibration Detection in a Rapidly-Adapting (RA) Tactile Channel

    Science.gov (United States)

    Kuroki, Scinob; Hagura, Nobuhiro; Nishida, Shin’ya; Haggard, Patrick; Watanabe, Junji

    2016-01-01

    An Asian spice, Szechuan pepper (sanshool), is well known for the tingling sensation it induces on the mouth and on the lips. Electrophysiological studies have revealed that its active ingredient can induce firing of mechanoreceptor fibres that typically respond to mechanical vibration. Moreover, a human behavioral study has reported that the perceived frequency of sanshool-induced tingling matches with the preferred frequency range of the tactile rapidly adapting (RA) channel, suggesting the contribution of sanshool-induced RA channel firing to its unique perceptual experience. However, since the RA channel may not be the only channel activated by sanshool, there could be a possibility that the sanshool tingling percept may be caused in whole or in part by other sensory channels. Here, by using a perceptual interference paradigm, we show that the sanshool-induced RA input indeed contributes to the human tactile processing. The absolute detection thresholds for vibrotactile input were measured with and without sanshool application on the fingertip. Sanshool significantly impaired detection of vibrations at 30 Hz (RA channel dominant frequency), but did not impair detection of higher frequency vibrations at 240 Hz (Pacinian-corpuscle (PC) channel dominant frequency) or lower frequency vibrations at 1 Hz (slowly adapting 1 (SA1) channel dominant frequency). These results show that the sanshool induces a peripheral RA channel activation that is relevant for tactile perception. This anomalous activation of RA channels may contribute to the unique tingling experience of sanshool. PMID:27935970

  18. Agressividade de três raças de Cercospora sojina em folhas de soja

    Directory of Open Access Journals (Sweden)

    Juliane Nicolodi Camera

    2014-06-01

    Full Text Available Este trabalho teve como objetivo avaliar a patogenicidade e a agressividade de três raças de Cercospora sojina, em dois cultivares de soja, BMX Magna e Bragg. Para isso, preparou-se suspensão, na concentração de 40 x 10³ conídio mL-1, para inoculação das plantas. Quinze dias após a inoculação com o fungo, verificou-se que a severidade e o número de lesões por folíolo, para a raça 23, não apresentaram diferenças estatísticas entre os cultivares. Para as raças 24 e 25, o cultivar BMX Magna apresentou maior valor do grau de infecção, diferindo estatisticamente daquele do cultivar Bragg. Com relação ao diâmetro das lesões, para a raça 23, o cultivar Bragg apresentou maior valor, para a raça 24, o maior valor ocorreu em BMX Magna e para a raça 25, não houve diferença estatística entre os cultivares. Portanto, as raças de C. sojina são patogênicas para os dois cultivares de soja e há diferença de agressividade entre elas, sendo as raças 24 e 25 mais agressivas do que a raça 23.

  19. Guayaquil au temps du choléra

    Directory of Open Access Journals (Sweden)

    1996-01-01

    Full Text Available L’épidémie de choléra survenue en 1991 en Équateur a frappé certaines villes et régions plus que d’autres sur la Côte. Guayaquil, la première ville du pays par le nombre de ses habitants (1 600 000 habitants, a connu le record de cas. L’analyse de la répartition des malades hospitalisés dans la ville montre que les quartiers pauvres, récents et, de surcroît, bâtis sur les eaux polluées du delta ne sont pas les plus frappés alors que la zone centrale taudifiée a concentré un nombre de cas élevé. Les pratiques sociales sont-elles davantage responsables de cette situation que les facteurs pourtant très contraignants ici de l’environnement ? GUAYAQUIL EN LOS TIEMPOS DEL CÓLERA. La epidemia del cólera, ocurrida en 1991 en Ecuador, ha golpeado mucho más algunas ciudades y regiones de la Costa. Guayaquil, la primera ciudad del país con 1 600 000 habitantes, ha conocido un número de casos record. El análisis de la distribución de los enfermos hospitalizados en la ciudad revela que los barrios pobres, recientes y además construidos sobre las aguas contaminadas del delta no son los más afectados por esta epidemia en relación con la parte central tugurizada. Las prácticas sociales tal vez tienen más responsabilidad en esta situación que las condiciones particularmente difíciles del medio ambiente. GUAYAQUIL DURING THE CHOLERA. The cholera epidemic, which occured in 1991, impacted some cities and regions of the coast much more than others. Guayaquil, inhabitants Ecuador's largest city with a population of some 1, 6000 000 inhabitants, experienced a record number of cases. An analysis of the sick hospitalized in this city reveals that the poor urban sections, which were built recently and moreover were constructed upon the contaminated waters of the delta, were not the most affected by this epidemic, particularly when compared to the congested central part of the city. This suggests that social practices were more

  20. Localization of powdery mildew resistance gene Ml-ra on barley chromosome 5

    DEFF Research Database (Denmark)

    Doll, Hans; Jensen, Hans Peter

    1986-01-01

    Evidence is presented that the powdery mildew resistance gene called Ml-(41/145) represents a unique, unnamed locus, which we suggest to be designated Ml-ra with reference to variety 'Ragusa b' [Hordeum vulgare]. Ml-ra is located on the short arm of chormosome 5 near powdery mildew resistance locus...... Ml-a and the seed storage protein loci Hor1 and Hor2. The most likely order of the loci is Hor1, Ml-a, Ml-ra, and Hor2....

  1. A shared HLA-DRB1 sequence confers RA susceptibility in Greeks.

    Science.gov (United States)

    Carthy, D; Ollier, W; Papasteriades, C; Pappas, H; Thomson, W

    1993-10-01

    Previous serological studies of Greek rheumatoid arthritis (RA) patients have failed to demonstrate an association with DR4. Using sequence specific oligonucleotide typing we have identified the DRB1 alleles in panels of Greek RA patients and controls. When patient and control HLA-DRB1 frequencies were compared, significantly higher frequencies of DRB1*0101 (23.3% vs. 7.0%, odds ratio [OR] 4.0, 95% confidence intervals [CI] 1.4-12.0) and DRB1*1001 (20.9% vs. 5.8%, OR 4.3, 95% CI 1.3-13.7) were found in RA patients compared with controls. No association of DRB1*04 with RA was observed (20.9% vs. 14.0% in controls) confirming earlier reports. However DRB1*04 subtyping demonstrated a small but significant increase of DRB1*0405 in patients (14.0% vs. 3.5%, OR 4.5, 95% CI 1.1-18.9). When the frequency of individuals carrying the shared RA susceptibility epitope was compared between patients and controls it was found to be significantly higher in RA patients (60.5% vs. 22.1%, OR 5.4, 95% CI 2.4-12.0). We conclude that the shared epitope is significantly associated with RA in this population, but that it is predominantly accounted for by DRB1*0101 and DRB1*1001. Previous studies of UK RA patients have demonstrated a negative association of DR2 with disease and articular erosions. HLA-DR2 variants, DRB1*1501 and *1502 are not at reduced frequency in Greek RA patients (DRB1*1501, 14.0% in patients vs. 7.0% in controls; DRB1*1502, 7.0% in patients vs. 7.0% in controls). Genes conferring RA resistance may be in linkage disequilibrium with DR2 in UK patients. This does not appear to be the case in Greek RA patients. No association was seen between RA and HLA-DPB1 type.

  2. Complete genome sequence of the biofilm-forming Microbacterium sp. strain BH-3-3-3, isolated from conventional field-grown lettuce (Lactuca sativa) in Norway.

    Science.gov (United States)

    Dees, Merete Wiken; Brurberg, May Bente; Lysøe, Erik

    2017-03-01

    The genus Microbacterium contains bacteria that are ubiquitously distributed in various environments and includes plant-associated bacteria that are able to colonize tissue of agricultural crop plants. Here, we report the 3,508,491 bp complete genome sequence of Microbacterium sp. strain BH-3-3-3, isolated from conventionally grown lettuce (Lactuca sativa) from a field in Vestfold, Norway. The nucleotide sequence of this genome was deposited into NCBI GenBank under the accession CP017674.

  3. Luminescent Properties of Tetrakis (1-(2-Thenoy)3,3,3-Trifluoracetate) Europium N-Hexadecyl Pyridinium in Modified Si-MCM-41

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Eu(TTA)4CsHsNC16H33 (TTA:1-(2-Thenoy)-3,3,3-Trifluoracetate) isencapsulated in Si-MCM41 modified with N-(3-Trimethoxysilethyl)ethylenediamine. The emission spectrum of the assembly shows only a 5D0→7F2 transition. As compared with the rare earth complex itself, the lifetime of the assembly becomes longer and its stability under the UV radiation is much better.

  4. Gamma spectrometry used for analysis of {sup 228}Ra in water; Utilizacao de espectrometria gama para analise de {sup 228} Ra nas aguas

    Energy Technology Data Exchange (ETDEWEB)

    Mancini, Luis Henrique [UNESP, Rio Claro, SP (Brazil). Inst. de Geociencias e Ciencias Exatas; Bonotto, Daniel Marcos [UNESP, Rio Claro, SP (Brazil). Inst. de Geociencias e Ciencias Exatas. Dept. de Petrologia e Metalogenia

    1998-07-01

    A methodology for determination of the natural isotope {sup 228}Ra in water by using the characterization of the underground and superficial waters from thorium an rare earths mineralization at Morro do Ferro, Pocos de Caldas, state of Minas Gerais, Brazil. The values determined for the {sup 228}Ra in water from 5 logging holes ranged from 0.5 to 391.2 pCi/l and the superficial waters presented a variation of 1.0 to 13.9 pCi/l.

  5. 210Pb- 226Ra and 228Ra- 232Th systematics in young arc lavas: implications for magma degassing and ascent rates

    Science.gov (United States)

    Turner, Simon; Black, Stuart; Berlo, Kim

    2004-10-01

    New data show that island arc rocks have ( 210Pb/ 226Ra) o ratios which range from as low as 0.24 up to 2.88. In contrast, ( 228Ra/ 232Th) appears always within error of 1 suggesting that the large 226Ra-excesses observed in arc rocks were generated more than 30 years ago. This places a maximum estimate on melt ascent velocities of around 4000 m/year and provides further confidence that the 226Ra excesses reflect deep (source) processes rather than shallow level alteration or seawater contamination. Conversely, partial melting must have occurred more than 30 years prior to eruption. The 210Pb deficits are most readily explained by protracted magma degassing. Using published numerical models, the data suggest that degassing occurred continuously for periods up to several decades just prior to eruption but no link with eruption periodicity was found. Longer periods are required if degassing is discontinuous, less than 100% efficient or if magma is recharged or stored after degassing. The long durations suggest much of this degassing occurs at depth with implications for the formation of hydrothermal and copper-porphyry systems. A suite of lavas erupted in 1985-1986 from Sangeang Api volcano in the Sunda arc are characterised by deficits of 210Pb relative to 226Ra from which 6-8 years of continuous 222Rn degassing would be inferred from recent numerical models. These data also form a linear ( 210Pb)/Pb-( 226Ra)/Pb array which might be interpreted as a 71-year isochron. However, the array passes through the origin suggesting displacement downwards from the equiline in response to degassing and so the slope of the array is inferred not to have any age significance. Simple modelling shows that the range of ( 226Ra)/Pb ratios requires thousands of years to develop consistent with differentiation occurring in response to cooling at the base of the crust. Thus, degassing post-dated, and was not responsible for magma differentiation. The formation, migration and extraction

  6. ScaRaB (Scanner for Radiation Budget). Final report; Das Strahlungsbilanzradiometer ScaRaB (Scanner for Radiation Budget). Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, J. [VEGA Informations-Technologien GmbH, Darmstadt (Germany); Hollmann, R.; Stuhlmann, R.; Raschke, E. [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Inst. fuer Atmosphaerenphysik

    2000-07-01

    A new radiometer for radiation budget measurements (scanner for radiation budget, (ScaRaB)) was developed within a German-French-Russian framework. In 1994/1995 the first instrument was launched on the METEOR satellite. The 2{sup nd} instrument was then launched in 1998 on the sunsynchronous Resurs satellite. The report describes the work done at GKSS within the ScaRaB project: calibration and validation. It gives an overview of related international and national research programmes and the future usefulness of the derived products to the scientific community. The work was funded by DLR under the contract number: FKZ 50-EE-9218. (orig.)

  7. VizieR Online Data Catalog: Thin disk BV-GV Hipparcos stars within 333pc (Gontcharov+, 2012)

    Science.gov (United States)

    Gontcharov, G. A.

    2016-01-01

    The variations of kinematic parameters with age are considered for a sample of 15402 thin-disk O-F stars with accurate RA, DEC, proper motion, and parallax higher than 3 mas from the Hipparcos catalogue (2007A&A...474..653V) and radial velocities from the PCRV (2006PAZh...32..844G) catalogue. The ages have been calculated from the positions of the stars on the Hertzsprung-Russell diagram relative to the isochrones from the Padova database (http://stev.oapd.inaf.it/cmd) by taking into account the extinction from the previously constructed 3D analytical model (2009AstL...35..780G) and extinction coefficient RV from the 3D map of its variations (2012AstL...38...12G). Smooth, mutually reconciled variations of the velocity dispersions sigma(U), sigma(V), sigma(W), solar motion components Usun, Vsun, Wsun, Ogorodnikov-Milne model parameters, Oort constants, and vertex deviation lxy consistent with all of the extraneous results for which the stellar ages were determined have been found and presented in the table solution.dat. The velocity dispersion variations are well fitted by power laws the deviations from which are explained by the influence of predominantly radial stellar streams: Sirius, Hyades, alpha Cet/Wolf 630, and Hercules. The accuracy of determining the solar motion relative to the local standard of rest is shown to be fundamentally limited due to these variations of stellar kinematics. The deviations of our results from those of Dehnen and Binney (1998MNRAS.294..429D), the Geneva-Copenhagen survey of dwarfs (V/117), and the Besancon model of the Galaxy (2003A&A...409..523R) are explained by the use of PCRV radial velocities with corrected systematic errors. (2 data files).

  8. Peeter ei võta lapsi ära / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Vastukaja ajalehes "Eesti Ekspress" 29. märtsil ilmunud artiklile "Peeter Kreitzberg: võtame vaestelt lapsed ära!" ja ajalehes "SL Õhtuleht" ilmunud Imbi Paju artiklile "Põhjala igavus ja Eesti hiilgus"

  9. Püha Birgitta keskus : Merivälja tee 18, Tallinn / Ra Luhse

    Index Scriptorium Estoniae

    Luhse, Ra, 1964-

    2001-01-01

    Arhitektuur ja sisekujundus: Arhitektibüroo Luhse & Tuhal. Arhitektid Ra Luhse, Tanel Tuhal. Konstruktsioonid: Teinos OÜ. Ehitaja: AS FKSM. Projekt 1997-1999, klooster valmis 2001. 2 ill.: välisvaated

  10. Towards a precise measurement of atomic parity violation in a single Ra{sup +} ion

    Energy Technology Data Exchange (ETDEWEB)

    Nunez Portela, M., E-mail: nunez@kvi.nl; Berg, J. E. van den; Bekker, H.; Boell, O.; Dijck, E. A.; Giri, G. S.; Hoekstra, S.; Jungmann, K.; Mohanty, A.; Onderwater, C. J. G.; Santra, B.; Schlesser, S.; Timmermans, R. G. E.; Versolato, O. O.; Wansbeek, L. W.; Willmann, L.; Wilschut, H. W. [Kernfysisch Versneller Instituut (KVI) (Netherlands)

    2013-03-15

    A single trapped Ra{sup + } (Z = 88) ion provides a very promising route towards a most precise measurement of Atomic Parity Violation (APV), since APV effects grow faster than Z{sup 3}. This experiment promises the best determination of the electroweak coupling constant at the lowest accessible energies. Such a measurement provides a sensitive test of the Standard Model in particle physics. At the present stage of the experiment, we focus on trapping and laser cooling stable Ba{sup + } ions as a precursor for radioactive Ra{sup + }. Online laser spectroscopy of the isotopes {sup 209 - 214}Ra{sup + } in a linear Paul trap has provided information on transition wavelengths, fine and hyperfine structures and excited state lifetimes as test of atomic structure calculations. Additionaly, a single trapped Ra{sup + } ion could function as a very stable clock.

  11. Ajakohatu küsimine kunsti algupära järele / Leo Luks

    Index Scriptorium Estoniae

    Luks, Leo, 1976-

    2002-01-01

    Rets.: Martin Heidegger. Kunstiteose algupära. Saksa keelest tõlkinud Ülo Matjus. Tartu, 2002 (Avatud Eesti Raamat). Konkreetse Heideggeri teose mõistmiseks vajalikust taustast. Kogumikust - Kaasaegne poliitiline filosoofia

  12. Hispaania võib oma väed Iraagist ära tuua / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Hispaania parlamendivalimised võitnud sotsialistliku partei liider, arvatav uus peaminister Jose Luis Rodriguez Zapatero lubas Hispaania väed Iraagist ära tuua. Diagrammid: Hispaania valimistulemused

  13. Ajakohatu küsimine kunsti algupära järele / Leo Luks

    Index Scriptorium Estoniae

    Luks, Leo, 1976-

    2002-01-01

    Rets.: Martin Heidegger. Kunstiteose algupära. Saksa keelest tõlkinud Ülo Matjus. Tartu, 2002 (Avatud Eesti Raamat). Konkreetse Heideggeri teose mõistmiseks vajalikust taustast. Kogumikust - Kaasaegne poliitiline filosoofia

  14. Hispaania võib oma väed Iraagist ära tuua / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Hispaania parlamendivalimised võitnud sotsialistliku partei liider, arvatav uus peaminister Jose Luis Rodriguez Zapatero lubas Hispaania väed Iraagist ära tuua. Diagrammid: Hispaania valimistulemused

  15. Activity concentrations of Rn-222, Ra-226, Ra-228, U-238 and Cs-137 in water samples of Styria/Austria; Aktivitaetskonzentrationen von Rn-222, Ra-226, Ra-228, U-238 und Cs-137 in Wasserproben aus der Steiermark/Oesterreich

    Energy Technology Data Exchange (ETDEWEB)

    Pichl, E. [Verein zur Foerderung der Strahlenforschung Oesterreich, Graz (Austria). Strahlenmesstechnik Graz; Rauch, P. [Land Steiermark (Austria). Abt. 15 - Energie, Wohnbau, Technik

    2015-07-01

    Activity concentrations of radon (Rn-222), radium (Ra-226, Ra-228), uranium (U-238), and radiocesium (Cs-137), were determined in 50 water samples from different geogenic regions of Styria/Austria. Samples were collected in the years 2010, 2011 and 2012, by experts of the Styrian government. For measuring activities of U-238 we used a low energy-semiconductor detector, and a high purity-semiconductor detector to analyze the activities of all the other radionuclides. More than 90% of the activity concentrations of Rn-222 in all water samples were lower than 50 Bq/l. All activity concentrations observed for radium and uranium were lower than the detection limits of the corresponding radionuclides (Ra-226: 0,02 Bq/l, Ra-228: 0,03 Bq/l, U-238: 0,06 Bq/l). None of the water samples were contaminated by Cs-137.

  16. Peeter ei võta lapsi ära / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Vastukaja ajalehes "Eesti Ekspress" 29. märtsil ilmunud artiklile "Peeter Kreitzberg: võtame vaestelt lapsed ära!" ja ajalehes "SL Õhtuleht" ilmunud Imbi Paju artiklile "Põhjala igavus ja Eesti hiilgus"

  17. Release of 226Ra from uranium mill tailings by microbial Fe(III) reduction

    Science.gov (United States)

    Landa, E.R.; Phillips, E.J.P.; Lovley, D.R.

    1991-01-01

    Uranium mill tailings were anaerobically incubated in the presence of H2 with Alteromonas putrefaciens, a bacterium known to couple the oxidation of H2 and organic compounds to the reduction of Fe(III) oxides. There was a direct correlation between the extent of Fe(III) reduction and the accumulation of dissolved 226Ra. In sterile tailings in which Fe(III) was not reduced, there was negligible leaching of 226Ra. The behavior of Ba was similar to that of Ra in inoculated and sterile systems. These results demonstrate that under anaerobic conditions, microbial reduction of Fe(III) may result in the release of dissolved 226Ra from uranium mill tailings. ?? 1991.

  18. I-RaCM: A Fully Integrated Risk and Lifecycle Cost Model Project

    Data.gov (United States)

    National Aeronautics and Space Administration — SpaceWorks Engineering, Inc. (SEI) proposes development of the Integrated Risk and Cost Model I-RaCM, as the innovation to meet the need for integrated cost and risk...

  19. Factors affecting {sup 223}Ra therapy: clinical experience after 532 cycles from a single institution

    Energy Technology Data Exchange (ETDEWEB)

    Etchebehere, Elba C. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States); Campinas State University (Unicamp), Department of Nuclear Medicine, Campinas (Brazil); Milton, Denai R. [The University of Texas MD Anderson Cancer Center, Department of Biostatistics, Houston, TX (United States); Araujo, John C. [The University of Texas MD Anderson Cancer Center, Department of Genitourinary Medical Oncology, Houston, TX (United States); Swanston, Nancy M.; Macapinlac, Homer A.; Rohren, Eric M. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States)

    2016-01-15

    The aim of this study was to identify baseline features that predict outcome in {sup 223}Ra therapy. We retrospectively reviewed 110 patients with metastatic castration-resistant prostate cancer treated with {sup 223}Ra. End points were overall survival (OS), progression-free survival (PFS), bone event-free survival (BeFS), and bone marrow failure (BMF). The following parameters were evaluated prior to the first {sup 223}Ra cycle: serum levels of hemoglobin (Hb), prostate-specific antigen (PSA), alkaline phosphatase (ALP), Eastern Cooperative Oncology Group (ECOG) status, pain score, use of chemotherapy, and external beam radiation therapy (EBRT). During/after {sup 223}Ra we evaluated: the total number of radium cycles (Ra{sub Tot}), the PSA doubling time (PSA{sub DT}), and the use of chemotherapy, EBRT, abiraterone, and enzalutamide. A significant reduction of ALP (p < 0.001) and pain score (p = 0.041) occurred throughout the {sup 223} Ra cycles. The risk of progression was associated with declining ECOG status [hazard ratio (HR) = 3.79; p < 0.001] and decrease in PSA{sub DT} (HR = 8.22; p < 0.001). Ra{sub Tot}, ALP, initial ECOG status, initial pain score, and use of abiraterone were associated with OS (p ≤ 0.008), PFS (p ≤ 0.003), and BeFS (p ≤ 0.020). Ra{sub Tot}, ALP, initial ECOG status, and initial pain score were significantly associated with BMF (p ≤ 0.001) as well as Hb (p < 0.001) and EBRT (p = 0.009). On multivariable analysis, only Ra{sub Tot} and abiraterone remained significantly associated with OS (p < 0.001; p = 0.033, respectively), PFS (p < 0.001; p = 0.041, respectively), and BeFS (p < 0.001; p = 0.019, respectively). Additionally, Ra{sub Tot} (p = 0.027) and EBRT (p = 0.013) remained significantly associated with BMF. Concomitant use of abiraterone and {sup 223}Ra seems to have a beneficial effect, while the EBRT may increase the risk of BMF. (orig.)

  20. Study of natural radionuclides - {sup 226}Ra, {sup 228}Ra and {sup 210}PB - in marine sediment cores from Southwest Atlantic during the Holocene; Estudo dos radionuclideos naturais - Ra226, Ra-228 e Pb-210 - em alguns registros sedimentares do Atlantico sudoeste ao longo do holoceno

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Alice Miranda Ribeiro

    2016-07-01

    Natural radionuclides from {sup 238}U and {sup 232}Th series have been successfully applied as tracers of environmental process and climate changes. The {sup 210}Pb (half-life of 22.2 years) is used in the geochronological dating technique of sediment cores of the last 100-150 years, and its respective sedimentation rate determination. The study of {sup 226}Ra and {sup 228}Ra concentrations (half-lives of 1,600 years and 5.75 years, respectively) helps calculate the activity of {sup 210}Pb in excess in the environment, besides being important tracers of marine processes, as ground water discharge. In this work it was determined the activity concentrations of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in four short marine cores collected since the continental platform to upper slope of Southwest Atlantic Ocean. Taking into account the results obtained, sedimentation rates and the ages of each sediment layer were determined using the geochronological dating method with {sup 210}Pb. All sediment samples were total acid digested in microwave. The sequential radiochemical separation of {sup 226}Ra, {sup 228}Ra, {sup 210}Pb were performed, obtaining in the end the precipitation of Ba(Ra)SO{sub 4} and PbCrO{sub 4}. The gross α measurements of {sup 226}Ra and gross β measurements of {sup 228}Ra and {sup 210}Pb from the precipitates were carried out in a gas-flow low background proportional counter. Concerning all cores analyzed, the activities concentrations of {sup 226}Ra ranged from 14 Bq.kg{sup -1} to 154 Bq.kg{sup -1}; the concentrations of {sup 228}Ra ranged from 17 Bq.kg{sup -1} to 45 Bq.kg{sup -1}; and the concentrations of {sup 210}Pb ranged from 20 Bq.kg{sup -1} to 2,073 Bq.kg{sup -1}. High values of {sup 210}Pb were observed on the top of all the cores studied, mainly related to atmospheric deposition. The results obtained in this work were of the same order of magnitude of those reported in the literature available on non contaminated areas of Southeast

  1. Participation of glutamate-333 of the D1 polypeptide in the ligation of the Mn₄CaO₅ cluster in photosystem II.

    Science.gov (United States)

    Service, Rachel J; Yano, Junko; Dilbeck, Preston L; Burnap, Robert L; Hillier, Warwick; Debus, Richard J

    2013-11-26

    In the 1.9 Å structural model of photosystem II (PDB: 3ARC), the amino acid residue Glu333 of the D1 polypeptide coordinates to the oxygen-evolving Mn₄CaO₅ cluster. This residue appears to be highly significant in that it bridges the two Mn ions (Mn(B3) and the "dangling" Mn(A4)) that are also bridged by the oxygen atom O5. This oxygen atom has been proposed to be derived from one of two substrate water molecules and to become incorporated into the product dioxygen molecule during the final step in the catalytic cycle. In addition, the backbone nitrogen of D1-Glu333 interacts directly with a nearby Cl⁻ atom. To further explore the influence of this structurally unique residue on the properties of the Mn₄CaO₅ cluster, the D1-E333Q mutant of the cyanobacterium Synechocystis sp. PCC 6803 was characterized with a variety of biophysical and spectroscopic methods, including polarography, EPR, X-ray absorption, and FTIR difference spectroscopy. The kinetics of oxygen release in the mutant were essentially unchanged from those in wild-type. In addition, the oxygen flash yields exhibited normal period-four oscillations having normal S state parameters, although the yields were lower, indicative of the mutant's lower steady-state dioxygen evolution rate of approximately 30% compared to that of the wild-type. The S₁ state Mn-XANES and Mn-EXAFS and S₂ state multiline EPR signals of purified D1-E333Q PSII core complexes closely resembled those of wild-type, aside from having lower amplitudes. The S(n+1)-minus-S(n) FTIR difference spectra showed only minor alterations to the carbonyl, amide, and carboxylate stretching regions. However, the mutation eliminated a negative peak at 3663 cm⁻¹ in the weakly H-bonding O-H stretching region of the S₂-minus-S₁ FTIR difference spectrum and caused an approximately 9 cm⁻¹ downshift of the negative feature in this region of the S₁-minus-S₀ FTIR difference spectrum. We conclude that fully functional Mn

  2. Contrasting genetic association of IL2RA with SLE and ANCA – associated vasculitis

    Directory of Open Access Journals (Sweden)

    Todd John A

    2009-03-01

    Full Text Available Abstract Background Autoimmune diseases are complex and have genetic and environmental susceptibility factors. The objective was to test the genetic association of systemic lupus erythematosus (SLE and anti-neutrophil cytoplasmic antibody (ANCA – associated systemic vasculitis (AAV with SNPs in the IL2RA region and to correlate genotype with serum levels of IL-2RA. Methods Using a cohort of over 700 AAV patients, two SLE case-control studies and an SLE trio collection (totalling over 1000 SLE patients, and a TaqMan genotyping approach, we tested 3 SNPs in the IL2RA locus, rs11594656, rs2104286 & rs41295061, each with a prior association with autoimmune disease; rs11594656 and rs41295061 with type 1 diabetes (T1D and rs2104286 with multiple sclerosis (MS and T1D. Results We show that SLE is associated with rs11594656 (P = 3.87 × 10-7 and there is some evidence of association of rs41295061 with AAV (P = 0.0122, which both have prior association with T1D. rs2104286, an MS and T1D – associated SNP in the IL2RA locus, is not associated with either SLE or AAV. Conclusion We have confirmed a previous suggestion that the IL2RA locus is associated with SLE and showed some evidence of association with AAV. Soluble IL-2RA concentrations correlate with rs11594656 genotype in quiescent disease in both AAV and SLE. Differential association of autoimmune diseases and SNPs within the IL2RA locus suggests that the IL2RA pathway may prove to play differing, as yet undefined, roles in each disease.

  3. Ra isotopes in trees: Their application to the estimation of heartwood growth rates and tree ages

    Science.gov (United States)

    Hancock, Gary J.; Murray, Andrew S.; Brunskill, Gregg J.; Argent, Robert M.

    2006-12-01

    The difficulty in estimating growth rates and ages of tropical and warm-temperate tree species is well known. However, this information has many important environmental applications, including the proper management of native forests and calculating uptake and release of atmospheric carbon. We report the activities of Ra isotopes in the heartwood, sapwood and leaves of six tree species, and use the radial distribution of the 228Ra/226Ra activity ratio in the stem of the tree to estimate the rate of accretion of heartwood. A model is presented in which dissolved Ra in groundwater is taken up by tree roots, translocated to sapwood in a chemically mobile (ion-exchangeable) form, and rendered immobile as it is transferred to heartwood. Uptake of 232Th and 230Th (the parents of 228Ra and 226Ra) is negligible. The rate of heartwood accretion is determined from the radioactive decay of 228Ra (half-life 5.8 years) relative to long-lived 226Ra (half-life 1600 years), and is relevant to growth periods of up to 50 years. By extrapolating the heartwood accretion rate to the entire tree ring record the method also appears to provide realistic estimates of tree age. Eight trees were studied (three of known age, 72, 66 and 35 years), including three Australian hardwood eucalypt species, two mangrove species, and a softwood pine (P. radiata). The method indicates that the rate of growth ring formation is species and climate dependent, varying from 0.7 rings yr-1 for a river red gum (E. camaldulensis) to around 3 rings yr-1 for a tropical mangrove (X. mekongensis).

  4. Bioavailability of radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb present in the brazilian phosphate fertilizers and phosphogypsum; Avaliacao da biodisponibilidade dos radionuclideos {sup 226}Ra, {sup 228}Ra e {sup 210}Pb presentes nos fertilizantes fosfatados e no fosfogesso de procedencia nacional

    Energy Technology Data Exchange (ETDEWEB)

    Russo, Ana Carolina

    2013-08-01

    Phosphogypsum, also called gypsum, by-product of the phosphate fertilizer industry, can be used as soil conditioner since it provides improvements in the soil-plant system. However, this by-product concentrates radionuclides of the U and Th series, present in the phosphate rock used as raw material, which can impact the environment. In order to study the bioavailability of radionuclides, samples of phosphogypsum and phosphate fertilizers (monoammonium phosphate and triple superphosphate) were analyzed. The concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb were determined by gamma spectrometry. The samples were leached with a mild EDTA solution and the radionuclides present in the final solution were determined by total alpha and beta counting on a gas flow proportional counter. The percentage of extraction varied from 1.6% to 1.7% for {sup 210}Pb, from 0.5% to 1.4% for {sup 226}Ra and from 0.1% to 1.0% for the {sup 228}Ra in phosphogypsum samples. The low percentage of extraction obtained for the radionuclides can be partly explained by the low solubility of phosphogypsum, which ranged from 7.7% to 16%. For the monoammonium phosphate samples the percentage of extraction were less than 26% for {sup 226}Ra, less than 10% for '2{sup 28}Ra and less than 10% for {sup 210}Pb. In spite of the high solubility of 77% of monoammonium phosphate in the EDTA solution, low concentrations of radionuclides were observed in the leached solution. For the triple superphosphate samples, the percentage of extraction was 2.3% for {sup 226}Ra, 1.2% for {sup 228}Ra and 11.3% for {sup 210}Pb. In spite of the high solubility of 66% of triple superphosphate in the EDTA solution, low concentrations of radionuclides were observed in the leached solution. (author)

  5. The space (reorganization in Guaíra after the end of “Sete Quedas”

    Directory of Open Access Journals (Sweden)

    Edson Belo Clemente de Souza

    2007-12-01

    Full Text Available This article analyses the space (re organization in themunicipality of Guaíra – PR after the formation of Itaipu Lakewith consequent immersions of the “Sete Quedas”. Due tothe socio-environmental impact caused by the flood, a newphase of development is going to be implemented in Guaírabased on the Directory Plans of 1980 and 1992, reorganizingthe geographic area of Guaíra in a corollary way.

  6. 226Ra bioavailability to plants at the Urgeiriça uranium mill tailings site.

    Science.gov (United States)

    Madruga, M J; Brogueira, A; Alberto, G; Cardoso, F

    2001-01-01

    Large amounts of solid wastes (tailings) resulting from the exploitation and treatment of uranium ore at the Urgeiriça mine (north of Portugal) have been accumulated in dams (tailing ponds). To reduce the dispersion of natural radionuclides into the environment, some dams were revegetated with eucalyptus (Eucalyptus globolus) and pines (Pinus pinea). Besides these plants, some shrubs (Cytisus spp.) are growing in some of the dams. The objective of this study is to determine the 226Ra bioavailability from uranium mill tailings by quantifying the total and available fraction of radium in the tailings and to estimate its transfer to plants growing on the tailing piles. Plant and tailing samples were randomly collected and the activity concentration of 226Ra in plants (aerial part and roots) and tailings was measured by gamma-spectrometry. The exchangeable fraction of radium in tailings was quantified using one single step extraction with 1 mol dm-3 ammonium acetate (pH = 7) or 1 mol dm-3 calcium chloride solutions. The results obtained for 226Ra uptake by plants show that 226Ra concentration ratios for eucalyptus and pines decrease at low 226Ra concentrations in the tailings and appear relatively constant at higher radium concentrations. For shrubs, the concentration ratios increase at higher 226Ra solid waste concentrations approaching a saturation value. Percentage values of 16.0 +/- 8.3 and 12.9 +/- 8.9, for the fraction of radium extracted from the tailings, using 1 mol dm-3 ammonium acetate or calcium chloride solutions, respectively, were obtained. The 226Ra concentration ratios determined on the basis of exchangeable radium are one order of magnitude higher than those based on total radium. It can be concluded that, at a 95% confidence level, more consistent 226Ra concentration ratios were obtained when calculated on the basis of available radium than when total radium was considered, for all the dams.

  7. Ra{sup +} ion trapping - atomic parity violation measurement and an optical clock

    Energy Technology Data Exchange (ETDEWEB)

    Mohanty, Amita; Dijck, Elwin A.; Nunez Portela, Mayerlin; Valappol, Nivedya; Boell, Oliver; Jungmann, Klaus; Onderwater, Cornelis G. G.; Schlesser, Sophie; Timmermans, Rob G.E.; Willmann, Lorenz; Wilschut, Hans W. [University of Groningen, FWN, Groningen (Netherlands)

    2014-07-01

    A single trapped Ra{sup +} ion has an excellent potential for a precision measurement of the Weinberg mixing angle at low momentum transfer and testing thereby the electroweak running. The absolute frequencies of the transition 7s {sup 2}S{sub 1/2}-7d{sup 2}D{sub 3/2} at wavelength 828 nm have been determined in {sup 212*214}Ra{sup +} to better than 19 MHz with laser spectroscopy on small samples of ions trapped in a linear Paul trap at the online facility TRIμP of KVI. The measurement of the Weinberg angle requires the localization of the ion within a fraction of an optical wavelength. The current experiments are focused on trapping and laser spectroscopy on a single Ba{sup +} as a precursor for Ra{sup +}. Work towards single ion trapping of Ra{sup +}, including the preparation of an offline {sup 223}Ra source is in progress. Most elements of the setup for single Ra+ ion parity measurement are also well suited for realizing a most stable optical clock.

  8. Opium addiction increases interleukin 1 receptor antagonist (IL-1Ra in the coronary artery disease patients.

    Directory of Open Access Journals (Sweden)

    Habibollah Saadat

    Full Text Available BACKGROUND: There is evidence that opium addiction has immunosuppressant effects. Coronary artery disease (CAD is a condition resulted from atherosclerosis which is dependent on the immune response. PURPOSE: To evaluate plasma levels of interleukin-6 and interleukin-1Ra in 30 patients with three-vessel coronary artery disease, ejection fraction of more than 35% and to evaluate their changes after prognostic treadmill test in 15 opium addicted and 15 non-addicted patients. METHODS: The participants underwent prognostic treadmill test and plasma levels of interleukin-6 (IL-6 and interleukin-1Ra (IL-1Ra were evaluated with ELISA method before, just after and 4 hours after the test. RESULTS: IL-1Ra (2183 pg/ml tended to decrease over time in the opium addicted group (1372 pg/ml after prognostic treadmill test and 1034 pg/ml 4 hours after that, although such decrease did not reach the statistical significance. IL-1Ra levels were significantly higher in opium addicted than in non addicted patients. Opium addiction had no significant effect on IL-6 changes. CONCLUSION: Consumption of opium in CAD patients is associated with higher IL-1Ra levels.

  9. Functionalized NaA nanozeolites labeled with {sup 224,225}Ra for targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Piotrowska, Agata, E-mail: a.kasperek@ichtj.waw.pl; Leszczuk, Edyta [Institute of Nuclear Chemistry and Technology (Poland); Bruchertseifer, Frank; Morgenstern, Alfred [Joint Research Centre – European Commission, Institute for Transuranium Elements (Germany); Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology (Poland)

    2013-11-15

    The {sup 223}Ra, {sup 224}Ra, and {sup 225}Ra radioisotopes exhibit very attractive nuclear properties for application in radionuclide therapy. Unfortunately the lack of appropriate bifunctional ligand for radium is the reason why these radionuclides have not found application in receptor-targeted therapy. In the present work, the potential usefulness of the NaA nanozeolite as a carrier for radium radionuclides has been studied. {sup 224}Ra and {sup 225}Ra, α-particle emitting radionuclides, have been absorbed in the nanometer-sized NaA zeolite (30–70 nm) through simple ion exchange. {sup 224,225}Ra-nanozeolites exhibited very high stability in solutions containing physiological salt, EDTA, amino acids, and human serum. To make NaA nanozeolite particles dispersed in water their surface was modified with a silane coupling agent containing poly(ethylene glycol) molecules. This functionalization approach let us covalently attach a biomolecule to the NaA nanozeolite surface.

  10. Molecular characterization of RA68 related potentially to rice flower development

    Institute of Scientific and Technical Information of China (English)

    WU Xiaohuai; WANG Tai

    2004-01-01

    One cDNA whose corresponding mRNA was preferentially accumulated in rice flowers was isolated by PCR-mediated RNA subtraction hybridization and RACE strategy. This gene, termed RA68, consists of three exons and two introns, the putative RA68 protein contained 219amino acid residues with a putative signal peptide and two domains. The N-terminal domain is hydrophilic and rich in proline and threonine embedded in PTPTSYG motifs. The C-terminal domain is hydrophobic. Southern blot and sequence analysis reveal that RA68 exists as one copy in the rice genome and localizes in chromosome 2. Northern hybridization indicates that RA68 is expressed preferentially in buds and flowers, but not in roots and leaves. Furthermore,in situ hybridization indicates that RA68 transcripts are present in pollen mother cells (PMCs), dyad cells, uninucleate pollens and macrospore sacs. Possible functions of RA68 during the flower development are discussed based on its expression and protein structure characteristics.

  11. An easy method for Ra-226 determination in river waters by liquid-scintillation counting

    Science.gov (United States)

    Moreno, H. P.; Vioque, I.; Manjón, G.; García-Tenorio, R.

    1999-01-01

    226Ra activity concentration in river water was determined using a low background liquid scintillation counter. Radium was extracted from the samples as Ra-BaSO4 precipitate which, afterwards, was dissolved with EDTA in ammonia medium. Solution was transferred into a low potassium glass vial and then mixed with a scintillation cocktail. Two different scintillation cocktails were selected for comparison. Efficiency, recovery yield and α/β separation were studied with both liquid scintillation cocktails. One single measurement, made one month after radium separation, allows to calculate the226Ra concentration as well as to assess the presence of alpha contamination of the sample. In the case of negligible interferences,224Ra concentrations can be subsequently evaluated in the same sample by the measurement made just after chemical separation of radium. This method has been applied for the determination of226Ra and224Ra activity concentrations in river water collected from different locations along the Odiel river estuary area (South-west of Spain). The presence of chemical industry, the wastes of which are released into the river, could be connected with radium activity concentration enhancements in the water.

  12. Overview of the Radiation Dosimetry Experiment (RaD-X) flight mission

    Science.gov (United States)

    Mertens, Christopher J.

    2016-11-01

    The NASA Radiation Dosimetry Experiment (RaD-X) stratospheric balloon flight mission addresses the need to reduce the uncertainty in predicting human exposure to cosmic radiation in the aircraft environment. Measurements were taken that characterize the dosimetric properties of cosmic ray primaries, the ultimate source of aviation radiation exposure, and the cosmic ray secondary radiations that are produced and transported to aviation altitudes. In addition, radiation detectors were flown to assess their potential application to long-term, continuous monitoring of the aircraft radiation environment. RaD-X was successfully launched from Fort Sumner, New Mexico (34.5°N, 104.2°W), on 25 September 2015. Over 18 h of science data were obtained from a total of four different type dosimeters at altitudes above 20 km. The RaD-X flight mission was supported by laboratory radiation exposure testing of the balloon flight dosimeters and also by coordinated radiation measurements taken on ER-2 and commercial aircraft. This paper provides the science background and motivation for the RaD-X flight mission, a brief description of the balloon flight profile and the supporting aircraft flights, and a summary of the articles included in the RaD-X special collection and their contributions to the science goals of the RaD-X mission.

  13. CD49d- Treg Cells with High Suppressive Capacity are Remarkably Less Efficient on Activated CD45RA- than on Naive CD45RA+ Teff Cells

    Directory of Open Access Journals (Sweden)

    Britta Kraczyk

    2014-07-01

    Full Text Available Background: Impairment of regulatory T cells (Tregs in common autoimmune diseases seems likely. However, the extent of Treg deficiency (number, function or differential susceptibility of T effector cells (Teffs to suppression is not completely understood. We hypothesize that even in healthy individuals both cell populations are heterogeneous and differ in their suppressive capability and their susceptibility to suppression. Material and Methods: Lymphocytes were enriched by MACS for CD4+CD25+ Tregs or CD4+CD25- Teffs. After multicolour staining (anti-CD25, anti-CD127, anti-CD49d or anti-CD45RA highly purified Treg and Teff subpopulations were collected by FACS. Functional capacity of Tregs or suppressive susceptibility of Teffs was analyzed in an in vitro assay. Results: When CD4+CD25highCD127-/low CD49d- Tregs were tested on naive CD4+CD127+CD25-CD45RA+ Teffs (93.8 % suppression was almost complete, while the suppressive capacity of CD4+CD25highCD127-/low CD49d+ Tregs was significantly less (71.8 %. Suppressive activity was low when CD4+CD25highCD127-/low CD49d+ Tregs were analyzed on CD4+CD127+CD25-CD45RA- Teffs (48.7%. Conclusion: Although CD49d+ Tregs are functional, the suppressive capacity is significantly lower compared to CD49d- Tregs. CD45RA+ Teffs can be completely suppressed, while CD45RA- Teffs display relative resistance. Phenotypic and functional heterogeneity of Tregs as well as Teffs has to be considered when analyzing deficiencies in immune regulation.

  14. Validation of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb measurements in soil and sediment samples through high resolution gamma ray spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Dias, Danila Carrijo da Silva; Silva, Nivaldo Carlos da; Bonifacio, Rodrigo Leandro; Guerrero, Eder Tadeu Zenun [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas

    2013-07-01

    Radionuclides found in ore extraction waste materials are a great source of concern regarding public health and environmental safety. One technique to determine the concentration of substances is high resolution gamma ray spectrometry using HPGe. Validating a measurement technique is essential to warrant high levels of quality to any scientific work. The Laboratory of Pocos de Caldas of the Brazilian Commission for Nuclear Energy partakes into a Quality Management System project, seeking Accreditation under ISO/IEC 17025 through the validation of techniques of chemical and radiometric analysis of environmental samples from water, soil and sediment. The focus of the Radon Laboratory at LAPOC is validation of Ra-226, Ra-228 and Pb-210 concentration determinations in soil and sediment through a gamma spectrometer system. The stages of this validation process included sample reception and preparation, detector calibration and sample analyses. Dried samples were sealed in metallic containers and analyzed after radioactive equilibrium between Ra-226 and daughters Pb-214 and Bi-214. Gamma spectrometry was performed using CANBERRA HPGe detector and gamma spectrum software Genie 2000. The photo peaks used for Ra-226 determination were 609 keV and 1020 keV of Bi-214 and 351 keV of Pb-214. For the Ra-228 determination a photopeak of 911 keV was used from its short half-life daughter Ac-228 (T1/2 = 6.12 h). For Pb-210, the photopeak of 46.5 keV was used, which, due to the low energy, self-absorption correction was needed. Parameters such as precision, bias/accuracy, linearity, detection limit and uncertainty were evaluated for that purpose. The results have pointed to satisfying results. (author)

  15. IL-1RA gene-transfected bone marrow-derived mesenchymal stem cells in APA microcapsules could alleviate rheumatoid arthritis.

    Science.gov (United States)

    Hu, Jianhua; Li, Hongjian; Chi, Guanhao; Yang, Zhao; Zhao, Yi; Liu, Wei; Zhang, Chao

    2015-01-01

    In order to investigate the encapsulation of interleukin 1 receptor antagonist (IL-RA) gene-modified mesenchymal stem cells (MSCs) in alginate-poly-L-lysine (APA) microcapsules for the persistent delivery of interleukin 1 receptor antagonist (IL-RA) to treat Rheumatoid arthritis (RA). We transfect mesenchymal stem cells with IL-RA gene, and quantify the IL-RA proteins released from the encapsulated cells followed by microencapsulation of recombinant mesenchymal stem cells, and thus observe the permeability of APA microcapsules and evaluate clinical effects after induction and treatment of collagen-induced arthritis (CIA). The concentration of IL-RA in the supernatant was determined by IL-RA ELISA kit by run in technical triplicates using samples from three separate mice. Encapsulated IL-RA gene-transfected cells were capable of constitutive delivery of IL-RA proteins for at least 30 days. Moreover, the APA microcapsules could inhibit the permeation of fluorescein isothiocyanate-conjuncted immunoglobulin G. Also, it has been found that the APA microcapsules can significantly attenuate collagen induced arthritis after delivering of APA microcapsules to rats. Our results demonstrated that the nonautologous IL-RA gene-transfected stem cells are of potential utility for RA therapy.

  16. SB-RA-2001 inhibits bacterial proliferation by targeting FtsZ assembly.

    Science.gov (United States)

    Singh, Dipty; Bhattacharya, Anusri; Rai, Ankit; Dhaked, Hemendra Pal Singh; Awasthi, Divya; Ojima, Iwao; Panda, Dulal

    2014-05-13

    FtsZ has been recognized as a promising antimicrobial drug target because of its vital role in bacterial cell division. In this work, we found that a taxane SB-RA-2001 inhibited the proliferation of Bacillus subtilis 168 and Mycobacterium smegmatis cells with minimal inhibitory concentrations of 38 and 60 μM, respectively. Cell lengths of these microorganisms increased remarkably in the presence of SB-RA-2001, indicating that it inhibits bacterial cytokinesis. SB-RA-2001 perturbed the formation of the FtsZ ring in B. subtilis 168 cells and also affected the localization of the late cell division protein, DivIVA, at the midcell position. Flow cytometric analysis of the SB-RA-2001-treated cells indicated that the compound did not affect the duplication of DNA in B. subtilis 168 cells. Further, SB-RA-2001 treatment did not affect the localization of the chromosomal partitioning protein, Spo0J, along the two ends of the nucleoids and also had no discernible effect on the nucleoid segregation in B. subtilis 168 cells. The agent also did not appear to perturb the membrane potential of B. subtilis 168 cells. In vitro, SB-RA-2001 bound to FtsZ with modest affinity, promoted the assembly and bundling of FtsZ protofilaments, and reduced the GTPase activity of FtsZ. GTP did not inhibit the binding of SB-RA-2001 to FtsZ, suggesting that it does not bind to the GTP binding site on FtsZ. A computational analysis indicated that SB-RA-2001 binds to FtsZ in the cleft region between the C-terminal domain and helix H7, and the binding site of SB-RA-2001 on FtsZ resembled that of PC190723, a well-characterized inhibitor of FtsZ. The findings collectively suggested that SB-RA-2001 inhibits bacterial proliferation by targeting the assembly dynamics of FtsZ, and this can be exploited further to develop potent FtsZ-targeted antimicrobials.

  17. Indução de estro em cabras da raça Toggenburg com dois diferentes dispositivos intravaginais Estrous induction in Toggenburg goats using intravaginal devices

    Directory of Open Access Journals (Sweden)

    V.V. Maffili

    2006-06-01

    Full Text Available Doze cabras nulíparas da raça Toggenburg foram distribuídas em dois tratamentos (T1 e T2 para indução do estro. O T1 (n=6 consistiu na inserção da esponja impregnada com 60mg de acetato de medroxiprogesterona, associado à aplicação de 50µg do análogo sintético d-cloprostenol (PGF. No quarto dia, foram aplicadas 250UI de gonadotropina coriônica eqüina (eCG e, no quinto, a esponja foi retirada. O T2 (n=6 diferiu somente quanto ao dispositivo empregado, que foi o CIDR-G®. Seis cabras do T1 e seis do T2 entraram em estro depois da retirada dos dispositivos, sendo que 83,3 (5/6 e 33,3% (2/6 ficaram gestantes em T1 e T2, respectivamente. O intervalo da retirada do dispositivo ao início do estro não diferiu entre tratamentos (P>0,05. As características ovulatórias não foram influenciadas pelos tratamentos. O intervalo da retirada do dispositivo à ovulação, para ambos os protocolos de indução do estro, não diferiu (P>0,05 entre tratamentos. Ambos os dispositivos foram eficientes em induzir o estro.Twelve Toggenburg breed nuliparous female goats were randomly assigned to two treatments intended to induce estrus. On day zero, animals on T1 (n=6 were treated with an intravaginal sponge impregnated with 60mg of medroxyprogesterone acetate plus 50µg of PGF analogue. The T1 goats received eCG (250IU on day 4, and on day 5 the sponge was removed. The T2 goats (n=6 received CIDR-G® as intravaginal sponge plus 50mg of PGF analogue. All goats expressed behavioral estrus, and the pregnancy rates were 83.3 (5/6 and 33.3% (2/6 for T1 and T2, respectively. The interval from withdrawal of the device to onset of estrus did not differ between treatments (P>0.05. Ovulatory traits also were not affected by treatments. The interval between CIDR-G® removal and ovulation for T1 and T2 goats were similar (P>0.05. Both sponge and CIDR-G were equally efficient in inducing the estrus behavior in goats.

  18. Investigations on the activity concentrations of 238U, 226RA, 228RA, 210PB and 40K in Jordan phosphogypsum and fertilizers.

    Science.gov (United States)

    Al-Jundi, J; Al-Ahmad, N; Shehadeh, H; Afaneh, F; Maghrabi, M; Gerstmann, U; Höllriegl, V; Oeh, U

    2008-01-01

    The activity concentrations of naturally occurring radionuclides ((238)U, (226)Ra, (228)Ra, (210)Pb and (40)K) in Jordanian phosphate ore, fertilizer material and phosphogypsum piles were investigated. The results show the partitioning of radionuclides in fertilizer products and phosphogypsum piles. The outcome of this study will enrich the Jordanian radiological map database, and will be useful for an estimation of the radiological impact of this industrial complex on the immediate environment. The activity concentration of (210)Pb was found to vary from 95 +/- 8 to 129 +/- 8 Bq kg(-1) with a mean value of 111 +/- 14 Bq kg(-1) in fertilizer samples, and from 364 +/- 8 to 428 +/- 10 Bq kg(-1) with a mean value of 391 +/- 30 Bq kg(-1) in phosphogypsum samples; while in phosphate wet rock samples, it was found to vary between 621 +/- 9 and 637 +/- 10 Bq kg(-1), with a mean value of 628 +/- 7 Bq kg(-1). The activity concentration of (226)Ra in fertilizer samples (between 31 +/- 4 and 42 +/- 5 Bq kg(-1) with a mean value of 37 +/- 6 Bq kg(-1)) was found to be much smaller than the activity concentration of (226)Ra in phosphogypsum samples (between 302 +/- 8 and 442 +/- 8 Bq kg(-1) with a mean value of 376 +/- 62 Bq kg(-1)). In contrast, the activity concentration of (238)U in fertilizer samples (between 1011 +/- 13 and 1061 +/- 14 Bq kg(-1) with a mean value of 1033 +/- 22 Bq kg(-1)) was found to be much higher than the activity concentration of (238)U in phosphogypsum samples (between 14 +/- 5 and 37 +/- 7 Bq kg(-1) with a mean value of 22 +/- 11 Bq kg(-1)). This indicates that (210)Pb and (226)Ra show similar behaviour, and are concentrated in phosphogypsum piles. In addition, both isotopes enhanced the activity concentration in phosphogypsum piles, while (238)U enhanced the activity concentration in the fertilizer. Due to the radioactivity released from the phosphate rock processing plants into the environment, the highest collective dose commitment for the lungs

  19. Preparation and crystal structure of a new bismuth vanadate, Bi{sub 3.33}(VO{sub 4}){sub 2}O{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Kumada, N., E-mail: kumada@yamanashi.ac.jp [Department of Research Interdisciplinary Graduate School of Medicine and Engineering, University of Yamanashi, Miyamae-cho 7-32, Kofu 400-8511 Japan (Japan); Takei, T.; Haramoto, R.; Yonesaki, Y.; Dong, Q.; Kinomura, N. [Department of Research Interdisciplinary Graduate School of Medicine and Engineering, University of Yamanashi, Miyamae-cho 7-32, Kofu 400-8511 Japan (Japan); Nishimoto, S.; Kameshima, Y.; Miyake, M. [Department of Material and Energy Science, Graduate School of Environmental Science, Okayama University, Tsusima-Naka 3-3-1, Okayama 700-8530 Japan (Japan)

    2011-06-15

    Graphical abstract: Crystal structure of Bi{sub 3.33}(VO{sub 4}){sub 2}O{sub 2}. Solid lines indicate the unit cell. Highlights: {yields} We can prepare a new bismuth vanadate, Bi{sub 3.33}(VO{sub 4}){sub 2}O{sub 2} by hydrothermal reaction using a hydrated sodium bismuthate. {yields} We clarify that the crystal structure is composed by four bismuth atoms with the coordination number of 6 or 8 and two VO{sub 4} tetrahedra. {yields} This compound exhibited photocatalytic behavior for decomposition of phenol under visible light irradiation. -- Abstract: Single crystals of a new bismuth vanadate, Bi{sub 3.33}(VO{sub 4}){sub 2}O{sub 2} was prepared by hydrothermal reaction using a hydrated sodium bismuthate, NaBiO{sub 3}.nH{sub 2}O as one of the starting compounds. The crystal structure was determined by using single crystal X-ray diffraction data. This compound crystallizes in the triclinic space group P1{sup -bar} (no. 2) with a = 7.114(1), b = 7.844(2), c = 9.372(2) A, {alpha} = 106.090(7), {beta} = 94.468(7) and {gamma} = 112.506(8){sup o}, Z = 2 and the final R factors are R1 = 0.052 and wR2 = 0.14 for 2085 unique reflections. The crystal structure is composed by four bismuth atoms with the coordination number of 6 or 8 and two VO{sub 4} tetrahedra, and one of four bismuth atoms is statistically distributed in the splitting sites with the distance of 0.83 A. This compound exhibited photocatalytic behavior for decomposition of phenol under visible light irradiation and its activity was less than that of monoclinic BiVO{sub 4}.

  20. Experimental and quantum chemical studies on the molecular structure of 3,3,3-trifluoropropane-1-sulfonyl chloride: CF3CH2CH2SO2Cl

    Science.gov (United States)

    Galván, J. E.; Defonsi Lestard, M. E.; Tuttolomondo, M. E.; Ben Altabef, A.

    2017-01-01

    The experimental and theoretical study on the molecular and vibrational analysis of CF3CH2CH2SO2Cl, 3,3,3-trifluoropropane-1-sulfonyl chloride is presented. The IR and Raman spectra were recorded in liquid state and compared with the spectral data obtained by the DFT/B3LYP method usingthe6-311G(3df) basis set. The influence of hyperconjugation effects of the lone pairs (LP) chlorine atom on the vibrational behavior of the group SO2 was determined. The TD-DFT approach was applied to assign the electronic transitions observed in the UV-visible spectrum.

  1. Measurement and modeling of density and viscosity of n-octanol-kerosene-phosphoric acid solutions in a temperature range 293.15-333.15 K

    Science.gov (United States)

    Ye, Changwen; Pei, Xiangjun; Liu, J. C.

    2016-12-01

    Densities and viscosities have been measured for the n-octanol + aviation kerosene (AK) + phosphoric acid (H3PO4) system with the mass fraction of H3PO4 in the range from w = 0 to 0.26 and in the temperature of 293.15-333.15 K. According to the experimental data, the measured viscosities were found well correlated with the temperature and mass fraction of H3PO4, which were fitted to regression equations. The result shows that the dilution effect of AK is obvious under the same temperature and mass fraction of H3PO4.

  2. Analytical study of (226)Ra activity concentration in market consuming foodstuffs of Ramsar, Iran.

    Science.gov (United States)

    Gooniband Shooshtari, M; Deevband, M R; Kardan, M R; Fathabadi, N; Salehi, A A; Naddafi, K; Yunesian, M; Nabizadeh Nodehi, R; Karimi, M; Hosseini, S S

    2017-01-01

    Ramsar, a city of Iran located on the coast of the Caspian Sea, has been considered to be enormously important due to its high natural radioactivity levels. People living in High Level Natural Radiation Areas (HLNRAs) have been exposed by several sources, one of which could be foodstuff. However, many studies have been carried out to measure the environmental radioactivity in Ramsar, but no survey has been conducted in all stapled consumed foods yet. This study was dedicated to determine (226)Ra activity concentration in the daily diets of Ramsar residents as a probable exposure. Approximately 70 different market samples were collected during the four seasons based on the daily consumption patterns of residents which have the highest consumption and their availability in the seasons. All samples, after washing, drying and pretreatment, were analyzed for (226)Ra radionuclide determination by α-spectrometry. The mean radioactivity concentration of (226)Ra ranged between 7 ± 1 mBq Kg(-1) wet weight in meat, and 318 ± 118 mBq Kg(-1) for tea dry leaves. The (226)Ra activity concentrations in collected samples varied from below the minimum detectable activity up to 530 ± 30 mBq Kg(-1). To compare the results with United Nations Scientific Committee on Effects of Atomic Radiation (UNSCEAR) reference values, the (226)Ra activity concentrations concluded from the results appear to be higher in milk, chicken and eggs and less in grain products, vegetables, fruits and fish products. These results indicate that no significant (226)Ra contamination is present in market foodstuffs and provide reference values for the foodstuffs in Ramsar. Of the total daily dietary (226)Ra exposure from market consuming foodstuffs for adults in Ramsar, the largest percentage was from wheat. The residents consuming wheat and manufacturing wheat products such as bread, pasta, porridge, crackers, biscuits, pancakes, pies, pastries, cakes, cookies, muffins, rolls, doughnuts, breakfast

  3. Variabilidade isoenzimática em oito raças de milho

    Directory of Open Access Journals (Sweden)

    VALENTE SÉRGIO EMÍLIO DOS SANTOS

    1999-01-01

    Full Text Available Com o objetivo de avaliar a variabilidade genética e as relações de afinidade entre dezenove populações de oito raças de milho (Zea mays L. - as comerciais antigas Cateto Sulino, Cateto Sulino Grosso, Cateto Nortista e Canario de Ocho, e as raças indígenas Moroti, Lenha, Entrelaçado e Caingang - analisaram-se os seguintes sistemas enzimáticos: glutamato oxalacetato transaminase (GOT, esterase (EST e malato desidrogenase (MDH. Observou-se maior semelhança entre as raças pertencentes a um mesmo grupo, mas as populações analisadas não se agruparam de acordo com as raças, classificadas anteriormente segundo caracteres morfológicos. Os sistemas enzimáticos utilizados não permitiram a caracterização individual de cada uma das raças analisadas. As indígenas apresentaram maior variabilidade do que as comerciais antigas quanto ao número de alelos por loco e à porcentagem de locos polimórficos.

  4. RA-RAR-β counteracts myelin-dependent inhibition of neurite outgrowth via Lingo-1 repression.

    Science.gov (United States)

    Puttagunta, Radhika; Schmandke, André; Floriddia, Elisa; Gaub, Perrine; Fomin, Natalie; Ghyselinck, Norbert B; Di Giovanni, Simone

    2011-06-27

    After an acute central nervous system injury, axonal regeneration is limited as the result of a lack of neuronal intrinsic competence and the presence of extrinsic inhibitory signals. The injury fragments the myelin neuronal insulating layer, releasing extrinsic inhibitory molecules to signal through the neuronal membrane-bound Nogo receptor (NgR) complex. In this paper, we show that a neuronal transcriptional pathway can interfere with extrinsic inhibitory myelin-dependent signaling, thereby promoting neurite outgrowth. Specifically, retinoic acid (RA), acting through the RA receptor β (RAR-β), inhibited myelin-activated NgR signaling through the transcriptional repression of the NgR complex member Lingo-1. We show that suppression of Lingo-1 was required for RA-RAR-β to counteract extrinsic inhibition of neurite outgrowth. Furthermore, we confirm in vivo that RA treatment after a dorsal column overhemisection injury inhibited Lingo-1 expression, specifically through RAR-β. Our findings identify a novel link between RA-RAR-β-dependent proaxonal outgrowth and inhibitory NgR complex-dependent signaling, potentially allowing for the development of molecular strategies to enhance axonal regeneration after a central nervous system injury.

  5. Behaviour of {sup 238}U, {sup 234}U, {sup 228}Ra and {sup 226}Ra in rock alterations: study of Morungaba granitoids, SP-Brazil and ground water in its fractures; Comportamento de {sup 238}U, {sup 234}U, {sup 228}Ra e {sup 226}Ra na alteracao de rochas: estudo dos granitoides de Morungaba (SP) e aguas subterraneas de suas fraturas

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Rosana N. dos [Pontificia Univ. Catolica de Sao Paulo, SP (Brazil). Dept. de Fisica]. E-mail: rosana@pucsp.br; Marques, Leila S. [Sao Paulo Univ., SP (Brazil). Inst. de Astronomia, Geofisica e Ciencias Atmosfericas. Dept. de Geofisica]. E-mail: leila@iag.usp.br

    2005-07-01

    This work presents the first results obtained on the investigation of the behavior of uranium and radium radioisotopes in the processes of weathering and rock-water interaction of Morungaba granitoids belonging to Meridional Pluton (Valinhos Town-SP-Brazil). Specific activities of {sup 238}U, {sup 234}U, {sup 228}Ra and {sup 226}Ra were determined in non altered granitoids (Group A), as well as in those affected by different degrees of weathering (Groups B, C and D). The uranium specific activities were determined by alpha spectrometry method, whereas for the determination of radium isotopes high resolution gamma-ray spectrometry technique was employed. The data indicate that {sup 238}U and {sup 234}U are in radioactive equilibrium in the fresh analyzed granitoids, but show a slight depletion of {sup 234}U in relation to {sup 238}U in the weathered rocks. The ({sup 226}Ra/{sup 238}U) and ({sup 226}Ra/{sup 234}U) activity ratios of all investigated rocks are similar, showing a significant {sup 226}Ra depletion, which is probably caused by its preferential leaching. These results indicate that even samples macroscopically classified as fresh rocks, their systems have been opened for some geochemical changes. The high ({sup 234}U/{sup 238}U) activity ratios of groundwaters which are found in the fractures of these granitoids suggest their prolonged residence times in the aquifer and/or their percolation by other rocks presenting different geochemical properties. (author)

  6. Possible cluster preformation in the 14C decay of 223Ra

    Science.gov (United States)

    Hussonnois, M.; Le Du, J. F.; Brillard, L.; Ardisson, G.

    1990-08-01

    A recent experiment on the 14C fine structure has shown that the branching ratio to 209Pb ground state is quite different from the one predicted by the various models of cluster emission. Assuming that the 14C is preformed in the 223Ra nucleus, we have calculated the hindrance factor F14C of the three 14C branches to 209Pb states with a barrier penetrability approximated by a square-well Coulomb potential. The F14C=3.9 and 4.6 values found for the 14C transitions to the two excited states at 779 keV (Iπ=11/2+) and 1423 keV (Iπ=15/2-), respectively, reveal that the cluster formation amplitudes in both transitions are close to those of the 222Ra and 224Ra 14C decays. Such values could be the result of ||nlj> shell-model components common to both the wave functions of the octupole deformed 223Ra nucleus and of the two first excited states of 209Pb spherical nucleus. The high hindrance factor F14C=583 of the 14C branch to the 209Pb ground state (Iπ=9/2+) could reveal the absence of ||1g9/2> shell-model component in the 223Ra wave function.

  7. Isotope shifts and hyperfine structure of {sup 212-214}Ra{sup +}

    Energy Technology Data Exchange (ETDEWEB)

    Giri, Gouri S.; Sahoo, Bijaya K.; Versolato, Oscar O.; Wansbeek, Lotje W.; Willmann, Lorenz; Wilschut, Hans W.; Jungmann, Klaus; Timmermans, Rob G.E. [Kernfysisch Versneller Instituut, University of Groningen (Netherlands)

    2010-07-01

    The availability of short lived Ra isotopes at the TRI{mu}P facility of the KVI makes the study of atomic structure of these isotopes possible. {sup 212-214}Ra ions are trapped in a buffer-gas filled Paul trap. Isotope shifts and hyperfine structures of {sup 212-214}Ra{sup +} for several transitions were obtained by laser spectroscopy. Ra{sup +} is of particular interest for a most precise measurement of Atomic Parity Violation (APV), currently underway in our group. Such a measurement will provide a stringent test of the Standard Model of particle physics. However, the interpretation of APV measurements require the determination of the weak matrix elements to better than 1% accuracy in order to extract the weak charge (Weinberg angle). Currently, our calculations are accurate to some 3%. We therefore plan to exploit the fact that radium has a wide range of isotopes by looking at the ratio E1APV/ E1'APV for two -or more- isotopes, and thus canceling atomic uncertainties. Here, nuclear structure effects start to play a role. The extracted isotope shifts and hyperfine interactions provide indispensable information. In addition, the measured hyperfine structure of {sup 213}Ra{sup +} is of particular interest for the proposed Radium single ion clock.

  8. Single Ra{sup +} ion spectroscopy - towards a measurement of atomic parity violation

    Energy Technology Data Exchange (ETDEWEB)

    Nunez Portela, Mayerlin; Mohanti, A.; Dijck, E.A.; Bekker, H.; Boell, O.; Berg, J. van den; Giri, G.S.; Jungmann, K.; Onderwater, C.J.G.; Santra, B.; Timmermans, R.G.E.; Versolato, O.O.; Wansbeek, L.W.; Willmann, L.; Wilschut, H.W. [KVI, University of Groningen, Groningen (Netherlands)

    2013-07-01

    The sensitivity of the Atomic Parity Violation (APV) signal grows faster than the third power of the atomic number Z. Ra{sup +} (Z=88) is heaviest alkaline earth ion available. A single trapped Ra{sup +} ion opens a very promising path for a measurement atomic parity violation. One of the experimental challenges is the localization of the ion within a fraction of an optical wavelength. For this the current experiments are focused on trapping and laser cooling of Ba{sup +} ions as a precursor for Ra{sup +}. Ba{sup +} ions are trapped and laser cooled in a precision hyperbolic Paul trap. Work towards single Ba{sup +} ion localization and detection is in progress. Recently the hyperfine structure of the 6d{sub 2}D{sub 3/2} states and the isotope shift of the 6d{sub 2}D{sub 3/2}-7p{sub 2}P{sub 1/2} transition in the isotopes {sup 209-214}Ra{sup +} has been measured in online laser spectroscopy experiments at the KVI AGOR/TRIμP facility. These results are essential for the interpretation of an APV measurement in Ra{sup +}.

  9. Systematic study of heavy cluster emission from {sup 210-226}Ra isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P., E-mail: drkpsanthosh@gmail.com [School of Pure and Applied Physics, Kannur University, Payyanur Campus, Payyanur 670 327 (India); Sahadevan, Sabina; Priyanka, B.; Unnikrishnan, M.S. [School of Pure and Applied Physics, Kannur University, Payyanur Campus, Payyanur 670 327 (India)

    2012-05-15

    The half lives for various clusters lying in the cold reaction valleys of {sup 210-226}Ra isotopes are computed using our Coulomb and proximity potential model (CPPM). The computed half lives of {sup 4}He and {sup 14}C clusters from {sup 210-226}Ra isotopes are in good agreement with experimental data. Half lives are also computed using the universal formula for cluster decay (UNIV) of Poenaru et al., and are found to be in agreement with CPPM values. Our study reveals the role of doubly magic {sup 208}Pb daughter in cluster decay process. Geiger-Nuttall plots for all clusters up to {sup 62}Fe are studied and are found to be linear with different slopes and intercepts. {sup 12,14}C emission from {sup 220}Ra; {sup 14}C emission from {sup 222,224}Ra; {sup 14}C and {sup 20}O emission from {sup 226}Ra are found to be most favourable for measurement and this observation will serve as a guide to the future experiments.

  10. [The effect of the mutant genes Ta, Ra and Sd on early embryogenesis in mice].

    Science.gov (United States)

    Sakharova, N Iu; Malashenko, A M; Mezhevikina, L M; Lepikhov, K A; Fialkovskaia, L A

    1996-01-01

    We studied early embryonic mortality of mice from mutant stocks Tabby (Ta, X-chromosome) and RaSd (RaSd/++, chromosome 2) maintained in the heterozygous state in F1 CBA x C57B1/6 hybrid. Tabby and RaSd mice were reciprocally crossed with F1 mice and examined for the morphological status of embryos washed from the oviduct on the third day of pregnancy, when the stage of eight blastomeres is normally attained. Mortality was evaluated from the number of embryos which did not reach the expected stage by this time. The results have shown that 2-4 cell embryos, which have received gene Ta with the X-chromosome of the female parent, differed from embryos with F1 genotype at the same stage of development by their increased mortality rate, whereas among embryos obtained from RaSd, the mortality was mainly observed before cleavage. Death of embryos receiving the mutant gene from hemizygous Ta males or heterozygous RaSd/++ males was not significantly different from the mortality of embryos without these mutations.

  11. Castration modulates singing patterns and electrophysiological properties of RA projection neurons in adult male zebra finches

    Directory of Open Access Journals (Sweden)

    Songhua Wang

    2014-04-01

    Full Text Available Castration can change levels of plasma testosterone. Androgens such as testosterone play an important role in stabilizing birdsong. The robust nucleus of the arcopallium (RA is an important premotor nucleus critical for singing. In this study, we investigated the effect of castration on singing patterns and electrophysiological properties of projection neurons (PNs in the RA of adult male zebra finches. Adult male zebra finches were castrated and the changes in bird song assessed. We also recorded the electrophysiological changes from RA PNs using patch clamp recording. We found that the plasma levels of testosterone were significantly decreased, song syllable’s entropy was increased and the similarity of motif was decreased after castration. Spontaneous and evoked firing rates, membrane time constants, and membrane capacitance of RA PNs in the castration group were lower than those of the control and the sham groups. Afterhyperpolarization AHP time to peak of spontaneous action potential (AP was prolonged after castration.These findings suggest that castration decreases song stereotypy and excitability of RA PNs in male zebra finches.

  12. La Realidad Aumentada (RA. Recursos y propuestas para la innovación educativa

    Directory of Open Access Journals (Sweden)

    Javier J. Maquilón Sánchez

    2017-01-01

    Full Text Available Este artículo contiene una propuesta de experiencia práctica de enseñanza-­‐aprendizaje, basada en la realidad aumentada (RA como recurso didáctico innovador. RA es tanto un concepto como una tecnología 3D interactiva actualmente en desarrollo. Por este motivo, en primer lugar se ha expuesto, por un lado, qué es la RA y, por otro lado, cuáles son las variantes tecnológicas actuales principales. Seguidamente, se ha hecho un análisis reflexivo de varios aspectos, que el docente ha de considerar respecto a la RA como tecnología aplicada a la educación, destacando la aportación innovadora de la RA como recurso didáctico. Finalmente se presenta el diseño y la elaboración de la actividad, tipo webquest que incluye un blog de aula.

  13. Long-term clinical investigation of patients with ankylosing spondylitis treated with /sup 224/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, E. (Universitatsklinik Friedrichsheim, Frankfurt, West Germany); Ruckbeil, C.; Wick, R.R.

    1983-01-01

    Between 1952 and 1980 about 250 patients with ankylosing spondylitis were treated with /sup 224/Ra at the Orthopaedic University Hospital of Frankfurt/M. In 1970, 119 of them were examined and X-rayed as was another group of 40 patients in 1980. The results of those examined could be compared with a group of 40 patients treated without /sup 224/Ra. Patients with /sup 224/Ra demonstrated a long-lasting period of subjective improvement after the treatment, with reduced consumption of antirheumatoid and analgesic drugs, on the average. Blood examinations show inflammatory activities. Nevertheless, the ankylosing spondylitis proceeded. In the final stages of the disease, neither the clinical aspects nor the X-rays showed any specific changes. We observed no case of malignant bone tumor. Of the 169 examined patients, 22 had a total of 32 children after the treatment with /sup 224/Ra. Among these was a set of twins with cerebral palsy and diabetes insipidus renalis. In conclusion, /sup 224/Ra in ankylosing spondylitis is a recommended treatment without higher risk compared to the common therapy with drugs.

  14. PADI4 Haplotypes in Association with RA Mexican Patients, a New Prospect for Antigen Modulation

    Directory of Open Access Journals (Sweden)

    Maria Guadalupe Zavala-Cerna

    2013-01-01

    Full Text Available Peptidyl arginine deiminase IV (PAD 4 is the responsible enzyme for a posttranslational modification called citrullination, originating the antigenic determinant recognized by anti-cyclic citrullinated peptide antibodies (ACPA. Four SNPs (single nucleotide polymorphisms have been described in PADI4 gene to form a susceptibility haplotype for rheumatoid arthritis (RA; nevertheless, results in association studies appear contradictory in different populations. The aim of the study was to analyze if the presence of three SNPs in PADI4 gene susceptibility haplotype (GTG is associated with ACPA positivity in patients with RA. This was a cross-sectional study that included 86 RA patients and 98 healthy controls. Polymorphisms PADI4_89, PADI4_90, and PADI4_92 in the PADI4 gene were genotyped. The susceptibility haplotype (GTG was more frequent in RA patients; interestingly, we found a new haplotype associated with RA with a higher frequency (GTC. There were no associations between polymorphisms and high scores in Spanish HAQ-DI and DAS-28, but we did find an association between RARBIS index and PADI4_89, PADI4_90 polymorphisms. We could not confirm an association between susceptibility haplotype presence and ACPA positivity. Further evidence about proteomic expression of this gene will determine its participation in antigenic generation and autoimmunity.

  15. Sobre o uso da variável raça-cor em estudos quantitativos

    Directory of Open Access Journals (Sweden)

    Jerônimo Oliveira Muniz

    2010-06-01

    Full Text Available A crescente inclusão da raça no debate público brasileiro, o aumento da sua disponibilidade em pesquisas de opinião e monitoramento e a facilidade de inclusão da variável em modelos estatísticos tem provocado um paradoxo na importância da raça. Ao mesmo tempo em que a cor da pele vem ganhando relevância no debate político, ela também vem perdendo a sua importância substantiva como um construto social complexo e dinâmico por ser utilizada de modo superficial, como uma categoria permanente e imutável em estudos quantitativos. Este ensaio bibliográfico discorre sobre os fatores que contribuem para essa tendência levando em conta a literatura nacional e internacional produzida nos últimos dez anos. Questiona-se o uso da raça em políticas públicas atentando-se para a sua confiabilidade, variabilidade e validade e discutem-se as limitações e possibilidades de uso da raça como um demarcador de diferenças. O ensaio conclui-se sugerindo uma agenda de pesquisa para aprimorar o entendimento e reduzir as incertezas associadas ao uso da variável "raça" em estudos quantitativos.

  16. Knock-down of IL-1Ra in obese mice decreases liver inflammation and improves insulin sensitivity.

    Directory of Open Access Journals (Sweden)

    Niclas Franck

    Full Text Available Interleukin 1 Receptor antagonist (IL-1Ra is highly elevated in obesity and is widely recognized as an anti-inflammatory cytokine. While the anti-inflammatory role of IL-1Ra in the pancreas is well established, the role of IL-1Ra in other insulin target tissues and the contribution of systemic IL-1Ra levels to the development of insulin resistance remains to be defined. Using antisense knock down of IL-1Ra in vivo, we show that normalization of IL-1Ra improved insulin sensitivity due to decreased inflammation in the liver and improved hepatic insulin sensitivity and these effects were independent of changes in body weight. A similar effect was observed in IL1-R1 KO mice, suggesting that at high concentrations of IL-1Ra typically observed in obesity, IL-1Ra can contribute to the development of insulin resistance in a mechanism independent of IL-1Ra binding to IL-1R1. These results demonstrate that normalization of plasma IL-1Ra concentration improves insulin sensitivity in diet- induced obese mice.

  17. Desempenho de frangos de corte consumindo rações contendo sorgo e gérmen integral de milho Performance of broilers fed sorghum and full-fat corn germ meal

    Directory of Open Access Journals (Sweden)

    José Henrique Stringhini

    2009-12-01

    Full Text Available Avaliou-se a substituição do sorgo pelo gérmen integral de milho em rações para frangos de corte. Foram conduzidos dois experimentos, em delineamento inteiramente casualizado com quatro níveis de substituição do sorgo pelo gérmen integral de milho (0; 33,3; 66,7 e 100% como concentrado energético em rações com ingredientes de origem vegetal (experimento 1 ou de origem animal (experimento 2, cada um com quatro repetições. Avaliaram-se o desempenho (ganho de peso, consumo de ração e conversão alimentar e o rendimento de carcaça e de cortes, em peso absoluto, em porcentagem do peso vivo e em porcentagem do peso da carcaça depenada e eviscerada. No experimento 1, os níveis de substituição tiveram efeito quadrático no peso final e no ganho de peso, que foram melhores nos níveis de 21,03 a 21,68% de substituição do sorgo pelo gérmen integral de milho. No experimento 2, verificou-se efeito quadrático para ganho de peso e conversão alimentar, que foram melhores nos níveis de 35,02 e 15,75% de substituição do sorgo pelo gérmen integral de milho. A substituição do sorgo pelo gérmen integral de milho não afetou os rendimentos de carcaça e dos cortes obtidos no experimento 1. No experimento 2, houve efeito quadrático para os pesos de carcaça, peito e asas. Em rações com ingredientes de origem vegetal, o sorgo pode ser substituído pelo gérmen integral de milho em níveis de 21,03 a 21,68% e, em rações com ingredientes de origem animal, de 15,75 a 35,02%.In this experiment, sorghum substitution with full-fat corn germ meal was evaluated in feed for broiler chickens. Two experiments were carried out in a randomized complete design with four levels of substitution of sorghum substitution with full-fat corn germ meal (0, 33.3, 66.7 and 100% as energetic concentrate in diets produced exclusively with vegetable ingredients (experiment 1 or with ingredients of animal origin (experiment 2 with four replications each

  18. SALINITY, HYDROSTATIC PRESSURE and TEMPERATURE profile data collected in the North Atlantic Ocean on the OCEANUS cruise OC333 as part of the GB project from 1998-11-16 to 1998-11-20 (NODC Accession 0104392)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0104392 includes profile and physical data collected aboard the OCEANUS during cruise OC333 in the North Atlantic Ocean from 1998-11-16 to 1998-11-20....

  19. Altered expression of retinoic acid (RA) receptor mRNAs in the fetal mouse secondary palate by all-trans and 13-cis RAs: implications for RA-induced teratogenesis.

    Science.gov (United States)

    Naitoh, H; Mori, C; Nishimura, Y; Shiota, K

    1998-01-01

    Retinoic acid (RA) is mandatory for various biological processes and normal embryonic development but is teratogenic at high concentrations. In rodents, one of the major malformations induced by RA is cleft palate (CP). RA mediates its effects by RA receptors (RARs), but the expression patterns of RARs in the developing palate are still unclear. We investigated the normal expression of RAR alpha, beta, and gamma messenger RNAs (mRNAs) in the fetal mouse secondary palate and the effects of all-trans and 13-cis RAs on the expression of RAR mRNAs by Northern blot analysis. RAR alpha (2.8, 3.8 kb), RAR beta (3.3 kb), and RAR gamma (3.7 kb) mRNAs were detected in the fetal palate on gestational days (GD) 12.5-14.5. The expression of RAR alpha and gamma mRNAs did not show apparent sequential changes, but that of RAR beta mRNA increased at GD 13.5. Treatment of pregnant mice with 100 mg/kg all-trans RA induced CP in 94% of the fetuses and elevated the levels of RAR beta and gamma mRNAs in the fetal palate. The up-regulation of RAR beta mRNA by all-trans RA was more marked than that of RAR gamma mRNA. Treatment with 100 mg/kg 13-cis RA induced CP in only 19% of the fetuses. Although 13-cis RA elevated the RAR beta and gamma mRNA levels in fetal palates, its up-regulation was slower and less marked than that induced by all-trans RA. These findings indicate that the induction of RAR beta mRNA in the fetal palate correlates well with the tissue concentration of all-trans RA after RA treatment, and RAR beta may be one of the most influential candidate molecules for RA-induced teratogenesis.

  20. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things.

    Science.gov (United States)

    Augustin, Aloÿs; Yi, Jiazi; Clausen, Thomas; Townsley, William Mark

    2016-09-09

    LoRa is a long-range, low-power, low-bitrate, wireless telecommunications system, promoted as an infrastructure solution for the Internet of Things: end-devices use LoRa across a single wireless hop to communicate to gateway(s), connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server. This paper provides an overview of LoRa and an in-depth analysis of its functional components. The physical and data link layer performance is evaluated by field tests and simulations. Based on the analysis and evaluations, some possible solutions for performance enhancements are proposed.

  1. On-line Excited-State Laser Spectroscopy of Trapped Short-Lived Ra$^+$ Ions

    CERN Document Server

    Versolato, O O; Wansbeek, L W; Berg, J E van den; van der Hoek, D J; Jungmann, K; Kruithof, W L; Onderwater, C J G; Sahoo, B K; Santra, B; Shidling, P D; Timmermans, R G E; Willmann, L; Wilschut, H W

    2010-01-01

    As an important step towards an atomic parity violation experiment in one single trapped Ra$^+$ ion, laser spectroscopy experiments were performed with on-line produced short-lived $^{212,213,214}$Ra$^+$ ions. The isotope shift of the $6\\,^2$D$_{3/2}$\\,-\\,$7\\,^2$P$_{1/2}$ and $6\\,^2$D$_{3/2}$\\,-\\,$7\\,^2$P$_{3/2}$ transitions and the hyperfine structure constant of the $7\\,^2$S$_{1/2}$ and $6\\,^2$D$_{3/2}$ states in $^{213}$Ra$^+$ were measured. These values provide a benchmark for the required atomic theory. A lower limit of $232(4)$ ms for the lifetime of the metastable $6\\,^2$D$_{5/2}$ state was measured by optical shelving.

  2. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things

    Science.gov (United States)

    Augustin, Aloÿs; Yi, Jiazi; Clausen, Thomas; Townsley, William Mark

    2016-01-01

    LoRa is a long-range, low-power, low-bitrate, wireless telecommunications system, promoted as an infrastructure solution for the Internet of Things: end-devices use LoRa across a single wireless hop to communicate to gateway(s), connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server. This paper provides an overview of LoRa and an in-depth analysis of its functional components. The physical and data link layer performance is evaluated by field tests and simulations. Based on the analysis and evaluations, some possible solutions for performance enhancements are proposed. PMID:27618064

  3. Production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Meriarty, H; Metcalfe, P; Knittel, T; Allen, B J

    2007-09-01

    The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. The production of Ac-225 has been achieved using bremsstrahlung photons from an 18 MV medical linear accelerator (linac) to bombard a Ra-226 target. A linac dose of 2800 Gy produced about 64 microCi of Ra-225, which decays to Ac-225. This result, while consistent with the theoretical calculations, is far too low to be of practical use. A more powerful linac is required that runs at a higher current, longer pulse length and higher frequency for practical production. This process could also lead to the reduction of the nuclear waste product Ra-226.

  4. Feasibility and Domain Validation of Rheumatoid Arthritis (RA) Flare Core Domain Set

    DEFF Research Database (Denmark)

    Bartlett, Susan J; Bykerk, Vivian P; Cooksey, Roxanne

    2015-01-01

    OBJECTIVE: The Outcome Measures in Rheumatology (OMERACT) Rheumatoid Arthritis (RA) Flare Group was established to develop an approach to identify and measure RA flares. An overview of our OMERACT 2014 plenary is provided. METHODS: Feasibility and validity of flare domains endorsed at OMERACT 11...... (2012) were described based on initial data from 3 international studies collected using a common set of questions specific to RA flare. Mean flare frequency, severity, and duration data were presented, and domain scores were compared by flare status to examine known-groups validity. Breakout groups......, and stiffness scores averaged ≥ 2 times higher (2 of 11 points) in flaring individuals. Correlations between flare domains and corresponding legacy instruments were obtained: r = 0.46 to 0.93. A combined definition (patient report of flare and 28-joint Disease Activity Score increase) was evaluated in 2 other...

  5. A survey on LPWA technology: LoRa and NB-IoT

    Directory of Open Access Journals (Sweden)

    Rashmi Sharan Sinha

    2017-03-01

    Full Text Available By 2020, more than twenty five billion devices would be connected through wireless communications. In accordance with the rapid growth of the internet of things (IoT market, low power wide area (LPWA technologies have become popular. In various LPWA technologies, narrowband (NB-IoT and long range (LoRa are two leading technologies. In this paper, we provide a comprehensive survey on NB-IoT and LoRa as efficient solutions connecting the devices. It is shown that unlicensed LoRa has advantages in terms of battery lifetime, capacity, and cost. Meanwhile, licensed NB-IoT offers benefits in terms of QoS, latency, reliability, and range.

  6. Diatom species composition in the Raška river (Southwestern Serbia

    Directory of Open Access Journals (Sweden)

    Vidaković Danijela P.

    2015-01-01

    Full Text Available The paper presents data on the composition of epilithic diatoms in the Raška River. Samples were collected by scraping stone surfaces with a brush from 5 localities along the Raška River in April, June, August and November 2011 and March and May 2012. Diatom frustules were cleaned using cold acid method, and mounted on permanent slides. An investigation of the Raška River resulted in description of 106 diatom taxa. The most species rich genera are Navicula (10, Gomphonema (10 and Nitzschia (9, while other genera are presented with one or more species. Detailed floristic analysis of the benthic diatom flora in this river has not been conducted before. Therefore, this paper provides a groundwork for future researches. [Projekat Ministarstva nauke Republike Srbije, br. TR 037009

  7. Low-level measurements of Ra-226/Rn-222 by pulse ionization chambers

    Science.gov (United States)

    El-Daoushy, Fand; Garcia-Tenorio, Rafael

    1988-10-01

    Characteristics of two ionization chambers have been studied and the chambers utilized for 226Ra/ 222Rn measurements for more than ten years. The results obtained show that coating of internal surfaces with a pure and thin Ag-layer enhances the background of ionization chambers in spite of some improvements at the early stages of operation. In addition to previously known parameters influencing the accuracy in routine measurements, new correction factors are suggested. 226Ra impurities in the body of ionization chambers are found to act not only as a permanent, but also as a temperature-dependent source of background. Earlier accuracies of 226Ra/ 222Rn measurements have been considerably improved by assuring long-term mechanical and thermal stability of the ionization chambers.

  8. A Study of LoRa: Long Range & Low Power Networks for the Internet of Things

    Directory of Open Access Journals (Sweden)

    Aloÿs Augustin

    2016-09-01

    Full Text Available LoRa is a long-range, low-power, low-bitrate, wireless telecommunications system, promoted as an infrastructure solution for the Internet of Things: end-devices use LoRa across a single wireless hop to communicate to gateway(s, connected to the Internet and which act as transparent bridges and relay messages between these end-devices and a central network server. This paper provides an overview of LoRa and an in-depth analysis of its functional components. The physical and data link layer performance is evaluated by field tests and simulations. Based on the analysis and evaluations, some possible solutions for performance enhancements are proposed.

  9. Employment of single-strand conformation polymorphism analysis in screening for α-1,3 glucosyltransferase gene mutation A333V in Croatian population.

    Science.gov (United States)

    Goreta, Sandra Supraha; Dabelic, Sanja; Dumic, Jerka

    2011-01-01

    Congenital disorder of glycosylation type Ic (CDG-Ic) is caused by mutations in hALG6 gene encoding α-1,3 glucosyltransferase (NP_037471.2), an enzyme that catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor in N-glycosylation process. The most frequent mutation in hALG6 gene causing CDG-Ic is c.998C>T that results in p.A333V substitution. Up-to-date, no CDG-Ic patient has been detected in Croatia. However, as a part of the comprehensive project undertaken with the aim to estimate the frequencies of the carriers for specific mutations and polymorphisms related to particular CDGs in Croatian population, we screened genomic DNA samples obtained from 600 healthy nonconsanguineous Croatian residents to determine the frequency of the A333V mutation. For that purpose, we established the conditions for polymerase chain reaction-based single-strand conformation polymorphism analysis that is suitable for primary screening and in population studies, especially when the initial sample volume is small or DNA quantity is limited. None of the analyzed samples carried this mutation, indicating that the frequency of the patients carrying this homozygous mutation in Croatian population would be <1 in 1.4×10(6).

  10. Evaluation of the activity concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in sediments from Antarctica in the Admiralty bay region; Avaliacao da concentracao de atividade de Ra-226, Ra-228 e Pb-210 em sedimentos provenientes da Antartica na regiao da baia do Almirantado

    Energy Technology Data Exchange (ETDEWEB)

    Mora, Tamires de Araujo

    2015-07-01

    The natural radionuclides from radioactive series of {sup 238}U, {sup 235}U and {sup 232}Th have been applied as tracers in environmental studies for understanding the dynamics that occur in both marine and terrestrial environment, as for example, in research of oceanic processes and management of the coastal region. In the marine environment, these radionuclides can be used to estimate biogeochemical fluxes of marine particles and nutrients that occur in the water column as well as in the sediment. Several research works applied the distribution and the respective disequilibrium degree of natural radionuclides in the environment, including geochronological models for obtaining historical information on samples of certain sediment profile. In this study we performed a radiochemical characterization of the distribution of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb from a sedimentary column called 1B (248 cm long) collected in the Admiralty Bay, Antarctic Peninsula region. The methodology used included the acid leaching of sediment samples followed by the radiochemical sequential separation of {sup 226}Ra and {sup 228}Ra by co-precipitation with Ba(Ra)SO{sub 4} and {sup 210}Pb by co-precipitation with PbCrO{sub 4}. All measurements were carried out by counting of gross alpha and gross beta measures in a low background gas flow proportional detector. The activity concentrations of {sup 226}Ra and {sup 210}Pb were used to estimate the unsupported {sup 210}Pb activities present in sediment profile 1 B. Based on unsupported {sup 210}Pb data and the application of the CIC model (Constant Initial Concentration), it was possible to determine the sedimentation rate of 0.59 ± 0.05 cm /year. (author)

  11. Controlled Cohort Study of Serum Gonadal and Adrenocortical Steroid Levels in Males Prior to Onset of Rheumatoid Arthritis (pre-RA: A Comparison to pre-RA Females and Sex Differences among the Study Groups

    Directory of Open Access Journals (Sweden)

    Alfonse T. Masi

    2013-01-01

    Full Text Available Serum testosterone levels are generally reported to be lower in male rheumatoid arthritis (RA patients, but it is not determined if a deficiency may occur before clinical onset of disease (pre-RA. Lower testosterone levels were recently reported in males many years before RA onset but were predictive only of rheumatoid factor (RF—negative disease. A preceding prospective study did not reveal androgenic-anabolic hormone association with risk of RA in men or women. This cohort study of males analyzed baseline serum levels of gonadal and adrenocortical steroids, luteinizing hormone, and prolactin in 18 pre-RA versus 72 matched non-RA control (CN subjects. Findings in males were compared to those in female pre-RA and CN subjects in the same cohort, and sex differences were analyzed. Steroidal and hormonal levels, including total testosterone, were similar between male study groups. In females, mean (±SE serum androstenedione (nmol/L was slightly (P=0.048 lower in 36 pre-RA (6.7 ± 0.36 than 144 CN (7.6 ± 0.22. With the exception of 3 partial correlations of hormonal variables observed to differ between pre-RA versus CN subjects, the patterns were similar overall. However, partial correlations of hormonal variables differed frequently by sex, both within and between study groups.

  12. A theoretical model for the production of Ac-225 for cancer therapy by neutron capture transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Melville, P

    2013-02-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation by bombarding Ra-226 with high-energy neutrons from a neutron source to produce Ra-225 and hence Ac-225, which can be used as a generator to produce Bi-213 for use in 'Targeted Alpha Therapy' for cancer. This paper examines the possibility of producing Ac-225 by neutron capture using a theoretical model in which neutron energy is convoluted with the corresponding neutron cross sections of Ra-226. The total integrated yield can then be obtained. This study shows that an intense beam of high-energy neutrons could initiate neutron capture on Ra-226 to produce Ra-225 and hence practical amounts of Ac-225 and a useful reduction of Ra-226. Copyright © 2012 Elsevier Ltd. All rights reserved.

  13. Developing a Construct to Evaluate Flares in Rheumatoid Arthritis: A Conceptual Report of the OMERACT RA Flare Definition Working Group

    DEFF Research Database (Denmark)

    Alten, Rieke; Choy, Ernest H; Christensen, Robin

    2011-01-01

    Rheumatoid arthritis (RA) patients and healthcare professionals (HCP) recognize that episodic worsening disease activity, often described as a "flare," is a common feature of RA that can contribute to impaired function and disability. However, there is no standard definition to enable measurement...... of its intensity and impact. The conceptual framework of the Outcome Measures in Rheumatology Clinical Trials (OMERACT) RA Flare Definition Working Group includes an anchoring statement, developed at OMERACT 9 in 2008: "flare in RA" is defined as worsening of signs and symptoms of sufficient intensity...... is intended to enhance patient-HCP communication. This article describes the conceptual framework being used by the OMERACT RA Flare Definition Working Group in developing a standardized method for description and measurement of "flare in RA" to guide individual patient treatment....

  14. Človeški vidik varnosti računalništva v oblaku

    OpenAIRE

    Maraž, Nataša

    2016-01-01

    Magistrska naloga obravnava človeške aspekte varnosti računalništva v oblaku. Predstavljen je pregled literature na področju oblačnih storitev oziroma računalništva v oblaku. Podan je tudi pregled uporabe oblačnih storitev z vidika posameznika in organizacij, še posebej pri storitvah v bančništvu. Zaradi čedalje večje uporabe oblačnih storitev v bančništvu je opredeljen pristop ohranjanja informacijske varnosti, ki jih zagotavljajo tri glavne dimenzije. Navedene so tudi trenutno veljavne regu...

  15. {sup 226} Ra committed effective dose assessment for osteoporosis treatment with `Gran-White` dolomite

    Energy Technology Data Exchange (ETDEWEB)

    Pecequilo, Brigitte R.S.; Campos, Marcia P. de [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    1997-12-01

    A total of 6 dolomite samples were prepared for activity concentration measurement by using high resolution gamma-ray spectrometry. The calculated average specific activity of {sup 226} Ra was 4.34 Bq/kg. The committed effective dose due to the Ra-226 specific activity in dolomite was performed following the ICRP 30 and ICRP 61 procedures and dose conversion factors. Values of 1.95 x 10{sup -6} Sv were obtained for committed effective dose and 5.93 x 10{sup -5} Sv for committed dose equivalent in the bone surface. (author). 9 refs., 2 tabs.

  16. Determination of specific activities of U-238, Ra-226, Ra-228 e Th-228 in samples of mineral fertilizers with phosphorus; Determinacao das atividades especificas de U-238, Ra-226, Ra-228 e Th-228 em amostras de fertilizantes minerais com fosforo

    Energy Technology Data Exchange (ETDEWEB)

    Garcez, R.W.D.; Lopes, J.M.; Silva, A.X. da, E-mail: rgarcez@nuclear.ufrj.br [Coordenacao dos Programas de Pos-Graduacao em Engenharoa (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Domingues, A.M.; Lima, M.A.F. [Universidade Federal Fluminense (UFF),Niteroi, RJ (Brazil)

    2016-07-01

    Samples were analyzed by gamma spectrometry mineral fertilizers with the HPGe detector and aid LabSOCS software for calculating the detection efficiency curve. Specific activities found for Pa-234m, Ra-226, Ra-228 and Th-228 in samples of phosphate fertilizers were 505 Bq.kg{sup -1}, 458 Bq.kg{sup -1}, 450 Bq.kg{sup -1} and 394 Bq.kg{sup -1}, respectively. And for the NPK fertilizer samples were found average values of 390 Bq.kg{sup -1}, 252 Bq.kg{sup -1}, 280 Bq.kg{sup -1} and 268 Bq.kg{sup -1}, respectively. (author)

  17. Initial Results from the Radiation Dosimetry Experiment (RaD-X) Balloon Flight Mission

    Science.gov (United States)

    Mertens, Christopher J.

    2015-01-01

    The NASA Radiation Dosimetry Experiment (RaD-X) high-altitude balloon mission was successfully launched from Fort Sumner, New Mexico USA on 25 September, 2015. Over 15 hours of science data were obtained from four dosimeters at altitudes above about 25 km. The four dosimeters flown on the RaD-X science payload are a Hawk version 3.0 Tissue Equivalent Proportional Counter (TEPC) manufactured by Far West Technologies, a Liulin dosimeter-spectrometer produced by the Solar Research and Technology Institute, Bulgarian Academy of Sciences, a total ionizing dose detector manufactured by Teledyne Microelectronic Technologies, and the RaySure detector provided by the University of Surrey.

  18. THE RELATION BETWEEN CHANT AND MYTY ON THE AIKEWÁRA RITE

    Directory of Open Access Journals (Sweden)

    Gilmar Matta da Silva

    2009-12-01

    Full Text Available In the group of tradicional knowledges that include the most varied fields of the knowledge of the indigenous people the song (music doesn't present a status differentiated as it happens in our society, but it is associated to other practices as the construction of the musical instruments, the narration of the myths, the performance of the dances and rituals. Based in the oral tradition of Aikewára the article emphases the relationship between song and myth to analize the integration and interaction and the Sapurahái of Karuára.

  19. Respuesta del tomate para proceso al riego parcial de la raíz

    OpenAIRE

    2007-01-01

    La escasez de agua para riego es un factor que limita la producción mundial. Prácticas orientadas al ahorro del agua para la agricultura son necesarias. El riego parcial de la raíz (RPR) podría ser una opción. Para valorar esta práctica, se estudiaron dos factores. El primer factor fue el sistema de riego de dos tipos: riego por gravedad (RG) y riego por goteo (RGo). El segundo factor fue la forma de aplicar el riego con dos niveles: el riego completo de la raíz (RCR) y el RPR. Este último co...

  20. Marguerite Yourcenar et le projet d'opéra de Wells Hively

    Directory of Open Access Journals (Sweden)

    Rémy Poignault

    2008-07-01

    Full Text Available L’étude de la correspondance de Marguerite Yourcenar avec Wells Hively croisée avec l’examen de deux versions du livret d’opéra proposées par le compositeur américain révèle comment Yourcenar, d’abord bien intentionnée, se montre critique à l’égard de cette tentative de réécriture pour l’opéra de l’épisode d’Antinoüs.

  1. Active phagocytosis of Mycobacterium tuberculosis (H37Ra) by T lymphocytes (Jurkat cells).

    Science.gov (United States)

    Zhang, Min; Zhu, Qi; Shi, Ming; Liu, Yang; Ma, Lei; Yang, Yining; Feng, Dongyun; Dai, Wen; Zhang, Lin; Kang, Tao; Chen, Ping; He, Ying; Liu, Tingting; Zhao, Qing; Wang, Wenjing; Zhi, Jin; Feng, Guodong; Zhao, Gang

    2015-08-01

    This study aimed to co-culture Jurkat T lymphocytes with inactivated Mycobacterium tuberculosis (Mtb H37Ra), explore whether T lymphocytes could phagocytose H37Ra cells, and determine the underlying mechanism. Jurkat T lymphocytes were co-cultured with H37Ra cells, and confocal laser scanning microscopy, electron microscopy, and flow cytometry techniques were used to identify phagocytosis and elucidate its mechanism. After Jurkat T lymphocytes phagocytosed H37Ra cells, the cell body became larger, with abundant cytoplasm, the portion of the nucleus closest to the bacterium deformed, long and short pseudopodia were extended, and the folds of the cell membrane formed depressions that created phagocytic vesicles surrounding the bacterium. The macropinocytosis inhibitor amiloride and the cytoskeletal inhibitor cytochalasin D were found to inhibit phagocytic efficacy; serum complements might enhance phagocytosis through opsonization. Jurkat T lymphocytes could actively phagocytose inactivated Mtb via the macropinocytotic mechanism. Actin remodeling played an important role in the macropinocytotic process. Serum complements may regulate phagocytosis.

  2. The Societal Dimension of Art: On Mara Raţiu’s Art as Social Activity

    Directory of Open Access Journals (Sweden)

    Cristian Hainic

    2012-05-01

    Full Text Available REVIEW OF Raţiu, Mara. Arta ca activitate socială: avatarurile discursului filosofic asupra artei contemporane (Art as Social Activity: The Avatars of Philosophical Discourse on Contemporary Art. Cluj-Napoca: Casa Cărţii de Ştiinţă, 2011.

  3. Fatigue as experienced by patients with rheumatoid arthritis (RA): a qualitative study.

    NARCIS (Netherlands)

    Repping-Wuts, H.; Uitterhoeve, R.; Riel, P.L.C.M. van; Achterberg, T. van

    2008-01-01

    OBJECTIVE: Interest in fatigue research has grown since the finding that fatigue is, besides pain, the symptom most frequently reported by patients with rheumatoid arthritis (RA). The aim of this study was to explore the experience of fatigue from the patients' perspective. METHODS: Twenty-nine pati

  4. GPS-free Geolocation using LoRa in Low-Power WANs

    DEFF Research Database (Denmark)

    Petersen, Martin Nordal; Fargas, Bernat Carbonés

    2017-01-01

    Internet of Things (IoT) has been growing over the last few years in multiple applications and due to the high need GPS for tracking capabilities, an innovative opportunity arises. This paper reports on a design and implementation of a LoRaWAN tracking system which is capable exploiting transmitted...

  5. Cosmic radiation dose measurements from the RaD-X flight campaign

    Science.gov (United States)

    Mertens, Christopher J.; Gronoff, Guillaume P.; Norman, Ryan B.; Hayes, Bryan M.; Lusby, Terry C.; Straume, Tore; Tobiska, W. Kent; Hands, Alex; Ryden, Keith; Benton, Eric; Wiley, Scott; Gersey, Brad; Wilkins, Richard; Xu, Xiaojing

    2016-10-01

    The NASA Radiation Dosimetry Experiment (RaD-X) stratospheric balloon flight mission obtained measurements for improving the understanding of cosmic radiation transport in the atmosphere and human exposure to this ionizing radiation field in the aircraft environment. The value of dosimetric measurements from the balloon platform is that they can be used to characterize cosmic ray primaries, the ultimate source of aviation radiation exposure. In addition, radiation detectors were flown to assess their potential application to long-term, continuous monitoring of the aircraft radiation environment. The RaD-X balloon was successfully launched from Fort Sumner, New Mexico (34.5°N, 104.2°W) on 25 September 2015. Over 18 h of flight data were obtained from each of the four different science instruments at altitudes above 20 km. The RaD-X balloon flight was supplemented by contemporaneous aircraft measurements. Flight-averaged dosimetric quantities are reported at seven altitudes to provide benchmark measurements for improving aviation radiation models. The altitude range of the flight data extends from commercial aircraft altitudes to above the Pfotzer maximum where the dosimetric quantities are influenced by cosmic ray primaries. The RaD-X balloon flight observed an absence of the Pfotzer maximum in the measurements of dose equivalent rate.

  6. Evaluation of the Psychometric Properties of SOGS-RA in the Polish Version

    Directory of Open Access Journals (Sweden)

    Jolanta Jarczyńska

    2016-09-01

    Full Text Available Objective: The objective was to adapt the American pathological gambling screening tool /SOGS-RA The South Oaks Gambling Screen - Revised for Adolescent/ by K. Winters, R. Stinchfield and J. Fulkerson (1993 and to evaluate its psychometric properties. Method: The adapted tool was used in research on a randomly selected sample of 2,617 adolescents aged 13-20 years in the 2012/2013 school year. Results: On the SOGS-RA scale, 2.6% of the trial participants achieved a score indicating past year problem gambling before the survey, 4.1% were classified as problem gamblers, whereas 17.3% of adolescents engaged in social gambling that did not pose a problem gambling risk at the time. The SOGS-RA demonstrated satisfactory internal consistency (Cronbach's alpha = 0.78. Conclusions: The Polish adaptation of the SOGS-RA scale is reliable and accurate, which is why it is worth recommending it for use in further research on Polish adolescents.

  7. RAGE activation induces invasiveness of RA fibroblast-like synoviocytes in vitro

    NARCIS (Netherlands)

    Steenvoorden, M.M.C.; Toes, R.E.M.; Ronday, H.K.; Huizinga, T.W.J.; Groot, J. de

    2007-01-01

    Ligands for the receptor for advanced glycation endproducts (RAGE) are increased in RA synovial fluid (SF), serum and synovium. Since RAGE is present on fibroblast-like synoviocytes (FLS), the present study investigates whether the RAGE ligands HMGB-1 and AGEs are able to stimulate the characteristi

  8. Spreading of water masses and regeneration of silica and sup(226)Ra in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    DileepKumar, M.; Yuan-Hui, Li

    Ra in the Indian Ocean 93 OEOSECS STATION NUYDER V. A40W INDIAN _ ____ 6 I I I ‘6’ I I I I I 0 I 2 I L l&l 0 4 5 6 GEOSECS STATION NUMBER 203 IQ EQ 209 IO. EQ LATITUDE Fig. 6. (b) Spreading of water masses (%) in the central Indian...

  9. Association of IL-2RA/CD25 with type 1 diabetes in the Belgian population

    NARCIS (Netherlands)

    Aminkeng, Folefac; Weets, Ilse; Van Autreve, Jan E.; Koeleman, Bobby P. C.; Quartier, Erik; Van Schravendijk, Chris; Gorus, Frans K.; Van der Auwera, Bart J. R.

    2010-01-01

    Our goals were to study the proposed association of IL-2RA /CD25 with type 1 diabetes in the Belgian population over a broad age range and to explore possible correlations with disease phenotypes immune markers HLA DQ INS and PTPN22 Patients (n = 1954) healthy controls (n = 2082) and families (n = 4

  10. Pseudomonas fluorescens Tn5-B20 mutant RA92 responds to carbon limitation in soil

    NARCIS (Netherlands)

    Overbeek, van L.S.; Elsas, van J.D.; Veen, van J.A.

    1997-01-01

    Tn5-B20 (lacZ as reporter gene) transcriptional fusion mutants of Pseudomonas fluorescens R2f Rpr were screened for their response to carbon limitation. Reporter gene expression was specifically induced by this stress factor in one mutant, designated RA92, and to a lower extent by phosphorus and nit

  11. Selective removal of 226Ra2+ from gas-field-produced waters

    NARCIS (Netherlands)

    Leeuwen, van Fijs W.B.; Miermans, Cornelis J.H.; Beijleveld, Hans; Tomasberger, Tanja; Davis, Jeffery T.; Verboom, Willem; Reinhoudt, David N.

    2005-01-01

    The 226Ra2+ selectivity of both the self-assembled (iso)guanosine-based systems and ionizable thiacalix[4]crown dicarboxylic acids was determined in gas-field-produced water and a metal ion-containing model solution (simulant). Seven gas-field-produced water samples have been analyzed. From a sample

  12. Social Metaphorical Mapping of the Concept of Force "CHI-KA-RA" in Japanese

    Science.gov (United States)

    Suzuki, Mariko

    2005-01-01

    This research focused on the concept of "force" ("CHI-KA-RA" in Japanese) in Newtonian mechanics. The primary objective was to develop a tool, based on metaphor, to interpret student thinking in learning scientific topics. The study provides an example of using the tool to trace the process of mutual changes in thinking during a dialog among…

  13. RAGE activation induces invasiveness of RA fibroblast-like synoviocytes in vitro

    NARCIS (Netherlands)

    Steenvoorden, M.M.C.; Toes, R.E.M.; Ronday, H.K.; Huizinga, T.W.J.; Groot, J. de

    2007-01-01

    Ligands for the receptor for advanced glycation endproducts (RAGE) are increased in RA synovial fluid (SF), serum and synovium. Since RAGE is present on fibroblast-like synoviocytes (FLS), the present study investigates whether the RAGE ligands HMGB-1 and AGEs are able to stimulate the

  14. NetRaVE: constructing dependency networks using sparse linear regression

    DEFF Research Database (Denmark)

    Phatak, A.; Kiiveri, H.; Clemmensen, Line Katrine Harder;

    2010-01-01

    NetRaVE is a small suite of R functions for generating dependency networks using sparse regression methods. Such networks provide an alternative to interpreting 'top n lists' of genes arising out of an analysis of microarray data, and they provide a means of organizing and visualizing the resulting...

  15. Teater annab ära tuleviku / Inna Grünfeldt

    Index Scriptorium Estoniae

    Grünfeldt, Inna, 1961-

    2003-01-01

    Rakvere Teatris esineb 8. ja 9. aug. rahvusvaheline performance'i trupp Insightout Company, kus teeb kaasa ka Mari Mägi. Lavastus kannab pealkirja "Ära anda tulevik" ja see on inspireeritud trupi liikmete mälupiltidest ja I. Allende romaanist "Paula"

  16. Towards a precise measurement of atomic parity violation in a single Ra+ ion

    NARCIS (Netherlands)

    Nunez Portela, M.; van den Berg, J. E.; Bekker, H.; Giri, G.S.; Hoekstra, S.; Jungmann, K.; Mohanty, A.; Onderwater, G.J.C.; Santra, B.; Schlesser, S.; Timmermans, R.G.E.; Versolato, O.O.; Wansbeek, L.W.; Willmann, L.; Wilschut, H.W.

    2013-01-01

    A single trapped Ra+(Z= 88) ion provides a very promising route towards a most precise measurement of Atomic Parity Violation (APV), since APV effects grow faster than Z 3. This experiment promises the best determination of the electroweak coupling constant at the lowest accessible energies. Such a

  17. Teater annab ära tuleviku / Inna Grünfeldt

    Index Scriptorium Estoniae

    Grünfeldt, Inna, 1961-

    2003-01-01

    Rakvere Teatris esineb 8. ja 9. aug. rahvusvaheline performance'i trupp Insightout Company, kus teeb kaasa ka Mari Mägi. Lavastus kannab pealkirja "Ära anda tulevik" ja see on inspireeritud trupi liikmete mälupiltidest ja I. Allende romaanist "Paula"

  18. 226Ra activity in the mullet species Liza aurata and South Adriatic Sea marine.

    Science.gov (United States)

    Antovic, N M; Antovic, I; Svrkota, N

    2010-08-01

    (226)Ra activity in the South Adriatic Sea-water, surface sediment, mud with detritus, seagrass (Posidonia oceanica) samples and the mullet (Mugilidae) species Liza aurata, as well as soil and sand from the Montenegrin Coast-was measured using the six-crystal gamma-coincidence spectrometer PRIPYAT-2M. The results are used for calculation of the absorbed (and annual effective) dose rates in air due to the (226)Ra gamma radiation. The absorbed dose rates ranged from 5.94 to 97.16 nGy h(-1) (soil) and from 0.65 to 7.65 nGy h(-1) (sand). In seawater (226)Ra activity is found to be from 0.08 to 0.15 Bq l(-1), while in whole L. aurata individuals from 0.58 to 1.97 Bq kg(-1). Annual intake of (226)Ra by human consumers of this fish species has been estimated to provide an effective dose of 0.006 mSv y(-1).

  19. RaPAL Bulletin, Numbers 5-13, 1988-1990.

    Science.gov (United States)

    RaPAL Bulletin, 1988

    1988-01-01

    This document consists of a 3-year compilation (9 issues) of the RaPAL (Research and Practice in Adult Literacy) Bulletin. Typical articles are: "Student Involvement in Research" (a report of a workshop by Alex Golightly, Nick Nicola, and Marilyn Stone); part of a dialogue between Paolo Freire and Ira Shor, writer/educators of Brazil and the…

  20. Imaging of Ra-223 with a small-pixel CdTe detector

    Science.gov (United States)

    Scuffham, J. W.; Pani, S.; Seller, P.; Sellin, P. J.; Veale, M. C.; Wilson, M. D.; Cernik, R. J.

    2015-01-01

    Ra-223 Dichloride (Xofigo™) is a promising new radiopharmaceutical offering survival benefit and palliation of painful bone metastases in patients with hormone-refractory prostate cancer [1]. The response to radionuclide therapy and toxicity are directly linked to the absorbed radiation doses to the tumour and organs at risk respectively. Accurate dosimetry necessitates quantitative imaging of the biodistribution and kinetics of the radiopharmaceutical. Although primarily an alpha-emitter, Ra-223 also has some low-abundance X-ray and gamma emissions, which enable imaging of the biodistribution in the patient. However, the low spectral resolution of conventional gamma camera detectors makes in-vivo imaging of Ra-223 challenging. In this work, we present spectra and image data of anthropomorphic phantoms containing Ra-223 acquired with a small-pixel CdTe detector (HEXITEC) [2] with a pinhole collimator. Comparison is made with similar data acquired using a clinical gamma camera. The results demonstrate the advantages of the solid state detector in terms of scatter rejection and quantitative accuracy of the images. However, optimised collimation is needed in order for the sensitivity to rival current clinical systems. As different dosage levels and administration regimens for this drug are explored in current clinical trials, there is a clear need to develop improved imaging technologies that will enable personalised treatments to be designed for patients.

  1. Tartu Ülikooli Pärnu kolledž / Ra Luhse

    Index Scriptorium Estoniae

    Luhse, Ra, 1964-

    1999-01-01

    Endise vabrikuhoone rekonstrueerimine ja uue õppehoone juurdeehitus. Uue kaasaegse vormikeelega hoone kavandamisel on arvestatud etapiviisilise väljaehitamisega. Projekteerija Arhitektuuribüroo Luhse & Tuhal, arhitektid Ra Luhse, Tanel Tuhal, Leles Luhse. Ehitus: AS Eston Ehitus. Projekt 1997-1998, valminud on uus õppehoone. 13 illustratsiooni. Luhse & Tuhal (arhitektibüroo). Eston Ehitus (ehitusettevõte)

  2. Data of evolutionary structure change: 1C2RA-1COTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C2RA-1COTA 1C2R 1COT A A -GDAAKGEKEFNKCKTCHSIIAPDGTEIVKGAKTGPNLY... THR CA 278 1COT A 1COTA...9563 20.21500015258789 -19.988000869750977 tion> 0.286000013351440430.7390000224113464 tion> 1.702983021736145 3.216418981552124 ...

  3. USA pastor trotsib soovitusi koraanipõletamine ära jätta / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2010-01-01

    Florida pastori Terry Jonesi plaan 11. septembril panna põlema 200 koraani on pälvinud kriitikat ja tal on palutud üritus ära jätta. Mitmes riigis on toimunud meeleavaldused Jonesi aktsiooni vastu

  4. Periodontal Disease and Subgingival Microbiota as Contributors for RA Pathogenesis: Modifiable Risk Factors?

    Science.gov (United States)

    Scher, Jose U.; Bretz, Walter A.; Abramson, Steven B.

    2014-01-01

    Purpose of review Since the early 1900s, the role of periodontal disease in the pathogenesis of rheumatoid arthritis has been a matter of intense research. The last decade has witnessed many advances supporting a link between periodontitis, the presence of specific bacterial species (i.e., Porphyromonas ginigivalis) and their effects in immune response. This review will examine available evidence on the subject. Recent findings Epidemiological studies have stressed the commonalities shared by periodontal disease and rheumatoid arthritis. Many groups have focused their attention towards understanding the periodontal microbiota and its alterations in states of health and disease. The presence of circulating antibodies against periodontopathic bacteria and associated inflammatory response has been found in both RA patients and subjects at-risk for disease development. Most recently, the periodontal microbiota of smokers and patients with RA has been elucidated, revealing profound changes in the bacterial communities compared to that of healthy controls. This has led to several small clinical trials of PD treatment as adjuvant for disease-modifying therapy in RA. Summary Smoking and periodontal disease are emerging risk factors for the development of RA. Epidemiological, clinical and basic research has further strengthened this association, pointing towards changes in the oral microbiota as possible contributors to systemic inflammation and arthritis. PMID:24807405

  5. Assessment of {sup 226}Ra age-dependent dose from water intake

    Energy Technology Data Exchange (ETDEWEB)

    Porntepkasemsan, Boonsom [Research and Development Group, Thailand Institute of Nuclear Technology, Vibhavadi Rangsit Road, Bangkok 10900 (Thailand)], E-mail: boonsom@oaep.go.th; Srisuksawad, Kanitha [Research and Development Group, Thailand Institute of Nuclear Technology, Vibhavadi Rangsit Road, Bangkok 10900 (Thailand)

    2008-11-15

    The radioactivity in canal and ground waters collected in a 2-year long observation from the vicinity of the Rare Earth Research and Development Center (RRDC), Phathumthani Province, Thailand, was measured in order to determine the concentration of {sup 226}Ra and to estimate the age-dependent effective dose to humans due to consumption. {sup 226}Ra activities in both canal and ground waters were well below the WHO guidance level for drinking water quality of 1 Bq L{sup -1}. The highest {sup 226}Ra effective doses per year were found for infants and teens. However, the observed levels of calculated {sup 226}Ra effective doses for all age groups in both canal and ground waters show satisfactory low values (less than 15 {mu}Sv yr{sup -1}). These values are acceptable in accordance with the WHO recommended reference dose level of 100 {mu}Sv yr{sup -1} from water intake of 2 L day{sup -1}.

  6. Analysis of Latency and MAC-layer Performance for Class A LoRaWAN

    DEFF Research Database (Denmark)

    Sørensen, René Brandborg; Kim, Dong Min; Nielsen, Jimmy Jessen

    2017-01-01

    We propose analytical models that allow to investigate the performance of Long Range Wide Area Network (LoRaWAN) uplink in terms of latency, collision rate, and throughput under the constraints of the regulatory duty cycling, when assuming exponential inter-arrival times. Our models take into acc...

  7. Data of evolutionary structure change: 2B9RA-2BPMD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2B9RA-2BPMD 2B9R 2BPM A D -VKDIYAYLRQLEAAQAVRPKYLLGR-EVTGNMRAILID...line>THR CA 261 GLY CA 332 ASN CA 307 2BPM... D 2BPMD YMKKQPDITNS .../line> ASP CA 206 VAL CA 247 GLU CA 298 2BPM... D 2BPMD

  8. RAGE activation induces invasiveness of RA fibroblast-like synoviocytes in vitro

    NARCIS (Netherlands)

    Steenvoorden, M.M.C.; Toes, R.E.M.; Ronday, H.K.; Huizinga, T.W.J.; Groot, J. de

    2007-01-01

    Ligands for the receptor for advanced glycation endproducts (RAGE) are increased in RA synovial fluid (SF), serum and synovium. Since RAGE is present on fibroblast-like synoviocytes (FLS), the present study investigates whether the RAGE ligands HMGB-1 and AGEs are able to stimulate the characteristi

  9. Tussenrapportage over fase 1 en 2 van het vervolgonderzoek naar Ra-226 in havenspeciepoldergronden

    NARCIS (Netherlands)

    Stoop P; Pennders RMJ; Lembrechts JFMM; LSO

    1994-01-01

    De ook in Nederland belangrijk toegenomen aandacht voor de risico's van radon (met name Rn-222)in het binnenhuismilieu waren voor VROM aanleiding een onderzoek te laten doen naar de relatie tussen de radonconcentratie in woningen en het gehalte aan radium (Ra-226)in de bodem waarop deze sta

  10. Data of evolutionary structure change: 1C8RA-3CODB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C8RA-3CODB 1C8R 3COD A B TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFY...ne>PHE CA 209 GLY CA 249 PHE CA 274 3COD... B 3CODB YILYVLFFGFTSKA...ne>GLU CA 222 VAL CA 302 3COD B 3CODB TSKAESMRPEV HHGGG

  11. Data of evolutionary structure change: 1C8RA-3CODA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1C8RA-3CODA 1C8R 3COD A A TGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFY...ne>PHE CA 209 GLY CA 249 PHE CA 274 3COD... A 3CODA YILYVLFFGFTSKA...>GLU CA 222 VAL CA 302 3COD A... 3CODA TSKAESMRPEV HHGGG H

  12. Evolution of the Role of RA and FGF Signals in the Control of Somitogenesis in Chordates.

    Science.gov (United States)

    Bertrand, Stéphanie; Aldea, Daniel; Oulion, Silvan; Subirana, Lucie; de Lera, Angel R; Somorjai, Ildiko; Escriva, Hector

    2015-01-01

    During vertebrate development, the paraxial mesoderm becomes segmented, forming somites that will give rise to dermis, axial skeleton and skeletal muscles. Although recently challenged, the "clock and wavefront" model for somitogenesis explains how interactions between several cell-cell communication pathways, including the FGF, RA, Wnt and Notch signals, control the formation of these bilateral symmetric blocks. In the cephalochordate amphioxus, which belongs to the chordate phylum together with tunicates and vertebrates, the dorsal paraxial mesendoderm also periodically forms somites, although this process is asymmetric and extends along the whole body. It has been previously shown that the formation of the most anterior somites in amphioxus is dependent upon FGF signalling. However, the signals controlling somitogenesis during posterior elongation in amphioxus are still unknown. Here we show that, contrary to vertebrates, RA and FGF signals act independently during posterior elongation and that they are not mandatory for posterior somites to form. Moreover, we show that RA is not able to buffer the left/right asymmetry machinery that is controlled through the asymmetric expression of Nodal pathway actors. Our results give new insights into the evolution of the somitogenesis process in chordates. They suggest that RA and FGF pathways have acquired specific functions in the control of somitogenesis in vertebrates. We propose that the "clock and wavefront" system was selected specifically in vertebrates in parallel to the development of more complex somite-derived structures but that it was not required for somitogenesis in the ancestor of chordates.

  13. Tourism potentials of the Raška region and development of rural tourism

    Directory of Open Access Journals (Sweden)

    Pavlović Mila

    2011-01-01

    Full Text Available In order to find solutions for stopping negative economic processes in the Raška region, as well as land reclamation and depopulation of villages, one of the main activities is adequate restructuration of the economy, according to available resources. In this paper we analyze a place of tourism in the Raška region, as an activity to which is not given appropriate developmental role in the previous development policies, as opposed to diverse and attractive natural and anthropogenic values. In the paper we identify the most significant tourism potentials of the Raška region and their evaluation score. Special attention is given to rural tourism as one of the activities that can have a greater role in future plans for demographic and economic revitalization of this area. We analyze the current state of rural tourism in the Raška region, and indicate main limiting factors that prevent rapid development of this, in many ways, primary form of tourism.

  14. Model for the induction of bone cancer by /sup 224/Ra. [In man

    Energy Technology Data Exchange (ETDEWEB)

    Groer, P.G.; Marshall, J.H.

    1976-01-01

    A mathematical model for the transformation of normal endosteal cells into malignant tumor cells by ..cap alpha.. irradiation is applied to /sup 224/Ra. The model postulates that a normal endosteal cell near the bone surface is transformed into a malignant cell by three consecutive events. The first two events are the initiation events. The probability of their occurrence is proportional to the absorbed endosteal dose and they generate dormant tumor cells. These dormant tumor cells are promoted by the third event, the promotion event. The probability of this last event is proportional to the rate of bone remodeling but independent of the radiation dose. In competition with these transforming events is the killing of any endosteal cell by ..cap alpha.. irradiation. Killing is balanced by replacement of killed endosteal cells by normal stem cells. This model provides the following interesting predictions for the human /sup 224/Ra cases: after the decay of /sup 224/Ra the tumor rate decreases exponentially at a rate proportional to the bone turnover rate; for exposure to the same dose the model predicts an increased number of tumors for protracted exposure (i.e., exposure at a lower dose rate). Implications of this model for the therapy of ankylosing spondylitis are discussed. Statistical procedures are suggested for comparison of this theoretical model with the existing data on the induction of osteosarcomas by /sup 224/Ra in man.

  15. Association of the IL2RA/CD25 Gene With Juvenile Idiopathic Arthritis

    Science.gov (United States)

    Hinks, Anne; Ke, Xiayi; Barton, Anne; Eyre, Steve; Bowes, John; Worthington, Jane; Thompson, Susan D; Langefeld, Carl D; Glass, David N; Thomson, Wendy

    2009-01-01

    Objective IL2RA/CD25, the gene for interleukin-2 receptor α, is emerging as a general susceptibility gene for autoimmune diseases because of its role in the development and function of regulatory T cells and the association of single-nucleotide polymorphisms (SNPs) within this gene with type 1 diabetes mellitus (DM), Graves' disease, rheumatoid arthritis (RA), and multiple sclerosis (MS). The aim of this study was to determine whether SNPs within the IL2RA/CD25 gene are associated with juvenile idiopathic arthritis (JIA). Methods Three SNPs within the IL2RA/CD25 gene, that previously showed evidence of an association with either RA, MS, or type 1 DM, were selected for genotyping in UK JIA cases (n = 654) and controls (n = 3,849). Data for 1 SNP (rs2104286) were also available from North American JIA cases (n = 747) and controls (n = 1,161). Association analyses were performed using Plink software. Odds ratios (ORs) and 95% confidence intervals (95% CIs) were calculated. Results SNP rs2104286 within the IL2RA/CD25 gene was significantly associated with UK JIA cases (OR for the allele 0.76 [95% CI 0.66–0.88], P for trend = 0.0002). A second SNP (rs41295061) also showed modest evidence for association with JIA (OR 0.80 [95% CI 0.63–1.0], P = 0.05). Association with rs2104286 was convincingly replicated in the North American JIA cohort (OR 0.84 [95% CI 0.65–0.99], P for trend = 0.05). Meta-analysis of the 2 cohorts yielded highly significant evidence of association with JIA (OR 0.76 [95% CI 0.62–0.88], P = 4.9 × 10−5). Conclusion These results provide strong evidence that the IL2RA/CD25 gene represents a JIA susceptibility locus. Further investigation of the gene using both genetic and functional approaches is now required. PMID:19116909

  16. Functional analysis of the Phycomyces carRA gene encoding the enzymes phytoene synthase and lycopene cyclase.

    Directory of Open Access Journals (Sweden)

    Catalina Sanz

    Full Text Available Phycomyces carRA gene encodes a protein with two domains. Domain R is characterized by red carR mutants that accumulate lycopene. Domain A is characterized by white carA mutants that do not accumulate significant amounts of carotenoids. The carRA-encoded protein was identified as the lycopene cyclase and phytoene synthase enzyme by sequence homology with other proteins. However, no direct data showing the function of this protein have been reported so far. Different Mucor circinelloides mutants altered at the phytoene synthase, the lycopene cyclase or both activities were transformed with the Phycomyces carRA gene. Fully transcribed carRA mRNA molecules were detected by Northern assays in the transformants and the correct processing of the carRA messenger was verified by RT-PCR. These results showed that Phycomyces carRA gene was correctly expressed in Mucor. Carotenoids analysis in these transformants showed the presence of ß-carotene, absent in the untransformed strains, providing functional evidence that the Phycomyces carRA gene complements the M. circinelloides mutations. Co-transformation of the carRA cDNA in E. coli with different combinations of the carotenoid structural genes from Erwinia uredovora was also performed. Newly formed carotenoids were accumulated showing that the Phycomyces CarRA protein does contain lycopene cyclase and phytoene synthase activities. The heterologous expression of the carRA gene and the functional complementation of the mentioned activities are not very efficient in E. coli. However, the simultaneous presence of both carRA and carB gene products from Phycomyces increases the efficiency of these enzymes, presumably due to an interaction mechanism.

  17. 利用 HPGe γ谱仪快速测量226 Ra%Rapid Measurement of 226 Ra Using HPGe Gamma Spectrometer

    Institute of Scientific and Technical Information of China (English)

    张轶名; 於国兵; 杜勤; 闻德运; 顾先宝; 潘灵婧

    2014-01-01

    HPGeγ谱分析中,一般通过测量222 Rn的子体来确定样品中226 Ra的含量,这种方法需要对样品密封数周后测量,无法实现样品中226 Ra含量的快速测量。文章分析了样品γ谱中186 keV全能峰的计数来源,对使用186 keV全能峰计算出的226 Ra的含量结果进行修正,得到较好的实验结果,实现了用186 keV全能峰快速测量样品中Ra的含量。%In general , the content of 226 Ra in a sample is deduced from results of 222 Rn progeny in HPGeγspectral analysis .Because the sample should be sealed for several weeks before the measurement , we can not get the results quickly through this method .The paper analyzes the source of the counts of the full -en-ergy peak in 186 keV in the full-energy peak , and modifies the result of 226 Ra content calculated by using the full-energy peak in 186 keV.The study gets good experiment results and realizes the rapid measurement of Ra in samples using the full -energy peak in 186 keV.

  18. Quantification of {sup 235} U and {sup 226} Ra in soil samples by means of Gamma spectroscopy; Cuantificacion de {sup 235} U y {sup 226} Ra en muestras de suelo por medio de espectrometria gamma

    Energy Technology Data Exchange (ETDEWEB)

    Quintero P, E.; Rojas M, V.P.; Montes M, F.R.; Gaso P, M.I.; Cervantes N, M.L. [Gerencia de Innovacion Tecnologica, A.P. 18-1027, C.P. 11801 Mexico D.F. (Mexico)

    2000-07-01

    In this work it is presented the Gamma Spectroscopy method which is realized in the Environmental Radiological Surveillance Laboratory using the option of deconvolution of a commercial software for the quantification of {sup 235} U and {sup 226} Ra; also is presented the method for the {sup 226} Ra correction activity. (Author)

  19. The Cossacks of the South of Russia in R.A. Fadeev’s geopolitical plans

    Directory of Open Access Journals (Sweden)

    Kuznetsov Oleg Viktorovich

    2013-11-01

    Full Text Available The political project of a conservative writer of political essays of the second half of the XIX c. R.A. Fadeev (1824–1883, in which a key part is assigned to the attraction of the Cossacks of Southern Russia to solving the pressing foreign policy issues, is analyzed. A conclusion that the Cossacks could be used as a militant vanguard, i.e. military force (infantry, cavalry, reconnaissance and an effective tool of the colonization of the suburbs of the Russian Empire – is drawn. The conditions under which R.A. Fadeev could implement his plans are revealed. The key condition is the preservation of the identity of the Cossacks as a class and as a sub-ethnos. The historical assessment of the R.A. Fadeev’s plans is given. According to the plans R.A. Fadeev, revived after the reforms of its military power, Russia should not only play a key role in international relations, but also strive for a first impact and then rule on its neighboring Asian and European territories. And in the perspective he saw the new world order, in which there would be two dominating superpowers, Russia and the United States. The Cossacks were assigned an important role in the implementation of these plans by the publicist.This geopolitical project, no matter how attractive it was not for the Russians at first glance, was a utopia. The publicist obviously overestimated the military and economic capabilities of contemporary Imperial Russia, the ability of the autocracy to the socio-economic and political renewal of the country corresponding to the demands of the times. Consequently, the Cossacks were not destined to play the role which was assigned to them by R.A. Fadeev. Althoughhe anticipated accurately the individual elements of the future world order established for several decades in the XX century.

  20. Mucosal delivery of anti-inflammatory IL-1Ra by sporulating recombinant bacteria

    Directory of Open Access Journals (Sweden)

    Ruggiero Paolo

    2004-10-01

    Full Text Available Abstract Background Mucosal delivery of therapeutic protein drugs or vaccines is actively investigated, in order to improve bioavailability and avoid side effects associated with systemic administration. Orally administered bacteria, engineered to produce anti-inflammatory cytokines (IL-10, IL-1Ra, have shown localised ameliorating effects in inflammatory gastro-intestinal conditions. However, the possible systemic effects of mucosally delivered recombinant bacteria have not been investigated. Results B. subtilis was engineered to produce the mature human IL-1 receptor antagonist (IL-1Ra. When recombinant B. subtilis was instilled in the distal colon of rats or rabbits, human IL-1Ra was found both in the intestinal lavage and in the serum of treated animals. The IL-1Ra protein in serum was intact and biologically active. IL-1-induced fever, neutrophilia, hypoglycemia and hypoferremia were inhibited in a dose-dependent fashion by intra-colon administration of IL-1Ra-producing B. subtilis. In the mouse, intra-peritoneal treatment with recombinant B. subtilis could inhibit endotoxin-induced shock and death. Instillation in the rabbit colon of another recombinant B. subtilis strain, which releases bioactive human recombinant IL-1β upon autolysis, could induce fever and eventually death, similarly to parenteral administration of high doses of IL-1β. Conclusions A novel system of controlled release of pharmacologically active proteins is described, which exploits bacterial autolysis in a non-permissive environment. Mucosal administration of recombinant B. subtilis causes the release of cytoplasmic recombinant proteins, which can then be found in serum and exert their biological activity in vivo systemically.

  1. LoRa Scalability: A Simulation Model Based on Interference Measurements

    Directory of Open Access Journals (Sweden)

    Jetmir Haxhibeqiri

    2017-05-01

    Full Text Available LoRa is a long-range, low power, low bit rate and single-hop wireless communication technology. It is intended to be used in Internet of Things (IoT applications involving battery-powered devices with low throughput requirements. A LoRaWAN network consists of multiple end nodes that communicate with one or more gateways. These gateways act like a transparent bridge towards a common network server. The amount of end devices and their throughput requirements will have an impact on the performance of the LoRaWAN network. This study investigates the scalability in terms of the number of end devices per gateway of single-gateway LoRaWAN deployments. First, we determine the intra-technology interference behavior with two physical end nodes, by checking the impact of an interfering node on a transmitting node. Measurements show that even under concurrent transmission, one of the packets can be received under certain conditions. Based on these measurements, we create a simulation model for assessing the scalability of a single gateway LoRaWAN network. We show that when the number of nodes increases up to 1000 per gateway, the losses will be up to 32%. In such a case, pure Aloha will have around 90% losses. However, when the duty cycle of the application layer becomes lower than the allowed radio duty cycle of 1%, losses will be even lower. We also show network scalability simulation results for some IoT use cases based on real data.

  2. Zaštita računarskih mreža / Protection of computer networks

    Directory of Open Access Journals (Sweden)

    Milojko Jevtović

    2005-09-01

    Full Text Available U radu su obrađene metode napada, oblici ugrožavanja i vrste pretnji kojima su izložene računarske mreže, kao i moguće metode i tehnička rešenja za zaštitu mreža. Analizirani su efekti pretnji kojima mogu biti izložene računarske mreže i informacije koje se preko njih prenose. Opisana su određena tehnička rešenja koja obezbeđuju potreban nivo zaštite računarskih mreža, kao i mere za zaštitu informacija koje se preko njih prenose. Navedeni su standardi koji se odnose na metode i procedure kriptozaštite informacija u računarskim mrežama. U radu je naveden primer zaštite jedne lokalne računarske mreže. / In this paper different methods of attacks, threats and different forms of dangers to the computer networks are described. The possible models and technical solutions for networks protection are also given. The effects of threats directed to the computer networks and their information are analyzed certain technical solutions that provide necessary protection level of the computer networks as well as measures for information protection are also described. The standards for methods and security procedure for the information in computer networks are enlisted. There is also an example of protecting one local data network (in this paper.

  3. Successful TB treatment induces B-cells expressing FASL and IL5RA mRNA.

    Science.gov (United States)

    van Rensburg, Ilana C; Wagman, Chandre; Stanley, Kim; Beltran, Caroline; Ronacher, Katharina; Walzl, Gerhard; Loxton, Andre G

    2017-01-10

    Activated B-cells increase T-cell behaviour during autoimmune disease and other infections by means of cytokine production and antigen-presentation. Functional studies in experimental autoimmune encephalomyelitis (EAE) indicate that B-cell deficiencies, and a lack of IL10 and IL35 leads to a poor prognosis. We hypothesised that B-cells play a role during tuberculosis. We evaluated B-cell mRNA expression using real-time PCR from healthy community controls, individuals with other lung diseases and newly diagnosed untreated pulmonary TB patients at three different time points (diagnosis, month 2 and 6 of treatment).We show that FASLG, IL5RA, CD38 and IL4 expression was lower in B-cells from TB cases compared to healthy controls. The changes in expression levels of CD38 may be due to a reduced activation of B-cells from TB cases at diagnosis. By month 2 of treatment, there was a significant increase in the expression of APRIL and IL5RA in TB cases. Furthermore, after 6 months of treatment, APRIL, FASLG, IL5RA and CD19 were upregulated in B-cells from TB cases. The increase in the expression of APRIL and CD19 suggests that there may be restored activation of B-cells following anti-TB treatment. The upregulation of FASLG and IL5RA indicates that B-cells expressing regulatory genes may play an important role in the protective immunity against M.tb infection. Our results show that increased activation of B-cells is present following successful TB treatment, and that the expression of FASLG and IL5RA could potentially be utilised as a signature to monitor treatment response.

  4. Estimation of dose rate of a package ({sup 223+}Ra) and evaluation of transport index; Dosisleistungsabschaetzung bei einem Versandstueck ({sup 223+}Ra) und Ermittlung der Transportkennzahl nach ADR

    Energy Technology Data Exchange (ETDEWEB)

    Bittner, Michael [TUEV SUED Industrie Services GmbH, Region Nordost, Leipzig (Germany). Anlagensicherheit/Strahlenschutz; Richter, Jens [TUEV SUED Industrie Services GmbH, Region Nordost, Dresden (Germany). Anlagensicherheit/Strahlenschutz

    2016-08-01

    The transport index of a package is to be determined according to provisions of the ADR. It is directly related to the maximum radiation level in mSv/h at a distance of 1 m from the external surface of the package or pallet. To evaluate the existing distribution of the dose equivalent outside the package or pallet calculations of photon dose rates are required. For Monte-Carlo simulations with MCNP5 a three-dimensional model of a package containing Xofigo trademark was created, which contains all relevant sources from {sup 223}Ra and its decay chain.

  5. Therapy palliative with {sup 2}23Ra without special radiation protection measures?; Palliative Therapie mit {sup 223}Ra ohne besondere Strahlenschutzmassnahmen?

    Energy Technology Data Exchange (ETDEWEB)

    Just, Guenther [Forschungsbuero Radonbalneologie (FRB), Grosspoesna (Germany); Petzold, Juergen

    2015-07-01

    For nearly 2 years now as a therapy of the castration resistant prostata carcinoma a nuclide therapy with {sup 223}Ra-Dichloride (trade-mark Xofigo) is applied. Xofigo is applied by a medical specialist for nuclear medicine altogether 6 times in a monthly distance. The activity used in each case is according to the body weight (50 kBq/kg BW). This therapy is licensed by the supervisory authorities of the German federal countries as an ambulant therapy. Special radiation protection measures are only required when exceeding a given number of 17 patients per year as incorparation measurements.

  6. A Microdeletion of Chromosome 9q33.3 Encompasses the Entire LMX1B Gene in a Chinese Family with Nail Patella Syndrome

    Directory of Open Access Journals (Sweden)

    Shujuan Jiang

    2014-11-01

    Full Text Available Nail patella syndrome (NPS is an autosomal dominant disorder characterized by nail malformations, patellar apoplasia, or patellar hypoplasia. Mutations within the LMX1B gene are found in 85% of families with NPS; thus, this gene has been characterized as the causative gene of NPS. In this study, we identified a heterozygous microdeletion of the entire LMX1B gene using multiplex ligation-dependent probe amplification (MLPA in a Chinese family with NPS. The determination of the deletion breakpoints by Illumina genome-wide DNA analysis beadchip showed that the deletion was located in chromosome 9q33.3 and spanned about 0.66 Mb in size. This heterozygous deletion provides strong evidence for haploinsufficiency as the pathogenic mechanism of NPS.

  7. IL-1Ra (recombinant human IL-1 receptor antagonist in the treatment of rheumatoid arthritis: the efficacy

    Directory of Open Access Journals (Sweden)

    L. Cozzi

    2011-09-01

    Full Text Available Interleukin 1 receptor antagonist (IL-1Ra is a naturally occurring IL-1 inhibitor, acting as a “receptor antagonist”, which blocks IL-1 mediated signal transduction. In 1990 IL-1Ra was cloned and later on, a large numbers of studies led to disclosure of the crucial importance of the imbalance between IL-1 and IL-1Ra in the pathogenesis of rheumatoid arthritis (RA. In 1991, almost 8 years after the initial isolation of IL-1, recombinant IL-1Ra (IL-1ra, Kineret was introduced in clinical trials involving patients with RA. Between 2001 and 2002 IL-1ra was approved by the US Food and Drug Administration and by the European Agency for the Evaluation of the Medicinal Products and in 2003 it was registered in Italy, too. In RA recombinant IL-1ra has been evaluated in 5 randomized, placebo-controlled clinical trials involving more than 2900 patients. Two of the trials involved the use of IL-1ra as monotherapy versus placebo and two trials in combination with methotrexate (MTX; the last trial explored the use of a fixed 100 mg/day IL-1ra dosage in a RA patient population including a wide array of co-morbid conditions as well as concomitant medications. The studies confirmed both the efficacy and the safety of IL-1ra in patients with active and severe RA. 43% of patients receiving 150 mg/day IL-1ra achieved a 20% response according to the American College of Rheumatology criteria (ACR20, compared to 27% in the placebo group. In the MTX combination therapy study, 42% of the patients receiving 1 mg/Kg/day of IL-1ra achieved an ACR20, 24% an ACR50 and 10% an ACR70. In each study, significant improvements in the Health Assessment Questionnaire scores (HAQ were observed. There were rapid gains in the number of days at work or domestic activity in the treated patients, and the increases in productivity were dose related. At early 24 weeks, there was significant reduction of both the score for progression of joint space narrowing (JSN and the Total modified

  8. Activity ratios of (234)U/(238)U and (226)Ra/(228)Ra for transport mechanisms of elevated uranium in alluvial aquifers of groundwater in south-western (SW) Punjab, India.

    Science.gov (United States)

    Kumar, A; Karpe, R K; Rout, S; Gautam, Y P; Mishra, M K; Ravi, P M; Tripathi, R M

    2016-01-01

    The concentrations of total dissolved uranium (U), its isotopic composition ((234)U, (235)U, (238)U) and two long lived Ra isotopes ((226)Ra and (228)Ra) in alluvial aquifers of groundwater were determined to investigate the groundwater flow pattern in the south-western (SW) Punjab, India. Particular attention was given to the spatial variability of activity ratios (ARs) of (234)U/(238)U and (226)Ra/(228)Ra to predict the possible sources and supply process of U into the water from the solid phase. The measured groundwater (234)U/(238)U ARs were ∼1 or >1 in the shallow zone (depth  30 m) with relatively low U concentration. The simultaneous elevated U concentration and (234)U/(238)U ARs in waters were possibly due to differences in imprints of rock-water interactions under hydrologic conditions. However, (234)U/(238)U ARs aquifers.

  9. On the 500 °C isothermal section of the ternary Eu–Ag–Ga system up to 33.3 at.% Eu

    Energy Technology Data Exchange (ETDEWEB)

    Verbovytskyy, Yu., E-mail: yuryvv@bigmir.net [Campus Tecnológico e Nuclear, Instituto Superior Técnico, Universidade Técnica de Lisboa/CFMC–UL, Estrada Nacional 10, 2695-066 Bobadela LRS (Portugal); Pereira, M.F.C. [Centro de Petrologia e Geoquímica, Instituto Superior Técnico, Universidade Técnica de Lisboa, Avenida Rovisco Pais 1, 1049-001 Lisboa (Portugal); Gonçalves, A.P. [Campus Tecnológico e Nuclear, Instituto Superior Técnico, Universidade Técnica de Lisboa/CFMC–UL, Estrada Nacional 10, 2695-066 Bobadela LRS (Portugal)

    2014-01-25

    Highlights: • Isothermal section of the Eu–Ag–Ga (0–33.3 at.% Eu) system at 500 °C. • Identification six new ternary intermetallic phases. • Crystal structure determination of the Eu{sub 2}Ag{sub 13.6–13}Ga{sub 3.3–4}. -- Abstract: The isothermal section of the ternary Eu–Ag–Ga system has been studied at 500 °C for the 0–33.3 at.% Eu concentration region. X-ray diffraction techniques, optical microscopy and scanning electron microscopy, complemented with energy dispersive X-ray spectroscopy, were used to identify the phases and characterize their crystal structures and compositions. The crystal structure of selected phases has been refined using powder X-ray diffraction data. This study indicates the formation of six new intermetallic phases in the explored region: EuAg{sub 0.14}Ga{sub 2.86} (own type, related to CeNiSi{sub 2} type), EuAg{sub 2.8}Ga{sub 1.8} (YbAg{sub 2.5}Ga{sub 2.1} type), Eu{sub 4}Ag{sub 14.7}Ga{sub 7.6} (Sc{sub 4}Cu{sub 14.76}Ga{sub 7.51} type), Eu{sub 4}Ag{sub 11.3}Ga{sub 5.7} (own type), Eu{sub 2}Ag{sub 13.6–13}Ga{sub 3.3–4} (Th{sub 2}Zn{sub 17} type) and EuAg{sub 3.2}Ga{sub 0.8} (unknown type)

  10. Co-contraction in RA patients with a mobile bearing total knee prosthesis during a step-up task

    NARCIS (Netherlands)

    Garling, E.H.; Wolterbeek, N.; Velzeboer, S.; Nelissen, R.G.H.H.; Valstar, E.R.; Doorenbosch, C.A.M.; Harlaar, J.

    2008-01-01

    It was hypothesized that rheumatoid arthritis (RA) patients with a total knee prosthesis that allows axial rotation of the bearing (MB) will show more co-contraction to stabilize the knee joint during a step-up task than RA patients with a fixed bearing total knee prosthesis (FB) where this rotation

  11. QUEST-RA: quantitative clinical assessment of patients with rheumatoid arthritis seen in standard rheumatology care in 15 countries

    DEFF Research Database (Denmark)

    Sokka, Tuulikki; Kautiainen, Hannu; Toloza, Sergio

    2007-01-01

    OBJECTIVE: To conduct a cross-sectional review of non-selected consecutive outpatients with rheumatoid arthritis (RA) as part of standard clinical care in 15 countries for an overview of the characteristics of patients with RA. METHODS: The review included current disease activity using data from...

  12. SF Treg cells transcribing high levels of Bcl-2 and microRNA-21 demonstrate limited apoptosis in RA

    NARCIS (Netherlands)

    van der Geest, Kornelis S. M.; Smigielska, Katarzyna; Park, Ji-Ah; Abdulahad, Wayel H.; Kim, Hye-Won; Kroesen, Bart-Jan; van den Berg, Anke; Boots, Annemieke M. H.; Lee, Eun-Bong; Brouwer, Elisabeth

    2015-01-01

    Objective. The aim of this study was to investigate the turnover of Treg cells in the SF of RA patients. Methods. Treg cells were enumerated in peripheral blood and SF of RA patients and analysed by flow cytometry for expression of the proliferation marker Ki-67 and binding of the apoptosis marker a

  13. Autoantibodies to citrullinated proteins in rheumatoid arthritis: clinical performance and biochemical aspects of an RA-specific marker.

    NARCIS (Netherlands)

    Nijenhuis, S.; Zendman, A.J.W.; Vossenaar, E.R.; Pruijn, G.J.M.; Venrooij, W.J.W. van

    2004-01-01

    Rheumatoid arthritis (RA) is a common, systemic autoimmune disease of which the exact etiology is not known. In the past 10 years, substantial progress has been made in the identification of the antigens specifically recognized by the autoantibodies of RA patients. A central factor in this respect i

  14. ra kontoris segab tööd / Patrick Kurtz ; tõlk. Pille Korpen

    Index Scriptorium Estoniae

    Kurtz, Patrick

    2005-01-01

    Üldnõuetest kontorite planeerimisel. Müra vähendamise planeerimisest. Tabelid: Müra helivõimsuse taseme allikad; Arvutitöökohtade akustika. Vt. ka: Avatud kontor võib olla ka vaikne. BNSi vastutav peatoimetaja Anvar Samost räägib avatud tööruumi eelistest

  15. ScaRaB and CERES-Terra: results of the inter-comparison campaigns

    Science.gov (United States)

    Trémas, Thierry L.; Aznay, Ouahid; Chomette, Olivier

    2016-09-01

    ScaRaB (SCAnner for RAdiation Budget) is an Indo-French satellite onboard MEGHA-TROPIQUES launched on October 12th 2011. This radiometer has been designed to fill the gap between the ERBS and CERES missions to study the water cycle and energy exchanges in the tropics. ScaRaB is fit with four parallel and independent channels: channel- 2 and channel-3 being considered as the main ones, channel-1 is dedicated to measure solar radiance while channel-4 is an infrared window. The absolute calibration of ScaRaB is achieved by internal calibration sources (black bodies and a lamp for channel-1). The radiometric properties of deserts sites and more especially their stable spectral response over time made them very good candidates to perform temporal monitoring of ScaRaB channel-1. This paper deals with the corresponding results. High altitude clouds are observed by ScaRaB to survey the balance between channel 2 and channel 3: the earth longwave radiance is isolated by subtracting the short-wave channel to the total channel. Radiometric cross calibration of Earth observation sensors is a crucial need to guarantee or quantify the consistency of measurements from different sensors. CERES and ScaRaB Earth Radiation Budget missions have the same specification: to provide an accuracy of 1% in the measurement of short-wave and long-wave radiances and an estimation of the short-wave and long-wave fluxes less than 10 W/m2. Taking advantage of the "equatorial" orbit of Megha-Tropiques, NASA proceeded to manoeuvers on CERES-Terra in order to ease an inter-comparison between both instruments over common targets. Actually, The CERES PAPS mode was used to align its swath scan in order to increase the collocated pixels between the two instruments. The experience lasted 3 months from March 22th and May 31st 2015. A previous similar campaign has already been led in 2012. This article presents the results of these inter-comparisons, providing an indication on the temporal stability of the

  16. Implementation of the Juvenile Justice and Welfare Act of 2006 (RA 9344: Inputs to Policy Amendments

    Directory of Open Access Journals (Sweden)

    DR. FREDDY E. BILOG

    2014-06-01

    Full Text Available The study aimed to assess the status of implementation of RA 9433 or Juvenile Justice and Welfare Act of 2006 with respect to the various sectors namely: police; city social welfare and development and family court.. It also determine the problems encountered by the three groups of respondents and test the difference among the responses of the three groups: to determine the implication of implementation of RA 9344 to the community as perceived by three groups of respondents and based on the findings to propose inputs to policy amendments. It was found out that majority of the juvenile offenders in Batangas City are 15-17 years old, single, males, finished elementary education with crime of theft committed in 2012 and under the custody of their parents or legal guardians. Objectives, compliance, evaluation and monitoring as status of RA 9344 were implemented as a new approach in criminal justice system with juvenile offenders. Each sector experiences problems in implementing RA 9344 especially when it comes to insufficient knowledge of the child, and the parents regarding the child’s severity of crime and constitutional rights. The study found a significant relationship between the status of implementation of RA 9344 and the problems encountered. Further, there are differences between the responses of the three groups of respondents. Exemption of youth offenders in criminal responsibility has an impact on the community since the youth may repeat the crime or they could commit crime that is more severe than the previous crime committed. Additionally, compliance, evaluation and monitoring were found to be significantly related to the impact of exemption of youth offenders in criminal responsibility. Based on the findings, the study identified inputs for possible amendments of policies that govern RA 9344 towards a more efficient and effective implementation. These intervention programs such as child management training and rehabilitative program

  17. 外源GA3和PP333对甜樱桃新梢生长及赤霉素代谢关键基因表达的影响%Effects of GA3 And PP333 on Shoot Growth and Gene Expression of Gibberellins Metabolism in Prunus Avium

    Institute of Scientific and Technical Information of China (English)

    刘芳; 袁华招; 沈欣杰; 廖雄; 李天红

    2013-01-01

    本研究以9年生甜樱桃红灯(Prunus avium L.‘Hongdeng’)为试材,于新梢生长期进行100mg·L-1赤霉素(GA3)、300 mg·L-1多效唑(PP333)叶面喷施处理.试验结果表明GA3可明显促进新梢生长,新梢生长量长达15.04cm,为对照的2倍,而PP333则显著抑制了新梢的生长.GA3处理可使其内源GA3含量发生明显变化,在处理后14d更高达对照的2.2倍,之后迅速下降,而PP333处理后内源GA3含量呈持续下降趋势.实时荧光定量PCR结果表明GA3处理能够抑制GA20-ox、GA3-ox2种合成关键酶基因的转录,而PP333处理则使GA20-ox、GA3-ox转录水平在后期明显升高.同时赤霉素代谢关键酶GA2-ox转录水平在不同处理中均表现出与赤霉素含量类似的变化规律.说明在甜樱桃内源赤霉素含量与合成代谢酶转录水平间,反馈调节机制可能发挥着重要作用.该研究结果将为生产中采用基因工程手段控制营养生长,实现矮化密植提供理论参考.

  18. CD45RA-Foxp3(low) non-regulatory T cells in the CCR7-CD45RA-CD27+CD28+ effector memory subset are increased in synovial fluid from patients with rheumatoid arthritis.

    Science.gov (United States)

    Matsuki, Fumichika; Saegusa, Jun; Nishimura, Keisuke; Miura, Yasushi; Kurosaka, Masahiro; Kumagai, Shunichi; Morinobu, Akio

    2014-07-01

    Increased numbers of regulatory T (Treg) cells are found in synovial fluid from patients with rheumatoid arthritis (RASF) compared with peripheral blood. However, Treg cells in RASF have been shown to have a decreased capacity to suppress T cells. Here we phenotypically classified CD4+ T cells in RASF into six subsets based on the expression of CD45RA, CCR7, CD27 and CD28, and demonstrated that the CCR7-CD45RA-CD27+CD28+ TEM subset was significantly increased in synovial fluid compared with peripheral blood. In addition, the proportion of Foxp3+ Treg cells in the CCR7-CD45RA-CD27+CD28+ TEM subset was significantly increased in RASF. Furthermore, most of the Foxp3+ Treg cells in RASF were non-suppressive CD45RA-Foxp3(low) non-Treg cells, and the frequency of the non-Treg cells in the CCR7-CD45RA-CD27+CD28+ TEM subset was significantly increased in RASF. Our findings suggest that the pro-inflammatory environment in RA joints may induce the increase of CD45RA-Foxp3(low) non-Treg cells in synovial fluid.

  19. Estudio comparado de las Rañas Españolas

    OpenAIRE

    1994-01-01

    Es intención del estudio conseguir un mayor conocimiento geomorfológico de las rañas de las distintas áreas seleccionadas (s de la cantábrica, n y s del Sistema Central, n de los montes de Toledo y ambas vertientes de Sierra Morena) y poner de manifiesto la diversidad de las rañas españolas, con el fin de profundizar en el tema de una posible génesis única o bien una poligenia. La diversidad se ha puesto de manifiesto a través del conocimiento del medio físico (geología, clima, suelo y vegeta...

  20. A COMPARISON OF THE ROSE-WAALER, LATEX FIXATION, "RA-TEST," AND BENTONITE FLOCCULATION TESTS.

    Science.gov (United States)

    Greenbury, C L; Keningale, J

    1960-07-01

    The bentonite flocculation test of Bozicevich, Bunim, Freund, and Ward (1958), the latex fixation test of Singer and Plotz (1956), and the "RA-test" (a latex reagent for use as a slide test) of Hyland Laboratories have been compared with each other and with a modified Rose-Waaler test, the behaviour of which has been previously extensively investigated. In these tests sera from 2,250 patients were tested by two or more methods on 3,000 occasions. The findings of this trial are set out and the merits of the tests and reasons for disagreement among them are discussed. It is concluded that the most satisfactory means of testing rheumatoid sera is by the Rose-Waaler test and the "RA-test," or a satisfactory modification of it, in parallel.

  1. Mechanics of the IL2RA gene activation revealed by modeling and atomic force microscopy.

    Science.gov (United States)

    Milani, Pascale; Marilley, Monique; Sanchez-Sevilla, Albert; Imbert, Jean; Vaillant, Cédric; Argoul, Françoise; Egly, Jean-Marc; Rocca-Serra, José; Arneodo, Alain

    2011-04-13

    Transcription implies recruitment of RNA polymerase II and transcription factors (TFs) by DNA melting near transcription start site (TSS). Combining atomic force microscopy and computer modeling, we investigate the structural and dynamical properties of the IL2RA promoter and identify an intrinsically negative supercoil in the PRRII region (containing Elf-1 and HMGA1 binding sites), located upstream of a curved DNA region encompassing TSS. Conformational changes, evidenced by time-lapse studies, result in the progressive positioning of curvature apex towards the TSS, likely facilitating local DNA melting. In vitro assays confirm specific binding of the General Transcription Factors (GTFs) TBP and TFIIB over TATA-TSS position, where an inhibitory nucleosome prevented preinitiation complex (PIC) formation and uncontrolled DNA melting. These findings represent a substantial advance showing, first, that the structural properties of the IL2RA promoter are encoded in the DNA sequence and second, that during the initiation process DNA conformation is dynamic and not static.

  2. Data communications with VSATs - RA/TDMA vs. SS/CDMA

    Science.gov (United States)

    Kim, Kap S.

    Random-access TDMA and spread-spectrum CDMA, two of the most predominant hub-VSAT (very-small-aperture terminal) inbound access techniques today, are discussed in relation to the interactive data application environment where the response time is the most critical performance parameter. The system access techniques, access time, channel capacity, and performance comparison are presented. It is concluded that, in general, either RA/TDMA or SS/CDMA can provide cost/performance-effective serivce for interactive applications as compared with terrestrial service alternatives. If the user's data application consists mostly of short message transactions and its inbound aggregated data rate is low (less than 9.6 kb/s), the SS/CDMA system is recommended. The RA/TDMA system is better suited for the user applications which require a mix of interactive and batch processings.

  3. Efecto del hierro en el desarrollo de las raíces de las plantas

    OpenAIRE

    Correa Velásquez, Jairo

    2012-01-01

    Se investigó el efecto del hierro en el desarrollo de las raíces del cacao, el café y el fríjol. También se observó la velocidad de recuperación de la clorofila en plantas cloróticas de cacao y café, al agregarles cantidades crecientes de hierro, y el efecto de dicha recuperación sobre el desarrollo radical. Además, se estudió el grado de absorción y movilización de Fe50 en plantas de cacao, y el efecto de distintas dosis de hierro en el crecimiento de raíces aisladas cacao, café y fríjol. ...

  4. Parasitismo em bovinos de raças de carne e brava no concelho de Coruche

    OpenAIRE

    Crespo, Maria Virgínia; Mariano, Pedro; ROSA, FERNANDA

    2013-01-01

    Entre março e maio de 2007 efetuou-se um estudo parasitológico em efetivos bovinos de raças de Carne e Brava do Concelho de Coruche, visando a determinação das principais helmintoses presentes. Colheram-se 206 amostras de fezes em explorações bovinas de carne e 30 em explorações de raça brava. As amostras foram sujeitas a análises coprológicas, com base em métodos qualitativos e quantitativos (técnicas de Willis, de sedimentação e de McMaster). Procedeu-se também à prospeção...

  5. Olivier Caïra, Jeux de rôle. Les forges de la fiction

    Directory of Open Access Journals (Sweden)

    Antoine Dauphragne

    2010-06-01

    Full Text Available Les forges de la fiction, d’Olivier Caïra, est à ranger parmi les rares ouvrages francophones en sciences humaines s’attachant au jeu de rôles. L’ouvrage en propose une analyse fine et dynamique centrée sur la pratique des joueurs. La démarche annoncée, qui entend proposer un texte accessible aussi bien aux rôlistes qu’aux universitaires, semble renvoyer autant à un souci de clarté qu’au profil de l’auteur. Olivier Caïra est sociologue ; ses travaux portent sur l’industrie du divertissement e...

  6. Measurements of octupole collectivity in Rn and Ra nuclei using Coulomb excitation

    CERN Multimedia

    We propose to exploit the unique capability of HIE-ISOLDE to provide post-accelerated $^{221,222}$Rn and $^{222,226,228}$Ra ion beams for the study of octupole collectivity in these nuclei. We will measure E3 transition moments in $^{222}$Rn and $^{222,226,228}$Ra in order to fully map out the variation in E3 strength in the octupole mass region with Z$\\thicksim$88 and N$\\thicksim$134. This will validate model calculations that predict different behaviour as a function of N. We will also locate the position of the parity doublet partner of the ground state in $^{221}$Rn, in order to test the suitability of odd-A radon isotopes for EDM searches.

  7. PACKAGING WASTE MANAGEMENT ON EXAMPLE OF CITY ZIELONA GÓRA

    Directory of Open Access Journals (Sweden)

    Joanna ZARĘBSKA

    2012-01-01

    Full Text Available The article presents the legal requirements of the European Union's packaging waste, and their most recent transposition into Polish law. The author has attempted to describe selected achievements of the Department of Public Utilities and Housing (DPUaH in Zielona Góra, which for many years on behalf of the city, in a systematic way it’s developing municipal waste management system (including packaging, consistent with EU policies and objectives of sustainable development. The deficiencies and weaknesses in the system are taken into consideration, whose liquidation is a priority for future investment of DPUaH consistent with the Waste Management Plan for the City of Zielona Góra.

  8. Precise Study of Fine Structure in $^{14}$C Emission from $^{223}$Ra

    CERN Multimedia

    2002-01-01

    We request 10 shifts in two sessions of beam time at ISOLDE for the production of a $^{223}$Ra source. This source will be used with the superconducting spectrometer SOLENO at Orsay for a precise measurement (good statistics and energy resolution) of the fine stucture in the energy spectrum of $^{14}$C nuclei emitted by $^{223}$Ra, discovered at Orsay in July 1989. The measurement will be devoted to carry out the hindrance factors of the transitions to 15$\\!^-\\!$/2$\\,$ (1.423 MeV) and 5$\\!^+\\!$/2$\\,$ (1.567 MeV) excited states of $^{209}$Pb, which present a particular interest for obtaining spectroscopic information and testing nuclear models.

  9. Studies of transport pathways of Th, U, rare earths, Ra-228, and Ra-226 from soil to plants and farm animals: Final progress report, 1983-1988

    Energy Technology Data Exchange (ETDEWEB)

    Linsalata, P

    1988-07-01

    This report consists of three parts. Part 1 discusses a field study conducted in an area of enhanced, natural radioactivity to assess the soil to edible vegetable concentration ratios (CR = concentration in dry vegetable/concentration in dry soil) of Th-232, Th-230, Ra-226, Ra-228, and the light rare earth elements (REE's), La, Ce, and Nd. Twenty-eight soil, and approximately 42 vegetable samples consisting of relatively equal numbers of seven varieties, were obtained from 11 farms on the Pocos de Caldas Plateau in the state of Minas Gerais, Brazil. This region is the site of a major natural analogue study to assess the mobilization and retardation processes affecting thorium and the REE's at the Morro do Ferro ore body, and uranium series radionuclides at the Osamu Utsumi open pit uranium mine. Thorium (IV) serves as a chemical analogue for quadrivalent plutonium, the light REE's (III) as chemical analogues for trivalent americium and curium, and uranium (VI) as an analogue for transuranics with stable oxidation states above IV, e.g., Pu(VI). Part 2 includes our final measurement results for naturally occurring light rare earth elements (REE's include La, Ce, Nd, and SM), U-series and Th-series radionuclides in adult farm animal tissues, feeds and soils. Our findings on soil-to-tissue concentration ratios (CR's) and the comparative behavior of these elements in farm animals raised under natural conditions by local farmers are presented. Part 3 summarizes our findings to date on the distribution and mobilization of Th-232, light rare earth elements (LREE), U-238 and Ra-228 in the MF basin. Estimates of first order, present day, mobilization rate constants resulting from ground water solubilization and seepage/stream transport are calculated using revised inventory estimates for the occurrence of these elements in the ore body and annual flux estimates for the transport of these elements away from the ore body. 151 refs., 20 figs., 40 tabs.

  10. Mechanics of the IL2RA Gene Activation Revealed by Modeling and Atomic Force Microscopy

    OpenAIRE

    Pascale Milani; Monique Marilley; Albert Sanchez-Sevilla; Jean Imbert; Cédric Vaillant; Françoise Argoul; Jean-Marc Egly; José Rocca-Serra; Alain Arneodo

    2011-01-01

    Transcription implies recruitment of RNA polymerase II and transcription factors (TFs) by DNA melting near transcription start site (TSS). Combining atomic force microscopy and computer modeling, we investigate the structural and dynamical properties of the IL2RA promoter and identify an intrinsically negative supercoil in the PRRII region (containing Elf-1 and HMGA1 binding sites), located upstream of a curved DNA region encompassing TSS. Conformational changes, evidenced by time-lapse studi...

  11. Final Report Ra Power Management 1255 10-15-16 FINAL_Public

    Energy Technology Data Exchange (ETDEWEB)

    Iverson, Aaron [Ra Power Management, Inc., Oakland, CA (United States)

    2016-10-12

    Ra Power Management (RPM) has developed a cloud based software platform that manages the financial and operational functions of third party financed solar projects throughout their lifecycle. RPM’s software streamlines and automates the sales, financing, and management of a portfolio of solar assets. The software helps solar developers automate the most difficult aspects of asset management, leading to increased transparency, efficiency, and reduction in human error. More importantly, our platform will help developers save money by improving their operating margins

  12. Final Report Ra Power Management 1255 10-15-16 FINAL_Public

    Energy Technology Data Exchange (ETDEWEB)

    Iverson, Aaron [Ra Power Management, Inc., Oakland, CA (United States)

    2016-09-30

    Ra Power Management (RPM) has developed a cloud based software platform that manages the financial and operational functions of third party financed solar projects throughout their lifecycle. RPM’s software streamlines and automates the sales, financing, and management of a portfolio of solar assets. The software helps solar developers automate the most difficult aspects of asset management, leading to increased transparency, efficiency, and reduction in human error. More importantly, our platform will help developers save money by improving their operating margins

  13. A Brief History of IL-1 and IL-1 Ra in Rheumatology

    Directory of Open Access Journals (Sweden)

    Jean-Michel Dayer

    2017-05-01

    Full Text Available The history of what, in 1979, was called interleukin-1 (IL-1, orchestrator of leukocyte inter-communication, began many years before then, initially by the observation of fever induction via the endogenous pyrogen (EP (1974 and then in rheumatology on the role in tissue destruction in rheumatoid diseases via the induction of collagenase and PGE2 in human synovial cells by a mononuclear cell factor (MCF (1977. Since then, the family has exploded to presently 11 members as well as many membrane-bound and soluble receptor forms. The discovery of a natural Interleukin-1 receptor antagonist (IL-1Ra in human biological fluids has highlighted the importance of IL-1 and IL-1Ra in human diseases. Evidence delineating its role in autoinflammatory syndromes and the elucidation of the macromolecular complex referred to as “inflammasome” have been instrumental to our understanding of the link with IL-1. At present, the IL-1blockade as therapeutic approach is crucial for many hereditary autoinflammatory diseases, as well as for adult-onset Still’s disease, crystal-induced arthropathies, certain skin diseases including neutrophil-triggered skin diseases, Behçet’s disease and deficiency of IL-1Ra and other rare fever syndromes. Its role is only marginally important in rheumatoid arthritis and is still under debate with regard to osteoarthritis, type 2 diabetes mellitus, cardiovascular diseases and cancer. This brief historical review focuses on some aspects of IL-1, mainly IL-1β and IL-Ra, in rheumatology. There are many excellent reviews focusing on the IL-1 family in general or with regard to specific diseases or biological discoveries.

  14. Quantifying bone weathering stages using the average roughness parameter Ra measured from 3D data

    Science.gov (United States)

    Vietti, Laura A.

    2016-09-01

    Bone surface texture is known to degrade in a predictable fashion due to subaerial exposure, and can thus act as a relative proxy for estimating temporal information from modern and ancient bone assemblages. To date, the majority of bone weathering data is collected on a categorical scale based on descriptive terms. While this qualitative classification of weathering data is well established, textural analyses of bone surfaces may provide means to quantify weathering stages but have yet to be tested. Here, I examined the suitability of textural analyses for bone weathering studies by first establishing bone surface regions most appropriate for weathering analyses. I then measured and compared the roughness texture of weathered bones at different stages. To establish regions of bone most suitable for textural analyses, Ra was measured from 3D scans of dorsal ribs of four adult ungulate taxa. Results indicate that the rib-shafts from unweathered ungulate skeletons were similar and are likely good candidates because differences in surface texture will not be due to differences in initial bone texture. To test if textural measurements could reliably characterize weathering stages, the average roughness values (Ra) were measured from weathered ungulate rib-shafts assigned to four descriptive weathering stages. Results from analyses indicate that the Ra was statistically distinct for each weathering stage and that roughness positively correlates with the degree of weathering. As such, results suggest that textural analyses may provide the means for quantifying bone-weathering stages. Using Ra and other quantifiable texture parameters may enable more reliable and comparative taphonomic analyses by reducing inter-observer variations and by providing numerical data more compatible for multivariate statistics.

  15. Efeito de diferentes formas de congelamento sobre raízes de mandioca

    Directory of Open Access Journals (Sweden)

    Maria Madalena Rinaldi

    2015-06-01

    Full Text Available ResumoAvaliaram-se as características físico-químicas, sensoriais e microbiológicas durante o armazenamento de raízes de mandioca submetidas a diferentes métodos de congelamento. As raízes foram caracterizadas fisicamente, processadas, acondicionadas em embalagem de polietileno de baixa densidade (PEBD de 100 µm de espessura e submetidas aos diferentes tratamentos: congelamento e armazenamento a –18 °C; congelamento e armazenamento a –80 °C; congelamento com nitrogênio líquido e armazenamento a –80 °C. O período de armazenamento foi de 31 dias. O produto submetido a todos os tratamentos apresentou níveis aceitáveis de pH, acidez titulável, sólidos solúveis, ratio, ácido ascórbico e tempo para a cocção, bem como quanto à contagem dos microrganismos avaliados. Nos tratamentos congelamento e armazenamento a –18 °C e congelamento com nitrogênio líquido e armazenamento a –80 °C as raízes de mandioca foram aceitas sensorialmente durante todo o armazenamento. Apesar dos bons resultados apresentados no armazenamento de raízes de mandioca submetidas ao congelamento com nitrogênio líquido e armazenamento a –80° C, sugerem-se estudos mais aprofundados quanto às exigências e custo para a utilização dessa tecnologia em nível de produtor. A temperatura de –18 °C é satisfatória para manter o produto com características adequadas por no mínimo 31 dias.

  16. PACKAGING WASTE MANAGEMENT ON EXAMPLE OF CITY ZIELONA GÓRA

    OpenAIRE

    Joanna ZARĘBSKA

    2012-01-01

    The article presents the legal requirements of the European Union's packaging waste, and their most recent transposition into Polish law. The author has attempted to describe selected achievements of the Department of Public Utilities and Housing (DPUaH) in Zielona Góra, which for many years on behalf of the city, in a systematic way it’s developing municipal waste management system (including packaging), consistent with EU policies and objectives of sustainable development. The deficiencies ...

  17. Integriteta podatkov skozi validacijo računalniško podprtega laboratorijskega sistema

    OpenAIRE

    Ramić, Jasmin

    2017-01-01

    Diplomska naloga obravnava zagotavljanje regulatorne skladnosti in validacijo računalniško podprtega laboratorijskega sistema v farmacevtski industriji. Opisuje delovanje in pomen regulatornih organov, pojasnjeni so standardi in primeri dobre prakse, ki se morajo upoštevati v procesu validacije. Z aktivnim uvajanjem zakona na področju elektronskih zapisov in elektronskih podpisov so agencije za prehrano in zdravila uspele postaviti jasne zahteve in smernice v farmacevtski industriji in tako p...

  18. [Automatization of colorimetric serum zinc determination using the Bayer RA 1000 autoanalyzer].

    Science.gov (United States)

    Shum-Cheong-Sing, J; Arnaud, J; Favier, A

    1994-01-01

    A colorimetric method for the determination of zinc in serum was adapted for use with the Bayer RA 1000 autoanalyzer. Zinc is dissociated from proteins by guanidinium hydrochloride and complexed with 2-(5-bromo-2-pyridylazo)-5-(N-propyl-N- sulfopropylamino-)phenol (5-Br-PAPS). Precision (within-run CVs from 1.4 to 4.2%; between-run CVs from 3.5 to 8.1%), accuracy (93 to 103%) and detection limit (1.15 mumol/l) were sufficient for routine determinations. Moreover, results obtained with the proposed Bayer RA 1000 method were in good agreement with those obtained by flame atomic absorption spectrometry (FAAS) which could be considered the reference method. For 119 sera, the correlation coefficient r was found to be 0.958 and the regression line was as follows: serum zinc (RA 1000) = 0.96 serum zinc (FAAS) + 0.8 mumol/l. Moreover, 98% of the differences between colorimetry and FAAS were within the range Md +/- 1.96 SDd, where Md is the mean of the differences and SDd is the standard deviation of the differences.

  19. Movimento negro e educação: ressignificando e politizando a raça

    Directory of Open Access Journals (Sweden)

    Nilma Lino Gomes

    2012-09-01

    Full Text Available Este artigo discute o papel do movimento negro brasileiro na ressignificação e politização da ideia de raça. A raça é aqui entendida como construção social que marca, de forma estrutural e estruturante, as sociedades latino-americanas, em especial, a brasileira. Ao refletir sobre a atuação do movimento negro, parte-se da premissa de que este movimento social, por meio de suas ações políticas, sobretudo em prol da educação, reeduca a si próprio, o Estado, a sociedade e o campo educacional sobre as relações étnico-raciais no Brasil, caminhando rumo à emancipação social. A ideia de raça analisada no presente artigo se assenta na reflexão realizada pelos estudos pós-coloniais, que discutem a sua centralidade nos países com passado colonial e a sua operacionalidade nas relações de poder, as quais têm sido mantidas e subsistem no pensamento moderno ocidental, inclusive, no educacional.

  20. Projekts: Piena produktu bērniem ražotnes izveide Rīgā

    OpenAIRE

    Šakina, Natālija

    2010-01-01

    Maģistra darba nosaukums ir „Projekts: Piena produktu bērniem ražotnes izveide Rīgā”. Maģistra darba mērķis-no 2010.gada 5.janvāra līdz 2010.gada 31.decembrim uzcelt uzņēmumu SIA „Mazulis” un sākot ar 2011.gada 2.janvāri uzsākt piena un skābpiena produktu bērniem ražošanu ar jaudu 10 tonnas produkcijas maiņā, nepārtērējot 2010.gadā projekta realizēšanai atvēlētos naudas līdzekļus 1250000 Ls apmērā, lai nodrošinātu Latvijas zīdaiņus un pirmskolas vecuma bērnus ar kvalitatīvu bērnu pār...

  1. Pharmacokinetics of C-1027 in mice as determined by TCA-RA method

    Institute of Scientific and Technical Information of China (English)

    You-Ping Liu; Quan-Sheng Li; Yu-Rong Huang; Mao-Jin Zhou; Chang-Xiao Liu

    2005-01-01

    AIM: To validate a radioactivity assay, the TCA-RA method,for the measurement of C-1027 in serum and to evaluate its application in determination of pharmacokinetics of C-1027 in mice.METHODS: 125I-C-1027 was prepared by the Iodogen method and separated by HPLC. The radioactivity assay was established and used to determine 125I-C-1027 in mice at doses of 10, 50 and 100 μg/kg after precipitation with20% trichloroacetic acid (TCA-RA method). Severalpharmacokinetic parameters were determined after intravenous injection of 125I-C-1027 to mice.RESULTS: After intravenous injection of 125I-C-1027 to mice,at doses of 10, 50 and 100 μg/kg; the apparent distribution volumes (Vd) were 0.26, 0.31 and 0.33 L/kg; the biological half-lives (T1/2) were 3.10, 3.40 and 3.90 h; the areas under curve (AUC) were 18.41, 103.69 and 202.74 ng/h/mL; the elimination rate constants (K) were 1.04, 1.26 and 0.58/h;and the total body clearance (Cl) were 0.54, 0.48 and0.49 L/kg/h, respectively.CONCLUSION: TCA-RA is a sensitive, reliable and suitable method for the determination of 125I-C-1027 in mouse serum.

  2. 18O and 226Ra in the Minjiang River estuary, China and their hydrological implications

    Science.gov (United States)

    Liu, Huatai; Guo, Zhanrong; Gao, Aiguo; Yuan, Xiaojie; Zhang, Bin

    2016-05-01

    In this work, the 2H, 18O and 226Ra values in groundwater and surface water in the Minjiang River estuary were investigated in the dry and wet seasons. The δ18O values in the dry season were always higher than those in the wet season in both groundwater and surface water because of the presence of evaporation in the water cycle process. During the dry season, the δ18O values in groundwater on the southern bank of the Minjiang River are much higher than those on the northern bank because evaporation is more intense in the farmland of the southern bank than in the urbanized northern bank. The δ18O values in the estuarine water exhibit a good positive correlation with salinity, with a coefficient of 0.96 (p = 0.05) in both seasons. The 226Ra activities in the estuarine water increase with increasing salinity because of desorption from riverine suspended particles. The 226Ra activity reaches a peak value at a salinity of 20.5. Based on a three-endmember model, the average proportions of the estuarine water are calculated to be 0.02 for groundwater, 0.39 for river water and 0.59 for seawater. From this mixing ratio, the groundwater discharge into the estuary is estimated to be 9.31 × 106 m3 d-1 in the wet season.

  3. Interseccionalidade gênero, raça e etnia e a lei Maria da Penha

    Directory of Open Access Journals (Sweden)

    Raquel da Silva Silveira

    2014-01-01

    Full Text Available A violência de gênero contra as mulheres é um fenômeno mundial abordado exaustivamente. Este artigo discute como a interseccionalidade gênero, raça e etnia emerge nos discursos jurídicos sobre as mulheres que acessam a justiça. O referencial teórico foi composto pela analítica do poder de Michel Foucault articulada aos conceitos de interseccionalidade, gênero, raça e etnia. A pesquisa de campo foi realizada no Poder Judiciário de Porto Alegre e de Sevilha entre agosto de 2010 e outubro de 2012. Foram construídas três amostras de conveniência: entrevistas com 290 mulheres, análise de 70 processos judiciais e de 55 boletins de ocorrência. Foram realizadas entrevistas com quatro juízes/as de Porto Alegre e dois juízes em Sevilha. Os resultados apontam uma sobrerrepresentação das mulheres negras nos boletins de ocorrência, nas entrevistas, mas não nos processos. Apesar disso, os/as juízes/as entrevistados/as compreendem que a interseccionalidade gênero-raça e etnia não interfere no acesso à justiça.

  4. ExoMars Lander Radioscience LaRa, a Space Geodesy Experiment to Mars.

    Science.gov (United States)

    Dehant, Veronique; Le Maistre, Sebastien; Yseboodt, Marie; Peters, Marie-Julie; Karatekin, Ozgur; Van Hove, Bart; Rivoldini, Attilio; Baland, Rose-Marie; Van Hoolst, Tim

    2017-04-01

    The LaRa (Lander Radioscience) experiment is designed to obtain coherent two-way Doppler measurements from the radio link between the ExoMars lander and Earth over at least one Martian year. The instrument life time is thus almost twice the one Earth year of nominal mission duration. The Doppler measurements will be used to observe the orientation and rotation of Mars in space (precession, nutations, and length-of-day variations), as well as polar motion. The ultimate objective is to obtain information / constraints on the Martian interior, and on the sublimation / condensation cycle of atmospheric CO2. Rotational variations will allow us to constrain the moment of inertia of the entire planet, including its mantle and core, the moment of inertia of the core, and seasonal mass transfer between the atmosphere and the ice caps. The LaRa experiment will be combined with other ExoMars experiments, in order to retrieve a maximum amount of information on the interior of Mars. Specifically, combining LaRa's Doppler measurements with similar data from the Viking landers, Mars Pathfinder, Mars Exploration Rovers landers, and the forthcoming InSight-RISE lander missions, will allow us to improve our knowledge on the interior of Mars with unprecedented accuracy, hereby providing crucial information on the formation and evolution of the red planet.

  5. [The life and work of Zaíra Cintra Vidal].

    Science.gov (United States)

    Lopes, G T; Caldas, N P; Lima, T C; Martingil, I C

    2001-01-01

    This is a social-historical study that aims at describing the trajectory of Zaíra Cintra Vidal, her participation in the Nursing School Rachel Haddock Lobo and in the Brazilian Association of Nursing (ABEn). The study is based on the concepts of symbolic power, habitus and symbolic struggle of Pierre Bourdieu. The primary sources are documents which were collected in the Documentation Center of Escola de Enfermagem Ana Neri (EEAN--Ana Neri School of Nursing) in the Federeal University of Rio de Janeiro (UFRJ) and at the Memory Center of the Faculty of Nursing (FENF) in the State University of Rio de Janeiro (UERJ). The data was collected between August 2000 and April 2001 by means of document analysis script. The outcomes showed that Zaíra Cintra Vidal was born on 5 May 1903; graduated from the Nursing School of the National Public Health Department in 1926; studied and post-graduated in the United States from 1927 until 1929 and returned to Brazil in 1943. Zaíra Cintra Vidal was the founder of the Nursing School Rachel Haddock Lobo and was its first director for nine years. She also and took part in ABEn's Direction Board and in the Revista Anais de Enfermagem (Nursing Magazine).

  6. Klebsiella phage vB_KleM-RaK2 - a giant singleton virus of the family Myoviridae.

    Directory of Open Access Journals (Sweden)

    Eugenijus Simoliūnas

    Full Text Available At 346 kbp in size, the genome of a jumbo bacteriophage vB_KleM-RaK2 (RaK2 is the largest Klebsiella infecting myovirus genome sequenced to date. In total, 272 out of 534 RaK2 ORFs lack detectable database homologues. Based on the similarity to biologically defined proteins and/or MS/MS analysis, 117 of RaK2 ORFs were given a functional annotation, including 28 RaK2 ORFs coding for structural proteins that have no reliable homologues to annotated structural proteins in other organisms. The electron micrographs revealed elaborate spike-like structures on the tail fibers of Rak2, suggesting that this phage is an atypical myovirus. While head and tail proteins of RaK2 are mostly myoviridae-related, the bioinformatics analysis indicate that tail fibers/spikes of this phage are formed from podovirus-like peptides predominantly. Overall, these results provide evidence that bacteriophage RaK2 differs profoundly from previously studied viruses of the Myoviridae family.

  7. Arg333 and Arg334 in the COOH terminus of the human P2Y1 receptor are crucial for Gq coupling.

    Science.gov (United States)

    Ding, Zhongren; Tuluc, Florin; Bandivadekar, Kavita R; Zhang, Lili; Jin, Jianguo; Kunapuli, Satya P

    2005-03-01

    The P2Y(1) ADP receptor activates G(q) and causes increases in intracellular Ca(2+) concentration through stimulation of PLC. In this study, we investigated the role of the amino acid residues in the COOH terminus of the human P2Y(1) receptor in G(q) activation. Stimulation of Chinese hamster ovary (CHO-K1) cells stably expressing the wild-type human P2Y(1) receptor (P2Y(1)-WT cells), P2Y(1)-DeltaR340-L373, or P2Y(1)-DeltaD356-L373 with 2-methylthio-ADP (2-MeSADP) caused inositol phosphate production. In contrast, cells expressing P2Y(1)-DeltaT330-L373, a mutant lacking the entire COOH terminus, completely lost their response to 2-MeSADP. Similar data were obtained by using these cell lines and measuring Ca(2+) mobilization upon stimulation with 2-MeSADP, indicating that the 10 amino acids (330TFRRRLSRAT339) in the COOH terminus of the human P2Y(1) receptor are essential for G(q) coupling. Radioligand binding demonstrated that both the P2Y(1)-WT and P2Y(1)-DeltaT330-L373-expressing cells have almost equal binding of [(3)H]MRS2279, a P2Y(1) receptor antagonist, indicating that COOH-terminal truncation did not drastically affect the conformation of the receptor. CHO-K1 cells expressing a chimeric P2Y(12) receptor with the P2Y(1) COOH terminus failed to elicit G(q) functional responses, indicating that the P2Y(1) COOH terminus is essential but not sufficient for G(q) activation. Finally, cells expressing a double-mutant P2Y(1) receptor (R333A/R334A) in the conserved BBXXB region of the COOH terminus of the G(q)-activating P2Y receptors completely lost their functional ability to activate G(q). We conclude that the two arginine residues (R333R334) in the COOH terminus of the human P2Y(1) receptor are essential for G(q) coupling.

  8. Dimethyl(3,3,3-trifluoropropyl)silyldiethylamine—A new silylating agent for the derivatization of β-blockers and β-agonists in environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Caban, Magda, E-mail: magdac@chem.univ.gda.pl; Mioduszewska, Katarzyna; Stepnowski, Piotr; Kwiatkowski, Marek; Kumirska, Jolanta

    2013-06-11

    Graphical abstract: -- Highlights: •DIMETRIS (dimethyl(3,3,3-trifluoropropyl)silyldiethylamine) – a new alternative silylating agent. •Selectiveness and strong nucleophilic character of DIMETRIS. •Introduction of fluorine atoms to the chemical structure by silylation in mild conditions. •Possibility of using MS and ECD detectors for GC determination of new derivatives. •Study of the influence of complex matrices on derivatization and analysis by SPE-GC–MS. •Similar MDLs for analytes using DIMETRIS to those observed for BSTFA derivatization. -- Abstract: Research into alternative derivatizing agents remains a major task in the trace analysis of polar compounds using GC. DIMETRIS (dimethyl(3,3,3-trifluoropropyl)silyldiethylamine) is a new and interesting proposition in this field. This agent possesses strong nucleophilic properties and reacts selectively with hydroxyl groups. The derivatization reaction takes place in the absence of any catalysts. The derivatives possess good chromatographic properties and are easily detected by mass spectrometry. By introducing fluorine atoms into the structure of the derivatives, we were able to use an electron-capture detector for their GC determination. No degradation of new derivatives was observed after seven days of storage in a refrigerator or during the GC analyses. Unlike a number of acylation agents, DIMETRIS does not corrode the analytical equipment. In this work β-blockers and β-agonists were used for testing the derivatizing properties of DIMETRIS. Derivatization of these drugs was optimal at 30 °C for 30 min. The method quantification limits of the target compounds determined in tap water samples by SPE-GC–MS(SIM) ranged from 3 to 40 ng L{sup −1} and resembled those obtained with samples derivatized using a mixture of N,O-bis(trimethylsilyl)trifluoroacetamide (BSTFA) and 1% chlorotrimethylsilane (TMCS) (hitherto regarded as optimal). This work confirmed that DIMETRIS is suitable for the trace

  9. Shared care or nurse consultations as an alternative to rheumatologist follow-up for rheumatoid arthritis (RA) outpatients with stable low disease-activity RA

    DEFF Research Database (Denmark)

    Sørensen, Jan; Primdahl, J; Horn, Hc

    2014-01-01

    Objectives: To compare the cost-effectiveness of three types of follow-up for outpatients with stable low-activity rheumatoid arthritis (RA). Method: In total, 287 patients were randomized to either planned rheumatologist consultations, shared care without planned consultations, or planned nurse...... clinics and general practice, prescription and non-prescription medicine, dietary supplements, other health-care resources, and complementary and alternative care. Measures of effectiveness and costs were collected by self-reported questionnaires at inclusion and after 12 and 24 months. Incremental cost...... and nurse care groups compared with the rheumatologist group. Shared care and nurse care were non-significantly less costly than rheumatologist care. As both shared care and nurse care were associated with slightly better EQ-5D improvements and lower costs, they dominated rheumatologist care. At EUR 10 000...

  10. Uptake of Ra during the recrystallization of barite: a microscopic and time of flight-secondary ion mass spectrometry study.

    Science.gov (United States)

    Klinkenberg, Martina; Brandt, Felix; Breuer, Uwe; Bosbach, Dirk

    2014-06-17

    A combined macroscopic and microanalytical approach was applied on two distinct barite samples from Ra uptake batch experiments using time of flight-secondary ion mass spectrometry (ToF-SIMS) and detailed scanning electron microscopy (SEM) investigations. The experiments were set up at near to equilibrium conditions to distinguish between two possible scenarios for the uptake of Ra by already existent barite: (1) formation of a Ba1-xRaxSO4 solid solution surface layer on the barite or (2) a complete recrystallization, leading to homogeneous Ba1-xRaxSO4 crystals. It could be clearly shown that Ra uptake in all barite particles analyzed within this study is not limited to the surface but extends to the entire solid. For most grains a homogeneous distribution of Ra could be determined, indicating a complete recrystallization of barite into a Ba1-xRaxSO4 solid solution. The maxima of the Ra/Ba intensity ratio distribution histograms calculated from ToF-SIMS are identical with the expected Ra/Ba ratios calculated from mass balance assuming a complete recrystallization. In addition, the role of Ra during the recrystallization of barite was examined via detailed SEM investigations. Depending on the type of barite used, an additional coarsening effect or a strong formation of oriented aggregates was observed compared to blank samples without Ra. In conclusion, the addition of Ra to a barite at close to equilibrium conditions has a major impact on the system leading to a fast re-equilibration of the solid to a Ba1-xRaxSO4 solid solution and visible effects on the particle size distribution, even at room temperature.

  11. Temporal evolution of natural radionuclides distributions {sup 238}U, {sup 234}Th, {sup 226}Ra, {sup 228}Ra, {sup 210}Pb and {sup 210}Po in the Bransfield strait, Antarctica peninsula; Evolucao temporal das distribuicoes dos radionuclideos naturais {sup 238}U, {sup 234}Th, {sup 226}Ra, {sup 228}Ra, {sup 210}Pb and {sup 210}Po no estreito de Bransfiel, peninsula Antartica

    Energy Technology Data Exchange (ETDEWEB)

    Lapa, Flavia Valverde

    2013-07-01

    Research on the distribution of natural radionuclides in Antarctica is rare and thus, there is great interest in to know their occurrence and factors related to its mobilization, transference and accumulation in this extremely fragile environment. Natural radionuclides have been used intensively as tracers in the ocean, helping to better understand processes as sinking and particle resuspension, water masses mixture and oceanic circulation. {sup 234}Th (t½ = 24.1 days) is a particle-reactive radionuclide produced continuously in seawater by the decay of its soluble precursor conservative with salinity {sup 238}U (t½ = 4.5 10{sup 9} years). Since {sup 234}Th presents relatively short half-life, it is used to quantify processes that occur in temporal scale varying from days to weeks. The disequilibrium {sup 234}Th/{sup 238}U in the surface ocean has been applied to estimate carbon fluxes exported via sinking material. The flux of particles biologically productive out of the euphotic zone in the Southern Ocean has special attention due to its importance in the control of CO{sub 2} atmospheric concentrations. The radionuclides {sup 210}Pb (t½ = 22.3 years) and {sup 210}Po (t½ = 138 days) are also particle-reactive. The disequilibrium {sup 210}Po/{sup 210}Pb has been used to estimate fluxes of particles exported in the ocean in the time scale of weeks. The long-lived Ra isotopes, {sup 226}Ra (t½ = 1,600 years) and {sup 228}Ra (t½ = 5.75 years) are soluble in seawater, presenting unique properties that make them excellent tracers of water masses. This research work had the aim to study the distributions of natural radionuclides {sup 238}U, {sup 234}Th, {sup 22}'6Ra, {sup 22}'8Ra, {sup 210}Pb and {sup 210}Po in the Bransfield Strait during 2 samplings carried out in the 2011 Austral Summer (OPERANTAR XXIX and XXX). (author)

  12. Efecto del Hierro en el Desarrollo de las Raíces de las Plantas

    Directory of Open Access Journals (Sweden)

    Correa Velásquez Jairo

    1964-08-01

    Full Text Available Se investigó el efecto del hierro en el desarrollo de las raíces del cacao, el café y el fríjol. También se observó la velocidad de recuperación de la clorofila en plantas cloróticas de cacao y café, al agregarles cantidades crecientes de hierro, y el efecto de dicha recuperación sobre el desarrollo radical. Además, se estudió el grado de absorción y movilización de Fe50 en plantas de cacao, y el efecto de distintas dosis de hierro en el crecimiento de raíces aisladas cacao, café y fríjol. Las plantas fueron cultivadas en el invernadero en solución HoagIand N° 2 sin Fe y las raíces para cultivo se obtuvieron de semillas germinadas en el laboratorio. Se usaron plantas de cacao del clon uf 668 de 3 meses y de café (variedad caturra con la misma edad. El hierro radiactivo utilizado fue en forma de cloruro (Fe59 cl 3 y el agregado a la solución o al follaje, en forma de quelato (Fe E. D. T. A.. Las adiciones de este elemento se hicieron cuando las plantas mostraban síntomas característicos de su deficiencia. Hubo una recuperación casi total de la clorosis y tanto el volumen como la longitud radical aumentaron con las aplicaciones crecientes de hierro, aunque la longitud relativa de los tallos mostró una tendencia decreciente. En las hojas de cacao se presentó una acumulación del Fe y su movilización hacia los demás órganos de la planta fue lenta y en proporción reducida en relación con el total absorbido. Igual cosa sucedió con el Fe50 suministrado a las raíces. No se pudieron observar los efectos del Fe en el crecimiento de raíces aisladas de cacao, café y fríjol, pues el desarrollo fue muy reducido, debido a que la rápida oxidación de los tejidos (al separar aquéllas del resto de la planta redujo la viabilidad a unos pocos días.

  13. HCA 333 Courses/sanptutorial

    OpenAIRE

    naser

    2015-01-01

    Subacute Care. Review the Subacute Care Case Pratt(2010) pp. 122-124 and develop a response to Question 8 a, b & c (located on the top of page 125 of the text) and post your response. In your response formulate a complete response to each component of Question 8. The response will provide evidence of critical thinking and problem solving applications. Include one reference in addition to the course text to support your response to question 8 component B. Respond to at least two of your cl...

  14. 225Ac and 223Ra production via 800 MeV proton irradiation of natural thorium targets.

    Science.gov (United States)

    Weidner, J W; Mashnik, S G; John, K D; Ballard, B; Birnbaum, E R; Bitteker, L J; Couture, A; Fassbender, M E; Goff, G S; Gritzo, R; Hemez, F M; Runde, W; Ullmann, J L; Wolfsberg, L E; Nortier, F M

    2012-11-01

    Cross sections for the formation of (225,227)Ac, (223,225)Ra, and (227)Th via the proton bombardment of natural thorium targets were measured at a nominal proton energy of 800 MeV. No earlier experimental cross section data for the production of (223,225)Ra, (227)Ac and (227)Th by this method were found in the literature. A comparison of theoretical predictions with the experimental data shows agreement within a factor of two. Results indicate that accelerator-based production of (225)Ac and (223)Ra is a viable production method.

  15. Potencial agronômico e teor de carotenoides em raízes de reserva de mandioca

    Directory of Open Access Journals (Sweden)

    Karina Nascimento da Silva

    2014-01-01

    Full Text Available Os programas de melhoramento genético de mandioca de mesa estão focados na seleção de variedades com a presença de carotenoides nas raízes de reserva. O trabalho foi realizado com o objetivo de avaliar o potencial agronômico e o teor de carotenoides em raízes de reserva de acessos de mandioca com coloração da polpa das raízes creme, amarela e rosada visando à utilização direta por produtores e/ou sua utilização como genitores em programas de melhoramento. Treze acessos de mandioca foram avaliados em experimento conduzido na Embrapa Cerrados por duas safras, quanto aos caracteres altura da primeira ramificação, altura da planta, massa da parte aérea, produtividade de raízes, porcentagem de amido nas raízes, severidade de bacteriose, teor de carotenoides nas raízes, tempo para a cocção em minutos e teor de ácido cianídrico nas raízes. Os resultados evidenciaram a existência de diferenças significativas entre os acessos para os caracteres altura da primeira ramificação, altura da planta, massa da parte aérea, produtividade de raízes, porcentagem de amido nas raízes, severidade de bacteriose e teor de carotenoides nas raízes. Também foram detectadas variações significativas entre as safras e interação significativa entre as safras e acessos para todos os caracteres, com exceção da severidade da bacteriose e do teor de carotenoides nas raízes. Nenhum acesso apresentou desempenho agronômico que justifique o cultivo de forma comercial na região do Cerrado do Brasil Central. Foram detectados acessos com potencial para utilização no melhoramento, visando ao incremento de β-caroteno BGMC 1221, BGMC BGMC 1223 e BGMC 1224 e de licopeno BGMC 1222 e BGMC 1229 em raízes de reserva.

  16. 挤光工艺在深长孔粗糙度Ra0.2加工中的应用%Application of Burnishing Technology in Machining of Deep Long Holes with Roughness Ra0.2

    Institute of Scientific and Technical Information of China (English)

    崔立平

    2010-01-01

    挤光加工是利用滚针对零件深长孔表面产生塑性变形,以达到修正表面微观几何形状、降低表面粗糙度的效果.表面粗糙度可从Ra3.2~Ra1.6降低到Ra0.8~Ra0.2.同时,滚压过程的本身导致了金属表面层金相组织的改变,形成了有利的残余应力,提高了零件的机械性能.

  17. Atmospheric lifetimes and Ozone Depletion Potentials of trans-1-chloro-3,3,3-trifluoropropylene and trans-1,2-dichloroethylene in a three-dimensional model

    Science.gov (United States)

    Patten, K. O.; Wuebbles, D. J.

    2010-11-01

    The chloroalkenes trans-1-chloro-3,3,3-trifluoropropylene (tCFP) and trans-1,2-dichloroethylene (tDCE) have been proposed as candidate replacements for other compounds in current use that cause concerns regarding potential environmental effects including destruction of stratospheric ozone. Because tCFP and tDCE contain chlorine atoms, the effects of these short-lived compounds on stratospheric ozone must be established. In this study, we derive the atmospheric lifetimes and Ozone Depletion Potentials (ODPs) for tCFP and for tDCE assuming emissions from land surfaces at latitudes 30° N to 60° N using the MOZART 3 three-dimensional model of atmospheric chemistry and physics. 53% of the ozone loss due to tCFP and 98% of the ozone loss due to tDCE take place in the troposphere, rather than in the stratosphere as generally expected from longer-lived chlorocarbons. The atmospheric lifetime of tCFP against chemical reaction is 40.4 days, and its ODP is quite small at 0.00034. The tDCE atmospheric lifetime is 12.7 days, and its ODP is 0.00024, which is the lowest ODP found for any chlorocarbon we have studied. Our study suggests that chlorine from tCFP and tDCE are unlikely to affect ozone at quantities likely to be emitted to the atmosphere.

  18. Atmospheric chemistry of BrO radicals: kinetics of the reaction with C2H5O2 radicals at 233-333 K.

    Science.gov (United States)

    Sakamoto, Yosuke; Yamano, Daisuke; Nakayama, Tomoki; Hashimoto, Satoshi; Kawasaki, Masahiro; Wallington, Timothy J; Miyano, Shun; Tonokura, Kenichi; Takahashi, Kenshi

    2009-09-24

    Cavity ring-down spectroscopy was used to study the title reaction in 50-200 Torr of O2 diluent at 233-333 K. There was no discernible effect of total pressure, and a rate constant of k(BrO + C2H5O2) = (3.8 +/- 1.7) x 10(-12) cm3 molecule(-1) s(-1) was determined at 293 K in 150 Torr total pressure of O2 diluent. The addition of 1.4 x 10(17) molecules cm(-3) of H2O vapor had no measurable impact on k(BrO + C2H5O2) at 293 K and 150 Torr. The rate constant exhibited a negative temperature dependence and was described by k(BrO + C2H5O2) = 6.5 x 10(-13) exp((505 +/- 570)/T) cm3 molecule(-1) s(-1). Results are discussed with respect to the atmospheric chemistry of BrO radicals.

  19. 9q33.3q34.11 microdeletion: new contiguous gene syndrome encompassing STXBP1, LMX1B and ENG genes assessed using reverse phenotyping.

    Science.gov (United States)

    Nambot, Sophie; Masurel, Alice; El Chehadeh, Salima; Mosca-Boidron, Anne-Laure; Thauvin-Robinet, Christel; Lefebvre, Mathilde; Marle, Nathalie; Thevenon, Julien; Perez-Martin, Stéphanie; Dulieu, Véronique; Huet, Frédéric; Plessis, Ghislaine; Andrieux, Joris; Jouk, Pierre-Simon; Billy-Lopez, Gipsy; Coutton, Charles; Morice-Picard, Fanny; Delrue, Marie-Ange; Heron, Delphine; Rooryck, Caroline; Goldenberg, Alice; Saugier-Veber, Pascale; Joly-Hélas, Géraldine; Calenda, Patricia; Kuentz, Paul; Manouvrier-Hanu, Sylvie; Dupuis-Girod, Sophie; Callier, Patrick; Faivre, Laurence

    2016-06-01

    The increasing use of array-CGH in malformation syndromes with intellectual disability could lead to the description of new contiguous gene syndrome by the analysis of the gene content of the microdeletion and reverse phenotyping. Thanks to a national and international call for collaboration by Achropuce and Decipher, we recruited four patients carrying de novo overlapping deletions of chromosome 9q33.3q34.11, including the STXBP1, the LMX1B and the ENG genes. We restrained the selection to these three genes because the effects of their haploinsufficency are well described in the literature and easily recognizable clinically. All deletions were detected by array-CGH and confirmed by FISH. The patients display common clinical features, including intellectual disability with epilepsy, owing to the presence of STXBP1 within the deletion, nail dysplasia and bone malformations, in particular patellar abnormalities attributed to LMX1B deletion, epistaxis and cutaneous-mucous telangiectasias explained by ENG haploinsufficiency and common facial dysmorphism. This systematic analysis of the genes comprised in the deletion allowed us to identify genes whose haploinsufficiency is expected to lead to disease manifestations and complications that require personalized follow-up, in particular for renal, eye, ear, vascular and neurological manifestations.

  20. Molecular design and property prediction of high density polynitro[3.3.3]-propellane-derivatized frameworks as potential high explosives.

    Science.gov (United States)

    Zhang, Qinghua; Zhang, Jiaheng; Qi, Xiujuan; Shreeve, Jean'ne M

    2014-11-13

    Research in energetic materials is now heavily focused on the design and synthesis of novel insensitive high explosives (IHEs) for specialized applications. As an effective and time-saving tool for screening potential explosive structures, computer simulation has been widely used for the prediction of detonation properties of energetic molecules with relatively high precision. In this work, a series of new polynitrotetraoxopentaaza[3.3.3]-propellane molecules with tricyclic structures were designed. Their properties as potential high explosives including density, heats of formation, detonation properties, impact sensitivity, etc., have been extensively evaluated using volume-based thermodynamic calculations and density functional theory (DFT).These new energetic molecules exhibit high densities of >1.82 g cm(-3), in which 1 gives the highest density of 2.04 g cm(-3). Moreover, most new materials show good detonation properties and acceptable impact sensitivities, in which 5 displays much higher detonation velocity (9482 m s(-1)) and pressure (43.9 GPa) than HMX and has a h50 value of 11 cm. These results are expected to facilitate the experimental synthesis of new-generation nitramine-based high explosives.

  1. Phase diagram of R-Fe-Co pseudoternary system with R≤33.3 %(mole fraction, R=Sm0.5Dy0.5)

    Institute of Scientific and Technical Information of China (English)

    王博文; 刘炜丽; 封文江; 金光; 郝延明; 李养贤

    2002-01-01

    Phase equilibria of the R-Fe-Co pseudoternary system with R≤33.3%(mole fraction, R=Sm0.5Dy0.5) were determined in an isothermal section at 1073K and a vertical section of RFe2-RCo2 by using OM, X-ray diffractometer, EPMA DTA techniques. There are seven intermetallic phases: (Sm, Dy)(Fe, Co)2, (Sm, Dy)(Fe, Co)3, (Sm, Dy)6(Fe, Co)23, (Sm, Dy)2(Fe, Co)7, (Sm, Dy)(Fe, Co)5, Th2Ni17-type and Th2Zn17-type (Sm, Dy)2(Fe, Co)17. The (Sm, Dy)6(Fe, Co)23 phase dissolves 36% Co(mole fraction) at 1073K. However, the (Sm, Dy)2(Fe, Co)7 phase in R2(Fe1-xCox)7 alloys dissolves about 19% Fe(mole fraction) at 1073K.

  2. Measurement and correlation of solubility of diosmin in four pure solvents and β-cyclodextrin solution at 298.15 K to 333.15 K

    Institute of Scientific and Technical Information of China (English)

    Md Khalid Anwer; Faiyaz Shakeel

    2015-01-01

    The aim of present study was to measure and correlate the solubility of poorly water-soluble flavonoid diosmin in water, ethanol, isopropyl alcohol (IPA), polyethylene glycol-400 (PEG-400) andβ-cyclodextrin (β-CD) aqueous solution (0.02 mol·L-1). The solubility of diosmin was measured using the shake flask method from (298.15 to 333.15) K at atmospheric pressure. The experimental solubilities of diosmin were regressed by the modified Apelblat model with a relative deviation in the range of 0.048%to 5.940%. The correlation coefficients were observed in the range of 0.9957 to 0.9995. The solubility of diosmin was found to be increased with temperature in all sample matrices investigated. The mole fraction solubility of diosmin was found to be higher inβ-CD aqueous solution and PEG-400 as compared to water, ethanol and IPA. Based on solubility data of present study, diosmin was considered as practical y insoluble in water, insoluble in ethanol&IPA and soluble in PEG-400 andβ-CD aqueous solution.

  3. Atmospheric lifetimes and Ozone Depletion Potentials of trans-1-chloro-3,3,3-trifluoropropylene and trans-1,2-dichloroethylene in a three-dimensional model

    Directory of Open Access Journals (Sweden)

    K. O. Patten

    2010-11-01

    Full Text Available The chloroalkenes trans-1-chloro-3,3,3-trifluoropropylene (tCFP and trans-1,2-dichloroethylene (tDCE have been proposed as candidate replacements for other compounds in current use that cause concerns regarding potential environmental effects including destruction of stratospheric ozone. Because tCFP and tDCE contain chlorine atoms, the effects of these short-lived compounds on stratospheric ozone must be established. In this study, we derive the atmospheric lifetimes and Ozone Depletion Potentials (ODPs for tCFP and for tDCE assuming emissions from land surfaces at latitudes 30° N to 60° N using the MOZART 3 three-dimensional model of atmospheric chemistry and physics. 53% of the ozone loss due to tCFP and 98% of the ozone loss due to tDCE take place in the troposphere, rather than in the stratosphere as generally expected from longer-lived chlorocarbons. The atmospheric lifetime of tCFP against chemical reaction is 40.4 days, and its ODP is quite small at 0.00034. The tDCE atmospheric lifetime is 12.7 days, and its ODP is 0.00024, which is the lowest ODP found for any chlorocarbon we have studied. Our study suggests that chlorine from tCFP and tDCE are unlikely to affect ozone at quantities likely to be emitted to the atmosphere.

  4. Ordination of environmental data using principal component analysis: the case of the radium isotopes (Ra-226 and Ra-28) in surface waters in an area associated with NORM/TENORM mining

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, Wagner de S.; Py Junior, Delcy de A.; Antunes, Marcos M., E-mail: wspereira@inb.gov.b, E-mail: delcy@inb.gov.b, E-mail: antunes@inb.gov.b [Industrias Nucleares do Brasil SA, Pocos de Caldas, MG (Brazil). Unidade de Tratamento de Minerios. Coordenacao de Protecao Radiologica; Kelecom, Alphonse, E-mail: kelecom@uol.com.b [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil). Inst. de Biologia. Curso de Pos-Graduacao em Biologia Marinha; Carmo, Roberto F., E-mail: rfcarmo@inb.gov.b [Industrias Nucleares do Brasil SA, Caetite, BA (Brazil). Unidade de Concentracao de Uranio. Coordenacao de Protecao Radiologica; Oliveira, Gabriela T. de [Centro Universitario de Sao Joao da Boa Vista (UNIFAE), SP (Brazil). Curso de Engenharia Quimica

    2009-07-01

    The radium isotopes Ra-226 and Ra-228 were analyzed in surface water at six points, during eighteen months, from June 2006 to December 2007, in the neighborhood of a mine of phosphate associated with uranium in the region of Santa Quiteria, state of Ceara, Brazil. The soluble fraction (which passes through filter of 0.45 micron) and the particulate fraction (which is retained on the 0.45 micron filter) were analyzed using the Principal Component Analysis, PCA, a method for ranking environmental data, and were analyzed also by F test for testing the difference between radionuclides and the difference between the two analyzed fractions. The PCA has identified four groups of samples. Results of Ra-226 in soluble fraction are grouped in the negative part of axis 1 (Factor 1) and axis 2 (Factor 2). Results of Ra-228 in particulate fraction are grouped in the positive part of axis 1 (Factor 1) and in the negative part of axis 2. Results of Ra-226 in soluble fraction are grouped along the positive part of axis 1 (Factor 1). Finally, results of Ra-228 in the particulate fraction are grouped in the positive part of axis 1 (Factor 1) and axis 2 (Factor 2). This last group has two discrepant points (01 and 06). There is no statistical difference between the two analyzed fractions but there are statistical differences between analyzed radionuclides. Therefore, three conclusions can be identified: The use of PCA with radionuclides and analyzed fractions as parameters permits the grouping of collecting data by their environmental similarities; the mean concentration of Ra-226 was statistically higher than that of Ra-228; and there is no statistical difference between soluble and particulate fractions. (author)

  5. Women, men, and rheumatoid arthritis: analyses of disease activity, disease characteristics, and treatments in the QUEST-RA study

    DEFF Research Database (Denmark)

    Sokka, Tuulikki; Toloza, Sergio; Cutolo, Maurizio

    2009-01-01

    remission. Therefore, we aimed to study possible associations of gender and disease activity, disease characteristics, and treatments of RA in a large multinational cross-sectional cohort of patients with RA called Quantitative Standard Monitoring of Patients with RA (QUEST-RA). METHODS : The cohort...... includes clinical and questionnaire data from patients who were seen in usual care, including 6,004 patients at 70 sites in 25 countries as of April 2008. Gender differences were analyzed for American College of Rheumatology Core Data Set measures of disease activity, DAS28 (disease activity score using 28.......3 versus 3.8, and fatigue of 4.6 versus 3.7 (P disease activity (0 to 1) on SJC28, women had statistically significantly higher mean values compared with men in all other disease activity...

  6. Intake of {sup 226} Ra in osteoporosis prevention and therapy with gran-white dolomite as calcium supplement

    Energy Technology Data Exchange (ETDEWEB)

    Pecequilo, B.R.S.; Campos, M.P. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)]. E-mails: brigitte@net.ipen.br; mpcampos@net.ipen.br

    2002-04-01

    A {sup 226} Ra average specific activity of 4.3 Bq.kg{sup -1} was determined by passive high resolution gamma-ray spectrometry in six samples of 'Gran White' dolomite. The committed effective dose and committed equivalent dose at bone surface were calculated through the Ana Comp code, using {sup 226} Ra intake and radium metabolic model from ICRP 67. The doses were calculated for patients submitted to osteoporosis prevention and osteoporosis therapy. (author)

  7. IL-13Ra2- and glioma stem cell-pulsed dendritic cells induce glioma cell death in vitro

    Institute of Scientific and Technical Information of China (English)

    Ying Wang; Ruifan Xie; Hongquan Niu; Ting Lei

    2016-01-01

    Objective Gliomas are the most common malignant tumors in the central nervous system. Despite mul-tiple therapies including surgery, chemotherapy, and radiotherapy, the prognosis of patients remains poor. Immunotherapy is an alternative method of treating glioma, and the use of dendritic cel vaccines is one of the promising treatment options. However, there is no specific tumor cel antigen that can trigger dendritic cel s (DCs). IL-13Ra2 is a specific antigen expressed in glioma cel s; in the current study, we have at-tempted to explore whether IL-13Ra2 could be the antigen that triggers DCs and to envisage its application as potential therapy for glioma. Methods The expression of IL-13Ra2 was detected in U251 glioma cel lines and primary glioma tissues using dif erent methods. DCs from human blood were isolated and pulsed with recombinant IL-13Ra2, fol-lowing which the cytotoxicity of these DCs on glioma cel s was detected and analyzed. Results About 55.9% human glioma tissue cel s expressed IL-13Ra2, while normal brain tissue cel s did not show any expression. DC vaccines loaded with IL-13Ra2, glioma cel antigen, and brain tumor stem cel (BTSC) antigen could significantly stimulate the proliferation of T lymphocytes and induce cel death in the glioma tissue. Compared to other groups, DC vaccines loaded with BTSC antigen showed the strongest ability to activate cytotoxic T lymphocytes (CTLs), while the glioma cel antigen group showed no significant dif erence. Conclusion IL-13Ra2, which is expressed in gliomas and by glioma stem cel s, as wel as IL-13Ra2 could prove to be potential antigens for DC vaccine-based immunotherapy.

  8. QUEST-RA: quantitative clinical assessment of patients with rheumatoid arthritis seen in standard rheumatology care in 15 countries

    DEFF Research Database (Denmark)

    Sokka, Tuulikki; Kautiainen, Hannu; Toloza, Sergio

    2007-01-01

    ) within and between countries was graphically analysed. A median regression model was applied to analyse differences in disease activity between countries. RESULTS: Between January 2005 and October 2006, the QUEST-RA (Quantitative Patient Questionnaires in Standard Monitoring of Patients with Rheumatoid...... of clinical status and treatments of patients with RA in standard clinical care in 2005-6 including countries that are infrequently involved in clinical research projects....

  9. 232Th-228Ra-228Th Recording of Estuarine and Coastal Sedimentological Events

    Science.gov (United States)

    Hillaire-Marcel, C.; Ghaleb, B.; Ruiz-Fernandez, A.

    2011-12-01

    Climatic events (e.g., storminess, floods) and river/coastal management activities (e.g., dredging) may result in the removal and re-suspension of contaminated sediments in shallow coastal areas and estuaries, thus leading to long-term contamination of such environments. Short-lived daughter isotopes of 232Th (228Ra-228Th) in sediments may then provide some quantitative assessment of the amount of material removed/re-deposited as well as some indications on the chronology of causal events. Examples from the Gulf of St. Lawrence (GSL) and the Pacific coastal rea of Mexico (PcM) are used to illustrate such isotopic responses to natural or anthropogenic disturbances. In the GSL relatively steady accumulation processes are usually observed, although sedimentary sequences show variable benthic mixing patterns over a large array of sedimentation rates (from mm/a to cm/a). In undisturbed sequences, 232Th-daughter isotopes in particulate matter show strong disequilibria due i) to 228Ra-diffusion/228Th adsorption in source-soils and during particulate transport, ii) 228Ra-behavior at the water column/sea-floor interface. Core-top sediments thus depict a strong excess in 228Th vs. 232Th. Below, a fast return (within ~ 10 a) of 228Th to equilibrium with its parent 228Ra leads to a 228Th deficit vs 232Th, in response to 228Ra-losses and diffusion towards the water column. Deeper, a return to full equilibrium conditions is observed (~ 30 a), but for "non-local mixing" events. Few disturbances are observed in the area. They include nearly cyclic pulses in 210Pb at the head of the Laurentian Trough, which we attribute to dredging operations of the St. Lawrence Sea-Way, and in the sealing of Hg-contaminated sediments in the Saguenay Fjord, by flood layers. Comparatively most sequences cored in estuarine settings of the PcM illustrate more critical situations with respect to the re-suspension of sediments, which are often contaminated due to land management and industrial practices

  10. Study on Effects of Paclobutrazoi Growth of Tagetes patula L.Plug Seedlings in Different Periods by Spraying%PP333对孔雀草穴盘苗生长的控制作用研究

    Institute of Scientific and Technical Information of China (English)

    张剑; 隋艳晖

    2011-01-01

    多效唑(PP333)常用来控制植物徒长,孔雀草穴盘育苗因夏季温度和湿度过高等原因易发生徒长,使产品质量降低.因此,采用不同浓度的PP333溶液在种子萌动前对孔雀草穴盘苗进行喷施处理,测定株高、根冠比、超氧物歧化酶(SOD)和过氧化物酶(POD)活性,筛选出最佳浓度,并研究其与对照的内源激素水平以及茎部细胞形态,探讨其作用机理.结果表明,萌前期喷施10-30mg/L的PP333能安全有效地抑制植株的生长高度,增强SOD和POD活性,从而提高花卉种苗的质量及抗逆性,且浓度越高,效果越明显,其中最佳处理为30mg/L PP333.PP333降低了孔雀草的GA和IAA含量,提高了ABA含量,抑制了孔雀草茎段细胞的伸长,从而使节间缩短,控制植株生长,提高植株抗逆性.

  11. Study of 223Ra uptake mechanism by Fe3O4 nanoparticles: towards new prospective theranostic SPIONs

    Science.gov (United States)

    Mokhodoeva, Olga; Vlk, Martin; Málková, Eva; Kukleva, Ekaterina; Mičolová, Petra; Štamberg, Karel; Šlouf, Miroslav; Dzhenloda, Rustam; Kozempel, Ján

    2016-10-01

    The use of superparamagnetic iron oxide nanoparticles ( SPIONs) and radiolabelled nanoparticles ( NPs) has grown considerably over the recent years, and the SPIONs labelled with medicinal radionuclides offer new opportunities in multimodal diagnostics and in the drug-delivery systems for targeted alpha-particle therapy (TAT) driven by magnetic field gradient or by biologically active moieties bound on NPs shell. However, the mechanisms of NPs radiolabelling are not studied substantially and still remain unclear, even though the way of label attachment directly implies the stability of the label-nanoparticle construct. Since the 223Ra was the first clinically approved alpha-emitter, it is a promising nuclide for further development of its targeted carriers. We report here on the study of 223Ra uptake by the Fe3O4 SPIONs, together with an attempt to propose the 223Ra uptake mechanism by the Fe3O4 NPs in the presence of a phosphate buffer a typical formulation medium, under the pseudo-equilibrium conditions. Further, the in vitro stability tests of the prepared [223Ra]Fe3O4 NPs were performed to estimate the 223Ra label stability. The potential use of 223Ra-labelled SPIONs in theranostic applications is also discussed.

  12. IL-1 receptor-antagonist (IL-1Ra) knockout mice show anxiety-like behavior by aging.

    Science.gov (United States)

    Wakabayashi, Chisato; Numakawa, Tadahiro; Odaka, Haruki; Ooshima, Yoshiko; Kiyama, Yuji; Manabe, Toshiya; Kunugi, Hiroshi; Iwakura, Yoichiro

    2015-07-10

    Interleukin 1 (IL-1) plays a critical role in stress responses, and its mRNA is induced in the brain by restraint stress. Previously, we reported that IL-1 receptor antagonist (IL-1Ra) knockout (KO) mice, which lacked IL-1Ra molecules that antagonize the IL-1 receptor, showed anti-depression-like behavior via adrenergic modulation at the age of 8 weeks. Here, we report that IL-1Ra KO mice display an anxiety-like phenotype that is induced spontaneously by aging in the elevated plus-maze (EPM) test. This anxiety-like phenotype was improved by the administration of diazepam. The expression of the anxiety-related molecule glucocorticoid receptor (GR) was significantly reduced in 20-week-old but not in 11-week-old IL-1Ra KO mice compared to wild-type (WT) littermates. The expression of the mineralocorticoid receptor (MR) was not altered between IL-1Ra KO mice and WT littermates at either 11 or 20 weeks old. Analysis of monoamine concentration in the hippocampus revealed that tryptophan, the serotonin metabolite 5-hydroxyindole acetic acid (5-HIAA), and the dopamine metabolite homovanillic acid (HVA) were significantly increased in 20-week-old IL-1Ra KO mice compared to littermate WT mice. These findings strongly suggest that the anxiety-like behavior observed in older mice was caused by the complicated alteration of monoamine metabolism and/or GR expression in the hippocampus.

  13. RA8, A human anti-CD25 antibody against human treg cells

    Energy Technology Data Exchange (ETDEWEB)

    Arias, Robyn; Flanagan, Meg; Miller, Keith D.; Nien, Yu-Chih; Hu, Peisheng; Gray, Dixon; Khawli, Leslie A.; Epstein, Alan L.

    2007-06-01

    Although anti-CD25 antibodies exist for clinical use in patients, there is a need for the development of a human Treg antibody that will abrogate the immunosuppressive function of this small but critical T cell subtype. Based upon mounting evidence that the level of Treg cells in the tumor microenvironment correlates with clinical prognosis and stage in man, it appears that Treg cells play an important role in the tumor's ability to overcome host immune responses. In mice, the rat anti-mouse CD25 antibody PC61 causes depletion of CD25-bearing Treg cells both peripherally in lymphatic tissues and in the tumor microenvironment, without inducing symptoms of autoimmunity. A similar antibody, though with the ability to delete Treg cells specifically, would be an important new tool for reversing tumor escape associated with Treg immunosuppression in man. To begin to generate such a reagent, we now describe the development of a human anti-CD25 antibody using a novel yeast display library. The target antigen CD25-Fc was constructed and used for five rounds of selection using a non-immune yeast display library that contained as many as 109 single chain variable fragments (scFv). Two unique clones with low KD values (RA4 and RA8) were then selected to construct fully human anti-CD25 antibodies (IgG1/kappa) for stable expression. One antibody, RA8, showed excellent binding to human CD25+ cell lines and to human Treg cells and appears to be an excellent candidate for the generation of a human reagent that may be used in man for the immunotherapy of cancer.

  14. CuRa: Cooperation on non-polluting resource exchange for cost reduction. Final report; CuRa: Cooperation fuer umweltschonenden Ressourcenaustausch zur Nutzung von Kostenreduktionspotenzialen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Schoen, M.; Delahaye, F.; Hiessl, H.; Kotz, C.; Kuntze, U.; Matuschweski, A.; Schuenke, P.; Zoche, P.; Hafkesbrink, J.; Rebhan, A.; Schroll, M.

    2003-02-01

    The project CuRa: (German acronym for Cooperation for Environmentally Friendly Exchange of Resources) aimed to design elements to put into practice the model of sustainable development. The focus was on the participation of industry and business on a regional level and two model regions were chosen for the analysis of case studies. It was intended to give impulses for regional material flow networks between companies, for example by bundling similar material flows to achieve a better profitability and by one-to-one cooperation between companies, one of them using the waste of the partner as raw material. In addition, the potential for reducing material throughput using modern information technology was investigated in a case study. A set of theses derived from institutional theory was verified on the basis of the empirical results. Useful for the development and the stabilization of networks are, among others, expected economic benefits for the partners, common socio-cultural values and traditions, and using existing institutional arrangements as a basis. Different forms of market and policy failures were identified as obstacles, e.g. the established system of waste disposal services, the focus among the responsible actors on compliance with existing rules, and different regulatory obstacles. Nevertheless, in spite of the insufficient number of successful examples and demonstration projects, a shift in orientation from focusing on mere waste disposal towards a closed loop recycling economy and even towards sustainable development was identified within the commercial sector. (orig.) [German] Im Projekt CuRa: (Cooperation fuer umweltschonenden Ressourcenaustausch) sollten in zwei Modellregionen Bausteine fuer die operative Umsetzung des Leitbildes nachhaltiger Entwicklung durch regionale Akteure aus Industrie und Gewerbe entwickelt werden. Es sollte ein Anstoss zu zwischen- und ueberbetrieblicher Vernetzung von Materialfluessen sowie zu einer Umgestaltung der

  15. Pitfalls in the assessment of smoking status detected in a cohort of South African RA patients.

    Science.gov (United States)

    Govind, Nimmisha; Ally, Mahmood M T M; Tikly, Mohammed; Anderson, Ronald; Hodkinson, Bridget; Meyer, Pieter W A

    2016-10-01

    This study was conceived in an attempt to explain the unexpectedly high frequency of elevated levels of serum cotinine measured retrospectively in a cohort of predominantly black South African females with rheumatoid arthritis (RA), findings that were inconsistent with the smoking histories derived from health questionnaires. The discrepant findings suggested either a greater tendency towards underreporting of smoking status in the study cohort, or possible confounding effects of the use of smokeless tobacco products. In addition to the cohort of RA patients (n = 138, of whom 115 (83 %) were female), blood samples were also taken from a second cohort consisting of 29 declared smokers, 18 (62 %) of whom where females, 29 smokeless tobacco (SLT) users (all female), and 22 non-users of any tobacco products, 18 (82 %) of whom were females. Serum cotinine levels were determined using an ELISA procedure. Cotinine levels of >10.0 ng/ml were detected in serum specimens from 43 (31 %), RA patients of whom 35 (81 %) were female, with a median value of 50.1 ng/ml and interquartile range (iqr) of 68.6. Only 18 of the 35 females indicated that they smoked. The groups of declared smokers and SLT users had equivalent median serum cotinine levels of 88.0 ng/ml (iqr = 10.8 ng/ml) and 87.0 ng/ml (iqr = 15.6 ng/ml), respectively, while cotinine was undetectable in specimens from non-tobacco product users (<0.2 ng/ml). Users of SLT products in South Africa are predominantly female and have serum cotinine levels which are comparable with those of current smokers, raising concerns about the validity of measurement of cotinine as the sole objective marker of smoking status in populations with high usage of SLTs. This situation can be rectified by ensuring that usage of SLT products is accurately recorded in health questionnaires, while inclusion of measurement of one or more additional, objective biomarkers of smoking in combination with cotinine may enable reliable

  16. Poredbena raščlamba dimenzija međučlanova lateralnih mostova

    OpenAIRE

    Mehulić, Ketij; Baučić, Ivo; Ćatović, Adnan; Živko-Babić, Jasenka; Stipetić, Jasmina

    1998-01-01

    Svrha istraživanja: Raščlamba topografskoanatomskih oblika međučlanova mostova premolarno-molarnoga segmenta u odnosu prema sljedećim varijablama: zastupljenost po pojedinom zubu u jednoj čeljusti te u objema čeljustima, čestoća nadomještanja određenih zuba po spolu, meziodistalni i okluzogingivni promjer, te visina međučlanova i vrijednosti higijenskoga kuta. Materijal i metoda: Istraživanje je provedeno na 973 člana lateralnih mostova u gornjoj i donjoj čeljusti na 251 pacijentu dobi od 18 ...

  17. Zasnova in izvedba računskega jedra OpenCL z vezjem FPGA

    OpenAIRE

    MARAŽ, DOMEN

    2016-01-01

    V diplomskem delu smo predstavili zasnovo in izvedbo računskega jedra OpenCL z vezjem FPGA. Uvodoma smo podali problematiko in ključne rešitve za povečevanje zmogljivosti in učinkovitosti procesnih sistemov. Predstavili smo heterogene sisteme, navedli njihov razvoj in izvedbe strojne opreme. Načrtovanje programske opreme za tovrstne sisteme je izredno kompleksno. Rešitev je v ogrodju OpenCL, ki ga je zasnovalo podjetje Apple Inc. in ga prepustilo krovni organizaciji Khronos Group. V delu je ...

  18. Raúl Serrano: dialéctica y creación teatral

    OpenAIRE

    Ana Cecilia Prenz

    1994-01-01

    Raúl Serrano estudioso de teatro, tiene una formación completamente diferente con respecto a la de los hombres de teatro argentino; es, con toda seguridad, la persona que más profunda y científicamente se ha dedicado al estudio de K. Stanislavskij en el ámbito del teatro de este país. La experiencia teatral adquirida en Europa influenciará profundamente sobre este autor en sus investigaciones, de tal modo que al regresar a su país de origen será profundamente crítico con respecto a la realida...

  19. Herencia del contenido de carotenos en raíces de yuca Manihot esculenta Crantz

    OpenAIRE

    Morillo Coronado, Yacenia

    2009-01-01

    Cinco familias de hermanos completos (CM 9816, GM 705, GM 708, GM 734 y GM 893) de un total de 32 familias de yuca fueron seleccionadas para el estudio de herencia del contenido de carotenos en raíces, ya que presentaron altos contenidos de carotenos totales y un gran contraste entre sus progenies (gran desviación estándar y un amplio rango de variación). Los individuos pertenecientes a las cinco familias fueron autopolinizados para generar a las familias S1. De las familias CM 9816, GM 708 y...

  20. La cultura de vocación intercultural en Raúl Fornet-Betancourt

    Directory of Open Access Journals (Sweden)

    Alexander Cer n Samboni

    2013-01-01

    Full Text Available En este artículo se sostienen algunas tesis provisionales sobre la concepción de cultura en la perspectiva del filósofo cubano Raúl Fornet-Betancourt y de otros representantes de la filosofía intercultural latinoamericana. Para ello, la tesis central afirma que se puede entender por cultura en Fornet- Betancourt el contexto histórico que sirve de identidad a una cultura así también la crítica que hace posible una radical desantropologización de la cultura, vista desde el paradigma latinoamericano de la liberación.

  1. Jenseits von Christa Wolf – marginalisierte Schriftstellerinnen in der Honecker-Ära

    Directory of Open Access Journals (Sweden)

    Beate Ihme-Tuchel

    2001-11-01

    Full Text Available Anne Lequy geht es in ihrer aus feministischer Sicht geschriebenen literaturwissenschaftlichen Studie um den „Ort“, um also um das „Zuhause“, um „Desorientierungen“ und um den „Schwerpunktverlust“ in den Arbeiten von weniger bekannten Schriftstellerinnen der Honecker-Ära. Sie untersucht, wie das „DDR-Milieu“ deren Schaffen beeinflusst hat, ob sie sich der Doppelmoral hinsichtlich der angeblich erreichten Gleichstellung von Mann und Frau bewusst waren und wie sie „auf diesen Betrug“ reagierten.

  2. Raíces metafísicas de la Lógica de Hegel

    Directory of Open Access Journals (Sweden)

    Miguel Giusti

    1994-06-01

    Full Text Available El artículo ofrece una reflexión hermenéutica sobre el sentido aparentementeparadójico de la combinación de los términos "ciencia" y "lógica" en laCiencia de la lógica de Hegel. Se muestran las raíces metafísicas de estaempresa, presentes en la transformación kantiana de la secular concepciónaristotélica, con la finalidad de hacer más comprensible la transformaciónhegeliana de la metafísica en lógica.

  3. Análise da estrutura genética da raça caracu

    OpenAIRE

    Dias, Amábily Cardoso

    2012-01-01

    O objetivo do trabalho foi determinar a estrutura genética dos bovinos da raça Caracu. Foi utilizado um arquivo de pedigree de 130.165 animais que foi obtido da Associação Brasileira de Criadores de Caracu. O banco de dados foi dividido em seis períodos: 1979-1983, 1984-1988, 1989-1993, 1994-1998, 1999-2003 e 2004-2008. Foram estimados o coeficiente de endogamia, o tamanho efetivo populacional e o número efetivo de fundadores e ancestrais. O coeficiente médio de endogamia entre os animais c...

  4. Tulumaksumäära langetamine on kõigi huvides / Meelis Atonen

    Index Scriptorium Estoniae

    Atonen, Meelis, 1966-

    2001-01-01

    Ilmunud ka: Valgamaalane, 10. nov. 2001, lk. 2; Severnoje Poberezhje, 13. nov. 2001, lk. 2; Koit, 13. nov. 2001, lk. 6; Võrumaa Teataja, 13. nov. 2001, lk. 2; Põhjarannik, 15. nov. 2001, lk. 2; Vooremaa, 15. nov. 2001, lk. 2; Pärnu Postimees, 17. nov. 2001, lk. 2; Hiiu Leht, 20. nov. 2001, lk. 2; Lääne Elu, 20. nov. 2001, lk. 4; Sakala, 21. nov. 2001, lk. 2; Nädaline, 24. nov. 2001, lk. 4. Tulumaksumäära langetamine on majanduskliima säilitamiseks hädavajalik. Autor: Reformierakond. Parlamendisaadik

  5. Traços laringais em Latundê (Nambikwára do Norte

    Directory of Open Access Journals (Sweden)

    Stella Telles

    Full Text Available Este trabalho reflete o status dos traços laringais na língua Latundê, pertencente ao subgrupo Nambikwára do Norte, da família Nambikwára. Os dados foram coletados in loco pela autora entre os anos 1997-2001. Para a análise, considerou-se também a literatura disponível sobre outras línguas da família. O presente artigo está organizado em cinco seções: na primeira, são fornecidas informações sobre a família Nambikwára e os inventários segmentais de três línguas da família; na segunda, são apresentados os quadros fonológicos (consonantal e vocálico do Latundê; na terceira, encontram-se dados que evidenciam a realização dos traços laringais existentes em consoantes Latundê (glotalização e aspiração e o contraste do traço creaky voice, nas vogais; na quarta, são feitas considerações sobre a variação laringal no Latundê; finalmente, na quinta seção, são apresentadas reflexões sobre a correspondência entre segmentos com traço laringal do Latundê e do Mamaindê, outra língua Nambikwára do Norte. Os resultados do estudo evidenciaram que no Latundê as consoantes neutralizaram os traços laringais, enquanto que as vogais os mantêm contrastivamente. No interior do ramo do Norte, a correspondência entre consoantes Latundê e Mamaindê parece indicar que a primeira língua é mais inovadora no processo de mudança histórica.

  6. Tulumaksumäära langetamine on kõigi huvides / Meelis Atonen

    Index Scriptorium Estoniae

    Atonen, Meelis, 1966-

    2001-01-01

    Ilmunud ka: Valgamaalane, 10. nov. 2001, lk. 2; Severnoje Poberezhje, 13. nov. 2001, lk. 2; Koit, 13. nov. 2001, lk. 6; Võrumaa Teataja, 13. nov. 2001, lk. 2; Põhjarannik, 15. nov. 2001, lk. 2; Vooremaa, 15. nov. 2001, lk. 2; Pärnu Postimees, 17. nov. 2001, lk. 2; Hiiu Leht, 20. nov. 2001, lk. 2; Lääne Elu, 20. nov. 2001, lk. 4; Sakala, 21. nov. 2001, lk. 2; Nädaline, 24. nov. 2001, lk. 4. Tulumaksumäära langetamine on majanduskliima säilitamiseks hädavajalik. Autor: Reformierakond. Parlamendisaadik

  7. Archaeological investigations of the Bronze Age village of Bagnara di Romagna (RA

    Directory of Open Access Journals (Sweden)

    Maurizio Cattani

    2014-12-01

    Full Text Available This paper summarizes the results of researches carried out in the area next to the modern village of Bagnara di Romagna (RA, where several evidences related to a Bronze Age settlement have been collected. Recently test trenches and surface collections allowed to retrieve bronze and ceramics dating from the Middle Bronze Age (phase BM2 to the Recent Bronze Age (phase BR2. The analysis of landscape and the palaeoenvironmental reconstruction complete the outline of the region of Imola, Faenza and Lugo during the Bronze Age where are well known the ancient settlements of Solarolo, via Ordiere, Monte Castellaccio end S. Giuliano di Toscanella.

  8. Atividade antimicrobiana de extratos de raízes de Byrsonima crassifolia

    Directory of Open Access Journals (Sweden)

    Luís Fernando Albarello Gellen

    2016-06-01

    Full Text Available A Byrsonima crassifolia ou popularmente conhecida como “murici” é amplamente difundida nas regiões norte, nordeste e algumas partes da região centro-oeste. Bastante utilizado na culinária local tanto pelo seu gosto exótico, como pelos seus efeitos terapêuticos. O objetivo do trabalho foi avaliar o potencial antimicrobiano do extrato de raízes de Byrsonima crassifolia sobre bactérias de interesse médico. As amostras de B. crassifolia foram coletadas no interior do estado do Tocantins, na região do município de Cristalândia. Em seguida as raízes foram encaminhadas para o Centro Universitário Luterano de Palmas - TO, onde foram realizados os processos de produção dos extratos provenientes das raízes. Os demais procedimentos foram realizados na Universidade Federal do Tocantins, campus de Gurupi. Foram utilizadas quatro cepas bacterianas, sendo elas: Klebsiella pneumoniae ATCC700603, Escherichia coli ATCC 35218, Staphylococcus aureus ATCC 25923 e Pseudomonas aeruginosa ATCC 27853. A concentração dos extratos consistiu de 10% aquecido, 20% aquecido e 20% não aquecido. A resistência aos antimicrobianos foi realizada pelo método de difusão em disco, cuja as avaliações procederam-se 24 horas após aplicação do extrato, com auxílio de um paquímetro digital e o resultado expresso em mm. As concentrações do extrato aquoso de Byrsonima crassifólia foram eficientes na inibição bacteriana, exceto para Escherichia coli ATCC 35218. Foram observadas nas raízes pigmentações de cor característica de antocianina e quercetina, condição que pode ter influenciado no potencial antimicrobiano, pela ação antibacteriana, antiflamatório e cicatrizante destes dois flavonoides natural.

  9. Leaching of radionuclides from uranium ore and mill tailings ( Ra- 226, Tn-230).

    Science.gov (United States)

    Landa, E.R.

    1982-01-01

    The major part of the extractable uranium is associated with a readily acid-soluble fraction in both ore and tailings. The major part of the extractable 226Ra was associated with an iron, manganese hydrous-oxide fraction in the ore and tailings. Thorium-230 was the least leachable of the radionuclides studied. The major portion of the extractable 230Th was associated with alkaline-earth sulphate precipitates, organic matter, or both. The specific effects of milling on each of the nuclides are discussed.-Author

  10. Inspection of state of spent fuel elements stored in RA reactor spent fuel storage pool

    Energy Technology Data Exchange (ETDEWEB)

    Aden, V.G.; Bulkin, S.Yu.; Sokolov, A.V. [Research and Development Institute of Power Engineering, Moscow (Russian Federation); Matausek, M.V.; Vukadin, Z. [VINCA Institute of Nuclear Science, Belgrade (Yugoslavia)

    1999-07-01

    About five thousand spent fuel elements from RA reactor have been stored for over 30 years in sealed aluminum barrels in the spent fuel storage pool. This way of storage does not provide complete information about the state of spent fuel elements or the medium inside the barrels, like pressure or radioactivity. The technology has recently been developed and the equipment has been manufactured to inspect the state of the spent fuel and to reduce eventual internal pressure inside the aluminum barrels. Based on the results of this inspection, a procedure will be proposed for transferring spent fuel to a more reliable storage facility. (author)

  11. Susceptibility loci for polycystic ovary syndrome on chromosome 2p16.3, 2p21, and 9q33.3 in a cohort of Caucasian women.

    Science.gov (United States)

    Lerchbaum, E; Trummer, O; Giuliani, A; Gruber, H-J; Pieber, T R; Obermayer-Pietsch, B

    2011-10-01

    In a recent genome-wide association study investigating Han Chinese PCOS women 3 loci that are strongly associated with PCOS were identified on chromosome 2p16.3 (rs13405728), 2p21 (rs13429458), and 9q33.3 (rs2479106). The aim of the study was to investigate the impact of rs13405728, rs13429458, and rs2479106 variants on PCOS susceptibility in a Caucasian cohort of PCOS and control women. Metabolic, endocrine, and anthropometric measurements and oral glucose tolerance tests were performed in 545 PCOS and 317 control women. The rs13405728, rs13429458, and rs2479106 polymorphisms were genotyped. There was no significant difference in genotype frequencies of rs13405728 and rs13429458 variants between PCOS and controls. There was a trend towards an association of the rs2479106 variant with PCOS susceptibility (p=0.053). PCOS women with the rs2479106 GG genotype had significantly higher WHR than PCOS women carrying the AG and AA genotype (p=0.034 and p=0.020, respectively). Moreover, QChol/HDL and LDL levels were significantly higher in PCOS women carrying the rs2479106 GG genotype when compared to those carrying the AA genotype (p=0.024 and p=0.035, respectively). PCOS women carrying the G allele of rs13405728 had significantly higher AUCgluc, glucose-30 min, and AUCins levels than those carrying the AA genotype (p=0.039, p=0.047, and p=0.044, respectively). In PCOS women, rs13405728 genotypes are associated with glucose and insulin metabolism. Moreover, rs2479106 genotypes were associated with increased WHR levels and an adverse serum lipid profile. Further, we observed a trend towards decreased PCOS susceptibility within carriers of the rs2479106 G-allele. Further studies in large Caucasian PCOS cohorts are warranted to confirm our findings. © Georg Thieme Verlag KG Stuttgart · New York.

  12. Mapping spin-wave dispersions in stripe-ordered La2-xSrxNiO4 ( x=0.275 , 0.333)

    Science.gov (United States)

    Woo, Hyungje; Boothroyd, A. T.; Nakajima, K.; Perring, T. G.; Frost, C. D.; Freeman, P. G.; Prabhakaran, D.; Yamada, K.; Tranquada, J. M.

    2005-08-01

    Using the MAPS spectrometer at the ISIS spallation source, we have measured the magnetic excitations of single-crystal samples of stripe-ordered La2-xSrxNiO4 with x=0.333 and 0.275. The full two-dimensional spin-wave dispersions were obtained using incident energies of 60 and 160 meV. To analyze the excitations, we have evaluated a spin-only Hamiltonian describing diagonal, site-centered stripes in the linear spin-wave approximation. Besides the superexchange energy J within antiferromagnetic domains, we have considered effective exchange couplings J1 and J2 across a charge stripe coupling second-neighbor Ni sites along Ni-O bond directions and along the plaquette diagonal, respectively. From least-squares fits of the model to the measurements on the x=1/3 sample at T=10K , we find that the dispersions are well described by a model using just J and J1 , but not J and J2 . Consistent with an analysis of previous measurements, we find that J is about 90% of the superexchange energy of undoped La2NiO4 and J1/J≈0.5 . The excitations observed for x=0.275 are surprisingly similar to those for x=1/3 , despite the differing magnetic-ordering wave vectors; the main difference is a broadening of the excitations for x=0.275 . For both samples, we find that one spin-wave branch has a gap of ˜20meV , confirming a previous observation for x=1/3 . We discuss the possible origin of this gap.

  13. A transmembrane polymorphism in FcgammaRIIb (FCGR2B) is associated with the production of anti-cyclic citrullinated peptide autoantibodies in Taiwanese RA.

    Science.gov (United States)

    Chen, J-Y; Wang, C-M; Ma, C-C; Hsu, L-A; Ho, H-H; Wu, Y-J J; Kuo, S-N; Wu, J

    2008-12-01

    The aim of the current study was to determine whether the FcgammaRIIb 187-Ile/Thr polymorphism is a predisposition factor for subtypes of RA defined by disease severity and production of autoantibodies against cyclic citrullinated peptides (anti-CCPs) in Taiwanese RA patients. Genotype distributions and allele frequencies of FcgammaRIIb 187-Ile/Thr were compared between 562 normal healthy controls and 640 RA patients as stratified by clinical parameters and autoantibodies. Significant enrichment of 187-Ile allele was observed in RA patients positive for anti-CCP antibodies as compared with the anti-CCP negative RA patients (P=0.001, OR 1.652 (95% CI 1.210-2.257)) or as compared with the normal controls (P=0.005, OR 1.348 (95% CI 1.092-1.664)). In addition, 187-Ile allele was found to be enriched in RA patients positive for rheumatoid factor (RF) compared to the RF negative RA patients (P=0.024, OR 1.562 (95% CI 1.059-2.303)). Furthermore, the homozygotes were enriched in destructive male RA patients (P=0.035; OR 2.038 (95% CI 1.046-3.973)) and the 187-Ile allele was associated with early-onset of RA in Taiwanese patients (P=0.045, OR 1.548 (95% CI 1.007-2.379)). Thus, FcgammaRIIb SNP 187-Ile/Thr may influence the RA phenotypes in Taiwanese RA.

  14. Recombinant Rhipicephalus appendiculatus gut (Ra86 and salivary gland cement (Trp64 proteins as candidate antigens for inclusion in tick vaccines: protective effects of Ra86 on infestation with adult R. appendiculatus

    Directory of Open Access Journals (Sweden)

    Saimo M

    2011-11-01

    Full Text Available Margaret Saimo1,2,*, David O Odongo3,4,*, Stephen Mwaura3, Just M Vlak1, Anthony J Musoke5, George W Lubega2, Richard P Bishop3, Monique M van Oers11Laboratory of Virology, Wageningen University, Wageningen, The Netherlands; 2School of Veterinary Medicine, Makerere University, Kampala, Uganda; 3International Livestock Research Institute, Nairobi, Kenya; 4School of Biological Sciences, University of Nairobi, Nairobi, Kenya; 5Onderstepoort Veterinary Institute, Onderstepoort, Pretoria, South Africa *These two authors made an equal contribution to this workAbstract: Rhipicephalus appendiculatus gut protein Ra86 (variants Ra85A and Ra92A and the salivary gland cement protein (Trp64 were expressed in the baculovirus-insect cell system. The recombinant gut proteins expressed as soluble proteins and the recombinant cement protein, as insoluble inclusion bodies, were used to immunize rabbits, which were then challenged with larval, nymphal, and adult stages of R. appendiculatus ticks. High tick mortality (23.3% occurred on adult ticks that fed on rabbits vaccinated with the gut proteins, compared with 1.9% mortality in ticks that fed on unvaccinated naïve control rabbits. The mean weight of engorged female ticks was significantly reduced by 31.5% in rabbits vaccinated with the Ra86 recombinant protein compared with controls, as was egg production. Marked effects on these parameters were also observed in adult ticks as a result from vaccination using Trp64, but these were not statistically significant. For both antigens, there was no demonstrable effect on larval or nymphal ticks. This study demonstrates for the first time the protective efficacy of a homolog of Boophilus microplus Bm86 in reducing tick infestation by the adult stage of the three-host tick R. appendiculatus. The results demonstrate the potential of Ra86 for vaccine development against this tick and for the control of East Coast fever.Keywords: baculovirus, Ra85A, Ra92A, Boophilus

  15. MSFIA-LOV system for {sup 226}Ra isolation and pre-concentration from water samples previous radiometric detection

    Energy Technology Data Exchange (ETDEWEB)

    Rodríguez, Rogelio [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Environment and Energy Department, Advanced Materials Research Center (CIMAV) S.C., Miguel de Cervantes 120, Chihuahua, Chih. 31136 (Mexico); Borràs, Antoni [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Leal, Luz [Environment and Energy Department, Advanced Materials Research Center (CIMAV) S.C., Miguel de Cervantes 120, Chihuahua, Chih. 31136 (Mexico); Cerdà, Víctor [Department of Chemistry, University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain); Ferrer, Laura, E-mail: laura.ferrer@uib.es [Environmental Radioactivity Laboratory (LaboRA), University of the Balearic Islands, Cra. Valldemossa km 7.5, 07122, Palma (Spain)

    2016-03-10

    An automatic system based on multisyringe flow injection analysis (MSFIA) and lab-on-valve (LOV) flow techniques for separation and pre-concentration of {sup 226}Ra from drinking and natural water samples has been developed. The analytical protocol combines two different procedures: the Ra adsorption on MnO{sub 2} and the BaSO{sub 4} co-precipitation, achieving more selectivity especially in water samples with low radium levels. Radium is adsorbed on MnO{sub 2} deposited on macroporous of bead cellulose. Then, it is eluted with hydroxylamine to transform insoluble MnO{sub 2} to soluble Mn(II) thus freeing Ra, which is then coprecipitated with BaSO{sub 4}. The {sup 226}Ra can be directly detected in off-line mode using a low background proportional counter (LBPC) or through a liquid scintillation counter (LSC), after performing an on-line coprecipitate dissolution. Thus, the versatility of the proposed system allows the selection of the radiometric detection technique depending on the detector availability or the required response efficiency (sample number vs. response time and limit of detection). The MSFIA-LOV system improves the precision (1.7% RSD), and the extraction frequency (up to 3 h{sup −1}). Besides, it has been satisfactorily applied to different types of water matrices (tap, mineral, well and sea water). The {sup 226}Ra minimum detectable activities (LSC: 0.004 Bq L{sup −1}; LBPC: 0.02 Bq L{sup −1}) attained by this system allow to reach the guidance values proposed by the relevant international agencies e.g. WHO, EPA and EC. - Highlights: • Automatic, rapid and selective method for {sup 226}Ra extraction/pre-concentration from water. • MSFIA-LOV system performs a sample clean-up prior to {sup 226}Ra radiometric detection. • {sup 226}Ra sample preparation allows using two radiometric detectors (LBPC and LSC). • Environmental levels of {sup 226}Ra are easily quantified. • High sensitivity and selectivity are achieved, reaching the

  16. Evaluating galactic cosmic ray environment models using RaD-X flight data

    Science.gov (United States)

    Norman, R. B.; Mertens, C. J.; Slaba, T. C.

    2016-10-01

    Galactic cosmic rays enter Earth's atmosphere after interacting with the geomagnetic field. The primary galactic cosmic rays spectrum is fundamentally changed as it interacts with Earth's atmosphere through nuclear and atomic interactions. At points deeper in the atmosphere, such as at airline altitudes, the radiation environment is a combination of the primary galactic cosmic rays and the secondary particles produced through nuclear interactions. The RaD-X balloon experiment measured the atmospheric radiation environment above 20 km during 2 days in September 2015. These experimental measurements were used to validate and quantify uncertainty in physics-based models used to calculate exposure levels for commercial aviation. In this paper, the Badhwar-O'Neill 2014, the International Organization for Standardization 15390, and the German Aerospace Company galactic cosmic ray environment models are used as input into the same radiation transport code to predict and compare dosimetric quantities to RaD-X measurements. In general, the various model results match the measured tissue equivalent dose well, with results generated by the German Aerospace Center galactic cosmic ray environment model providing the best comparison. For dose equivalent and dose measured in silicon, however, the models were compared less favorably to the measurements.

  17. Average Frequency – RA Value for Reinforced Concrete Beam Strengthened with Carbon Fibre Sheet

    Directory of Open Access Journals (Sweden)

    Mohamad M. Z.

    2016-01-01

    Full Text Available Acoustic Emission (AE is one of the tools that can be used to detect the crack and to classify the type of the crack of reinforced concrete (RC structure. Dislocation or movement of the material inside the RC may release the transient elastic wave. In this situation, AE plays important role whereby it can be used to capture the transient elastic wave and convert it into AE parameters such as amplitude, count, rise time and duration. Certain parameter can be used directly to evaluate the crack behavior. But in certain cases, the AE parameter needs to add and calculate by using related formula in order to observe the behavior of the crack. Using analysis of average frequency and RA value, the crack can be classified into tensile or shear cracks. In this study, seven phases of increasing static load were used to observe the crack behavior. The beams were tested in two conditions. For the first condition, the beams were tested in original stated without strengthened with carbon fibre sheet (CFS at the bottom of the beam or called as tension part of the beam. For the second condition, the beams were strengthened with CFS at the tension part of the beam. It was found that, beam wrapped with CFS enhanced the strength of the beams in term of maximum ultimate load. Based on the relationship between average frequency (AF and RA value, the cracks of the beams can be classified.

  18. Natural radioactivity levels (K, Th and Ra in some areas of Punjab, India

    Directory of Open Access Journals (Sweden)

    Kumar Sanjeev

    2012-04-01

    Full Text Available Radioactivity, natural and man-made, is omnipresent in the earth's crust in different amounts. Natural radioactive materials under certain conditions can reach hazardous radiological levels. So, it becomes necessary to study the natural radioactivity levels in soil to assess the dose for the population in order to know the health risks and to have a baseline for future changes in the environmental radioactivity due to human activities. 226Ra, 232Th and 40K analysis has been carried out in soil samples collected from some areas of Punjab, India using gamma-ray spectrometry. Phe technique of gamma ray spectrometry was applied using high purity germanium gamma-ray detector and a PC based MCA. Radium equivalent activities are calculated for the analyzed samples to assess radiation hazards arising due to the use of these soil samples in construction of dwellings. Phe measured activity in the soil ranges from 23.17 to 57.87 Bq kg−1, 59.03 to 160.40 Bq kg−1 and 228.06 to 501.03 Bq kg−1 for 226Ra, 232Ph and 40K with mean values of 37.93, 84.47 and 351.17Bqkg−1 respectively. It has been observed that on the average the outdoor terrestrial gamma air absorbed dose rate is about 84.65nGyh−1.

  19. Mechanics of the IL2RA gene activation revealed by modeling and atomic force microscopy.

    Directory of Open Access Journals (Sweden)

    Pascale Milani

    Full Text Available Transcription implies recruitment of RNA polymerase II and transcription factors (TFs by DNA melting near transcription start site (TSS. Combining atomic force microscopy and computer modeling, we investigate the structural and dynamical properties of the IL2RA promoter and identify an intrinsically negative supercoil in the PRRII region (containing Elf-1 and HMGA1 binding sites, located upstream of a curved DNA region encompassing TSS. Conformational changes, evidenced by time-lapse studies, result in the progressive positioning of curvature apex towards the TSS, likely facilitating local DNA melting. In vitro assays confirm specific binding of the General Transcription Factors (GTFs TBP and TFIIB over TATA-TSS position, where an inhibitory nucleosome prevented preinitiation complex (PIC formation and uncontrolled DNA melting. These findings represent a substantial advance showing, first, that the structural properties of the IL2RA promoter are encoded in the DNA sequence and second, that during the initiation process DNA conformation is dynamic and not static.

  20. U-Th-Ra disequilibria in sediments of the Dora Baltea river (Italia)

    Science.gov (United States)

    Chabaux, F.; Deloche, A.; Pelt, E.; Granet, M.; Perrone, Th.; Boutin, R.; Viville, D.; Rihs, S.; Stille, P.

    2012-04-01

    In order to constrain the transfer time of sediments in Alpine rivers, we propose to use the U-series nuclides approach recently developed for Himalayan rivers (e.g., Chabaux et al., 2008; Granet et al., 2010). Therefore, a series of bank sediments has beeen collected along the Dora Baltea river (Italia), one of the Po's tributaries draining the southern slope of the Mont Blanc Massif. In addition to U series nuclides, major and trace element concentrations and Sr and Nd isotope ratios have been analyzed for each sample. The study indicates that the (234U/238U)-, (230Th/234U)- and the (226Ra/230Th)- activity ratios are very similar for all the samples, whereas the 230Th/232Th ratios can differ from one sample to another. Such a variation, consistent with the Sr and Nd isotope data, is certainly the consequence of mineralogical heterogeneities in the samples. This suggests that the use of 238U-230Th-232Th systematics alone is probably insufficient for constraining the transfer time of sediments in the Po rivers alluvial plain, whereas the combination of 238U-230Th disequilibrium with the 230Th-226Ra disequilibrium can help to constrain such time information.

  1. Fitting peculiar spectral profiles in He I 10830 \\r{A} absorption features

    CERN Document Server

    Manrique, S J González; Yabar, A Pastor; Denker, M Collados C; Fischer, C E; Gömöry, P; Diercke, A; González, N Bello; Schlichenmaier, R; Balthasar, H; Berkefeld, T; Feller, A; Hoch, S; Hofmann, A; Kneer, F; Lagg, A; Nicklas, H; Suárez, D Orozco; Schmidt, D; Schmidt, W; Sigwarth, M; Sobotka, M; Solanki, S K; Soltau, D; Staude, J; Strassmeier, K G; Verma, M; Volkmer, R; von der Lühe, O; Waldmann, T

    2016-01-01

    The new generation of solar instruments provides better spectral, spatial, and temporal resolution for a better understanding of the physical processes that take place on the Sun. Multiple-component profiles are more commonly observed with these instruments. Particularly, the He I 10830 \\r{A} triplet presents such peculiar spectral profiles, which give information on the velocity and magnetic fine structure of the upper chromosphere. The purpose of this investigation is to describe a technique to efficiently fit the two blended components of the He I 10830 \\r{A} triplet, which are commonly observed when two atmospheric components are located within the same resolution element. The observations used in this study were taken on 2015 April 17 with the very fast spectroscopic mode of the GREGOR Infrared Spectrograph (GRIS) attached to the 1.5-meter GREGOR solar telescope, located at the Observatorio del Teide, Tenerife, Spain. We apply a double-Lorentzian fitting technique using Levenberg-Marquardt least-squares ...

  2. Coverage and Capacity Analysis of Sigfox, LoRa, GPRS, and NB-IoT

    DEFF Research Database (Denmark)

    Vejlgaard, Benny; Lauridsen, Mads; Nguyen, Huan Cong

    2017-01-01

    In this paper the coverage and capacity of SigFox, LoRa, GPRS, and NB-IoT is compared using a real site deployment covering 8000 km2 in Northern Denmark. Using the existing Telenor cellular site grid it is shown that the four technologies have more than 99 % outdoor coverage, while GPRS is challe......In this paper the coverage and capacity of SigFox, LoRa, GPRS, and NB-IoT is compared using a real site deployment covering 8000 km2 in Northern Denmark. Using the existing Telenor cellular site grid it is shown that the four technologies have more than 99 % outdoor coverage, while GPRS...... is challenged for indoor coverage. Furthermore, the study analyzes the capacity of the four technologies assuming a traffic growth from 1 to 10 IoT device per user. The conclusion is that the 95 %-tile uplink failure rate for outdoor users is below 5 % for all technologies. For indoor users only NB-IoT provides...

  3. MEFV, TNF1rA, CARD15 and NLRP3 mutation analysis in PFAPA.

    Science.gov (United States)

    Dagan, Efrat; Gershoni-Baruch, Ruth; Khatib, Ihab; Mori, Adi; Brik, Riva

    2010-03-01

    PFAPA is a periodic fever disease, of unknown etiology, characterized by aphthous stomatitis, pharyngitis and cervical adenitis. To inquire whether genes implicated in other auto-inflammatory diseases might be involved in its pathogenesis, predominant mutations in the genes causing familial Mediterranean fever, TNF receptor-associated periodic fever syndrome, Crohn's disease and Muckel-Wells syndrome were analyzed in PFAPA patients. Patients (n = 57) with PFAPA, according to previously published criteria were recruited, at the Meyer Children Hospital during 2006-2007. Clinical information was complemented during physicians-parents encounter. Predominant mutations in MEFV, TNF1rA, CARD15/NOD2 and NLRP3 genes were tested. Mean age at diagnosis was 30.64 +/- 16.4 months. Boys (n = 33; 58%) were diagnosed earlier than girls (n = 21; 42%) at 26.18 +/- 13.83 and 36.41 +/- 18.32 months, respectively (P = 0.05). Fifteen patients (27%) carried an MEFV mutation; two patients (3.6%) a CARD15 mutation, one patient (1.8%) a variance in TNF1rA and another had both an MEFV and a CARD15 mutation. Clinical symptoms were equally manifested in carriers and non-carriers. The high carrier rate of MEFV mutations in our PFAPA cases compares well with that of the general population in Israel. It is debated whether MEFV mutations, when mediated by the presence of additional modifiers, may expose a transient fever condition, namely PFAPA.

  4. RaD-X: Complementary measurements of dose rates at aviation altitudes

    Science.gov (United States)

    Meier, Matthias M.; Matthiä, Daniel; Forkert, Tomas; Wirtz, Michael; Scheibinger, Markus; Hübel, Robert; Mertens, Christopher J.

    2016-09-01

    The RaD-X stratospheric balloon flight organized by the National Aeronautics and Space Administration was launched from Fort Sumner on 25 September 2015 and carried several instruments to measure the radiation field in the upper atmosphere at the average vertical cutoff rigidity Rc of 4.1 GV. The German Aerospace Center (Deutsches Zentrum für Luft- und Raumfahrt) in cooperation with Lufthansa German Airlines supported this campaign with an independent measuring flight at the altitudes of civil aviation on a round trip from Germany to Japan. The goal was to measure dose rates under similar space weather conditions over an area on the Northern Hemisphere opposite to the RaD-X flight. Dose rates were measured in the target areas, i.e., around vertical cutoff rigidity Rc of 4.1 GV, at two flight altitudes for about 1 h at each position with acceptable counting statistics. The analysis of the space weather situation during the flights shows that measuring data were acquired under stable and moderate space weather conditions with a virtually undisturbed magnetosphere. The measured rates of absorbed dose in silicon and ambient dose equivalent complement the data recorded during the balloon flight. The combined measurements provide a set of experimental data suitable for validating and improving numerical models for the calculation of radiation exposure at aviation altitudes.

  5. Rapid Reagentless Detection of M. tuberculosis H37Ra in Respiratory Effluents

    Energy Technology Data Exchange (ETDEWEB)

    Adams, K L; Steele, P T; Bogan, M J; Sadler, N M; Martin, S; Martin, A N; Frank, M

    2008-01-29

    Two similar mycobacteria, Mycobacteria tuberculosis H37Ra and Mycobacteria smegmatis are rapidly detected and identified within samples containing a complex background of respiratory effluents using Single Particle Aerosol Mass Spectrometry (SPAMS). M. tuberculosis H37Ra (TBa), an avirulent strain, is used as a surrogate for virulent tuberculosis (TBv); M. smegmatis (MSm) is utilized as a near neighbor confounder for TBa. Bovine lung surfactant and human exhaled breath condensate are used as first-order surrogates for infected human lung expirations from patients with pulmonary tuberculosis. This simulated background sputum is mixed with TBa or MSm and nebulized to produce conglomerate aerosol particles, single particles that contain a bacterium embedded within a background respiratory matrix. Mass spectra of single conglomerate particles exhibit ions associated with both respiratory effluents and mycobacteria. Spectral features distinguishing TBa from MSm in pure and conglomerate particles are shown. SPAMS pattern matching alarm algorithms are able to distinguish TBa containing particles from background matrix and MSm for >50% of the test particles, which is sufficient to enable a high probability of detection and a low false alarm rate if an adequate number of such particles are present. These results indicate the potential usefulness of SPAMS for rapid, reagentless tuberculosis screening.

  6. Concerted action of NIC relaxase and auxiliary protein MobC in RA3 plasmid conjugation.

    Science.gov (United States)

    Godziszewska, Jolanta; Moncalián, Gabriel; Cabezas, Matilde; Bartosik, Aneta A; de la Cruz, Fernando; Jagura-Burdzy, Grazyna

    2016-08-01

    Conjugative transfer of the broad-host-range RA3 plasmid, the archetype of the IncU group, relies on the relaxase NIC that belongs to the as yet uncharacterized MOBP4 subfamily. NIC contains the signature motifs of HUH relaxases involved in Tyr nucleophilic attack. However, it differs in the residue involved in His activation for cation coordination and was shown here to have altered divalent cation requirements. NIC is encoded in the mobC-nic operon preceded directly by oriT, where mobC encodes an auxiliary transfer protein with a dual function: autorepressor and stimulator of conjugative transfer. Here an interplay between MobC and NIC was demonstrated. MobC is required for efficient NIC cleavage of oriT in supercoiled DNA whereas NIC assists MobC in repression of the mobC-nic operon. A 7-bp arm of IR3 (IR3a) was identified as the binding site for NIC and the crucial nucleotides in IR3a for NIC recognition were defined. Fully active oriTRA3 was delineated to a 47-bp DNA segment encompassing a conserved cleavage site sequence, the NIC binding site IR3a and the MobC binding site OM . This highly efficient RA3 conjugative system with defined requirements for minimal oriT could find ample applications in biotechnology and computational biology where simple conjugative systems are needed.

  7. Aniela Meyer Ginsberg e os estudos de raça/etnia e intercultura no Brasil

    Directory of Open Access Journals (Sweden)

    Renata Rocha Tsuji da Cunha

    2014-12-01

    Full Text Available Este ensaio delineia as contribuições de Aniela Meyer Ginsberg (1902-1986 para o estudo das relações étnico-raciais e interculturais no Brasil. Sua produção sobre estes temas – entre artigos, capítulos de livros e resumos de congressos – foi nosso objeto central de interesse. Influenciada pela agenda antirracista do pós-guerra, os processos inter e intraculturais, as relações étnico-raciais e as migrações estavam no centro de suas investigações. Aniela é uma personagem importante da história do pensamento psicológico brasileiro, seus estudos sobre raça/ etnia no Brasil configuram-se como estudos intraculturais da sociedade nacional e de suas amplas diversidades. A autora procurou desconstruir a visão determinista biológica das raças/etnias e mostrar que é na interação dos indivíduos com a sociedade que as diferenças podem transformar-se em desigualdades.

  8. Upgrades for an improved measurement of the EDM of 225Ra

    Science.gov (United States)

    Rabga, Tenzin; Bailey, Kevin; Dietrich, Matthew R.; Greene, John P.; Holt, Roy J.; Korsch, Wolfgang; Lu, Zheng-Tian; Mueller, Peter; O'Connor, Tom P.; Fromm, Steven; Ready, Roy; Singh, Jaideep T.

    2017-01-01

    If charge conjugation (C), parity (P) and time-reversal (T) symmetries, collectively form a good symmetry of nature, CPT, then T-violating phenomena would also violate CP. An Electric Dipole Moment (EDM) would violate time-reversal symmetry, and therefor EDMs provide a sensitive way for probing CP-violation that might explain the abundance of matter over anti-matter in the Universe. The 225Ra atom (t1/2 = 15 days, I = 1/2) is a particularly attractive candidate for an EDM search in diamagnetic atoms due to its octupole deformed nuclear structure, nearly degenerate parity doublet ground state, and a large mass, that make it sensitive to T-violating interactions in the nuclear sector. Our latest measurement limits the atomic EDM of 225Ra to be less than 1.4x10-23 e-cm (95% C.L). Further experimental upgrades are being implemented including an electric field upgrade to enhance the EDM sensitivity and STIRAP for an improved spin precession detection scheme. With these upgrades in place our EDM sensitivity should increase by nearly two orders of magnitude and allow us to substantially improve constraints on certain T-violating processes within the nucleus. This work is supported by the U.S. DOE, Office of Science, Office of Nuclear Physics, under contract DE-AC02-06CH11357 and the Michigan State University.

  9. Early vascular alterations in SLE and RA patients--a step towards understanding the associated cardiovascular risk.

    Directory of Open Access Journals (Sweden)

    Maria José Santos

    Full Text Available Accelerated atherosclerosis represents a major problem in both systemic lupus erythematosus (SLE and rheumatoid arthritis (RA patients, and endothelial damage is a key feature of atherogenesis. We aimed to assess early endothelial changes in SLE and RA female patients (127 SLE and 107 RA without previous CV events. Biomarkers of endothelial cell activation (intercellular adhesion molecule-1 (sICAM-1, vascular cell adhesion molecule-1 (sVCAM-1, thrombomodulin (TM, and tissue factor (TF were measured and endothelial function was assessed using peripheral artery tonometry. Reactive hyperemia index (RHI, an indicator of microvascular reactivity, and augmentation index (AIx, a measure of arterial stiffness, were obtained. In addition, traditional CV risk factors, disease activity and medication were determined. Women with SLE displayed higher sICAM-1 and TM and lower TF levels than women with RA (p = 0.001, p<0.001 and p<0.001, respectively. These differences remained significant after controlling for CV risk factors and medication. Serum levels of vascular biomarkers were increased in active disease and a moderate correlation was observed between sVCAM-1 levels and lupus disease activity (rho = 0.246 and between TF levels and RA disease activity (rho = 0.301. Although RHI was similar across the groups, AIx was higher in lupus as compared to RA (p = 0.04. Also in active SLE, a trend towards poorer vasodilation was observed (p = 0.06. In conclusion, women with SLE and RA present with distinct patterns of endothelial cell activation biomarkers not explained by differences in traditional CV risk factors. Early vascular alterations are more pronounced in SLE which is in line with the higher CV risk of these patients.

  10. Oceanographic profile data collected from CTD casts aboard RA-4 as part of project OPR-P136-RA-14 in the Coastal Waters of SE Alaska and Gulf of Alaska from 2014-05-07 to 2014-11-11 (NCEI Accession 0130664)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0130664 includes physical and profile data collected aboard the RA-4 during project OPR-P136-RA-14 in the Coastal Waters of SE Alaska and Gulf of...

  11. 多效唑对杨梅枯枝病的影响及防治%Effect of paclobutrazol (PP333) on twig dieback of Myrica rubra and control

    Institute of Scientific and Technical Information of China (English)

    陈方永; 倪海枝; 王引; 任正初; 刘继红; 王一光

    2014-01-01

    Summary Red bayberry ( Myrica rubra ( Lour .) Zucc) is one of the major fruits planted in Zhejiang Province , China . It provides an important financial support for the farmers in this area . However , the fungal disease twig dieback severely threats the growth of red bayberry . Once one plant is infected by this disease , it would spread and destroy the whole orchard in three years . Controlling technology on this disease is urgently needed at this area .Paclobutrazol ( PP333 ) is a chemical widely used for plant growth regulation . It causes plant growth shorter , stronger , more branches and better fruiting . It has been widely used on the red bayberry for higher production . However , over‐dosage use of the chemical PP333 is suspected to connect with the epidemic of twig dieback in Zhejiang , China . The causal agent of the twig dieback disease was proved to be Pestalotiopsis species . It is postulated that the application of PP333 inhibits some bacteria growth and breaks microbial community balance in the soil , so that the causal agent of twig dieback is predominant .In order to test the hypothesis , we investigated the correlation between application amount of PP 333 and disease severity in eight farms in Zhejiang in four years . In the eight farms , we investigated the connection of application dosage of PP333 with the residues of the chemical in leaves , roots and fruits respectively . In different treatments of PP333 , leaf colour , root architecture and fruit quality were also investigated . Application of three concentrations of PP333 , T1 (200 mg/kg) , T2 (300 mg/kg) and T 3 ( 500 mg/kg) , resulted in light , moderate and heavy twig dieback disease , respectively . The results showed that over‐dosage application of PP333 in successive years caused fruit tree early senility and server diseases infection .In order to cure the infected fruit trees , we applied a new home‐made chemical to the infected trees . The results showed that the home

  12. A theoretical model for the production of Ac-225 for cancer therapy by photon-induced transmutation of Ra-226.

    Science.gov (United States)

    Melville, G; Fan Liu, Sau; Allen, B J

    2006-09-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. We are investigating the reduction of radium by transmutation on a small scale by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) to produce Ra-225, which subsequently decays to Ac-225, which can be used as a generator to produce Bi-213 for use in 'targeted alpha therapy' for cancer. This paper examines the possibility of producing Ac-225 with a linac using an accurate theoretical model in which the bremsstrahlung photon spectrum at 18 MV linac electron energy is convoluted with the corresponding photonuclear cross sections of Ra-226. The total integrated yield can then be obtained and is compared with a computer simulation. This study shows that at 18 MV, the photonuclear reaction on Ra-226 can produce low activities of Ac-225 with a linac. However, a high power linac with high current, pulse length and frequency is needed to produce practical amounts of Ac-225 and a useful reduction of Ra-226.

  13. RA Acts in a Coherent Feed-Forward Mechanism with Tbx5 to Control Limb Bud Induction and Initiation

    Science.gov (United States)

    Nishimoto, Satoko; Wilde, Susan M.; Wood, Sophie; Logan, Malcolm P.O.

    2015-01-01

    Summary The retinoic acid (RA)- and β-catenin-signaling pathways regulate limb bud induction and initiation; however, their mechanisms of action are not understood and have been disputed. We demonstrate that both pathways are essential and that RA and β-catenin/TCF/LEF signaling act cooperatively with Hox gene inputs to directly regulate Tbx5 expression. Furthermore, in contrast to previous models, we show that Tbx5 and Tbx4 expression in forelimb and hindlimb, respectively, are not sufficient for limb outgrowth and that input from RA is required. Collectively, our data indicate that RA signaling and Tbx genes act in a coherent feed-forward loop to regulate Fgf10 expression and, as a result, establish a positive feedback loop of FGF signaling between the limb mesenchyme and ectoderm. Our results incorporate RA-, β-catenin/TCF/LEF-, and FGF-signaling pathways into a regulatory network acting to recruit cells of the embryo flank to become limb precursors. PMID:26212321

  14. RA Acts in a Coherent Feed-Forward Mechanism with Tbx5 to Control Limb Bud Induction and Initiation

    Directory of Open Access Journals (Sweden)

    Satoko Nishimoto

    2015-08-01

    Full Text Available The retinoic acid (RA- and β-catenin-signaling pathways regulate limb bud induction and initiation; however, their mechanisms of action are not understood and have been disputed. We demonstrate that both pathways are essential and that RA and β-catenin/TCF/LEF signaling act cooperatively with Hox gene inputs to directly regulate Tbx5 expression. Furthermore, in contrast to previous models, we show that Tbx5 and Tbx4 expression in forelimb and hindlimb, respectively, are not sufficient for limb outgrowth and that input from RA is required. Collectively, our data indicate that RA signaling and Tbx genes act in a coherent feed-forward loop to regulate Fgf10 expression and, as a result, establish a positive feedback loop of FGF signaling between the limb mesenchyme and ectoderm. Our results incorporate RA-, β-catenin/TCF/LEF-, and FGF-signaling pathways into a regulatory network acting to recruit cells of the embryo flank to become limb precursors.

  15. Identifying Preliminary Domains to Detect and Measure Rheumatoid Arthritis Flares: Report of the OMERACT 10 RA Flare Workshop

    DEFF Research Database (Denmark)

    Bingham, Clifton O; Alten, Rieke; Bartlett, Susan J

    2011-01-01

    Background. While disease flares in rheumatoid arthritis (RA) are a recognized aspect of the disease process, there is limited formative research to describe them. METHODS: The Outcome Measures in Rheumatology Clinical Trials (OMERACT) RA Flare Definition Working Group is conducting an internatio......Background. While disease flares in rheumatoid arthritis (RA) are a recognized aspect of the disease process, there is limited formative research to describe them. METHODS: The Outcome Measures in Rheumatology Clinical Trials (OMERACT) RA Flare Definition Working Group is conducting...... an international research project to understand the specific characteristics and impact of episodic disease worsening, or "flare," so that outcome measures can be developed or modified to reflect this uncommonly measured, but very real and sometimes disabling RA disease feature. Patient research partners provided...... was identified as a component of the research agenda needed to establish criterion validity for a flare definition; this can be used in prospective studies to further evaluate the Discrimination and Feasibility components of the OMERACT filter for a flare outcome measure. CONCLUSION: Our work to date has...

  16. Chromosomal localization of a novel retinoic acid induced gene RA28 and the protein distribution of its encoded protein

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Gene RA28 is a retinoic acid induced novel gene isolated in our laboratory previously. All-trans retinoic acid (ATRA) was used to induce lung adenocarcinoma cell line GLC-82, and RA28 was obtained by subtractive hybridization. Green fluorescent protein (GFP) has emerged as a unique tool for examining introcellular phenomena in living cells. GFP possesses an intrinsic fluorescence at 488 nm that does not require other co-factors. In this report, an eukaryotic expression plasmid pEGFP-C1-RA28 was constructed and transfected with parental cell line GLC-82 to analyze protein expression and its distribution in living cells. Moreover, radiation hybrid (RH) technique was used to localize RA28 to the chromosome. The results show that gene RA28 is mapped to the chromosome 19q13.1 region, its encoded protein is distributed on cell membrane. All the results further demonstrate that GFP and RH techniques are accurate, fast, repetitive, and will be powerful methods for investigating the gene and protein localization.

  17. Våld i nära relationer : En diskursanalys kring framställningar om våld i nära relationer i tidskriften Socionomen

    OpenAIRE

    Alakokkare, Marlene; Andreasson, Cecilia

    2014-01-01

    Syftet med denna kvalitativa uppsats är att undersöka hur våld i nära relationer framställs i tidskriften Socionomen. Vår empiri består av 42 artiklar som berör våld i nära relationer. Artiklarna är publicerade mellan åren 1997 - 2013 i tidskriften Socionomen. Uppsatsens teoretiska utgångspunkt är ett socialkonstruktionistiskt perspektiv, som bidrar med att synliggöra sociala konstruktioner inom forskningsområdet. Som analysmetod används en form av diskursanalys för att urskilja subjektsposit...

  18. Magmatic Processes at Loihi Seamount Inferred From 226Ra-230Th-234U-238U Disequilibria

    Science.gov (United States)

    Pietruszka, A. J.; Hauri, E. H.; Garcia, M. O.

    2001-12-01

    We have conducted a detailed study of the U-series isotope geochemistry of young tholeiitic, transitional and alkalic Loihi basalts to examine the melt generation process during the preshield stage of a Hawaiian volcano. A previous study (Sims et al. 1999; GCA, v. 63) of two dredged lavas from the deep flanks of Loihi found a higher (230Th/238U) activity ratio in an alkalic basalt (1.07) compared to a tholeiitic basalt (1.04). This difference suggests that the tholeiitic basalt may have formed at a higher rate of mantle upwelling than the alkalic basalt. Our samples were collected from surface lava flows at Loihi's summit and along the volcano's south rift zone by submersible. Analyses were preformed using high-precision plasma ionization mass spectrometry. The samples display a relatively large range in the amount of excess 226Ra (0-13%) that extends to much lower values than observed at Kilauea Volcano (11-12%). The low (226Ra/230Th) ratios of Loihi lavas probably result from post-eruptive decay of 226Ra and imply eruption ages of 0-12 kyr. All of the Loihi samples (including the 1996 lava) have small amounts of excess 234U (0.2-0.8%). The most likely source for (234U/238U)>1 at Loihi is seawater, which has (234U/238U)=1.14. Since all of the samples were fresh, hand-picked glasses, these elevated (234U/238U) ratios may have resulted from the assimilation of a seawater-derived component within Loihi's magmatic plumbing system rather than post-eruptive U addition. The range of (230Th/238U) that we measured is 1.01-1.07, which is larger than the previous range known for Loihi. Mass balance calculations using the measured (234U/238U) ratios suggest that 1-6% of the U in the samples that we analyzed is ultimately derived from seawater. Correcting the 230Th-238U disequilibria of the Loihi lavas for this seawater-derived U results in a narrower range in the amount of excess 230Th (6-9%) with no significant differences between tholeiitic, transitional or alkalic basalts

  19. 263~373 K温度区间2-氯-3,3,3-三氟丙烯饱和蒸气压的实验研究%Measurement of Saturated Vapor Pressure of 2-Chloro-3,3,3-Trifluoropropene at 263~373 K

    Institute of Scientific and Technical Information of China (English)

    张伟; 杨志强; 吕婧; 吕剑

    2014-01-01

    Saturated vapor pressures of 2-chloro-3,3,3-trifluoropropene (HCFO-1233xf) were measured in a temperature range of 263.15~372.90 K by a static method. A total of 97 experimental points were obtained. The temperature and pressure fluctuation were within 2 mK and 1.2 kPa, respectively. The measured saturated vapor pressures and temperature were correlated by Antoine equation lnP=A-B/(T+C), and the constants of the equation were determined as A=15.119, B=3070.575 and C=7.198. The relative deviations between the calculated results from the Antoine equation and the experimental data are less than ±1%. The average molar evaporation heat of HCFO-1233xf was also estimated at 263.15~372.90 K by Clausius-Clapeyron equation which is 24363.31 J⋅mol-1. The normal boiling point is 285.22 K calculated from the Antoine equation.%采用静态法,测定了2-氯-3,3,3-三氟丙烯(HCFO-1233xf)的饱和蒸气压97个数据点,温度263.15~372.90 K,温度不确定度小于±2 mK,压力不确定度小于±1.2 kPa,并用 Antoine 方程 lnP=A-B/(T+C)进行关联,确定了蒸气压方程的三个参数 A、B、C 的值分别为15.119、3070.575和7.198。Antoine方程计算得到的饱和蒸气压与实验数据吻合较好,相对误差均在±1%以内。通过 Clausius-Clapeyron方程计算得到 HCFO-1233xf 在263.15~372.90 K 的平均摩尔蒸发热为24363.31 J⋅mol-1,通过 Antoine 方程计算得到的常压沸点为285.22 K。

  20. Patients with seronegative RA have more inflammatory activity compared with patients with seropositive RA in an inception cohort of DMARD-naïve patients classified according to the 2010 ACR/EULAR criteria.

    Science.gov (United States)

    Nordberg, Lena Bugge; Lillegraven, Siri; Lie, Elisabeth; Aga, Anna-Birgitte; Olsen, Inge Christoffer; Hammer, Hilde Berner; Uhlig, Till; Jonsson, Maria Karolina; van der Heijde, Désirée; Kvien, Tore K; Haavardsholm, Espen Andre

    2017-02-01

    To compare the presentation of seropositive and seronegative early rheumatoid arthritis (RA) in disease-modifying antirheumatic drug (DMARD)-naïve patients classified according to the 2010 American College of Rheumatology (ACR)/European League Against Rheumatism (EULAR) criteria. All patients had symptom duration from first swollen joint EULAR classification criteria for RA. NCT01205854; Pre-results. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.