Flow film boiling heat transfer in water and Freon-113
International Nuclear Information System (INIS)
Liu, Qiusheng; Shiotsu, Masahiro; Sakurai, Akira
2002-01-01
Experimental apparatus and method for film boiling heat transfer measurement on a horizontal cylinder in forced flow of water and Freon-113 under pressurized and subcooled conditions were developed. The experiments of film boiling heat transfer from single horizontal cylinders with diameters ranging from 0.7 to 5 mm in saturated and subcooled water and Freon-113 flowing upward perpendicular to the cylinders were carried out for the flow velocities ranging from 0 to 1 m/s under system pressures ranging from 100 to 500 kPa. Liquid subcoolings ranged from 0 to 50 K, and the cylinder surface superheats were raised up to 800 K for water and 400 K for Freon-113. The film boiling heat transfer coefficients obtained were depended on surface superheats, flow velocities, liquid subcoolings, system pressures and cylinder diameters. The effects of these parameters were systematically investigated under wider ranges of experimental conditions. It was found that the heat transfer coefficients are higher for higher flow velocities, subcoolings, system pressures, and for smaller cylinder diameters. The observation results of film boiling phenomena were obtained by a high-speed video camera. A new correlation for subcooled flow film boiling heat transfer was derived by modifying authors' correlation for saturated flow film boiling heat transfer with authors' experimental data under wide subcooled conditions. (author)
Gas-Chromatographic Determination Of Water In Freon PCA
Melton, Donald M.
1994-01-01
Gas-chromatographic apparatus measures small concentrations of water in specimens of Freon PCA. Testing by use of apparatus faster and provides greater protection against accidental contamination of specimens by water in testing environment. Automated for unattended operation. Also used to measure water contents of materials, other than Freon PCA. Innovation extended to development of purgeable sampling accessory for gas chromatographs.
High pressure freon decontamination of remote equipment
International Nuclear Information System (INIS)
Wilson, C.E.
1987-01-01
A series of decontamination tests using high pressure FREON 113 was conducted in the 200 Area of the Hanford site. The intent of these tests was to evaluate the effectiveness of FREON 113 in decontamination of manipulator components, tools, and equipment items contaminated with mixed fission products. The test results indicated that high pressure FREON 113 is very effective in removing fissile material from a variety of objects and can reduce both the quantity and the volume of the radioactive waste material presently being buried
A coexistence curve equation for refrigerant-F-113 within the vicinity of the critical point
International Nuclear Information System (INIS)
Al'okhyin, O.D.; Bezruchko, Yi.V.; Bulavyin, L.A.
2003-01-01
The experimental data on the dependence of the density on temperature have been presented for refrigerant F-113 along the coexistence curve within the wide temperature range including the close vicinity of the critical temperature. The extended equation of state for freon-113 along this direction has been proposed on the base of the van der Waals model of a fluctuation gas. Parameters of the equation is determined by the interaction of molecules inside density fluctuations at the distances r>R c and by the interaction between fluctuations at the distances r>R c (R c is the correlation radius of the system)
Burnout in the boiling of water and freon-113 on tubes with annular fins
International Nuclear Information System (INIS)
Rubin, I.R.; Pul'kin, I.N.; Roizen, L.I.
1986-01-01
This paper presents the results of numerical calculations of burnout heat flux associated with the boiling of Freon-113 and water on an annular fin of constant thickness which have been approximated by simple analytical relations. These are used to calculate the critical burnout parameters of tubes with an annular fin assembly. The calculated data may be used for the analysis of tubes with an annular fin assembly over a wide range of variation of the thermophysical properties of the material and geometrical parameters of the fin assembly
Operation of Resistive Plate Chamber Detectors with a New Environmentally Friendly Freon
Lewis, Helen Elizabeth
2014-01-01
RPC particle gas detectors at CERN provide a vital element to the physics experiments carried out on the LHC. While their current operation and working gas mixtures are successful, environ- mental and economic factors force a revision of the mixture, specifically the eventual replacement of the current Freon gas R134-a with a newer, less environmentally harmful formulation, namely R1234-yf. The methods and results presented here outline the detector response to the introduction of the new Freon and its behavior under various mixtures. The electronegativity and hence impact on RPC parameters was investigated. It was found that the new Freon gas is indeed electroneg- ative, and suppresses the RPC signal. The mixture was modified to include Argon to increase ionization, and the final results of the operation of the RPC were satisfactory. Further work to refine the mixture for future implementation is necessary.
Energy Technology Data Exchange (ETDEWEB)
Yagyu, Sumio; Maekawa, Koich; Sugawara, Koich; Hayashida, Masaru; Fujishima, Ichiro; Fukuyama, Yuji; Morikawa, Tomoyuki; Yamato, Tadao; Obata, Norio [Advanced Technology Lab., Kubota Corp., Amagasaki, Hyogo (Japan)
1999-07-01
This paper describes recent results at Kubota to develop a gas engine driven freon-free heat supply system. Utilizing a gas mixture which consists of CO and H{sub 2} supplied from a broad area energy utilization network, the system produces four heat sources (263 K, 280 K, 318 K, and 353 K) for air-conditioning, hot water supply, and refrigeration in a single system. It also conforms to fuel systems that utilize methane and hydrogen. This multi-functional heat supply system is composed of an efficient gas engine (methanol gas engine) and a freon-free heat pump (heat-assisted Stirling heat pump). The heat-assisted Stirling heat pump is mainly driven by engine shaft power and is partially assisted by thermal power provided by engine exhaust heat. By proportioning the two energy sources to match the characteristics of the driving engine, the heat pump is supplied with the maximum share of the original energy fueling the engine. Developing the system will establish freon-free thermal utilization system technology that satisfies both wide heat demands and various fuel systems. (orig.)
Reactions of the radical cations of aliphatic aldehydes in freon matrices
International Nuclear Information System (INIS)
Belevskij, V.N.; Belopushkin, S.I.; Feldman, V.I.
1985-01-01
ESR spectra of γ-irradiated solutions of acetic and propionic aldehydes in freon-11 and freon-113 affected by aldehyde concentration, temperature, and the action of light were studied. It is shown that the radical cations are converted into neutral radicals, and the cations CHsub(3)CHsub(2)CHOsup(+). are converted to RCO and CHsub(3)CHCHO due to ion-molecular reactions of proton transfer of hydrogen atom transfer. (author)
International Nuclear Information System (INIS)
Shchapin, I.Yu.; Belevskij, V.N.
1996-01-01
Transformations of cation-radicals of 1,3- and 1,4-pentadienes, 2,3-dimethylbutadienes and cyclopentene, formed by X-ray irradiation at 77 K, are studied in the freon-11 and 113 matrices. It is shown that cation-radicals of 1,3-pentadienes in the CFCl 3 matrix at 77 K are regrouped in cyclopentene cation-radicals. There is no such a regrouping in the freon-113 matrix. The 1,4-pentadiene radicals have plane structure in the CFCl 3 matrix and are transformed into pentadienyl radicals in the freon-113 matrix. The cation radicals of dimethylbutadiene in the freon-113 matrix are transformed into end allyl radicals. The cation-radicals of cyclopentene in the freon-113 matrix are transformed at 110 K in cyclic allyl radicals. The radicals formation mechanism is in good agreement with the data, obtained during studies on liquid hydrocarbons, X-irradiated at 293 K in the presence of spin trap of 2.4.6-tri-tert-butylnitrosobenzene
International Nuclear Information System (INIS)
Tanimoto, K.; Ishii, M.
1998-01-01
Transient characteristics of two-phase natural circulation within a Freon-113 loop with a large condenser have been examined mainly focused on the flashing phenomenon. General behavior was described and parametric studies were performed. The items observed were the period and duration of flashing, peak flow rate, amount of flow carryover per flashing, lowest-peak liquid level within the condenser, and the peak void distribution in the riser section. The parameters considered were the heater power input, valve friction at the heater inlet (simulating the loopwise friction), condenser cooling, degree of subcooling at the heater inlet, and the heat loss to the surroundings. As a whole, the heater power input, valve friction, and the rate of condenser cooling played important roles in flashing while the other effects being marginal. In general, the flow appeared to be more unstable with the larger condensing surface which causes the condensation-induced flashing. (orig.)
Directory of Open Access Journals (Sweden)
Ye Chang
2018-01-01
Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.
International Nuclear Information System (INIS)
Isakson, K.; Vessell, A.L.
1994-07-01
Fermilab is presently phasing out all solvents containing Freon-113 (CFC-113) as part of the continuing Waste Minimization Program. These solvents are used primarily in cleaning the flux off of electronic circuit boards after soldering, specifically in bench type work. Title VI of the Clean Air Act mandates a production phase-out for ozone depleting substances, like CFC-113, by the year 2000. Our study addresses this issue by evaluating and choosing alternative non-CFC solvents to replace the CFC-1 13 solvents at Fermilab. Several potential non-CFC cleaning solvents were tested. The evaluation took place in three parts: controlled experimental evaluation, chemical composition evaluation, and employee performed evaluation. First, we performed a controlled nine-step procedure with the potential solvents where each was evaluated in categories such as cleaning effectiveness, odor, residue, type of output and drying time. Next, we listed the chemical composition of each solvent. We noted which solvents contained hydrochlorofluorocarbons because they are targeted for phase-out in the future and will be recognized as interim solutions only. Finally, after preliminary testing, five solvents were chosen as the best options. These solvents were sent to be tested by Fermilab employees who use such materials. Their opinions are valuable not only because they are knowledgeable in this field, but also because they will be using the solvents chosen to replace the CFC-113 solvents. The results favored two ''best alternatives'': Safezone Solvent Flux Remover by Miller-Stephenson and E-Series CFC Free Flux-Off 2000 by Chemtech. Another possible solution also pursued is the no-clean solder option. In our study, we were not able to thoroughly investigate the many types of no-clean solders because of time and financial constraints. The testing that was done, however, showed that no-clean solder was a viable alternative in many cases
Vapor Explosions with Subcooled Freon
International Nuclear Information System (INIS)
Henry, R.E.; Fauske, Hans K.; McUmber, L.M.
1976-01-01
Explosive vapor formation accompanied by destructive shock waves, can be produced when two liquids, at much different temperatures, are brought into intimate contact. A proposed analytical model states that the interface temperature upon contact between the two liquid systems, gust be greater than or equal to the spontaneous nucleation temperature of that liquid-liquid system and that the thermal boundary layer must be sufficiently developed to support a critical size cavity. For time scales greater than 10-12 sec, the interface temperature upon contact of two semi-infinite masses, with constant thermal properties, can be related to the initial liquid temperatures. The spontaneous nucleation behavior at the interface can either be heterogeneous or homogeneous in nature. In either case, the critical size cavities, which initiate the vaporization process, are produced by local density fluctuations within the cold liquid. For homogeneous conditions, the two liquids present a well-wetted system and the vapor embryos are produced entirely within the cold liquid. For heterogeneous conditions, which result from poor, or imperfect wetting, at the liquid-liquid interface, the critical sized cavities are created at the interface at somewhat lower temperatures. A sequence of experiments, using Freon-22 and water, Freon-22 and mineral oil, and Freon-12 and mineral oil have been performed to test this spontaneous nucleation premise. For Freon-22 at its normal boiling point, the interface temperature of the water must be at least 77 deg. C before the interface temperature equals or exceeds the minimum homogeneous nucleation value of 54 deg. C and 84 deg. C before the interface temperature equals 60 deg. C where the homogeneous nucleation rate becomes truly explosive. The Freon-water test demonstrated explosive interactions for water temperatures considerably lower than this value and this was attributed to the heterogeneous nucleation characteristics of that particular system
Critical heat flux experimental facility using Freon R-134a fluid
Energy Technology Data Exchange (ETDEWEB)
Hong, Sung Deok; Chung, C. H.; Kim, B. D. [Korea Atomic Energy Research Institute, Taejeon (Korea)
2000-02-01
A CHF experimental loop using Freon R-134a as a working fluid has been designed and built to facilitate modeling of high pressure/temperature water CHF experiments. This loop was designed to operate at 4 MPa, 100 deg C with the maximum flow rate of 2.5 kg/s. The detailed technical specification and operating procedure of the loop are described together with comments on the performance and limitations of the loop. A series of CHF experiment was carried out in a vertical round tube and the fluid-to-fluid modeling techniques are applied for it's validity for the high temperature/pressure reactor conditions. The experimental range covered all the application ranges of CHF correlations developed for both PWR and PHWR. 28 refs., 9 figs., 5 tabs. (Author)
International Nuclear Information System (INIS)
Lasa, J.
1981-01-01
In developing the use of Freon-11 and Freon-12 as environmental tracers in aeronomy, oceanography and hydrology electron capture gas chromatography was used to measure the concentration changes. A detector in the coulometric mode was designed and operated as a solute switch. The detection limit was in the order of 0.2x10 -12 g for a modified head space method in handling aqueous samples. Theoretical analysis of the detector design and the effects of factors including pulsing period, flowrates of carrier gas and the radioactivity of the detector source were discussed and confirmed experimentally
1970-01-01
hexahydrate (ErClj-6H201 Erbium gallate (see Trierbium p«ntagallium dodecaoxide) Trierbium pentagallium dodecaoxide lErjGajO« (Garnet) J Erbium oxide (E...Freon 22) Isotron 113 (see Freon 113) Isotron 114 (see Freon 114) J odium (see Iodine) Kalium (see Potassium) Krypton Lanthana (see Lanthanum ...oxide) Lanthanum Lanthanum oxide (LajOj) Lanthanum sesquioxide (see Lanthanum oxide) Dilantanum trioxide (see Lanthanum oxide) T auehing gas (see
Experimental study of conjugate heat transfer from liquid metal layer cooled by overlying freon
International Nuclear Information System (INIS)
Cho, J.S.; Suh, K.Y.; Chung, C.H.; Park, R.J.; Kim, S.B.
2001-01-01
Steady-state and transient experiments were performed for the heat transfer from the liquid metal pool with overlying Freon (R113) coolant in the process of boiling. The simulant molten pool material is tin (Sn) with the melting temperature of 232 Celsius degrees. The metal pool is heated from the bottom surface and the coolant is injected onto the molten metal pool. Tests were conducted under the condition of the bottom surface heating in the test section and the forced convection of the R113 coolant being injected onto the molten metal pool. The bottom heating condition was varied from 8 kW to 14 kW. The temperature distributions of the metal layer and coolant were obtained in the steady-state experiment. The boiling mechanism of the R113 coolant was changed from the nucleate boiling to film boiling in the transient experiment. The critical heat flux (CHF) phenomenon was observed during the transition from the nucleate boiling to the film boiling. Also, the Nusselt (Nu) number and the Rayleigh (Ra) number in the molten metal pool region were obtained as functions of time. Analysis was done for the relationship between the heat flux and the temperature difference between the metal layer surface and the boiling coolant. In this experiment, the heat transfer is achieved with accompanying solidification in the molten metal pool by the boiling R113 coolant there above. The present test results of the natural convection heat transfer on the molten metal pool are higher than those of the liquid metal natural convection heat transfer without coolant boiling. It can be interpreted that the heat transfer rate is enhanced by the overlying boiling coolant having the high heat removal rate. Analysis of the relationship between the heat flux and the difference between the metal layer surface temperature and the coolant bulk boiling temperature revealed that the CHF occurs when the temperature difference reaches a neighborhood of 50 Celsius degrees. Also, if the temperature
Volume reduction and material recirculation by freon decontamination
International Nuclear Information System (INIS)
Berners, O.; Buhmann, D.; Yamashita, Y.; Yoshiaki, M.
1989-01-01
This paper discusses the use of freon in a large variety of decontamination in the nuclear and non-nuclear fields. As far as the contamination is loose or smerable, surfaces of nearly all materials can be decontaminated. Freon is electrically non-conductive, chemically neutral and has a low surface tension. So it is capable of creeping under the contaminant and loosening or dissolving it. Used freon can be collected, cleaned and recirculated. Its cleaning can be done easily by evaporation at its lower vapor point of about 48 degrees C (104 degrees F). Good decontamination results could be achieved, expensive materials, tools and equipment could be recirculated. Big volumes of materials could get separated from their contaminants, which is the real radioactive waste. Freon decontamination is an effective, overall economical and approved technology to volume reduction and material recirculation
International Nuclear Information System (INIS)
Rahmani, R.
1983-01-01
The nucleate boiling heat-transfer coefficient and the maximum heat flux were studied experimentally as functions of velocity, quality and heater diameter for single-phase flow, and two-phase flow of Freon-113 (trichlorotrifluorethane). Results show: (1) peak heat flux: over 300 measured peak heat flux data from two 0.875-in. and four 0.625-in.-diameter heaters indicated that: (a) for pool boiling, single-phase and two-phase forced convection boiling the only parameter (among hysteresis, rate of power increase, aging, presence and proximity of unheated rods) that has a statistically significant effect on the peak heat flux is the velocity. (b) In the velocity range (0 0 position or the point of impact of the incident fluid) and the top (180 0 position) of the test element, respectively
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
The paper made a research survey of a technology to decompose the recovered CFC (specified freon) in which energy efficiency is high and no hazardous materials such as dioxin are generated. As to the technology to decompose specified freon, the high frequency plasma method, the cement kiln method and the combustion method are at the stage of the demonstration test and close to the commercialization. The catalyst method has finished the basic test and is at the stage of a pilot plant. Besides, there are the supercritical water decomposition method, the ultraviolet decomposition method, etc., but they are at the stage of the fundamental research. Mechanisms of the dioxin generation and the suppression of dioxin generation in case of incinerating waste mixed with halide have been made clear. In the fundamental test, conditions were obtained under which the freon decomposition rate of more than 99.99% is attained by the combustion of a mixture of industrial waste and freon using the combustion method, and measures for reduction in hazardous materials such as dioxin were expected to be taken. In the catalyst method, the result obtained was the decomposition rate of more than 99.99% and the catalyst life of more than 1000 years, and its practicality was confirmed. 43 refs., 97 figs., 29 tabs.
International Nuclear Information System (INIS)
Nabizadeh, H.
1977-01-01
Simulation of the thermohydraulic processes of the steady-state reactor operation with boiling water and typical fuel element geometries leads to considerable increase of the heat rates to be tranferred and thus to an increase of the experimental cost which can hardly be justified. By proper choice of a model fluid with low heat of evaporation the system parameters like pressure, temperature, and heat rate, while retaining the original geometry, may be reduced to a fraction of those of the original fluid water. This permits not only a decrease in experimental cost but also a modification of the existing calculation data under more favorable experimental conditions. Starting from these considerations the cooling medium R113 was used as model fluid in carrying out the experiments. The necessary knowledge of the thermodynamical laws of simularity, however, have to be determined first of all in simple geometries and the scaling factors are then derived from them. In this connection the following experimental studies have been carried out with R113: a) average volumetric steam quality; b) two-phase pressure drop; c) critical heat flux. (orig.) [de
Transport Properties of operational gas mixtures used at LHC
Assran, Yasser
2011-01-01
This report summarizes some useful data on the transport characteristics of gas mixtures which are required for detection of charged particles in gas detectors. We try to replace Freon used for RPC detector in the CMS experiment with another gas while maintaining the good properties of the Freon gas mixture unchanged. We try to switch to freonless gas mixture because Freon is not a green gas, it is very expensive and its availability is decreasing. Noble gases like Ar, He, Ne and Xe (with some quenchers like carbon dioxide, methane, ethane and isobutene) are investigated. Transport parameters like drift velocity, diffusion, Townsend coefficient, attachment coefficient and Lorentz angle are computed using Garfield software for different gas mixtures and compared with experimental data.
Evaluation of high pressure Freon decontamination. I. Preliminary tests
International Nuclear Information System (INIS)
Rankin, W.N.
1983-01-01
High-pressure Freon blasting techniques are being evaluated for applications involving the removal of non-adherent radioactive particulate contamination at SRP. Very little waste is generated by this technique because the used Freon can be easily distilled and reused. One of the principle advantages of this technique is that decontaminated electrical equipment can be returned to service immediately without drying, unlike high-pressure water blasting techniques. Preliminary scoutin tests evaluating high-pressure Freon blasting for decontamination at SRP were carried out at Quadrex Co., Oak Ridge, TN, October 12 and 13. DWPF-type contamination (raw sludge plus volatiles) and separations area-type contamination (diluted boiling point (47.6 0 C) allow it to rapidly separate from higher boiling contaminants via distillation with filtration to remove particulate material, and distillation with condensation, the solvent may be recovered for indefinite reuse while reducing the radioactive waste to a minimum. 3 references, 5 figures, 6 tables
CHEMICAL ANALYSIS OF DENSE-GAS EXTRACTS FROM LIME FLOWERS
Directory of Open Access Journals (Sweden)
Demyanenko DV
2015-04-01
Full Text Available The purpose of this work was to make qualitative and quantitative analysis of phenolic biologically active substances (BAS in the extracts produced from lime flowers with condensed gases, using method of high-performance liquid chromatography (HPLC. Materials and methods: materials for this study were the extracts obtained by consequent processing of the herbal drug and marcs thereof with various condensed gases: difluorochloromethane (Freon R22, difluoromethane (Freon R32, azeotropic mixture of difluoromethane with pentafluoroethane (Freon 410A and freon-ammonium mixture. Extracts obtained with the latter were subjected to further fractionation by liquidliquid separation into hexane, chloroform, ethyl acetate and aqueous-alcohol phases. Besides, the supercritical СО2 extract, obtained from the herbal drug under rather strong conditions (at temperature 60°С and pressure 400 bar, was studied in our previous research. Presence of phenolic BAS and their quantity in the researched samples were determined by method of HPLC with UVspectrometric detection. Results and discussion: It has been found that Freon R22 extracted trace amounts of rutin from lime flowers – its content was only 0.08% of the total extract weight. On the other hand, Freons R32 and R410А showed good selectivity to moderately polar BAS of lime flowers (derivatives of flavonoids and hydroxycinnamic acids: in particular, the extract obtained with freon R32 contained about 1.3% of the total phenolic substances, and it was the only one of the investigated condensed gases used by us which took the basic flavonoid of lime flowers tiliroside – its content was 0.42% of extract weight. Also Freons R32 and R410А were able to withdraw another compound dominating among phenolic substances in the yielded extracts. Its quantity was rather noticeable – up to 0.87% of extract weight. This substance was not identified by existing database, but its UV-spectrum was similar to those of
Development of a Centrifugal Technique for the Microbial Bioburden Analysis of Freon (CFC-11)
Benardini, James N.; Koukol, Robert C.; Kazarians, Gayane A.; Morales, Fabian
2013-01-01
NASA Procedural Requirement 8020.12C entitled "Planetary Protection Provisions for Robotic Extraterrestrial Missions" states that the source-specific encapsulated microbial density for encapsulated organisms (div(0)) in nonmetallic materials ranges from 1-30 spores/cubic cm. The standard laboratory procedure, NASA Standard Procedures for the Microbial Examination of Space Hardware, NHB 5340.1B, does not provide any direction into the methodologies to understand the bioburden within such a fluid as CFC-11 (Freon). This general specification value for the Freon would be applicable to the Freon charged within the Mars Science Laboratory fs (MSL fs) Heat Rejection System. Due to the large volume required to fill this system, MSL could not afford to conservatively allocate 55.8% of the total spore budget of the entire laboratory system (rover, descent stage, cruise stage, and aeroshell) of 5.00 X 10(exp 5) spores at launch. A novel filtration approach was developed to analyze the Freon employing a 50 kDa molecular weight cutoff (MCO) filter, followed by 0.22-micron pore-size filter to establish a calculated microbial bioburden.
Wen, Chi-Hsiang; Chu, Fang-Hua
2017-03-01
The regulation of autumn leaf coloration in deciduous trees has long been an enigma. Due to the fact that different coloration phenotypes may be considered when planting, more understanding of the regulation mechanism is needed. In this study, a R2R3-MYB transcription factor gene LfMYB113 was identified from a subtropical deciduous tree species Formosan sweet gum (Liquidambar formosana Hance). The expression patterns of LfMYB113 in four selected phenotypes were different and were positively correlated with leaf anthocyanin content. In a 35S::LfMYB113 transgenic Nicotiana tabacum plant, both the early and late genes in the anthocyanin biosynthetic pathway were shown to be up-regulated. It was also shown that LfMYB113 can activate the promoter sequence of LfDFR1 and LfDFR2. Transient overexpression of LfMYB113 in Nicotiana benthamiana showed strong anthocyanin accumulation and pre-senescence; the latter was confirmed by up-regulation of senescence-associated genes. In addition, the activation of proLfSGR::YFP by LfMYB113 in transient experiments indicated that LfMYB113 may have a role in regulation of Chl degradation. To our knowledge, this is the first time a R2R3-MYB transcription factor has been functionally identified as one of the key regulators of autumn leaf coloration and autumn leaf senescence. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
ANALISIS PERBANDINGAN EVAPORATOR KULKAS (LEMARI ES DENGAN MENGUNAKAN REFRIGERANT R-22 DAN R-134A
Directory of Open Access Journals (Sweden)
Imam Faozan
2017-03-01
Full Text Available Tulisan ini bertujuan untuk mengetahui komponen mesin refrigerasi khususnya pembahasan evaporator. Dalam penelitian ini digunakan lemari pendingin (kulkas sederhana untuk pengawetan dan pendinginan bahan makanan dalam rumah tangga. Untuk refrigerant yang digunakan adalah Refrigerant Freon R – 22 dan Freon R - 134a sebagai perbandingan dan untuk mengetahui performance evaporator ( COP pada mesin refrigerasi untuk rumah tangga. Lemari pendingin yang dianalisa berukuran tinggi = 1 m, panjang = 0,55 m dan lebar 0,5 m. Temperatur evaporasi = -5°C dan temperature kondensasi = 40°C.
Complexon Solutions in Freon for Decontamination of Solids and SNF Treatment
International Nuclear Information System (INIS)
Kamachev, V.; Shadrin, A.; Murzin, A.
2008-01-01
Full text of publication follows: The possibility of using complexon solutions in supercritical and compressed carbon dioxide for decontamination of solid surfaces and for spent nuclear fuel (SNF) treatment was demonstrated in the works of Japanese, Russian and American researchers. The obtained data showed that the use of complexon solutions in carbon dioxide sharply decreases the volume of secondary radioactive wastes because it can be easily evaporated, purified and recycled. Moreover, high penetrability of carbon dioxide allows decontamination of surfaces with complex shape. However, one of the disadvantages of carbon dioxide is its high working pressure (10-20 MPa for supercritical CO 2 and 7 MPa for compressed CO 2 ). Moreover, in case of SNF treatment, carbon dioxide solvent will be contaminated with 14 C, which in the course of SNF dissolution in CO 2 containing TBP*HNO 3 adduct stage will be oxidized into CO 2 . These main disadvantages can be eliminated by using complexon solutions in ozone-friendly Freon HFC-134a for decontamination and SNF treatment. Our experimental data for real contaminated materials showed that the decontamination factor for complexon solutions in liquid Freon HFC-134a at 1,2 MPa and 25 deg. C is close to that attained in carbon dioxide. Moreover, the possibility of SNF treatment in Freon HFC-134a was demonstrated in trials using real SNF and its imitators. (authors)
Freon Rig design for performing to heat transfer experiments for nuclear reactors fuel bundles
International Nuclear Information System (INIS)
Flores, L.F.V.
1981-01-01
The main features of a Freon Rig design for performing to heat transfer experiments for PWR and BWR fuel bundles, are presented. The project is based on a Freon Rig pressurized at 30 bar with a flow rate up to 80 m 3 /h. The maximum power fed to test sections is of about 420 KW D.C. The rig was designed to use scaling techniques wich would enable a fluid of low latente heat to be used in place of water, thereby reducing the cost of testes. (Author) [pt
On scaling laws for modelling the steam/water flow in a 'Dodewaard' fuel-assembly using Freon-12
International Nuclear Information System (INIS)
Graaf, R. van de; Mudde, R.F.; Hagen, T.H.J.J. van der.
1991-09-01
To stimulate the steam/water flow behaviour in a fuel assembly as present in the boiling water reactor at Dodewaard, Freon-12 is used as a modelling fluid. Scaling criteria are elaborated using dimensional analysis as a fluid-to-fluid modelling technique. When scaling is emphasized on void-fraction distribution and flow-regime transitions it is found that an approximately half-scale geometry for the Freon-model should be used. Together with the low latent heat of vaporization of Freon-12 this reduces the total required heat input significantly to be only 2% of the required heat input in a 'Dodewaard' fuel-assembly. Finally, working pressure (and saturation temperature) can also be brought to a convenient level. (author). 16 refs., 11 figs., 1 tab
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-11-01
The technical basics and the state of the art for the substitution of the CFC refrigerants R-11, R-13, R-503, R-13B1, R-113, R-114 and R-12B1 in existing refrigeration systems are described and explained. The report contains an overview of the current applications of these refrigerants in the FRG, a review and discussion of existing substitutes, the presentation and evaluation of research and experiences with the conversion to alternative refrigerants, the presentation of the required infrastructure and a discussion of the technical feasibility. The conversion of existing systems to refrigerants of lower ozone depletion potential is in conclusion evaluated with regard to its technical feasibility, environmental relevance and economic efficiency. (orig.) [Deutsch] Es werden die technischen Grundlagen und der Stand der Technik zum Ersatz der FCKW-Kaeltemittel R11, R13, R503, R13B1, R113, R114 und R12B1 in bestehenden Kaelteanlagen dargestellt und erlaeutert. Der Bericht beinhaltet einen Ueberblick ueber die derzeitige Anwendung dieser Kaeltemittel in der BRD, die Vorstellung und Diskussion existierender Ersatzstoffe, die Darstellung und Bewertung der Forschung und Erfahrungen zu Umruestungen auf Ersatzstoffe, die Vorstellung der erforderlichen Infrastruktur und die Diskussion der technischen Durchfuehrbarkeit. Die Umstellung bestehender Anlagen auf Kaeltemittel mit geringerem Ozonabbaupotential wird abschliessend hinsichtlich der technischen Durchfuehrbarkeit, der Umweltrelevanz und der Wirtschaftlichkeit bewertet. (orig.)
Burnout and intensification of heat transfer in a four-red bundle in freon-12 and water flows
International Nuclear Information System (INIS)
Perepelitsa, N.I.; Pomet'ko, R.S.; Sapankevich, A.P.
1979-01-01
Results of experimental investigation of burnout and intensification of heat transfer in a four-rod bundle in freon-12 and water flows are presented. Experiments are carried out at mass rates of 1000-2500 kg/(m 2 xc), pressures of 6.86-12.74 MPa, coolant temperatures at the channel entry of 240-300 deg C for water and pressures of 1.06-2.46 MPa, temperatures of 20-65 deg C for freon. Pressure at the channel exit, coolant expense and temperature at the channel entry were kept constant during experiments. Burnout was attained by smooth increase of electric power and was fixed by indexes of thermal pairs placed in tubes. The comparison of experimental results for freon-12 and water showed that regularities of burnout arising and dependence of critical heat flux (critical power) on regime parameters are qualitatively similar. The experiments showed that dynamics of burnout development for bundles with standard lattices and with lattice-turbulators is essentially different. In the first case burnout starting was accompanied by sharp change of heat transfer surface temperature. In the second case under similar conditions surface temperature increased smoothly in strict correspondance with conducted power. Data evaluation coefficient of freon-12 burnout is specified to water
Method of separating radioactive krypton gas
International Nuclear Information System (INIS)
Kimura, Shigeru; Awada, Yoshihisa.
1975-01-01
Object: To effectively and safely separate and recover Kr-85, which requires a long storage period for attenuating radioactivity, from a mixture gas consisting of Kr-85 and Xe by a liquefaction distillation method. Structure: A mixture gas consisting of Kr and Xe is subjected to heat exchange in a cooler with Freon gas from a plurality of distillation towers for its temperature reduction from normal temperature to a lower temperature, and then it is supplied to a distillation tower. The distillation tower is held at a pressure above 15 ata, preferably around 20 ata, and a condenser provided at the top of the distillation tower is furnished with Freon as cooling medium. The rare mixture gas is distilled by liquefaction within a distillation tower, and Kr-85 is obtained from a top duct while obtaining Xe from a bottom duct. Xe after separation by liquefaction is returned to a rare mixture gas supply inlet of a liquefaction distillation means for repeated refinement in the distillation tower. (Kamimura, M.)
Tiscione, Nicholas B; Yeatman, Dustin Tate; Shan, Xiaoqin; Kahl, Joseph H
2013-10-01
Volatiles are frequently abused as inhalants. The methods used for identification are generally nonspecific if analyzed concurrently with ethanol or require an additional analytical procedure that employs mass spectrometry. A previously published technique utilizing a capillary flow technology splitter to simultaneously quantitate and confirm ethyl alcohol by flame ionization and mass spectrometric detection after headspace sampling and gas chromatographic separation was evaluated for the detection of inhalants. Methanol, isopropanol, acetone, acetaldehyde, toluene, methyl ethyl ketone, isoamyl alcohol, isobutyl alcohol, n-butyl alcohol, 1,1-difluoroethane, 1,1,1-trifluoroethane, 1,1,1,2-tetrafluoroethane (Norflurane, HFC-134a), chloroethane, trichlorofluoromethane (Freon®-11), dichlorodifluoromethane (Freon®-12), dichlorofluoromethane (Freon®-21), chlorodifluoromethane (Freon®-22) and 1,2-dichlorotetrafluoroethane (Freon®-114) were validated for qualitative identification by this method. The validation for qualitative identification included evaluation of matrix effects, sensitivity, carryover, specificity, repeatability and ruggedness/robustness.
Analysis and test of a breadboard cryogenic hydrogen/Freon heat exchanger
Desjardins, L. F.; Hooper, J.
1973-01-01
System studies required to verify a tube-in-tube cryogenic heat exchanger as optimum for the space shuttle mission are described. Design of the optimum configuration, which could be fabricated from commercially available hardware, is discussed. Finally, testing of the proposed configuration with supercritical hydrogen and Freon 21 is discussed and results are compared with thermal and dynamic analysis.
International Nuclear Information System (INIS)
Macbeth, R.V.; Wood, R.W.
1980-06-01
The use of a 'Freon' to model high-pressure boiling water has been employed successfully in a number of applications. A prerequisite in modelling is that a well tried and proven basis for the modelling exists. This is not entirely the situation with subcooled boiling however, since past work had tended to concentrate on bulk boiling conditions. Since many of the questions that arise in the design of subcooled boiling systems are concerned with two-phase flow structure, it was decided to place emphasis on attempting to match photographs of subcooled two-phase conditions in high-pressure water (at 55.2 and 82.7 bar) with those of Freon-12 at the corresponding pressures (8.13 and 12.75 bar). A special test-section was constructed giving visual access to a vapour forming region and to an unheated region into which vapour bubbles were drawn by the flow of subcooled liquid. The photographs obtained show that close similarity of two-phase flow structure exists in water and in Freon at corresponding conditions as determined by a previously established modelling procedure. (U.K.)
Radiation polymerization of tetrafluoroethylene in freon-22
International Nuclear Information System (INIS)
Schnautz, N.G.; Thompson, J.C.
1979-02-01
The radiation-induced solution-polymerization of tetrafluoroethylene in Freon-22 has been investigated over a temperature range of - 62 degrees celcius to 0 degrees celcius. The rate of polymerization for the in-source process was found to be directly propertional to monomer concentration and an activation energy of only 7,66 kj/mole was calculated. The number-average molecular mass of the product PTFE ranged from 2X10 4 to 6X10 4 and was relatively independent of the usual reaction parameters. The rate of postpolymerization was also found to be directly proportional to monomer concentration. The postpolyerization process did not result in any enchancement of the initial PTFE molecular mass [af
Burnout experiments in freon 12 using different types of orifices to simulate the core grids
International Nuclear Information System (INIS)
Ladeira, L.; Katsaounis, A.; Orlowski, R.; Fulfs, H.; Hofmann, K.
1978-01-01
This paper will report on burnout experiments carried out in freon 12 mainly at steady state and further at mass flow or power transient conditions with annular test sections axially uniformly heating either the inside or both the inside and outside rod. The runs are performed without orifice and using three different types of orifices simulating the reactor spacer grid. An important influence of the flow restriction on burnout position and value is measured. Furthermore, the comparison between the burnout correlations W2, W3, B and W2 and GE and experimental results from the literature using simple test section geometries in water and freon 12 demonstrate, that the accuracy is more or less comparable for both fluids. (orig.) [de
Transient heat transfer phenomena of the liquid metal layer cooled by overlying R113 coolant
International Nuclear Information System (INIS)
Cho, J. S.; Seo, K. R.; Jung, C. H.; Park, R. J.; Kim, S. B.
1999-01-01
To understand the fundamental relationship of the natural convection heat transfer in the molten metal pool and the boiling mechanism of the overlying coolant, experiments were performed for the transient heat transfer of the liquid metal pool with overlying R113 coolant with boiling. The simulant molten pool material is tin (Sn) with the melting temperature of 232 deg C. The metal pool is heated from the bottom surface and the coolant is injected onto the molten metal pool. Tests were conducted by changing the bottom surface boundary condition. The bottom heating condition was varied from 8kW to 14kW. As a result the boiling mechanism of the R113 coolant is changed from the nuclear boiling to film boiling. The Nusselt number and the Rayleigh number in the molten metal pool region obtained as functions of time. Analysis was made for the relationship between the heat flux and the temperature difference of the metal layer surface temperature and the boiling coolant bulk temperature
International Nuclear Information System (INIS)
Guo, Y.; Bullock, D.E.; Pioro, I.L.; Martin, J.
2006-01-01
An experimental program has been completed to study the behaviour of sheath wall temperatures in the Bruce Power Station Low Void Reactivity Fuel (shortened hereafter to Bruce LVRF) bundles under post-dryout (PDO) heat-transfer conditions. The experiment was conducted with an electrically heated simulator of a string of nine Bruce LVRF bundles, installed in the MR-3 Freon heat transfer loop at the Chalk River Laboratories (CRL), Atomic Energy of Canada Limited (AECL). The loop used Freon R-134a as a coolant to simulate typical flow conditions in CANDU R nuclear power stations. The simulator had an axially uniform heat flux profile. Two radial heat flux profiles were tested: a fresh Bruce LVRF profile and a fresh natural uranium (NU) profile. For a given set of flow conditions, the channel power was set above the critical power to achieve dryout, while heater-element wall temperatures were recorded at various overpower levels using sliding thermocouples. The maximum experimental overpower achieved was 64%. For the conditions tested, the results showed that initial dryout occurred at an inner-ring element at low flows and an outer-ring element facing internal subchannels at high flows. Dry-patches (regions of dryout) spread with increasing channel power; maximum wall temperatures were observed at the downstream end of the simulator, and immediately upstream of the mid-bundle spacer plane. In general, maximum wall temperatures were observed at the outer-ring elements facing the internal subchannels. The maximum water-equivalent temperature obtained in the test, at an overpower level of 64%, was significantly below the acceptable maximum temperature, indicating that the integrity of the Bruce LVRF will be maintained at PDO conditions. Therefore, the Bruce LVRF exhibits good PDO heat transfer performance. (authors)
Czech Academy of Sciences Publication Activity Database
Giel, Verena; Kredatusová, Jana; Trchová, Miroslava; Brus, Jiří; Žitka, Jan; Peter, Jakub
2016-01-01
Roč. 77, April (2016), s. 98-113 ISSN 0014-3057 R&D Projects: GA ČR(CZ) GPP106/12/P643 Institutional support: RVO:61389013 Keywords : gas separation * gas sorption * gas permeation Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.531, year: 2016
Disentangling α and β relaxation in orientationally disordered crystals with theory and experiments
Cui, Bingyu; Gebbia, Jonathan F.; Tamarit, Josep-Lluis; Zaccone, Alessio
2018-05-01
We use a microscopically motivated generalized Langevin equation (GLE) approach to link the vibrational density of states (VDOS) to the dielectric response of orientational glasses (OGs). The dielectric function calculated based on the GLE is compared with experimental data for the paradigmatic case of two OGs: freon-112 and freon-113, around and just above Tg. The memory function is related to the integral of the VDOS times a spectral coupling function γ (ωp) , which tells the degree of dynamical coupling between molecular degrees of freedom at different eigenfrequencies. The comparative analysis of the two freons reveals that the appearance of a secondary β relaxation in freon-112 is due to cooperative dynamical coupling in the regime of mesoscopic motions caused by stronger anharmonicity (absent in freon-113) and is associated with the comparatively lower boson peak in the VDOS. The proposed framework brings together all the key aspects of glassy physics (VDOS with the boson peak, dynamical heterogeneity, dissipation, and anharmonicity) into a single model.
Cardiotoxicity of Freon among refrigeration services workers: comparative cross-sectional study
2009-01-01
Background Freon includes a number of gaseous, colorless chlorofluorocarbons. Although freon is generally considered to be a fluorocarbon of relatively low toxicity; significantly detrimental effects may occur upon over exposure. The purpose of the present study is to investigate whether occupational exposure to fluorocarbons can induce arterial hypertension, myocardial ischemia, cardiac arrhythmias, elevated levels of plasma lipids and renal dysfunction. Methods This comparative cross-sectional study was conducted at the cardiology clinic of the Suez Canal Authority Hospital (Egypt). The study included 23 apparently healthy male workers at the refrigeration services workshop who were exposed to fluorocarbons (FC 12 and FC 22) and 23 likewise apparently healthy male workers (unexposed), the control group. All the participants were interviewed using a pre-composed questionnaire and were subjected to a clinical examination and relevant laboratory investigations. Results There were no significant statistical differences between the groups studied regarding symptoms suggesting arterial hypertension and renal affection, although a significantly higher percentage of the studied refrigeration services workers had symptoms of arrhythmias. None of the workers had symptoms suggesting coronary artery disease. Clinical examination revealed that the refrigeration services workers had a significantly higher mean pulse rate compared to the controls, though no significant statistical differences were found in arterial blood pressure measurements between the two study groups. Exercise stress testing of the workers studied revealed normal heart reaction to the increased need for oxygen, while sinus tachycardia was detected in all the participants. The results of Holter monitoring revealed significant differences within subject and group regarding the number of abnormal beats detected throughout the day of monitoring (p < 0.001). There were no significant differences detected in the
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-03-01
An investigational study was made of the quantity of the specified freon remaining in the construction use heat insulating material, the rational method for the recovery/treatment, etc. As to the standardization of the method to analyze the remaining freon quantity, the tube furnace - GC method and the MS method were proposed, and the basic items that can be developed to JIS (Japanese Industrial Standard) were standardized. In the estimation of the remaining freon quantity, the actual state of the use of heat insulating materials was surveyed from the statistics on the start of construction work, survey of the heat insulating area in actual buildings and listening to heat insulation workers/cold store construction companies, etc. Further, the remaining quantity was analyzed of samples collected from various buildings nationwide and by years of completion. As a result, it was found out that, even in samples before 1995, HCFC is used in about 10% and that, in case of limiting to the specified freon (CFC), the freon remaining quantity was more than 1-4 wt% even after a lapse of 30 years. The paper arranged subjects on the freon recovery/treatment in each stage of the life cycle and the required conditions for technology/equipment. (NEDO)
Genovese, Alessandro; Piombino, Paola; Lisanti, Maria Tiziana; Moio, Luigi
2005-06-01
Gas Chromatography-Mass Spectrometry (GC-MS) analysis by Selective Ion Monitoring (SIM) was applied to quantify 4-Hydroxy-2,5-dimethyl-3(2H)-furanone (HDMF) in both red and white wines obtained from some Italian cultivar of Vitis vinifera. Wines were extracted by liquid-liquid extraction performed with 1,1,2-trichlorotrifluoroethane (Freon 113). The ion m/z 128 was used for quantification while the ion m/z 129 as qualifier. Precision, linearity and accuracy of the method resulted satisfactory. Results showed a significant variation in the concentration of furaneol in wine with grape variety. Generally, HDMF concentrations in white wines were lower than in red wines. Among white wines, Chardonnay resulted characterized by the highest concentration of HDMF. Among red wines the highest concentrations of HDMF were detected in Primitivo and Refosco varieties.
Characterization of flow regimes in the post-dryout region
International Nuclear Information System (INIS)
Obot, N.T.; Ishii, M.
1988-01-01
A visual study of film boiling using photographic and high speed motion-picture methods was carried out to determine the flow regime transition criteria in the post-CHF region. An idealized inverted annular flow was obtained by introducing a liquid jet of Freon 113 through a nozzle, precisely centered with respect to the internal diameter of the test section, with an annual gas flow. The respective ranges for liquid and gas exit velocities were 0.05-0.5 and 0.03-8.2 m/s. Nitrogen and helium were used in the study
International Nuclear Information System (INIS)
Stevens, G.F.; Wood, R.W.
1966-01-01
Previous experiments on the Winfrith Freon Rig have produced scaling factors which relate these Freon experiments to the corresponding experiments in water with an accuracy of about 10%. It has also been found that the Freon rig is accurate, economical and easy to use. The scaling factors so obtained have now been tested against data for 19-rod clusters which had previously been tested at Columbia University. This report presents the results of the rod cluster tests in which comparison is made between Freon-12 and water for three test-sections which differ in the means of spacing the individual rods. All the test-sections were heated uniformly with respect to length, but had a radial flux depression of nominally 0.70/1.0. The results provide strong evidence that the scaling factor method using Freon-12 at 155 lb/in 2 (abs) is a useful technique for predicting the behaviour at burn-out of complicated test-sections cooled by boiling water at 1000 lb/in 2 with only one-eighteenth of the power required for the water experiment. In particular, the Freon tests reproduce closely the relative burn-out powers previously measured in water. It has also been found that repeated rebuilding of a nominally unchanged cluster from the same components can produce burn-out powers differing by ± 6%. This new result illustrates the power and value of the Freon technique. (author)
Results of two-phase natural circulation in hot-leg U-bend simulation experiments
International Nuclear Information System (INIS)
Ishii, M.; Lee, S.Y.; Abou El-Seoud, S.
1987-01-01
In order to study the two-phase natural circulation and flow termination during a small break loss of coolant accident in LWR, simulation experiments have been performed using two different thermal-hydraulic loops. The main focus of the experiment was the two-phase flow behavior in the hot-leg U-bend typical of BandW LWR systems. The first group of experiments was carried out in the nitrogen gas-water adiabatic simulation loop and the second in the Freon 113 boiling and condensation loop. Both of the loops have been designed as a flow visualization facility and built according to the two-phase flow scaling criteria developed under this program. The nitrogen gas-water system has been used to isolate key hydrodynamic phenomena such as the phase distribution, relative velocity between phases, two-phase flow regimes and flow termination mechanisms, whereas the Freon loop has been used to study the effect of fluid properties, phase changes and coupling between hydrodynamic and heat transfer phenomena. Significantly different behaviors have been observed due to the non-equilibrium phase change phenomena such as the flashing and condensation in the Freon loop. The phenomena created much more unstable hydrodynamic conditions which lead to cyclic or oscillatory flow behaviors
Current gas storage R and D programmes at Gas Research Institute
International Nuclear Information System (INIS)
Shikari, Y.A.
1990-01-01
The Gas Research Institute (GRI) is currently involved in the development of concepts aimed at an enhancement of natural gas service to the consumer. In order to maintain the attractiveness of the gas options to industrial consumers and to reinforce the ''value-in-use'' of natural gas to residential as well as commercial customers, it is essential to develop efficient, economical, and safe means of reducing the ''cost-of-service'', including that of natural gas storage in underground formations. Specifically, research and development (R and D) is needed to explore ways to better utilize existing storage fields and also to develop new storage facilities at minimum cost. GRI is currently sponsoring research projects aimed at controlling gas migration in underground gas storage reservoirs, reducing base (or cushion) gas requirements, understanding the gas-gas phase mixing behaviour via laboratory experiments and reservoir models, developing cost-effective gas separation processes using membranes, and optimizing the operation and maintenance (O and M) costs of underground gas storage operations. This paper provides an overview of the GRI's Gas Storage R and D Programme and highlights key results achieved to date for selected research projects. (author). 16 refs, 6 figs, 3 tabs
Sorption of Trace-Level Organics by ABS, FEP, FRE and FRP Well Casings
1994-06-01
and there did not appear to be any controls that free energy of their surface by adsorption . Silica losses could be compared with. Because they were...Proceedings of Second Canadian/Ameri- Dekker, Inc. can Conference on Hydrogeology, Hazardous Wastes Jones, J.N. and G.D. Miller (1988) Adsorption of...Freon® 12 A’ A2 A A2 B’ B Freon® 22 - A A A A A Freon® 113 - A A B - - Freon* TF - A A B A A Fuel Oils D A’ B A2 A A Furfural D A’ A D A B Gallic
Directory of Open Access Journals (Sweden)
Pavlenko Aleksandr
2017-01-01
Full Text Available Results of experimental studies of heat-and-mass transfer and hydrodynamic processes at distillation on a regular packing are presented. The mixture of freons R114–R21 at the pressure of 0.3 MPa was used as a working mixture. The mixture was separated on the Mellapak 350Y structured packing with the diameter of 0.9 m under the conditions of complete reflux (L/V = 1 at different packing heights. A specially designed liquid distributor with a possibility to change the density and pattern of drip points was used to irrigate the packing. The experimental data on the efficiency of mixture separation (height of transfer unit HTU and distribution of the local flow rate density over the column cross-section were compared. It is shown that an increase in the height of the structured packing from 2.1 m to 4.0 m leads to a significant decrease in the efficiency of mixture separation in the distillation column.
S113R mutation in SLC33A1 leads to neurodegeneration and augmented BMP signaling in a mouse model
Directory of Open Access Journals (Sweden)
Pingting Liu
2017-01-01
Full Text Available The S113R mutation (c.339T>G (MIM #603690.0001 in SLC33A1 (MIM #603690, an ER membrane acetyl-CoA transporter, has been previously identified in individuals with hereditary spastic paraplegia type 42 (SPG42; MIM #612539. SLC33A1 has also been shown to inhibit the bone morphogenetic protein (BMP signaling pathway in zebrafish. To better understand the function of SLC33A1, we generated and characterized Slc33a1S113R knock-in mice. Homozygous Slc33a1S113R mutant mice were embryonic lethal, whereas heterozygous Slc33a1 mutant mice (Slc33a1wt/mut exhibited behavioral abnormalities and central neurodegeneration, which is consistent with hereditary spastic paraplegia (HSP phenotypes. Importantly, we found an upregulation of BMP signaling in the nervous system and mouse embryonic fibroblasts of Slc33a1wt/mut mice. Using a sciatic nerve crush injury model in vivo and dorsal root ganglion (DRG culture in vitro we showed that injury-induced axonal regeneration in Slc33a1wt/mut mice was accelerated and mediated by upregulated BMP signaling. Exogenous addition of BMP signaling antagonist, noggin, could efficiently alleviate the accelerated injury-induced axonal regrowth. These results indicate that SLC33A1 can negatively regulate BMP signaling in mice, further supporting the notion that upregulation of BMP signaling is a common mechanism of a subset of hereditary spastic paraplegias.
Energy Technology Data Exchange (ETDEWEB)
Gudz, A.
1975-05-01
Natural gas from the Shatlyk gas field in the Kara Kum Desert, Turkmenia, U.S.S.R., will soon be available to the European section of the U.S.S.R. with the recent completion of the 291-mi Shatlyk-Khiva gas pipeline and the completion of all associated production units by the end of the year. The gas field, with explored reserves of (1.5 trillion m/sup 3/), is expected to be producing (100 million m/sup 3//day) at the end of 1975. Diagonal profiling was used in the exploration stage to reduce the number of boreholes required from 16 to 11, saving about $6.7 million (5 million rubles) and cutting the exploration time by almost 2 y. Most of the boreholes, drilled within the contour of the gas-bearing structure, can be used for gas production. The gas, produced at 2352 psi and 205/sup 0/F, is cooled to 113/sup 0/F, stripped of condensate and moisture, metered, and treated before transmission.
Entrainment in vertical annular two-phase flow
International Nuclear Information System (INIS)
Sawant, Pravin; Ishii, Mamoru; Mori, Michitsugu
2009-01-01
Prediction of amount of entrained droplets or entrainment fraction in annular two-phase flow is essential for the estimation of dryout condition and analysis of post dryout heat transfer in light water nuclear reactors and steam boilers. In this study, air-water and organic fluid (Freon-113) annular flow entrainment experiments have been carried out in 9.4 and 10.2 mm diameter test sections, respectively. Both the experiments covered three distinct pressure conditions and wide range of liquid and gas flow conditions. The organic fluid experiments simulated high pressure steam-water annular flow conditions. In each of the experiments, measurements of entrainment fraction, droplet entrainment rate and droplet deposition rate have been performed by using a liquid film extraction method. A simple, explicit and non-dimensional correlation developed by Sawant et al. (2008a) for the prediction of entrainment fraction is further improved in this study in order to account for the existence of critical gas and liquid flow rates below which no entrainment is possible. Additionally, a new correlation is proposed for the estimation of minimum liquid film flow rate at the maximum entrainment fraction condition. The improved correlation successfully predicted the newly collected air-water and Freon-113 entrainment fraction data. Furthermore, the correlations satisfactorily compared with the air-water, helium-water and air-genklene experimental data measured by Willetts (1987). (author)
International Nuclear Information System (INIS)
2011-01-01
This addendum to the Closure Report for Corrective Action Unit 113: Area 25, Reactor Maintenance, Assembly, and Disassembly Facility, Building 3110, Nevada Test Site, Nevada, DOE/NV--891-VOL I-Rev. 1, dated July 2003, provides details of demolition, waste disposal, and use restriction (UR) modification for Corrective Action Unit 113, Area 25 R-MAD Facility. Demolition was completed on July 15, 2010, when the last of the building debris was disposed. Final field activities were concluded on August 30, 2010, after all equipment was demobilized and UR signs were posted. This work was funded by the American Recovery and Reinvestment Act.
Simulation experiments for hot-leg U-bend two-phase flow phenomena
International Nuclear Information System (INIS)
Ishii, M.; Hsu, J.T.; Tucholke, D.; Lambert, G.; Kataoka, I.
1986-01-01
In order to study the two-phase natural circulation and flow termination during a small break loss of coolant accident in LWR, simulation experiments have been performed. Based on the two-phase flow scaling criteria developed under this program, an adiabatic hot leg U-bend simulation loop using nitrogen gas and water and a Freon 113 boiling and condensation loop were built. The nitrogen-water system has been used to isolate key hydrodynamic phenomena from heat transfer problems, whereas the Freon loop has been used to study the effect of phase changes and fluid properties. Various tests were carried out to establish the basic mechanism of the flow termination and reestablishment as well as to obtain essential information on scale effects of parameters such as the loop frictional resistance, thermal center, U-bend curvature and inlet geometry. In addition to the above experimental study, a preliminary modeling study has been carried out for two-phase flow in a large vertical pipe at relatively low gas fluxes typical of natural circulation conditions
International Nuclear Information System (INIS)
Katsaounis, A.; Orlowski, R.; Fulfs, H.; Hofmann, K.; Ladeira, L.C.D.
1978-06-01
This paper will report on burnout experiments carried out in freon 12 mainly at steady state and further at mass flow or power transient conditions with annular test sections axially uniformly heating either the inside or both the inside and outside rod. The runs are performed without orifice and using three different types of orifices simulating the reactor spacer grid. An important influence of the flow restriction on burnout position and value is measured. Furthermore, the comparison between the burnout correlations W2, W3, BandW2 and GE and experimental results from the literature using simple test section geometries in water and freon 12 demonstrate, that the accuracy is more or less comparable for both fluids
Burnout in a high heat-flux boiling system with an impinging jet
International Nuclear Information System (INIS)
Monde, M.; Katto, Y.
1978-01-01
An experimental study has been made on the fully-developed nucleate boiling at atmospheric pressure in a simple forced-convection boiling system, which consists of a heated flat surface and a small, high-speed jet of water or of freon-113 impinging on the heated surface. A generalized correlation for burnout heat flux data, that is applied to either water or freon-113 is successfully evolved, and it is shown that surface tension has an important role for the onset of burnout phenomenon, not only in the ordinary pool boiling, but also in the present boiling system with a forced flow. (author)
Visualization of nucleate pool boiling of freon 113
International Nuclear Information System (INIS)
Afify, M.A.; Fruman, D.H.
1987-01-01
The purpose of this investigation is to give a fine description of the behaviour of vapour bubbles in nucleate pool boiling at sites of known sizes using high speed photography. The shapes and growth history of isolated bubbles were determined for a variety of experimental conditions. Coalescence effects between two adjacent or consecutive bubbles were also visualized and the occurrence of vapour patches and continuous vapour columns was demonstrated. Quantitative analysis of the films allows to determine the history and nucleation characteristics of bubbles as a function of various parameters such as heat flux, liquid subcooling and size and nature of nucleation sites. These results are in good agreement with those found in the literature
International Nuclear Information System (INIS)
Stevens, G.F.; Kirby, G.J.
1964-07-01
An earlier report presented the results of an experimental investigation into forced convection burn-out in Freon 12 (Arcton 12) at 155 lb/in 2 (abs) flowing vertically upwards in uniformly heated round tubes. This work was carried out as part of a programme devised to explore the possibility of developing model techniques for studies of two-phase flow and burn-out in high pressure water. The Freon 12 burn-out data was shown to exhibit qualitative similarity with data for water at 1000 Ib/in 2 , and to bring to light a number of details previously concealed by experimental scatter and inadequate coverage. The object of this paper is to present the results of a quantitative comparison of the Freon 12 data and the available water data, and to discuss the implications of this on the possibility of developing model techniques in the study of burn-out. (author)
Monta, William J.
1992-01-01
A pitot-rake survey of the simulated exhaust of a half-span scramjet nozzle model was conducted in the Langley 20-Inch Mach 6 Tunnel to provide an additional data set for computational fluid dynamics (CFD) code comparisons. A wind-tunnel model was tested with a 26-tube pitot rake that could be manually positioned along the mid-semispan plane of the model. The model configuration had an external expansion surface of 20 degrees and an internal cowl expansion of 12 degrees; tests were also performed with a flow fence. Tests were conducted at a free-stream Reynolds number of approximately 6.5 x 10(exp 6) per foot and a model angle of attack of -0.75 degrees. The two exhaust gas mediums that were tested were air and a Freon 12-argon mixture. Each medium was tested at two jet total pressures at approximately 28 and 14 psia. This document presents the flow-field survey results in graphical as well as tabular form, and several observations concerning the results are discussed. The surveys reveal the major expected flow-field characteristics for each test configuration. For a 50-percent freon 12 and 50-percent argon mixture by volume (Fr-Ar), the exhaust jet pressures were slightly higher than those for air. The addition of a flow fence slightly raised the pitot pressure for the Fr-Ar mixture, but it produced little change for air. For the Fr-Ar exhaust, the plume was larger and the region between the shock wave and plume was smaller.
Genovese, Alessandro; Dimaggio, Rosa; Lisanti, Maria Tiziana; Piombino, Paola; Moio, Luigi
2005-06-01
One hundred and one volatile compounds, reported in literature as powerful odorants of wine, were quantified by Gas Chromatography-Selective Ion Monitoring/Mass Spectrometry (GC-SIM/MS) in Primitivo, Aglianico, Merlot and Cabernet Sauvignon red wines. Wine samples were extracted by 3 different extraction methods: 1) separation of the alcoholic fraction from the aqueous phase by salting-out and subsequent extraction by liquid-liquid micro-extraction with 1,1,2-trichlorotrifluoroethane (Freon 113); 2) extraction by liquid-liquid micro-extraction with dichloromethane; 3) solid phase extraction (SPE cartridge: 800 mg of LiChrolut EN resin) with pentane-dichloromethane (20:1) and dichloromethane. The selection of the ion fragments used for quantification was directly performed on a red wine sample. For each compound the area of the corresponding peak was normalized respect to the peak of the internal standard and then interpolated in a calibration curve obtained analysing a model wine solution (water, ethanol, tartaric acid and known amounts of analytes and of internal standard). The methods showed a good linearity: r2>0.990, except for farnesol (isomer a and c), octanal, decanal, furaneol and phenylacetic acid with 0.966 furaneol and sotolon. The Aglianico wines were characterised by the major fermentation compounds (esters, fatty acids and 2-phenylethanol), beta-damascenone, beta-ionone and linalool. The Primitivo wines were characterized by furaneol, methoxypyrazine, gamma-nonalactone and acetaldehyde, while Cabernet Sauvignon and Merlot wines principally by cask derivates (vanillin, (Z) 3-methyl-gamma-octalactone [(Z) wiskylactone], maltol and eugenol), some aldehydes and 3-isopropyl-2-methoxypyrazine.
International Nuclear Information System (INIS)
Li Xiaoming; Feng Quanke; Bi Qincheng; Chen Tingkuan; Du Shejiao
2004-01-01
The void fraction at different heights in the annular channel of moderator cell mockup was measured with a differential pressure transducer. The tests proved that the ratio of surface tension to density of liquid phase is the main factor that determines the physical properties on void fraction. The larger the ratio, the smaller the void fraction. The ratio of surface tension to density of Freon 113 is lower than that of liquid hydrogen. Therefore, Freon 113 can be used as working fluid to study the void fraction in the hydrogen two-phase thermo-siphon loop in the cold neutron source (CNS) of China Advanced Research Reactor (CARR), and the results are conservative
Reducing Organic Contamination in NASA JSC Astromaterial Curation Facility
Calaway, M. J.; Allen, C. C.; Allton, J. H.
2013-01-01
Future robotic and human spaceflight missions to the Moon, Mars, asteroids and comets will require handling and storing astromaterial samples with minimal inorganic and organic contamination to preserve the scientific integrity of each sample. Much was learned from the rigorous attempts to minimize and monitor organic contamination during Apollo, but it was not adequate for current analytical requirements; thus [1]. OSIRIS-REx, Hayabusa-2, and future Mars sample return will require better protocols for reducing organic contamination. Future isolation con-tainment systems for astromaterials, possibly nitrogen enriched gloveboxes, must be able to reduce organic and inorganic cross-contamination. In 2012, a baseline study established the current state of organic cleanliness in gloveboxes used by NASA JSC astromaterials curation labs that could be used as a benchmark for future mission designs [2, 3]. After standard ultra-pure water (UPW) cleaning, the majority of organic contaminates found were hydrocarbons, plasticizers, silicones, and solvents. Hydro-carbons loads (> C7) ranged from 1.9 to 11.8 ng/cm2 for TD-GC-MS wafer exposure analyses and 5.0 to 19.5 ng/L for TD-GC-MS adsorbent tube exposure. Plasticizers included peracetic acid sterilization were used in the atmospheric de-contamination (R) cabinets. Later, Lunar curation gloveboxes were degreased with a pressurized Freon 113 wash. Today, UPW has replaced Freon as the standard cleaning procedure, but does not have the degreasing solvency power of Freon. Future Cleaning Studies: Cleaning experiments are cur-rently being orchestrated to study how to degrease and reduce organics in a JSC curation glovebox lower than the established baseline. Several new chemicals in the industry have replaced traditional degreasing solvents such as Freon and others that are now federally restricted. However, these new suites of chemicals remain untested for lowering organics in curation gloveboxes. 3M's HFE-7100DL and Du
Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.
A TED study of Si(113) surfaces was carried out. Reflections from the 3 × 2 reconstruction were seen at room temperature, while half-order reflections were very faint. The surface showed the phase transition between the 3 × 1 and the disordered (rough) structures at about 930°C. The (113) surface structure at room temperature was analyzed using TED intensity. Four kinds of structure models proposed previously, including both the 3 × 1 and the 3 × 2 reconstructed structures, were examined. The R-factors calculated using the energy-optimized atomic coordinates are not sufficiently small. After minimization of the R-factors, Dabrowski's 3 × 2 structure model is most agreeable, while Ranke's 3 × 1 and 3 × 2 structure models are not to be excluded. STM observation showed that the surface is composed of small domains of the 3 × 2 structure.
International Nuclear Information System (INIS)
Sutherland, R.J.
1992-01-01
The natural gas industry has proposed an increase in the DOE gas R ampersand D budget from about $100 million to about $250 million per year for each of the next 10 years. The proposal includes four programs: natural gas supplies, fuel cells, natural gas vehicles and stationary combustion systems. This paper is a qualitative assessment of the gas industry proposal and recommends a natural gas R ampersand D strategy for the DOE. The methodology is a conceptual framework based on an analysis of market failures and the energy policy objectives of the DOE's (1991) National Energy Strategy. This framework would assist the DOE in constructing an R ampersand D portfolio that achieves energy policy objectives. The natural gas supply program is recommended to the extent that it contributes to energy price stability. Stationary combustion programs are supported on grounds of economic efficiency and environmental quality. The fuel cell program is supported on grounds of environmental quality. The natural gas vehicle program may potentially contribute to environmental quality and energy price stability. The R ampersand D programs in natural gas vehicles and in fuel cells should be complemented with policies that encourage the commercialization and use of the technology, not merely its development
Rotary mode core sampling approved checklist: 241-TX-113
International Nuclear Information System (INIS)
Fowler, K.D.
1998-01-01
The safety assessment for rotary mode core sampling was developed using certain bounding assumptions, however, those assumptions were not verified for each of the existing or potential flammable gas tanks. Therefore, a Flammable Gas/Rotary Mode Core Sampling Approved Checklist has been completed for tank 241-TX-113 prior to sampling operations. This transmittal documents the dispositions of the checklist items from the safety assessment
Quality control of the 113Sn-113mIn generator
International Nuclear Information System (INIS)
Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.
1989-01-01
Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia
Strategies for fundamental and exploratory R&D in natural gas extraction
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
Natural gas is being increasingly viewed as a key US energy source. While gas supplies are sufficient today, there is concern as to whether sufficient supplies of affordably priced natural gas exist to support its expanded use as an environmentally clean substitute for oil, coal or other fuels. One important strategy for expanding the volumes of affordable gas supplies is to undertake fundamental and exploratory research in gas development, production, and processing. The R&D opportunities have been grouped according to the traditional phases of gas development and use, as follows: Extraction and Development Research Efficient development of gas resources will require detailed reservoir diagnosis, more efficient well drilling and improved well stimulation. Advanced diagnostic tools, more powerful reservoir models, and improved development technologies would enable otherwise submarginal gas resources to become economically recoverable. Production and Processing Research: The primary opportunities in gas production and processing are in new technologies for the identification and separation of low quality gas and for the restimulation and production of abandoned gas fields. This paper examines, in more detail, specific high priority R&D topics for the DOE/FE AE&PT program.
International Nuclear Information System (INIS)
Nickerson, J.R.
1982-05-01
A 6-m, 37-element, electrically heated bundle with full end plate simulation, cooled by Freon-12, has been tested for CHF (critical heat flux) and post-CHF conditions in the MR-3 Freon loop. The bundle was tested in a horizontal attitude and had a uniform axial heat flux distribution and radial heat flux depression. A total of 110 CHF points have been collected over the following range of water equivalent conditions: exit pressure 8.27 - 11.03 MPa, mass flux 1.38 - 8.14 Mg.m -2 .s -1 , inlet subcooling 0 - 500 kJ.kg -1 , outlet quality 10% - 37%. The data have been correlated on both a systems and local conditions basis over a limited mass flux range to within 2.8% rms. Significant CHF increases over smooth bundle results have been observed along with significant CHF improvement over a two end plate bundle simulation in the lower mass flux ranges. A satisfactory axial drypatch spreading correlation has been determined and extensive drypatch wall superheat mapping has been performed
Freon Fra Fjernvarmerør – En Overset Risiko For Indeklima Og Grundvand?
DEFF Research Database (Denmark)
Kjeldsen, Peter; Mogensen, Susanne B.; Langeland, Majbrith
2011-01-01
Isoleringsskum i fjernvarmerør er fremstillet med brug af fluorerede og klorerede flygtige stoffer (CFC-11 og 1,1,1-TCA), som langsomt frigives til jorden under brug. Den videre skæbne for de flygtige stoffer efter at de frigives til jorden er ukendt, men fordampning til atmosfæren, nedbrydning, og...... at man også bør interessere sig for risikoen for påvirkning af indeklimaet i nærliggende bygninger, specielt i områder hvor 1,1,1-TCA har været benyttet. Det konkluderes at problemet bør belyses yderligere bl.a. ved måling af tilstedeværelse af 1,1,1-TCA, CFC-11, samt potentielle nedbrydningsprodukter i...
Charef, Adil; Feddaoui, M'barek; Najim, Monssif; Meftah, Hicham
2018-04-01
A computational study of the liquid film condensation from vapour-gas mixtures of HFC refrigerants inside a vertical tube is performed. The external wall of the tube is subjected to constant temperature. The model uses an implicit finite difference method to solve the governing equations for the liquid film and gas flow together including the boundary and interfacial matching conditions. Parametric computations were realised to examine the effects of inlet Reynolds number, tube length, and inlet temperature of the gas mixtures on the condensation mechanism. A comparative study between the results obtained for studied R152 a and R134 a with presence of non-condensable gas is made. The predicted results indicate that the condensation of R152 a-air corresponds to a higher accumulated condensation m c d and local heat transfer coefficient h T when compared to R134 a-air in the same conditions. Increasing the inlet Reynolds number or the tube length improve the condensation. Additionally, lower non-condensable gas in R152 a - a i r substantially enhances the heat and mass exchanges.
Sakaue, H; Takahashi, T; Teramoto, Y
2002-01-01
Non-freon gas mixtures (Ar/iso-C sub 4 H sub 1 sub 0) were tested as the chamber gas for 1 and 2 mm gas gap Resistive Plate Chambers (RPCs) with float glass as the resistive electrodes, operated in the streamer mode. With the narrower (1 mm) gas gap, streamer charge is reduced (approx 1/3), which reduces the dead time (and dead area), associated with each streamer, improving the detection efficiency. The best performance was obtained for two cases: Ar/iso-C sub 4 H sub 1 sub 0 =50/50 and 60/40. For the 50/50 mixture, a detection efficiency of better than 98% was obtained for the 1 mm gap RPC, while the efficiency was 95% for the 2 mm gap RPC, each operated as a double-gap RPC. The measured time resolution (rms) was 1.45+-0.05 (2.52+-0.09) ns for the 1 (2) mm gap RPC for the 50/50 mixture.
Directory of Open Access Journals (Sweden)
Balev Dessislav Kostadinov
2017-03-01
Full Text Available Ground spices are a source of hazards for dry-fermented meat products. Since dry-cured sausages are not subjected to heat treatment, there is a high risk of microbial cross-contamination and physical impurities. The aim of this study was to determine effects of the replacement of 3 g/kg of ground black pepper (Piper nigrum L., and cumin (Cuminum cyminum with their aliquots of new freon extracts, and compare them with the effect of 0.2 g/kg antioxidant addition (taxifolin extract from Siberian larch (Larix sibirica Ledeb, rosemary (Rosmarinus officinalis L. extract, and butylated hydroxytoluene on sensory properties, color stability, proximate composition, free amino nitrogen and pH of Bulgarian-type dry-cured „Sudjuk“ sausages. The replacement of natural ground spices with aliquots of their extracts improved sensory properties and stabilized the color characteristics of the final product during 30 days of storage at 0–4°C. The addition of 0.2 g/kg rosemary extract was as effective as the addition of freon extracts on the overall assessment to the 14th day of the experiment. It was determined that the addition of antioxidants or spice extracts had no significant effect on proximate composition, pH, and free amino nitrogen accumulation of the “Sudjuk”. The addition of 0.2 g/kg, taxifolin or rosemary extracts and butylated hydroxytoluene was not so efficient in improving the sensory properties and color stabilization in comparison to the new freon spice extracts. The examined spice extracts can be successfully used to improve the quality of “Sudjuk” sausages.
Energy Technology Data Exchange (ETDEWEB)
Rasmussen, Niels Bjarne
2010-05-15
Danish Gas Technology Centre has been carrying out a feasibility project to clarify the possibilities of installing gas expanders at M/R-stations (Measuring and Regulating) in the Distribution system of the natural gas grid. A large number of such expanders are installed around the world. The novelty of this project is to use a heat pump to perform the necessary heating of the gas before the expander, and to ''export'' to the electricity grid the remaining electricity from the generator connected to the expander. The present project includes the small M/R-stations at the gas Distribution grid where pressure is reduced from 40 or 20 bar to 4 bar. The preliminary project (year 1 of project) has investigated whether components for such smaller systems can be found, and it has investigated prices for different quantities. A technical feasibility study has been done. Also, preliminary calculations of payback times has been carried out. A large potential of CO{sub 2}-reduction is present with this technology based on saving of natural gas combustion and on new electricity production displacing existing production without any use of primary energy. The main results and conclusions are: 1) There are component suppliers for expander systems suitable to the size of distribution network M/R stations. 2) Pressure regulators provided at the stations are laid out with significant overcapacity, enabling a simplified installation of the expander systems. 3) If the system is being rolled out across the Danish distribution grid, the realistic saving potential is approx. 2.3 million Nm3 of gas per year and a production of almost 40 million kWh of electricity. 4) If the price is 0.60 DKK/kWh for electricity sold, the simple pay-back is 6-7 years on average, covering a variation from 3 to 16 years at the various stations. The smallest stations are omitted. The best stations covering more than half of the gas flow have a pay-back time between 3 and 6 years. 5) The
Reactivity of solvent alcohol on degradation of CFC113
International Nuclear Information System (INIS)
Nakagawa, Seiko
2003-01-01
1,1,2-Trichloro-trifluoroethane (CFC113) was dissolved in alkaline 1-butanol, 2-butanol, iso-butyl alcohol, and phenyl ethyl alcohol and irradiated with 60 Co gamma rays after purged with pure nitrogen gas. In all these solvents, the concentration of CFC113 and hydroxide ion decreased and that of chloride ion increased with a dose observed in 2-propanol solution. The reaction efficiency increases in order of 1-butanol< iso-butyl alcohol< phenyl ethyl alcohol<2-butanol<2-propanol. The solvent effect will depend on the binding energy of the αC-H of the alcohol molecule and electron affinity and dipole moment of the ketones or aldehydes produced from the alcohols
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
The R and D were carried out aiming at developing a device which removes/recovers freon substitutes and organic solvents discharged from semiconductor/pharmaceutical plans, using zeolite excellent in adsorption performance. In the R and D of high-functional zeolite, the design of materials is conducted by computer simulation, and effectiveness of the simulation was shown. In the development of zeolite honeycombs, the following were conducted: installation of honeycomb-form device, study of formation conditions, and fabrication of samples for adsorption/desorption tests. Moreover, the R and D were made on heater-monolithic zeolite, surface treatment of zeolite honeycomb, catalyst support, analysis, adsorption/desorption evaluation, micro-porous material cross-linking among clay layers, etc. As to the adsorption unit, the shape was so studied/designed that the gas containing NMP can efficiently keep in touch with zeolite honeycomb. Concerning the design of switching removal/recovery device, conducted were the design of a system which can be controlled at low cost, the development of adsorption/desorption operated software, etc. (NEDO)
On the volatility of nihonium (Nh, Z = 113)
Energy Technology Data Exchange (ETDEWEB)
Aksenov, Nikolay V.; Steinegger, Patrick; Abdullin, Farid Sh.; Albin, Yury V.; Chepigin, Viktor I.; Lebedev, Vyacheslav Ya.; Madumarov, Alexander Sh.; Malyshev, Oleg N.; Petrushkin, Oleg V.; Polyakov, Alexander N.; Popov, Yury A.; Sabel' nikov, Alexey V.; Sagaidak, Roman N.; Shirokovsky, Igor V.; Shumeiko, Maksim V.; Starodub, Gennadii Ya.; Tsyganov, Yury S.; Utyonkov, Vladimir K.; Voinov, Alexey A.; Vostokin, Grigory K.; Yeremin, Alexander V.; Dmitriev, Sergey N. [Flerov Laboratory of Nuclear Reactions, Joint Institute for Nuclear Research, Dubna (Russian Federation); Bozhikov, Gospodin A. [Flerov Laboratory of Nuclear Reactions, Joint Institute for Nuclear Research, Dubna (Russian Federation); Institute for Advanced Physical Studies, Sofia (Bulgaria); Eichler, Robert [Laboratory of Radiochemistry, Paul Scherrer Institute, Villigen PSI (Switzerland); Departement fuer Chemie und Biochemie, Universitaet Bern, Bern (Switzerland)
2017-07-15
Gas-phase chromatography studies of nihonium (Nh, Z = 113) were carried out at the one-atom-at-a-time level. For the production of nihonium, the heavy-ion-induced nuclear fusion reaction of {sup 48}Ca with {sup 243}Am was used. This leads to isotopes {sup 284,285}Nh, as the direct descendants of the α-decaying precursors {sup 288,289}Mc. Combining the Dubna Gas-Filled Recoil Separator with gas-phase chromatographic separation, the experiment was sensitive to elemental nihonium and its adsorption behavior on Teflon, theoretically predicted by modern relativistic density functional theory. The non-observation of any decays of Nh after the chemical separation indicates a larger than expected retention of elemental Nh on a Teflon surface. (orig.)
Experimental and theoretical study on forced convection film boiling heat transfer
International Nuclear Information System (INIS)
Liu, Qiusheng
2001-01-01
Theoretical solutions of forced convection film boiling heat transfer from horizontal cylinders in saturated liquids were obtained based on a two-phase laminar boundary layer film boiling model. It was clarified that author's experimental data for the cylinders with the nondimensional diameters, D, of around 1.3 in water and in Freon-113 agreed with the values of theoretical numerical solutions based on the two-phase laminar boundary layer model with the smooth vapor-liquid interface except those for low flow velocities. A forced convection film boiling heat transfer correlation including the radiation contribution from the cylinders with various diameters in saturated and subcooled liquids was developed based on the two-phase laminar boundary layer film boiling model and the experimental data for water and Freon-113 at wide ranges of flow velocities, surface superheats, system pressures and cylinder diameters. (author)
LncRNA GAS5 Represses Osteosarcoma Cells Growth and Metastasis via Sponging MiR-203a
Directory of Open Access Journals (Sweden)
Yang Wang
2018-01-01
Full Text Available Background/Aims: LncRNA GAS5, a growth suppressor, has been reported to exert anti-tumor actions in various cancers, whereas the exact mechanism underling the anti-tumor action is still unclear. This study was aimed to investigate the effect of lncRNA GAS5 on osteosarcoma and tried to decode the underling mechanisms. Methods: Expressions of lncRNA GAS5 in MG-63 cells were silenced by shRNA transfection, while were overexpressed by vector transfection. Cell viability, migration, invasion and apoptosis were respectively assessed by MTT, Transwell assay and flow cytometry. Regulations between lncRNA GAS5 and miR-203a, as well as between miR-203a and TIMP2 were detected by qPCR, western blot and dual luciferase activity assay. Results: LncRNA GAS5 was down-regulated in MG-63 and OS-732 cells compared to hFOB1.19 cells. Silence of lncRNA GAS5 significantly promoted MG-63 cells viability, migration and invasion, and up-regulated Cyclin D1, Cyclin B1, CDK1 and CDK4 expressions. miR-203a was negatively regulated by lncRNA GAS5. The promoting activities of lncRNA GAS5 silence on MG-63 cells growth and metastasis were reversed by miR-203a suppression. TIMP2 was a target of miR-203a and the anti-growth and anti-metastasis actions of miR-203a suppression were reversed by TIMP2 silence. Further, lncRNA GAS5 silence, miR-203a overexpression, and TIMP2 silence could activate PI3K/AKT/GSK3β signaling while block NF-κB signaling. Conclusion: LncRNA GAS5 might be a tumor suppressor in osteosarcoma via sponging miR-203a, sequestering miR-203a away from TIMP2.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...
E.B.R.O. 499 Union Gas settlement agreement
International Nuclear Information System (INIS)
1998-01-01
This alternative dispute resolution agreement is for the consideration of the Ontario Energy Board in its determination of the 1999 rates for Union Gas Limited, under Docket No. E.B.R.O. 499. The agreement is supported by the evidence filed in E.B.R.O. 499. The topics discussed in this report are administration policy, rate base, operating revenue, cost of service, cost of capital, cost allocations, and rate design
Improving the performance of plastic SQS tubes by means of a modified gas mixture
International Nuclear Information System (INIS)
Bateman, J.E.; Connolly, J.E.
1987-01-01
In the course of developing the plastic SQS detector modules for the muon endcaps on the OPAL experiment, we met with great difficulty in achieving reliable operation from the devices when following the accepted design and operation methods. Study of the breakdown modes of the devices revealed that interaction with the cathode surfaces seemed to be a key factor. In an attempt to ameliorate the situation the standard gas mixture was modified to include a very small doping of a liquid freon. With this gas stable operation became routine with counting plateaux of just on 90% over a range of 400 V in EHT. The pulse height spectra obtained with the doped gas give some insight into the streamer mechanism. (author)
The effect of diameter on vertical and horizontal flow boiling crisis in a tube cooled by Freon-12
International Nuclear Information System (INIS)
Merilo, M.; Ahmad, S.Y.
1979-03-01
The influence of test section orientation and diameter on flow boiling crisis occurring in tubes has been studied experimentally using Freon-12 as a coolant. At low mass flux the critical heat flux (CHF) was lower in horizontal flow than in vertical. As either the liquid or vapour velocity, or both, were increased the vertical and horizontal CHF results converged. Above a mass flux of 4 Mg.m -2 .s -1 the results were essentially identical. The effect of tube diameter on boiling crisis in general depends crucially on the parameters which are maintained constant when the comparison is made. (author)
study on 113 Sn-113m In generator of the chromatographic column elution mode
International Nuclear Information System (INIS)
Abdel-Halim, A.A.
2002-01-01
this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days
TED analysis of the Si(113) surface structure
Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.
1999-09-01
We carried out a TED (transmission electron diffraction) analysis of the Si(113) surface structure. The TED patterns taken at room temperature showed reflections due to the 3×2 reconstructed structure. The TED pattern indicated that a glide plane parallel to the direction suggested in some models is excluded. We calculated the R-factors (reliability factors) for six surface structure models proposed previously. All structure models with energy-optimized atomic positions have large R-factors. After revision of the atomic positions, the R-factors of all the structure models decreased below 0.3, and the revised version of Dabrowski's 3×2 model has the smallest R-factor of 0.17.
Condenser inleakage monitoring system development. Final report
International Nuclear Information System (INIS)
Kassen, W.R.; Putkey, T.A.; Sawochka, S.G.; Pearl, W.L.; Clouse, M.E.
1982-09-01
An instrument/hardware package for air and condenser cooling water inleakage location employing the helium and freon techniques was designed and fabricated. The package consists of design details for tracer gas distribution hardware, injection plenums, and a sample preconditioner and instrument module. Design of the package was based on an evaluation of helium and freon leak detectors and a survey of utility user's experience with the helium and freon techniques. The applicability of the instrument/hardware package to air and cooling water inleakage location was demonstrated at Pacific Gas and Electric Company's Moss Landing Station. The use of calibrated leaks indicated that cooling water leaks down to 1.5 x 10 -4 gpm (0.56 ml/min) and air leaks down to 0.05 cfm were readily detectable with the helium technique, whereas a 4 x 10 -4 gpm (1.5 ml/min) liquid leak was the readily detectable minimum via the freon technique. The field demonstration and in-house detector testing showed the helium technique to be preferable to the freon technique for inleakage location at PWRs, BWRs, and fossil-fueled systems
A study of water hammer phenomena in a one-component two-phase bubbly flow
International Nuclear Information System (INIS)
Fujii, Terushige; Akagawa, Koji
2000-01-01
Water hammer phenomena caused by a rapid valve closure, that is, shock phenomena in two-phase flows, are an important problem for the safety assessment of a hypothetical LOCA. This paper presents the results of experimental and analytical studies of the water hammer phenomena in a one-component tow-phase bubbly flow. In order to clarify the characteristics of water hammer phenomena, experiments for a one-component two-phase flow of Freon R-113 were conducted and a numerical simulation of pressure transients was developed. An overall picture of the water hammer phenomena in a one-component two-phase flow is presented an discussed. (author)
International Nuclear Information System (INIS)
Lasry, Inbal; Berman, Bluma; Glaser, Fabian; Jansen, Gerrit; Assaraf, Yehuda G.
2009-01-01
The proton-coupled folate transporter (PCFT/SLC46A1) mediates intestinal folate uptake at acidic pH. Some loss of folic acid (FA) transport mutations in PCFT from hereditary folate malabsorption (HFM) patients cluster in R113, thereby suggesting a functional role for this residue. Herein, unlike non-conservative substitutions, an R113H mutant displayed 80-fold increase in the FA transport Km while retaining parental Vmax, hence indicating a major fall in folate substrate affinity. Furthermore, consistent with the preservation of 9% of parental transport activity, R113H transfectants displayed a substantial decrease in the FA growth requirement relative to mock transfectants. Homology modeling based on the crystal structures of the Escherichia coli transporter homologues EmrD and glycerol-3-phosphate transporter revealed that the R113H rotamer properly protrudes into the cytoplasmic face of the minor cleft normally occupied by R113. These findings constitute the first demonstration that a basic amino acid at position 113 is required for folate substrate binding.
Krypton separation from waste gas of a reprocessing plant by low temperature rectification
International Nuclear Information System (INIS)
1987-01-01
6 lectures at this seminar describe and evaluate the results of the research and development work on low temperature krypton separation from the waste gas of the reprocessing of nuclear fuels. They are used for making decisions for the process to be used in the future on a large scale at the Wackersdorf reprocessing plant. 2 further lectures deal with alternatives to this process, which were also developed: the freon washing and low temperature adsorption of krypton. All the lectures were included separately in the INIS and ENERGY databases. (RB) [de
Effect of orientation on critical heat flux in a 3-rod bundle cooled by Freon-12
International Nuclear Information System (INIS)
Dimmick, G.R.
1979-06-01
Critical heat flux measurements have been made in a segmented 3-rod test section cooled by Freon-12. Three test section orientations were used: vertical, inclined at 11 deg to the vertical, and horizontal. It was found that at flows of less than 2.5 Mg.m -2 .s -1 the transverse gravity force on the inclined and horizontal orientations reduced the magnitude of the critical heat flux and also changed the location of initial dryout when compared to the vertical data. To account for the effect of orientation during correlation of the data, the Reynolds number was modified to include a transverse gravity term. The minimum standard deviation for the data from the three orientations combined was 3.4 percent and less than 3.7 percent for the three orientations separately. (author)
Industrial-energy markets: Implications for natural gas technology R and D
International Nuclear Information System (INIS)
Samsa, M.E.
1989-04-01
The paper reviews the role and competitive position of natural gas for major industrial functional uses and focuses on the key issues and factors affecting the future of natural gas use in industrial applications. Gas use is discussed within the context of all other major fuel groups used by the industrial sector. The manufacturing and nonmanufacturing segments are isolated and each of the major uses (boilers, cogeneration, process heating, feedstocks, lease and plant, and nonstationary applications) are discussed separately. A discussion is included on the implications of the analysis on GRI's R and D program and on the technical service options that are available to the gas industry
Energy Technology Data Exchange (ETDEWEB)
Tillner, R.; Baehr, H.D.; Klobasa, F. (Hannover Univ. (Germany, F.R.). Inst. fuer Thermodynamik)
1990-01-01
Difluoroethane (R152a) could substitute R12 refrigerants in spite of its flammability. It does not affect the atmospheric ozone layer, it does not heat the earth as much as R134a, and it has the better energetic properties. The thermodynamic properties of R152a were assessed with the help of comprehensive measurements at pressures up to 160 bar, i.e. 55 steam pressure values (30deg C to 113deg C), 233 liquid density values (20deg C to 140deg C), and 304 gas density values (40deg C to 160deg C). Measurements by Institut fuer Thermodynamik (University of Hanover) and data published by other research institutes provided the basis for simple calculations of correlations for individual phases and a comprehensive thermal state equation for the entire fluid phase of R152a. These equations facilitate calculation of the thermodynamic properties prevailing in the entire phase which is relevant to cryo- and heat pump engineering. (orig./HW).
The NCSU [North Carolina State Univ.] freon PWR [pressurized water reactor] loop
International Nuclear Information System (INIS)
Caves, J.R.; Doster, J.M.; Miller, G.D.; Wehring, B.W.; Turinsky, P.J.
1989-01-01
The nuclear engineering department at North Carolina State University has designed and constructed an operating scale model of a pressurized water reactor (PWR) nuclear steam supply system (NSSS). This facility will be used for education, training, and research. The loop uses electric heaters to simulate the reactor core and Freon as the primary and secondary coolant. Viewing ports at various locations in the loop allow the students to visualize flow regimes in normal and off-normal operating conditions. The objective of the design effort was to scale the thermal-hydraulic characteristics of a two-loop Westinghouse NSSS. Provisions have been made for the simulation of various abnormal occurrences. The model is instrumented in much the same manner as the actual NSSS. Current research projects using the loop include the development of adaptive expert systems to monitor the performance of the facility, diagnose mechanical faults, and to make recommendations to operators for mitigation of accidents. This involves having thermal-hydraulics and core-physics simulators running faster than real time on a mini-supercomputer, with operating parameters updated by communication with the data acquisition and control computer. Further opportunities for research will be investigated as they arise
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
At the end of 1995, a total abolition of the production of the specified freons (CFC) was achieved. In future, it will be important to proceed with the appropriate recovery/destruction of the CFC, etc. which has been used so far, not only for the protection of ozone layer, but for the prevention of global warming. For the international study of facilities (technology) for destruction CFC, etc., the Technical Assessment Committee (TAC) was installed for destruction technology of ozone layer depletion substances (ODS) under the United Nations Environment Programme (UNEP), and the destruction efficiency (DE) of ODS was set up. In Japan, more than 30 facilities are already handling the destruction of CFC on a commercial basis. The number is expected to increase by the promotion of protection of ozone layer and prevention of global warming. This survey indicated quantitatively and qualitatively based on the TAC DE what the facilities for destruction of CFC should be which were considered of domestic laws in Japan, and was made a guide for existing facilities and ones to be newly installed. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
J. L. Smith
2001-01-01
This Streamlined Approach for Environmental Restoration (SAFER) Plan addresses the action necessary for the closure in place of Corrective Action Unit (CAU) 113 Area 25 Reactor Maintenance, Assembly, and Disassembly Facility (R-MAD). CAU 113 is currently listed in Appendix III of the Federal Facility Agreement and Consent Order (FFACO) (NDEP, 1996). The CAU is located in Area 25 of the Nevada Test Site (NTS) and consists of Corrective Action Site (CAS) 25-04-01, R-MAD Facility (Figures 1-2). This plan provides the methodology for closure in place of CAU 113. The site contains radiologically impacted and hazardous material. Based on preassessment field work, there is sufficient process knowledge to close in place CAU 113 using the SAFER process. At a future date when funding becomes available, the R-MAD Building (25-3110) will be demolished and inaccessible radiologic waste will be properly disposed in the Area 3 Radiological Waste Management Site (RWMS).
International Nuclear Information System (INIS)
Smith, J. L.
2001-01-01
This Streamlined Approach for Environmental Restoration (SAFER) Plan addresses the action necessary for the closure in place of Corrective Action Unit (CAU) 113 Area 25 Reactor Maintenance, Assembly, and Disassembly Facility (R-MAD). CAU 113 is currently listed in Appendix III of the Federal Facility Agreement and Consent Order (FFACO) (NDEP, 1996). The CAU is located in Area 25 of the Nevada Test Site (NTS) and consists of Corrective Action Site (CAS) 25-04-01, R-MAD Facility (Figures 1-2). This plan provides the methodology for closure in place of CAU 113. The site contains radiologically impacted and hazardous material. Based on preassessment field work, there is sufficient process knowledge to close in place CAU 113 using the SAFER process. At a future date when funding becomes available, the R-MAD Building (25-3110) will be demolished and inaccessible radiologic waste will be properly disposed in the Area 3 Radiological Waste Management Site (RWMS)
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...
Li, Yanhua; Gu, Junjiao; Lu, Hong
2017-12-01
Several lines of evidence have indicated that growth arrest-specific transcript 5 (GAS5) functions as a tumor suppressor and is aberrantly expressed in multiple cancers. GAS5 was found to be downregulated in gastric cancer (GC) tissues, and ectopic expression of GAS5 inhibited GC cell proliferation. The present study aimed to explore the underlying mechanisms of GAS5 involved in GC cell proliferation. GAS5 and miR-222 expressions in GC cell lines were estimated by quantitative real-time polymerase chain reaction. The effects of GAS5 and miR-222 on GC cell proliferation were assessed by MTT assay and 5-bromo-2-deoxyuridine (BrdU) incorporation assays. The interaction between GAS5 and miR-222 was confirmed by luciferase reporter assay and RNA immunoprecipitation assay. The protein levels of the phosphatase and tensin homolog (PTEN), phosphorylated protein kinase B (Akt) (p-Akt), Akt, phosphorylated mammalian target of rapamycin (mTOR) (p-mTOR), and mTOR were determined by western blot. GAS5 was downregulated and miR-222 was upregulated in GC cells. GAS5 directly targeted and suppressed miR-222 expression. GAS5 overexpression and miR-222 inhibition suppressed cell proliferation, increased PTEN protein level and decreased p-Akt and p-mTOR protein levels in GC cells while GAS5 knockdown and miR-222 overexpression exhibited the opposite effects. Moreover, mechanistic analyses revealed that GAS5 regulated GC cell proliferation through the PTEN/Akt/mTOR pathway by negatively regulating miR-222. GAS5/miR-222 axis regulated proliferation of GC cells through the PTEN/Akt/mTOR pathway, which facilitated the development of lncRNA-directed therapy against this deadly disease.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...
Characterization of Volatiles in Rambutan Fruit (Nephelium lappaceum L.).
Ong; Acree; Lavin
1998-02-16
The volatile compounds from the red-skinned cultivar of rambutan, Jitlee (Nephelium lappaceumL.), a tropical fruit native to Southeast Asia, were extracted using both Freon 113 and ethyl acetate solvents. Isolation and characterization of odor-active compounds present in the fruit were mediated by gas chromatography/olfactory (GC/O), chromatography, and spectrometry. Authentic standards were used to determine mass spectral, retention index, and odor match. Of over 100 volatiles detected by GC/MS, twice as many polar volatiles were detected in the ethyl acetate extract as in the nonpolar Freon extract. GC/O analysis also detected more odor-active compounds in the polar extracts. Over 60 compounds in the extracts had some odor activity. The 20 most potent odorants included beta-damascenone, (E)-4,5-epoxy-(E)-2-decenal, vanillin, (E)-2-nonenal, phenylacetic acid, cinnamic acid, unknown 1 (sweaty), ethyl 2-methylbutyrate, and delta-decalactone. On the basis of calculated odor activity values, beta-damascenone, ethyl 2-methylbutyrate, 2,6-nonadienal, (E)-2-nonenal, and nonanal were determined to be the main contributors to the fruit aroma. Taken together, these results indicate that the exotic aroma character of rambutan is the interaction of fruity-sweet and fatty-green odors, with the possible contribution of "civet-like"-sweaty, spicy, and woody notes.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...
23 CFR 660.113 - Construction.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...
International Nuclear Information System (INIS)
Casas, J.C.; Corradini, M.L.
1992-01-01
In this paper, investigations are performed to study the mixing between immiscible liquids in a pool configuration due to an upward gas flow. A water-R113 system is sued in the bubbly/churn-turbulent regimes to determine the effects of the unagitated pool depth on layer mixing. The superficial gas velocity at which full mixing is attained is observed to increase with the pool depth, although it is concluded that this is a weak dependency. Mixing in the churn-turbulent regime is studied with Wood's metal-water and Wood's metal-silicone fluid (100 cS) as pairs of fluids. Additional past mixing data from six other fluids are also included in the data base. A criterion is proposed to determine if two liquids will entrain in bubbly or churn-turbulent flow. Correlations are derived that, for a set of given conditions, allow prediction of the mixing state (mixed or segregated) of a system. Because of the indirect method of measuring the mixed layer thickness, pool void fraction experiments are also performed. For the case of water and R113, the effect of unagitated pool depth on the void fraction is studied
Ha, Cheol Woong; Kim, Kwantae; Chang, Yeon Ji; Kim, Bongkeun; Huh, Won-Ki
2014-07-01
In Saccharomyces cerevisiae, the stability of highly repetitive rDNA array is maintained through transcriptional silencing. Recently, a β-1,3-glucanosyltransferase Gas1 has been shown to play a significant role in the regulation of transcriptional silencing in S. cerevisiae. Here, we show that the gas1Δ mutation increases rDNA silencing in a Sir2-dependent manner. Remarkably, the gas1Δ mutation induces nuclear localization of Msn2/4 and stimulates the expression of PNC1, a gene encoding a nicotinamidase that functions as a Sir2 activator. The lack of enzymatic activity of Gas1 or treatment with a cell wall-damaging agent, Congo red, exhibits effects similar to those of the gas1Δ mutation. Furthermore, the loss of Gas1 or Congo red treatment lowers the cAMP-dependent protein kinase (PKA) activity in a cell wall integrity MAP kinase Slt2-dependent manner. Collectively, our results suggest that the dysfunction of Gas1 plays a positive role in the maintenance of rDNA integrity by decreasing PKA activity and inducing the accumulation of Msn2/4 in the nucleus. It seems that nuclear-localized Msn2/4 stimulate the expression of Pnc1, thereby enhancing the association of Sir2 with rDNA and promoting rDNA stability. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.
Inverted annular flow experimental study
International Nuclear Information System (INIS)
De Jarlais, G.; Ishii, M.
1985-04-01
Steady-state inverted annular flow of Freon 113 in up flow was established in a transparent test section. Using a special inlet configuration consisting of long aspect-ratio liquid nozzles coaxially centered within a heated quartz tube, idealized inverted annular flow initial geometry (cylindrical liquid core surrounded by coaxial annulus of gas) could be established. Inlet liquid and gas flowrates, liquid subcooling, and gas density (using various gas species) were measured and varied systematically. The hydrodynamic behavior of the liquid core, and the subsequent downstream break-up of this core into slugs, ligaments and/or droplets of various sizes, was observed. In general, for low inlet liquid velocities it was observed that after the initial formation of roll waves on the liquid core surface, an agitated region of high surface area, with attendant high momentum and energy transfers, occurs. This agitated region appears to propagate downsteam in a quasi-periodic pattern. Increased inlet liquid flow rates, and high gas annulus flow rates tend to diminish the significance of this agitated region. Observed inverted annular flow (and subsequent downstream flow pattern) hydrodynamic behavior is reported, and comparisons are drawn to data generated by previous experimenters studying post-CHF flow
Predicting the properties of the 113 to 120 transactinide elements
International Nuclear Information System (INIS)
Bonchev, D.; Kamenska, V.
1981-01-01
The information indices, recently introduced for the description of the electronic structure of atoms, are used as a more convenient basis than atomic number (or period number) for correlations with the properties of the chemical elements within the main groups of the periodic table. When the derived equations are extrapolated, the expected values for a number of properties or characteristics of the 113 to 120 transactinide elements are obtained: entropies in the gas and solid state, heats of melting and sublimation, melting and boiling points, first and second ionization potentials, atomic volumes, densities, covalent radii, and orbital exponents. Some corrections to the predictions were made by proceeding from the similarity in the trend of the expected values for elements 113 to 120 and the known data on elements 81 to 88. Some properties of elements 85 to 88, missing from the literature, were also calculated
Urban, Peter; Schneider von Deimling, Jens; Greinert, Jens
2015-04-01
The GEOMAR Helmholtz Centre for Ocean Research Kiel is currently developing a Imagenex Delta T based lander system for monitoring and quantifying marine gas release (bubbles). The GasQuant II is built as the successor of the GasQuant I system (Greinert, 2008), that has been successfully used for monitoring tempo-spatial variability of gas release in the past (Schneider von Deimling et al., 2010). The new system is lightweight (40 kg), energy efficient, flexible to use and built for ROV deployment with autonomous operation of up to three days. A prototype has been successfully deployed in Eckernförde Bay during the R/V ALKOR cruise AL447 in October/November 2014 to monitor the tempo-spatial variability of gas bubble seepage and to detect a possible correlation with tidal variations. Two deployments, one in forward- and one in upward looking mode, reveal extensive but scattered single bubble releases rather than distinct and more continuous sources. While these releases are difficult to detect in forward looking mode, they can unambiguously be detected in the upward looking mode even for minor gas releases, bubble rising speeds can be determined. Greinert, J., 2008. Monitoring temporal variability of bubble release at seeps: The hydroacoustic swath system GasQuant. J. Geophys. Res. Oceans Vol. 113 Issue C7 CiteID C07048 113, 7048. doi:10.1029/2007JC004704 Schneider von Deimling, J., Greinert, J., Chapman, N.R., Rabbel, W., Linke, P., 2010. Acoustic imaging of natural gas seepage in the North Sea: Sensing bubbles controlled by variable currents. Limnol. Oceanogr. Methods 8, 155. doi:10.4319/lom.2010.8.155
Ustinov, D. A.; Sukhikh, A. A.; Sidenkov, D. V.; Ustinov, V. A.
2017-10-01
The heat supply by means of heat pumps is considered now as a rational method of local heating which can lead to economy of primary fuel. At use of low-potential heat, for example, the heat of a ground (5 … 18 °C) or ground waters (8 … 10°C) only small depressing of temperature of these sources (on 3 … 5°C) is possible that demands application of heat exchangers with intensified heatmass transfer surfaces. In thermal laboratory of TOT department the 200 W experimental installation has been developed for research of process of boiling of freon R134a. The principle of action of the installation consists in realisation of reverse thermodynamic cycle and consecutive natural measurement of characteristics of elements of surfaces of heat exchangers of real installations at boiling points of freon from-10°C to +10°C and condensing temperatures from 15°C to 50 °C. The evaporator casing has optical windows for control of process of boiling of freon on ribbed on technology of distorting cut tubes. Temperature measurement in characteristic points of a cycle is provided by copper-constantan thermocouples which by means of ADT are connected to the computer that allows treat results of measurements in a real time mode. The structure of a two-phase flow investigated by means of the optical procedure based on laser technique.
14 CFR 1240.113 - Financial accounting.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...
48 CFR 49.113 - Cost principles.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS
42 CFR 56.113 - Grantee accountability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...
Burnout experiments with 6 x 6, 8 x 8 and 7 x 7 rod bundle test sections using freon as model fluid
International Nuclear Information System (INIS)
Fulfs, H.; Katsaounis, A.; Minden, C.v.
1976-01-01
This paper reports on burnout experiments at staedy state condition using Freon12 as model fluid. The experiments were carried out with three test sections with 6 x 6, 8 x 8 and 7 x 7 rod bundles. The axial flux distribution of the rods is either constant or reactor like. The transformed measured points using STEVENS and BOURE scaling factors to equivalent water conditions respectively, were compared to the burnout correlation W3 using the reactor layout program DYNAMIT. The DYNAMIT code is a thermohydraulic lay-out reactor program without consideration of mixing flow between the subchannels. (orig.) [de
24 CFR 27.113 - Foreclosure costs.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...
10 CFR 71.113 - Document control.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...
Lytvynenko, Anton S; Kolotilov, Sergey V; Kiskin, Mikhail A; Eremenko, Igor L; Novotortsev, Vladimir M
2015-02-28
The results of quantum chemical modeling of organic and metal-containing intermediates that occur in electrocatalytic dehalogenation reactions of organic chlorides are presented. Modeling of processes that take place in successive steps of the electrochemical reduction of representative C1 and C2 chlorides - CHCl3 and Freon R113 (1,1,2-trifluoro-1,2,2-trichloroethane) - was carried out by density functional theory (DFT) and second-order Møller-Plesset perturbation theory (MP2). It was found that taking solvation into account using an implicit solvent model (conductor-like screening model, COSMO) or considering explicit solvent molecules gave similar results. In addition to modeling of simple non-catalytic dehalogenation, processes with a number of complexes and their reduced forms, some of which were catalytically active, were investigated by DFT. Complexes M(L1)2 (M = Fe, Co, Ni, Cu, Zn, L1H = Schiff base from 2-pyridinecarbaldehyde and the hydrazide of 4-pyridinecarboxylic acid), Ni(L2) (H2L2 is the Schiff base from salicylaldehyde and 1,2-ethylenediamine, known as salen) and Co(L3)2Cl2, representing a fragment of a redox-active coordination polymer [Co(L3)Cl2]n (L3 is the dithioamide of 1,3-benzenedicarboxylic acid), were considered. Gradual changes in electronic structure in a series of compounds M(L1)2 were observed, and correlations between [M(L1)2](0) spin-up and spin-down LUMO energies and the relative energies of the corresponding high-spin and low-spin reduced forms, as well as the shape of the orbitals, were proposed. These results can be helpful for determination of the nature of redox-processes in similar systems by DFT. No specific covalent interactions between [M(L1)2](-) and the R113 molecule (M = Fe, Co, Ni, Zn) were found, which indicates that M(L1)2 electrocatalysts act rather like electron transfer mediators via outer-shell electron transfer. A relaxed surface scan of the adducts {M(L1)2·R113}(-) (M = Ni or Co) versus the distance between the
Experimental study on flow pattern and heat transfer of inverted annular flow
International Nuclear Information System (INIS)
Takenaka, Nobuyuki; Akagawa, Koji; Fujii, Terushige; Nishida, Koji
1990-01-01
Experimental results are presented on flow pattern and heat transfer in the regions from inverted annular flow to dispersed flow in a vertical tube using freon R-113 as a working fluid at atmospheric pressure to discuss the correspondence between them. Axial distributions of heat transfer coefficient are measured and flow patterns are observed. The heat transfer characteristics are divided into three regions and a heat transfer characteristics map is proposed. The flow pattern changes from inverted annular flow (IAF) to dispersed flow (DF) through inverted slug flow (ISF) for lower inlet velocities and through agitated inverted annular flow (AIAF) for higher inlet velocities. A flow pattern map is obtained which corresponds well with the heat transfer characteristic map. (orig.)
9 CFR 113.7 - Multiple fractions.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...
49 CFR 194.113 - Information summary.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...
19 CFR 113.35 - Individual sureties.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...
7 CFR 1710.113 - Loan security.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...
Highly selective room temperature NO2 gas sensor based on rGO-ZnO composite
Jyoti, Kanaujiya, Neha; Varma, G. D.
2018-05-01
Blending metal oxide nanoparticles with graphene or its derivatives can greatly enhance gas sensing characteristics. In the present work, ZnO nanoparticles have been synthesized via reflux method. Thin films of reduced graphene oxide (rGO) and composite of rGO-ZnO have been fabricated by drop casting method for gas sensing application. The samples have been characterized by X-ray diffraction (XRD) and Field-emission scanning electron microscope (FESEM) for the structural and morphological studies respectively. Sensing measurements have been carried out for the composite film of rGO-ZnO for different concentrations of NO2 ranging from 4 to 100 ppm. Effect of increasing temperature on the sensing performance has also been studied and the rGO-ZnO composite sensor shows maximum percentage response at room temperature. The limit of detection (LOD) for rGO-ZnO composite sensor is 4ppm and it exhibits a high response of 48.4% for 40 ppm NO2 at room temperature. To check the selectivity of the composite sensor, sensor film has been exposed to 40 ppm different gases like CO, NH3, H2S and Cl2 at room temperature and the sensor respond negligibly to these gases. The present work suggests that rGO-ZnO composite material can be a better candidate for fabrication of highly selective room temperature NO2 gas sensor.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd
International Nuclear Information System (INIS)
White, B.; Ebert, D.; Munno, F.
1990-01-01
Other investigators have evaluated the dose response of neutron bubble dosimeters for possible use as personnel monitors for the U.S. Navy in low level radiation fields. In addition to dose measurements, these devices have been modified to measure the neutron energy spectra. These methods tend to be cumbersome, inaccurate, or both and do not use the same devices as employed in the dosimetry. The BD-100R dosimeter used in this work consists of a test tube containing an elastic polymer with interspersed droplets of two types of Freon; Freon-12 and Freon-114. Each superheated liquid droplet is a potential nucleation site. The minimum energy needed to form a bubble from the nucleation site is given by, E = 16πγ 3 (T)/3(ΔP) 2 , where ΔP is the difference between the vapor pressure of the droplet and the applied pressure. Upon reaching a critical radius, a bubble becomes unstable and grows in size. It may be seen from this equation that the energy deposition required for bubble formation is inversely proportional to the square of the pressure difference. The number of bubbles formed continually decreases with increasing applied pressure, until a pressure is reached where no bubbles are formed since the energy transferred can no longer vaporize the Freon. This investigation is intended to demonstrate the determination of an unknown spectrum utilizing the dosimeter response (number of bubbles formed) as a function of the neutron energy (applied pressure). A set of 12 dosimeters was initially exposed outside the East Beam Port (EBP) at the Maryland University Training Reactor (MUTR). The dosimeters were inside a pressure chamber which could accommodate up to 18 dosimeters. The same set of dosimeters were irradiated using a paraffin moderated PuBe source for which the neutron energy spectrum is unknown. There were eight exposures of six dosimeters at varied pressures in the EBP. The average number of bubbles and standard deviation was measured for each pressure. Data
The micro-gap resistive plate chamber
Cerron-Zeballos, E; Lamas-Valverde, J; Platner, E D; Roberts, J; Williams, M C S; Zichichi, A
1999-01-01
Previously we have found that the freon C/sub 2/F/sub 5/H has very good properties when used in a resistive plate chamber (RPC) with a single gap of 2 mm. In this paper we report on the performance of a multigap RPC consisting of 4 gaps of 0.8 mm filled with a gas mixture containing this freon. (7 refs).
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...
Enzymatic in-situ generation of H2O2 for decolorization of Acid Blue 113 by fenton process
Directory of Open Access Journals (Sweden)
Karimi Afzal
2012-01-01
Full Text Available Decolorization of Acid Blue 113 in an aqueous medium by bio-Fenton process has been investigated in this research. Enzymatic oxidation of glucose was performed to in-situ generation of H2O2 which was employed to react with Fe2+ for producing hydroxyl radicals. The effect of various parameters include concentrations of 113, glucose, and FeSO4, activity of glucose oxidase (GOx and the effect of pH were assessed. The highest decolorization of AB 113 were achieved at Fe2+ concentration of 0.2 mmol/L, pH =4.0, glucose concentration of 0.018 mol/L, and glucose oxidase activity of 2500 U/L in the constant temperature (23 ±0.1ºC and constant shaking rate (160 r/min, while the concentration of 113 was 40 mg/L. In these conditions, 113 decolorization efficiency after 60 min was obtained about 95%.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...
48 CFR 32.113 - Customary contract financing.
2010-10-01
... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...
Liu, Zongyuan; Yu, Lingmin; Guo, Fen; Liu, Sheng; Qi, Lijun; Shan, Minyu; Fan, Xinhui
2017-11-01
A highly sensitive NO2 gas sensor based on ZnO nanowalls decorated rGO nanosheets was fabricated using a thermal reduction and soft solution process. The highly developed interconnected microporous networks of ZnO nanowalls were anchored homogeneously on the surface of reduced graphene oxide (rGO). Sensors fabricated with heterojunction structures achieved a higher response (S = 9.61) and shorter response-recovery (25 s, 15 s) behavior at room temperature to 50 ppm level NO2 effectively in contrast to those sensors based on net ZnO nanowalls or rGO layers. The stability and selectivity of ZnO/rGO heterojunction were carried out. Meanwhile, the effects of humidity on ZnO/rGO heterojunction gas sensor were investigated. The more preferable sensing performance of ZnO/rGO heterojunction to NO2 was discussed. It can be surmised that this NO2 gas sensor has potential for use as a portable room temperature gas sensor.
International Nuclear Information System (INIS)
Green, W.J.
1981-12-01
Comparisons have been made between experimental critical heat flux (CHF) data for upflow of water in uniformly heated vertical tubes and values calculated from an empirical CHF correlation developed from Freon-12 data. When this correlation is re-evaluated to account for vapour Prandtl number effects, very good agreement is obtained between experimental data and calculated values over a wide range of coolant conditions. Comparison of values calculated from the revised correlation with 2063 sets of CHF data obtained from experiments with water in vertical, uniformly heated tubes shows a mean ratio of the calculated to experimental CHF of 0.82 and an r.m.s. error of 5.8 per cent for the following coolant conditions: (1) local pressure of 3.4 to 12 MPa; (2) mass flux greater than approx. 300 kg s -1 m -2 , and (3) thermal equilibrium value of exit quality greater than 0.1
48 CFR 432.113 - Customary contract financing.
2010-10-01
... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...
Preparation of an sup(113m) indium generator
International Nuclear Information System (INIS)
Ling, H.W.
1979-01-01
This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt
Directory of Open Access Journals (Sweden)
Lingfeng Jin
2016-12-01
Full Text Available Acetylene (C2H2 gas sensors were developed by synthesizing a reduced graphene oxide (rGO-loaded SnO2 hybrid nanocomposite via a facile two-step hydrothermal method. Morphological characterizations showed the formation of well-dispersed SnO2 nanoparticles loaded on the rGO sheets with excellent transparency and obvious fold boundary. Structural analysis revealed good agreement with the standard crystalline phases of SnO2 and rGO. Gas sensing characteristics of the synthesized materials were carried out in a temperature range of 100–300 °C with various concentrations of C2H2 gas. At 180 °C, the SnO2–rGO hybrid showed preferable detection of C2H2 with high sensor response (12.4 toward 50 ppm, fast response-recovery time (54 s and 23 s, limit of detection (LOD of 1.3 ppm and good linearity, with good selectivity and long-term stability. Furthermore, the possible gas sensing mechanism of the SnO2–rGO nanocomposites for C2H2 gas were summarized and discussed in detail. Our work indicates that the addition of rGO would be effective in enhancing the sensing properties of metal oxide-based gas sensors for C2H2 and may make a contribution to the development of an excellent ppm-level gas sensor for on-line monitoring of dissolved C2H2 gas in transformer oil.
5 CFR 831.113 - Payments to children.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...
Candidates to replace R-12 as a radiator gas in Cherenkov detectors
Harvey, Allan H.; Paulechka, Eugene; Egan, Patrick F.
2018-06-01
Dichlorodifluoromethane (R-12) has been widely used as a radiator gas in pressure threshold Cherenkov detectors for high-energy particle physics. However, that compound is becoming unavailable due to the Montreal Protocol. To find a replacement with suitably high refractive index, we use a combination of theory and experiment to examine the polarizability and refractivity of several non-ozone-depleting compounds. Our measurements show that the fourth-generation refrigerants R-1234yf (2,3,3,3-tetrafluoropropene) and R-1234ze(E) (trans-1,3,3,3-tetrafluoropropene) have sufficient refractivity to replace R-12 in this application. If the slight flammability of these compounds is a problem, two nonflammable alternatives are R-218 (octafluoropropane), which has a high Global Warming Potential, and R-13I1 (trifluoroiodomethane), which has low Ozone Depletion Potential and Global Warming Potential but may not be sufficiently inert.
21 CFR 113.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...
2010-07-01
... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...
2010-04-01
... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...
34 CFR 668.113 - Request for review.
2010-07-01
... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...
46 CFR 113.25-6 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...
14 CFR 1214.113 - Allocation of risk.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...
6 CFR 11.3 - Demand for payment.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...
9 CFR 113.4 - Exemptions to tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...
RPC gas recovery by open loop method
Energy Technology Data Exchange (ETDEWEB)
Joshi, Avinash [Alpha Pneumatics, 11, Krishna Kutir, Madanlal Dhigra Road, Panch Pakhadi (India)], E-mail: alpha_pneumatics@hotmail.com
2009-05-01
RPC detectors require to be flushed with small but continuous flow of gas mixture. Dealing with large number of detectors, gas consumption to very large volumes. Gas flow is a running expense and constituent gases are too expensive to be treated as consumables. Exhaust gas mixture from detectors is a potential environmental hazard if discharged directly into the atmosphere. Storage of gases on a large scale also leads to inventory- and safety-related problems. A solution to these problems is the recovery and reuse of exhaust gas mixture from RPC detectors. Close loop method employs recirculation of exhausted gas mixture after purification, analysis and addition of top-up quantities. In open loop method, under consideration here, individual component gases are separated from gas mixture and reused as source. During open loop process, gases liquefiable at low pressures are separated from ones liquefiable at high pressure. The gas phase components within each group are successively separated by either fractional condensation or gravity separation. Gas mixture coming from RPC exhaust is first desiccated by passage through molecular sieve adsorbent type (3A+4A). Subsequent scrubbing over basic activated alumina removes toxic and acidic contaminants such as S{sub 2}F{sub 10} produced during corona (arcing) discharge. In the first stage of separation isobutane and freon are concentrated by diffusion and liquefied by fractional condensation by cooling upto -30 deg. C. Liquefied gases are returned to source tanks. In the second stage of separation, argon and sulphur hexafluoride, the residual gases, are concentrated by settling due to density difference. SF{sub 6} is stored for recovery by condensation at high pressure while argon is further purified by thermal cracking of crossover impurities at 1000 deg. C followed by wet scrubbing.
RPC gas recovery by open loop method
International Nuclear Information System (INIS)
Joshi, Avinash
2009-01-01
RPC detectors require to be flushed with small but continuous flow of gas mixture. Dealing with large number of detectors, gas consumption to very large volumes. Gas flow is a running expense and constituent gases are too expensive to be treated as consumables. Exhaust gas mixture from detectors is a potential environmental hazard if discharged directly into the atmosphere. Storage of gases on a large scale also leads to inventory- and safety-related problems. A solution to these problems is the recovery and reuse of exhaust gas mixture from RPC detectors. Close loop method employs recirculation of exhausted gas mixture after purification, analysis and addition of top-up quantities. In open loop method, under consideration here, individual component gases are separated from gas mixture and reused as source. During open loop process, gases liquefiable at low pressures are separated from ones liquefiable at high pressure. The gas phase components within each group are successively separated by either fractional condensation or gravity separation. Gas mixture coming from RPC exhaust is first desiccated by passage through molecular sieve adsorbent type (3A+4A). Subsequent scrubbing over basic activated alumina removes toxic and acidic contaminants such as S 2 F 10 produced during corona (arcing) discharge. In the first stage of separation isobutane and freon are concentrated by diffusion and liquefied by fractional condensation by cooling upto -30 deg. C. Liquefied gases are returned to source tanks. In the second stage of separation, argon and sulphur hexafluoride, the residual gases, are concentrated by settling due to density difference. SF 6 is stored for recovery by condensation at high pressure while argon is further purified by thermal cracking of crossover impurities at 1000 deg. C followed by wet scrubbing.
46 CFR 113.05-7 - Environmental tests.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...
9 CFR 113.33 - Mouse safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...
International Nuclear Information System (INIS)
Stevens, G.F.; Wood, R.W.; Pryzbylski, J.
1968-09-01
Burnout results are given for an annular test section 12ft long and having an inner heated rod 0.625 in diameter, and an outer unheated tube of 0.825in bore. In one case the rod was uniformly heated and in the other case the rod was given a symmetrical chopped cosine heat flux profile. The Freon data is shown to compare well with equivalent water data using an established scaling technique; this applied both to burnout power and to burnout position. The comparison is made at pressures of 1000 psia and 750 psia water equivalent and the same scaling factors are shown to work at both pressures. (author)
Critical heat flux of forced convection boiling in an oscilating acceleration field. Pt. 1
International Nuclear Information System (INIS)
Otsuji, T.; Kurosawa, A.
1982-01-01
The influence of periodically varying acceleration on critical heat flux (CHF) of Freon-113 flowing upward in a uniformly heated vertical annular channel has been studied experimentally. The freon loop was oscillated vertically to determine the ratio of CHF in the oscillating acceleration field to the corresponding stationary value. The amplitude of inlet flow oscillation induced by variation of acceleration, which causes early CHF, is proportional to the acceleration amplitude. The dependence of inlet flow rate on the oscillating acceleration decreases with increasing inlet subcooling, and no oscillation of inlet flow is observed in the case of negative exit quality (subcooled boiling). Nevertheless the degradation of CHF is more remarkable in the low quality region. This result suggests the necessity to introduce an other mechanism of early CHF than flow oscillation. (orig.)
9 CFR 113.326 - Avian Pox Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...
9 CFR 113.39 - Cat safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...
46 CFR 113.10-9 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...
46 CFR 113.43-5 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...
9 CFR 113.40 - Dog safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...
49 CFR 214.113 - Head protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...
R and D programme on generation IV nuclear energy systems: the high temperatures gas-cooled reactors
International Nuclear Information System (INIS)
Carre, F.; Fiorini, G.L.; Billot, P.; Anzieu, P.; Brossard, P.
2005-01-01
The Generation IV Technology Roadmap selected, among others, a sequenced development of advanced high temperature gas cooled reactors as one of the main focus for R and D on future nuclear energy systems. The selection of this research objective originates both from the significance of high temperature and fast neutrons for nuclear energy to meet the needs for a sustainable development for the medium-long term (2020/2030 and beyond), and from the significant common R and D pathway that supports both medium term industrial projects and more advanced versions of gas cooled reactors. The first step of the 'Gas Technology Path' aims to support the development of a modular HTR to meet specific international market needs around 2020. The second step is a Very High Temperature Reactor - VHTR (>950 C) - to efficiently produce hydrogen through thermo-chemical or electro-chemical water splitting or to generate electricity with an efficiency above 50%, among other applications of high temperature nuclear heat. The third step of the Path is a Gas Fast Reactor - GFR - that features a fast-spectrum helium-cooled reactor and closed fuel cycle, with a direct or indirect thermodynamic cycle for electricity production and full recycle of actinides. Hydrogen production is also considered for the GFR. The paper succinctly presents the R and D program currently under definition and partially launched within the Generation IV International Forum on this consistent set of advanced gas cooled nuclear systems. (orig.)
33 CFR 136.113 - Other compensation.
2010-07-01
...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...
International Nuclear Information System (INIS)
Pavan, S.
1992-01-01
The last three decades have witnessed significant developments in engineering relative to the distribution and use of natural gas. This paper reviews these developments which, in natural gas distribution, include - polyethylene conduits, the use of radar to trace buried conduits, telemetering, innovative pressure reducing techniques and equipment, optimized retrofitting of buried pipelines, leak detection techniques, and energy recovery systems applied to pressure reducing operations. Relative to the efficient combustion and new uses of natural gas, the paper reviews the state-of-the-art in the design of compact wall mounted gas fired boilers for building space heating, gas fuelled space heating ventilation and air conditioning systems, and natural gas fed fuel cells
Chemically assisted laser ablation ICP mass spectrometry.
Hirata, Takafumi
2003-01-15
A new laser ablation technique combined with a chemical evaporation reaction has been developed for elemental ratio analysis of solid samples using an inductively coupled plasma mass spectrometer (ICPMS). Using a chemically assisted laser ablation (CIA) technique developed in this study, analytical repeatability of the elemental ratio measurement was successively improved. To evaluate the reliability of the CLA-ICPMS technique, Pb/U isotopic ratios were determined for zircon samples that have previously been analyzed by other techniques. Conventional laser ablation for Pb/U shows a serious elemental fractionation during ablation mainly due to the large difference in elemental volatility between Pb and U. In the case of Pb/U ratio measurement, a Freon R-134a gas (1,1,1,2-tetrafluoroethane) was introduced into the laser cell as a fluorination reactant. The Freon gas introduced into the laser cell reacts with the ablated sample U, and refractory U compounds are converted to a volatile U fluoride compound (UF6) under the high-temperature condition at the ablation site. This avoids the redeposition of U around the ablation pits. Although not all the U is reacted with Freon, formation of volatile UF compounds improves the transmission efficiency of U. Typical precision of the 206Pb/238U ratio measurement is 3-5% (2sigma) for NIST SRM 610 and Nancy 91500 zircon standard, and the U-Pb age data obtained here show good agreement within analytical uncertainties with the previously reported values. Since the observed Pb/U ratio for solid samples is relatively insensitive to laser power and ablation time, optimization of ablation conditions or acquisition parameters no longer needs to be performed on a sample-to-sample basis.
7 CFR 1955.113 - Price (housing).
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...
An examination of the influence of spacers on burnout in an annulus cooled by the upflow of Freon-12
International Nuclear Information System (INIS)
Ilic, V.
1975-04-01
To evaluate the spacer influence on burnout, tests were carried out in Freon-12 at 1.04 MPa (abs.) test section inlet pressure with an internally heated annulus 2743 mm long by 14.4 mm heater diameter, the outer tube (shroud) having a bore of 22.1 mm. The inner rod (heater) was located centrally to the shroud by spacers and their configuration was changed for each test. Comparison of the results with those obtained with a test section having no spacers indicated that spacers can increase burnout power up to 75 per cent, decrease it, or show no effect at all, depending on the combination of the inlet temperature and mass velocity. If the spacers were streamlined, removed from the upstream portion of the heater or relocated farther upstream from the downstream end of the heater, there was a considerably reduced effect on the test section performance. (author)
Natural gas: intersection of men, techniques and markets
International Nuclear Information System (INIS)
Laupretre, J.M.; Rasmusen, H.J.
1996-01-01
The 113. gas conference has held in Paris between the 10. to 13. September 1996. Its topic was ''the natural gas: intersection of men, techniques and markets''. Jean-Michel Laupretre, chairman of the technical association of the gas industry in France (TAG), in his opening allocution and Hans Rasmusen, chairman of the international Union of gas industry, in his Union message have stressed on the actuality of such a subject. (O.M.)
Average equilibrium charge state of 278113 ions moving in a helium gas
International Nuclear Information System (INIS)
Kaji, D.; Morita, K.; Morimoto, K.
2005-01-01
Difficulty to identify a new heavy element comes from the small production cross section. For example, the production cross section was about 0.5 pb in the case of searching for the 112th element produced by the cold fusion reaction of 208 Pb( 70 Zn,n) 277 ll2. In order to identify heavier elements than element 112, the experimental apparatus with a sensitivity of sub-pico barn level is essentially needed. A gas-filled recoil separator, in general, has a large collection efficiency compared with other recoil separators as seen from the operation principle of a gas-filled recoil separator. One of the most important parameters for a gas-filled recoil separator is the average equilibrium charge state q ave of ions moving in a used gas. This is because the recoil ion can not be properly transported to the focal plane of the separator, if the q ave of an element of interest in a gas is unknown. We have systematically measured equilibrium charge state distributions of heavy ions ( 169 Tm, 208 Pb, 193,209 Bi, 196 Po, 200 At, 203,204 Fr, 212 Ac, 234 Bk, 245 Fm, 254 No, 255 Lr, and 265 Hs) moving in a helium gas by using the gas-filled recoil separator GARIS at RIKEN. Ana then, the empirical formula on q ave of heavy ions in a helium gas was derived as a function of the velocity and the atomic number of an ion on the basis of the Tomas-Fermi model of the atom. The formula was found to be applicable to search for transactinide nuclides of 271 Ds, 272 Rg, and 277 112 produced by cold fusion reactions. Using the formula on q ave , we searched for a new isotope of element 113 produced by the cold fusion reaction of 209 Bi( 70 Zn,n) 278 113. As a result, a decay chain due to an evaporation residue of 278 113 was observed. Recently, we have successfully observed the 2nd decay chain due to an evaporation residue of 278 113. In this report, we will present experimental results in detail, and will also discuss the average equilibrium charge sate of 278 113 in a helium gas by
International Nuclear Information System (INIS)
Guzman Acevedo, C.
1981-08-01
Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...
27 CFR 21.113 - Isopropyl alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...
9 CFR 113.451 - Tetanus Antitoxin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...
Burnout correlations for even- and odd-numbered peripheral rod clusters over low pressure range
International Nuclear Information System (INIS)
Akaho, E.H.K.
1995-01-01
Burnout data with low pressure Freon-113 for even- and odd- numbered peripheral rod clusters with relatively large spacings were used to derive equations in terms of dimensionless parameters suggested by Barnett. The equations which are for three different flow regimes for each rod geometry (even or odd) were found to predict burnout data with maximum RMS deviation being 3.8%. (author). 11 figs., 3 tabs., 15 refs
13 CFR 113.410 - Comparable facilities.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...
Adcock, Karina E.; Reeves, Claire E.; Gooch, Lauren J.; Leedham Elvidge, Emma C.; Ashfold, Matthew J.; Brenninkmeijer, Carl A. M.; Chou, Charles; Fraser, Paul J.; Langenfelds, Ray L.; Hanif, Norfazrin Mohd; O'Doherty, Simon; Oram, David E.; Ou-Yang, Chang-Feng; Moi Phang, Siew; Abu Samah, Azizan; Röckmann, Thomas; Sturges, William T.; Laube, Johannes C.
2018-04-01
Atmospheric measurements of the ozone-depleting substance CFC-113a (CCl3CF3) are reported from ground-based stations in Australia, Taiwan, Malaysia and the United Kingdom, together with aircraft-based data for the upper troposphere and lower stratosphere. Building on previous work, we find that, since the gas first appeared in the atmosphere in the 1960s, global CFC-113a mixing ratios have been increasing monotonically to the present day. Mixing ratios of CFC-113a have increased by 40 % from 0.50 to 0.70 ppt in the Southern Hemisphere between the end of the previously published record in December 2012 and February 2017. We derive updated global emissions of 1.7 Gg yr-1 on average between 2012 and 2016 using a two-dimensional model. We compare the long-term trends and emissions of CFC-113a to those of its structural isomer, CFC-113 (CClF2CCl2F), which still has much higher mixing ratios than CFC-113a, despite its mixing ratios and emissions decreasing since the 1990s. The continued presence of northern hemispheric emissions of CFC-113a is confirmed by our measurements of a persistent interhemispheric gradient in its mixing ratios, with higher mixing ratios in the Northern Hemisphere. The sources of CFC-113a are still unclear, but we present evidence that indicates large emissions in East Asia, most likely due to its use as a chemical involved in the production of hydrofluorocarbons. Our aircraft data confirm the interhemispheric gradient as well as showing mixing ratios consistent with ground-based observations and the relatively long atmospheric lifetime of CFC-113a. CFC-113a is the only known CFC for which abundances are still increasing substantially in the atmosphere.
21 CFR 113.81 - Product preparation.
2010-04-01
...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...
French steam generator design developments
International Nuclear Information System (INIS)
Ginier, R.; Campan, J.L.; Pontier, M.; Leridon, A.; Remond, A.; Castello, G.; Holcblat, A.; Paurobally, H.
1986-01-01
From the outset of the French nuclear power program, a significant R and D effort has been invested in improvement of the design and operation of Pressurized Water Reactors including a special committment to improving steam generators. The steam generator enhancement program has spawned a wide variety of specific R and D resources, e.g., low temperature hydraulic models for investigation of areas with single-phase flow, and freon-filled models for simulation of areas of steam generators experiencing two-phase flow (tube bundles and moisture separators). For the moisture separators, a large scale research program using freon-filled models and highly sophisticated instrumentation was used. Tests at reactor sites during startup of both 900 MWe and 1300 MWe have been used to validate the assumptions made on the basis of loop tests. These tests also demonstrated the validity of using freon to simulate two-phase flow conditions. The wealth of knowledge accumulated by the steam generator R and D program has been used to develop a new design of steam generators for the N4 plants. The current R and D effort is aimed at qualifying the N4 steam generator model and developing more comprehensive models. One prong of the R and D effort is the Megeve program. Megeve is a 25 MW steam generator which simulates operating conditions of the N4 model. The other prong is Clotaire, a freon-filled steam generator model which will be used to qualify thermal/hydraulic design codes used for multidimensional calculations for design of tube bundles
49 CFR 230.113 - Wheels and tire defects.
2010-10-01
... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...
Origin of planetary primordial rare gas - The possible role of adsorption.
Fanale, F. P.; Cannon, W. A.
1972-01-01
The degree of physical adsorption of Ne, Ar, Kr, and Xe on pulverized samples of the Allende meteorite at 113 K has been measured. The observed pattern of equilibrium enrichment of heavy rare gases over light on the pulverized meteorite surfaces relative to the gas phase is similar to the enrichment pattern exhibited by planetary primordial rare gas when compared with the composition of solar rare gas. Results indicate that, at 113 K, a total nebular pressure of from .01 to .001 atm would be required to explain the Ar, Kr, and Xe abundances in carbonaceous chondrites with an adsorption mechanism. This pressure estimate is compatible with the range of possible nebular pressures suggested by astrophysical arguments. However, the subsequent mechanism by which initially adsorbed gas might have been transferred into the interiors of grains cannot be identified at present.
47 CFR 25.113 - Station licenses and launch authority.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...
Dense gas dispersion in the atmosphere
Energy Technology Data Exchange (ETDEWEB)
Nielsen, Morten
1998-09-01
Dense gas dispersion is characterized by buoyancy induced gravity currents and reduction of the vertical mixing. Liquefied gas releases from industrial accidents are cold because of the heat of evaporation which determines the density for a given concentration and physical properties. The temperature deficit is moderated by the heat flux from the ground, and this convection is an additional source of turbulence which affects the mixing. A simple model as the soil heat flux is used to estimate the ability of the ground to sustain the heat flux during release. The initial enthalpy, release rate, initial entrainment and momentum are discussed for generic source types and the interaction with obstacles is considered. In the MTH project BA experiments source with and without momentum were applied. The continuously released propane gas passed a two-dimensional removable obstacle perpendicular to the wind direction. Ground-level gas concentrations and vertical profiles of concentration, temperature, wind speed and turbulence were measured in front of and behind the obstacle. Ultrasonic anemometers providing fast velocity and concentration signals were mounted at three levels on the masts. The observed turbulence was influenced by the stability and the initial momentum of the jet releases. Additional information were taken from the `Dessert tortoise` ammonia jet releases, from the `Fladis` experiment with transition from dense to passive dispersion, and from the `Thorney Island` continuous releases of isothermal freon mixtures. The heat flux was found to moderate the negative buoyancy in both the propane and ammonia experiments. The heat flux measurements are compared to an estimate by analogy with surface layer theory. (au) 41 tabs., 146 ills., 189 refs.
International Nuclear Information System (INIS)
Stevens, G.F.; Elliott, D.F.; Wood, R.W.
1965-05-01
Some correlations of forced convection burn-out data are based on the approximate linearity of the relationship between burn-out heat flux and the channel-averaged quality at the burn-out point. These correlations perform satisfactorily on data obtained from uniformly heated configurations. Therefore the further inference is sometimes made that the burn-out heat flux is uniquely related to the quality, and that the burn-out in non-uniformly heated configurations can be calculated from measurements made with uniform heating. This report presents burn-out data for Freon 12 flowing vertically upwards through both uniformly and non-uniformly heated round tubes. This data shows that the quality at burn-out does depend on the heat flux profile, and that the inference mentioned above is not justified. (author)
9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.
2010-01-01
..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...
9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.
2010-01-01
... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...
9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...
9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...
9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.
2010-01-01
... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...
Development of a large-area Multigap RPC with adequate spatial resolution for muon tomography
Wang, J.; Wang, Y.; Wang, X.; Zeng, M.; Xie, B.; Han, D.; Lyu, P.; Wang, F.; Li, Y.
2016-11-01
We study the performance of a large-area 2-D Multigap Resistive Plate Chamber (MRPC) designed for muon tomography with high spatial resolution. An efficiency up to 98% and a spatial resolution of around 270 μ m are obtained in cosmic ray and X-ray tests. The performance of the MRPC is also investigated for two working gases: standard gas and pure Freon. The result shows that the MRPC working in pure Freon can provide higher efficiency and better spatial resolution.
14 CFR 13.113 - Noncompliance with the investigative process.
2010-01-01
... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...
9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.
2010-01-01
... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...
9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...
Grannas, A. M.; Fuentes, J. D.; Ramos-Garcés, F.; Wang, D. K.; Martins, D. K.
2012-12-01
Volatile organic compounds (VOCs) of both biogenic and anthropogenic origin are important to troposphere chemistry, particularly the formation of photochemical smog and secondary organic aerosol. There is concern that increased natural gas exploration may lead to increased emissions of certain VOCs during well development and due to fugitive emissions from operational well sites and pipelines. For a six-day period in June 2012, a variety of VOCs were measured using canister sampling from a mobile measurement platform. Transects from southwestern to northeastern Pennsylvania were studied, with samples obtained in rural, forested, urban, farm-impacted and gas well-impacted sites. As expected, biogenic VOCs and isoprene oxidation products were enhanced in forested regions, while anthropogenic non-methane hydrocarbons were enhanced in urban areas. BTEX (benzene, toluene, ethylbenzene and xylenes) was enhanced in urban areas, but the concentrations of BTEX measured near developing and existing natural gas sites were similar to rural and forested sites. Halogenated hydrocarbons and Freon compounds were consistent at all site locations. We will discuss the specific concentrations and signatures of these compounds and assess the potential impact of agricultural activities and gas well development on the observed VOC concentrations and variability.
9 CFR 113.122 - Salmonella Choleraesuis Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...
9 CFR 113.120 - Salmonella Typhimurium Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...
37 CFR 11.3 - Suspension of rules.
2010-07-01
... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...
Energy Technology Data Exchange (ETDEWEB)
Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)
1969-03-15
In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.
9 CFR 113.317 - Parvovirus Vaccine (Canine).
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...
PROSPECTS FOR USE OF CONDENSED GASES AND SUPERCRITICAL FLUIDS IN PHYTOCHEMICAL PRODUCTION
Directory of Open Access Journals (Sweden)
Demyanenko DV
2017-03-01
, sulfur hexafluoride (insulating gas or their mixtures, etc. Their major characteristics include lower vapor pressure if compared with liquid СО2, antimicrobic activity allowing to solve one the main problem in phytochemical production – microbial contamination of extracts (and other herbal drug preparations, possibility to extract not only lipophilic, but also more polar substances depending on choice of solvents or their mixes and their higher extraction rate.It has been found that some kinds of freons (for example, R22 due to their higher polarity are able to take wider spectrum of BAS than liquid СО2: essential and fat oils, fat-soluble vitamins, coumarins, carotenoids, phenolic alcohols, valrates, iridoids, some alkaloids and flavonoids. Besides, certain freons (for example, С318 have very high selectivity allowing to extract essential oils without accompanying fats. Some condensed gases, such as liquid ammonia, dimethyl ether and difluoromethane (freon R32 can be used as well for obtaining of hydrophilic BAS (saponins, alkaloids, flavonoids. Thus such solvents should be polar enough or can be mixed with polar modifiers. Supercritical fluids and some subcritical condensed gases are suitable for fractionating of primary (crude extracts because their selectivity considerably depends on temperature, pressure and composition (in case of mixtures with each other or with cosolvents. Also high selectivity of condensed gas and SCFs is shown in near-critical areas. Very important property of most of condensed gases and SCFs is their ability to considerably reduce microbial contamination of extracts in comparison with initial plant raw materials. Conclusions. Among existing methods for intensification of stage of plant extraction the most applicable for commercial scale is use of condensed gases and supercritical fluids as extractants. It is found that for today in the world the most widespread SCF is carbon dioxide. The main lacks of СО2 as an extractant are high
9 CFR 113.315 - Feline Rhinotracheitis Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113.315 Section 113.315 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Inspection Service and observed each day for 14 days post-challenge. The rectal temperature of each animal...
9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...
19 CFR 113.33 - Corporations as principals.
2010-04-01
... president, treasurer, or secretary of the corporation. The officer's signature shall be prima facie evidence... 19 Customs Duties 1 2010-04-01 2010-04-01 false Corporations as principals. 113.33 Section 113.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...
9 CFR 113.101 - Leptospira Pomona Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.103 - Leptospira Canicola Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.105 - Leptospira Hardjo Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.65 - Brucella Abortus Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65... Bacterial Vaccines § 113.65 Brucella Abortus Vaccine. Brucella Abortus Vaccine shall be prepared as a desiccated live culture bacterial vaccine from smooth colonial forms of the Brucella abortus organism...
9 CFR 113.123 - Salmonella Dublin Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...
49 CFR 199.113 - Employee assistance program.
2010-10-01
... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee assistance program (EAP) for its employees and supervisory personnel who will determine whether an employee... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199...
A Study on Liver Scan using 113mIn Colloid
International Nuclear Information System (INIS)
Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi
1969-01-01
There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.
Concentrations of /sup 113m/Cd in the marine environment
Energy Technology Data Exchange (ETDEWEB)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.
1980-09-18
Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.
9 CFR 113.329 - Newcastle Disease Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329 Section 113.329 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF.... Challenge virus shall be provided or approved by Animal and Plant Health Inspection Service. (4) If at least...
9 CFR 113.106 - Clostridium Chauvoei Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Chauvoei Bacterin. 113.106 Section 113.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... Animal and Plant Health Inspection Service, shall be used for challenge 14 to 15 days following the last...
9 CFR 113.107 - Clostridium Haemolyticum Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Haemolyticum Bacterin. 113.107 Section 113.107 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... challenge 14 to 15 days following the last injection of the product. Each of eight vaccinates and each of...
9 CFR 113.306 - Canine Distemper Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of the...
9 CFR 113.302 - Distemper Vaccine-Mink.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or ferrets...
Energy Technology Data Exchange (ETDEWEB)
Heneghan, C.P.; Branthwaite, M.A.
1981-04-01
A technique for measuring cardiac output which depends on the uptake of an inert soluble gas from the lungs has been evaluated during anesthesia. A respiratory mass spectrometer has been used to follow the concentrations of argon and freon-22 during passive rebreathing in anaesthetized patients before cardiopulmonary bypass. Values for cardiac output obtained with this technique are reproducible, but lower than those recorded using the direct Fick technique before and after the rebreathing manoeuvre. A reduction in cardiac output caused by vigorous rebreathing is the most likely explanation for the discrepancy and, although serial measurements of oxygen consumption may permit application of a correction factor, a method of measurement which causes significant haemodynamic disturbance cannot be recommended for widespread use.
F(R) cosmology via Noether symmetry and Λ-Chaplygin Gas like model
Fazlollahi, H. R.
2018-06-01
In this work, we consider f (R) alternative theories of gravity with an eye to Noether symmetry through the gauge theorem. For non-vacuum models, one finds Λ like gravity with energy density of Chaplygin Gas. We also obtain the effective equation of state parameter for corresponding cosmology and scale factor behavior with respect to cosmic time which show that the model provides viable EoS and scale factor with respect to observational data.
Huang, Chien-Hsiang; Chen, Chiao-Chi V; Siow, Tiing-Yee; Hsu, Sheng-Hsiou S; Hsu, Yi-Hua; Jaw, Fu-Shan; Chang, Chen
2013-01-01
The ability to evaluate the cerebral microvascular structure and function is crucial for investigating pathological processes in brain disorders. Previous angiographic methods based on blood oxygen level-dependent (BOLD) contrast offer appropriate visualization of the cerebral vasculature, but these methods remain to be optimized in order to extract more comprehensive information. This study aimed to integrate the advantages of BOLD MRI in both structural and functional vascular assessments. The BOLD contrast was manipulated by a carbogen challenge, and signal changes in gradient-echo images were computed to generate ΔR2* maps. Simultaneously, a functional index representing the regional cerebral blood volume was derived by normalizing the ΔR2* values of a given region to those of vein-filled voxels of the sinus. This method is named 3D gas ΔR2*-mMRA (microscopic MRA). The advantages of using 3D gas ΔR2*-mMRA to observe the microvasculature include the ability to distinguish air-tissue interfaces, a high vessel-to-tissue contrast, and not being affected by damage to the blood-brain barrier. A stroke model was used to demonstrate the ability of 3D gas ΔR2*-mMRA to provide information about poststroke revascularization at 3 days after reperfusion. However, this technique has some limitations that cannot be overcome and hence should be considered when it is applied, such as magnifying vessel sizes and predominantly revealing venous vessels.
A new fire alarm system for electrical installations
Pietersen, A H
1978-01-01
Fires in electrical installations are considered to develop in four phases - initiation, smouldering, flame formation and heat development. Cables are among the more sensitive components, with working temperatures around 50 degrees C and fire detection at 70 degrees C. Conventional alarms include smoke detectors. The new technique described uses microcapsules containing powder forming a gas of the Freon type after diffusion. A typical microcapsule loses 4% per year and has a natural life of 10 years. Fabrication methods are described. Detection is by gas concentration, with a sensitivity of 1 to 10 ppm, or by acoustic methods with microphones to pick up the sound of fractures. Pressure/temperature characteristics of various types of Freon mixtures commercially available are given in graphical form.
Investigations on the indium-113m isotope generators
International Nuclear Information System (INIS)
Oniciu, L.; Veglia, A.
1975-01-01
Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)
13 CFR 113.3-3 - Structural accommodations for handicapped clients.
2010-01-01
... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...
48 CFR 18.113 - Interagency acquisitions under the Economy Act.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interagency acquisitions under the Economy Act. 18.113 Section 18.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.113 Interagency acquisitions under...
40 CFR 63.113 - Process vent provisions-reference control technology.
2010-07-01
... § 63.113 Process vent provisions—reference control technology. (a) The owner or operator of a Group 1... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process vent provisions-reference control technology. 63.113 Section 63.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...
9 CFR 113.64 - General requirements for live bacterial vaccines.
2010-01-01
... bacterial vaccines. 113.64 Section 113.64 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.64 General requirements for live bacterial vaccines... bacterial vaccine shall meet the requirements in this section. (a) Purity test. Final container samples of...
32 CFR Appendix A to Part 113 - Certificate of Compliance
2010-07-01
... 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL Pt. 113, App. A Appendix A to Part 113—Certificate... consumer credit transaction to which this form refers. (If the unpaid balance has been adjusted as a...
46 CFR 113.35-9 - Mechanical engine order telegraph systems.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems. 113.35-9 Section 113.35-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-9 Mechanical engine order...
27 CFR 40.113 - Change in location to another region.
2010-04-01
... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer shall...
9 CFR 113.300 - General requirements for live virus vaccines.
2010-01-01
... vaccines. 113.300 Section 113.300 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Virus Vaccines § 113.300 General requirements for live virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a live virus vaccine shall meet the...
13 CFR 113.520 - Job classification and structure.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Job classification and structure. 113.520 Section 113.520 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION... males or for females; (b) Maintain or establish separate lines of progression, seniority lists, career...
Umnahanant, Patamaporn; Hasty, Darrell; Chickos, James
2012-06-01
The vaporization, fusion, and sublimation enthalpies of (R,S)- and (R)-flurbiprofen at T = 298.15 K are reported and compared with literature values when available. Correlation gas chromatography experiments were first performed to identify appropriate standards that could be used for materials containing a single fluorine substituent. Subsequent correlations resulted in a vaporization enthalpy for (R,S)-flurbiprofen and (R)-flurbiprofen, ΔH(vap) (298.15 K), of (127.5 ± 5.5) and (127.4 ± 4.7) kJ mol, respectively. Fusion enthalpies, ΔH(fus) (387 K), of (28.2 ± and, ΔH(fus) (381 K), (22.8 ± kJ mol(-1) were also measured by differential scanning calorimetry for the racemic and chiral forms of flurbiprofen. Adjusted to T = 298.15 K and combined with the vaporization enthalpy resulted in sublimation enthalpies, ΔH(sub) (298.15 K), of (155.6 ± 5.8) and (145.1 ± 5.7) kJ mol(-1) for (R,S)- and (R)-flurbiprofen, respectively. The fusion enthalpy measured for the racemic form was in excellent agreement with the literature value, while the sublimation enthalpy varies substantially from previous work. Two weak solid-solid phase transitions were also observed for (R)-flurbiprofen at T = 353.9 K (0.30 ± 0.1) and 363.2 K (0.21 ± 0.03) kJ · mol(-1). Copyright © 2012 Wiley Periodicals, Inc.
Chemistry of radiation damage to wire chambers
International Nuclear Information System (INIS)
Wise, J.
1992-08-01
Proportional counters are used to study aspects of radiation damage to wire chambers (wire aging). Principles of low-pressure, rf plasma chemistry are used to predict the plasma chemistry in electron avalanches (1 atm, dc). (1) Aging is studied in CF 4 /iC 4 H 10 gas mixtures. Wire deposits are analyzed by Auger electron spectroscopy. An apparent cathode aging process resulting in loss of gain rather than in a self-sustained current is observed in CF 4 -rich gases. A four-part model considering plasma polymerization of the hydrocarbon, etching of wire deposits by CF 4 , acceleration of deposition processes in strongly etching environments, and reactivity of the wire surface is developed to understand anode wire aging in CF 4 /iC 4 H 10 gases. Practical guidelines suggested by the model are discussed. (2) Data are presented to suggest that trace amounts of Freons do not affect aging rates in either dimethyl ether or Ar/C 2 H 6 . Apparent loss of gain is explained by attachment of primary electrons to a continuously increasing concentration of Freon 11 (CCl 3 F) in the counter gas. An increase in the concentration of Freon 11 in dimethyl ether is caused by a distillation process in the gas supply bottle and is a natural consequence of the unequal volatilities of the two compounds
International Nuclear Information System (INIS)
Green, W.J.; Stevens, J.R.
1981-08-01
Experiments have been performed using vertical heated tubes, cooled internally by Freon-12, to determine critical heat fluxes (CHFs) for both a uniformly heated section and an exit region with a separately controlled power supply. Heated lengths of the main separately were 2870 mm (8.48 and 16.76 mm tube bores) and 3700 mm (for 21.34 mm tube bore); heated length of the exit section was 230 mm. Coolant pressures, exit qualities and mass fluxes were in the range 0.9 to 1.3 MPa, 0.19 to 0.86, and 380 to 2800 kg m -2 s -1 , respectively. The data have been compared with published empirical correlations specifically formulated to predict CHFs in Freon-cooled, vertical tubes; relevant published CHF data have also been compared with these correlations. These comparisons show that, even over the ranges of conditions for which the correlations were developed, predicted values are only accurate to within +-20 per cent. Moreover, as mass fluxes increase above 3500 kg m -2 s -1 , the modified Groeneveld correlation becomes increasingly inadequate, and the Bertoletti and modified Bertoletti correlations under-predict CHF values by increasing amounts. At mass fluxes below 750 kg m -2 s -1 the Bertoletti correlations exhibit increasing inaccuracy with a decrease in mass flux. For non-uniform heating, the correlations are at variance with the experimental data
9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...
21 CFR 211.113 - Control of microbiological contamination.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Control of microbiological contamination. 211.113 Section 211.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and...
International Nuclear Information System (INIS)
Bianco de Salas, G.N.; Arciprete, J.A.; Mitta, A.E.A.
1978-05-01
The preparation of 113 Sn/sup(113m)In generators is described as well as its installation in cell. The chemical and radiochemical controls and the conditions to concentrate the eluate, if necessary, are described in detail. Production and exportation figures are given. (author) [es
Characterization of kappa opioid binding using dynorphin A1-13 and U69,593 in the rat brain
Energy Technology Data Exchange (ETDEWEB)
Devlin, T.; Shoemaker, W.J. (Univ. of Connecticut Health Center, Farmington (USA))
1990-05-01
Previous studies of kappa opioid binding sites have suggested heterogeneous binding to this class of opioid receptors. To further investigate kappa receptor heterogeneity, we analyzed the binding properties of various kappa-selective ligands in rat brain homogenates. Displacement assays were carried out using (3H)bremazocine in the presence of various displacing ligands under mu and delta receptor-blocked conditions. Homologous displacement of (3H)bremazocine produced shallow displacement which best fit a two-site model of drug-receptor interaction. Dynorphin A1-13 and U69,593 exhibited similar biphasic displacement of (3H)bremazocine. Maximal displacement by these ligands, however, represented only approximately 55% of total (3H)bremazocine binding, which suggests the existence of a third component of (3H)bremazocine binding. Biphasic displacement by dynorphin A1-13 was detected in tissue throughout the brain and the spinal cord, whereas the dynorphin-resistant component of (3H)bremazocine binding was uniquely absent in the spinal cord. U50,488H, tifluadom and ethylketocyclazocine appeared to displace from additional, dynorphin-insensitive sites, as their maximal displacement exceeded that seen with either dynorphin A1-13 or U69,593. These results strongly suggest the existence of at least three components of non-mu, non-delta (3H)bremazocine binding in the rat brain: two with differential affinity for dynorphin A1-13 and U69-593 (kappa-1 and kappa-2 sites), and a third (termed here R1) that was further resolved into two binding sites by bremazocine. Preliminary analysis of the R1 component using naloxone revealed one high-affinity site, which may be opiate in nature, and a second site whose binding properties closely resemble those of the sigma receptor described by others.
9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...
9 CFR 113.409 - Tuberculin-PPD Bovis, Intradermic.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tuberculin-PPD Bovis, Intradermic. 113... REQUIREMENTS Diagnostics and Reagents § 113.409 Tuberculin—PPD Bovis, Intradermic. Tuberculin—PPD Bovis... completed product from each serial shall be subjected to a comparison specificity test using a Reference PPD...
9 CFR 113.206 - Wart Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...
40 CFR 600.113-78 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-78... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-78 Fuel economy calculations. The...
40 CFR 600.113-88 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...
40 CFR 600.113-93 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-93... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-93 Fuel economy calculations. The...
9 CFR 113.209 - Rabies Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... Killed Virus Vaccines § 113.209 Rabies Vaccine, Killed Virus. Rabies Vaccine (Killed Virus) shall be prepared from virus-bearing cell cultures or nerve tissues obtained from animals that have developed rabies...
9 CFR 202.113 - Rule 13: Written hearing.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 13: Written hearing. 202.113 Section 202.113 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... waiver of the right to file such evidence. (g) Extension of time for depositions. If any party timely...
13 CFR 113.455 - Textbooks and curricular material.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Textbooks and curricular material. 113.455 Section 113.455 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Se...
A study on critical heat flux in gap
Energy Technology Data Exchange (ETDEWEB)
Park, Rae Joon; Jeong, Ji Whan; Cho, Young Ro; Chang, Young Cho; Kang, Kyung Ho; Kim, Jong Whan; Kim, Sang Baik; Kim, Hee Dong
1999-04-01
The scope and content of this study is to perform the test on critical heat flux in hemispherical narrow gaps using distilled water and Freon R-113 as experimental parameters, such as system pressure from 1 to 10 atm and gap thickness of 0.5, 1.0, 2.0, and 5.0 mm. The CHFG test results have shown that the measured values of critical power are much lower than the predictions made by empirical CHF correlations applicable to flat plate gaps and annuli. The pressure effect on the critical power was found to be much milder than predictions by those CHF correlations. The values and the pressure trend of the critical powers measured in the present experiments are close to the values converted from the CCFL data. This confirms the claim that a CCFL brings about local dryout and finally, global dryout in hemispherical narrow gaps. Increases in the gap thickness lead to increase in critical power. The measured critical power using R-113 in hemispherical narrow gaps are 60 % lower than that using water due to the lower boiling point, which is different from the pool boiling condition. The CCFL (counter counter flow limit) test facility was constructed and the test is being performed to estimate the CCFL phenomena and to evaluate the CHFG test results on critical power in hemispherical narrow gaps. (Author). 35 refs., 2 tabs., 19 figs.
A study on critical heat flux in gap
International Nuclear Information System (INIS)
Park, Rae Joon; Jeong, Ji Whan; Cho, Young Ro; Chang, Young Cho; Kang, Kyung Ho; Kim, Jong Whan; Kim, Sang Baik; Kim, Hee Dong
1999-04-01
The scope and content of this study is to perform the test on critical heat flux in hemispherical narrow gaps using distilled water and Freon R-113 as experimental parameters, such as system pressure from 1 to 10 atm and gap thickness of 0.5, 1.0, 2.0, and 5.0 mm. The CHFG test results have shown that the measured values of critical power are much lower than the predictions made by empirical CHF correlations applicable to flat plate gaps and annuli. The pressure effect on the critical power was found to be much milder than predictions by those CHF correlations. The values and the pressure trend of the critical powers measured in the present experiments are close to the values converted from the CCFL data. This confirms the claim that a CCFL brings about local dryout and finally, global dryout in hemispherical narrow gaps. Increases in the gap thickness lead to increase in critical power. The measured critical power using R-113 in hemispherical narrow gaps are 60 % lower than that using water due to the lower boiling point, which is different from the pool boiling condition. The CCFL (counter counter flow limit) test facility was constructed and the test is being performed to estimate the CCFL phenomena and to evaluate the CHFG test results on critical power in hemispherical narrow gaps. (Author). 35 refs., 2 tabs., 19 figs
2010-04-01
... THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.3 Application. (a) General. The regulations in this part apply to transactions between industry members and trade buyers. (b) Transactions...
9 CFR 113.312 - Rabies Vaccine, Live Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from virus-bearing... administration. (iii) Observe all animals for signs of rabies until scheduled time to sacrifice. If animals show...
9 CFR 113.38 - Guinea pig safety test.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the animals...
ESO 113-IG45 galaxy and/or quasar?
West, R M; Danks, A C
1978-01-01
Spectroscopy, UBV photometry and photography have been obtained of the extraordinary 13th magnitude object ESO 113-IG45 identified as a Seyfert galaxy by Fairall (1977); R.A.=01/sup h/ 21/sup m/.9; Decl .=-59 degrees 04' (1950). V/sub 0/=13630+or-50 km s/sup -1/; M/sub V /=-24/sup m/.0; largest diameter 75 kpc or more (with H/sub 0/=55 km s /sup -1/ Mpc/sup -1/). The nucleus is stellar-like and several times more luminous than the surrounding envelope which has a well-developed lane-structure. It is the intrinsically most luminous Seyfert nuclear yet known, and may be described as a 'quasar in the center of a (spiral) galaxy'. It is probably associated with the X-ray source 2A0120-591. (14 refs).
Shiga toxin-producing Escherichia coli is a foodborne and waterborne pathogen and is responsible for outbreaks of human gastroenteritis. This report documents the draft genome sequences of seven O113:H21 strains recovered from livestock, wildlife, and soil samples collected in a major agricultural r...
49 CFR 215.113 - Defective plain bearing wedge.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...
19 CFR 113.55 - Cancellation of export bonds.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cancellation of export bonds. 113.55 Section 113... export bonds. (a) Manner of cancellation. A bond to assure exportation as defined in § 101.1 of this... shall be signed by a revenue officer of the foreign country to which the merchandise is exported, unless...
9 CFR 113.6 - Animal and Plant Health Inspection Service testing.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal and Plant Health Inspection Service testing. 113.6 Section 113.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Applicability § 113.6 Animal and Plant Health Inspection Service testing. A...
An experimental study on critical heat flux in a hemispherical narrow gap
International Nuclear Information System (INIS)
Park, R.J.; Lee, S.J.; Kang, K.H.; Kim, J.H.; Kim, S.B.; Kim, H.D.; Jeong, J.H.
2000-01-01
An experimental study of CHFG (Critical Heat Flux in Gap) has been performed to investigate the inherent cooling mechanism using distilled water and Freon R-113 in hemispherical narrow gaps. As a separate effect test of the CHFG test, a CCFL (Counter Current Flow Limit) test has been also performed to confirm the mechanism of the CHF in narrow annular gaps with large diameter. The CHFG test results have shown that an increase in the gap thickness leads to an increase in critical power. The pressure effect on the critical power was found to be much milder than predictions by CHF correlations of other studies. In the CCFL experiment, the occurrence of CCFL was correlated with the Wallis parameter, which was assumed to correspond to the critical power in the CHFG experiment. The measured values of critical power in the CHFG tests are much lower than CCFL experimental data and the predictions made by empirical CHF correlations. (author)
R and D on the power conversion system for gas turbine high temperature reactors
International Nuclear Information System (INIS)
Takizuka, Takakazu; Takada, Shoji; Yan Xing; Kosugiyama, Shinichi; Katanishi, Shoji; Kunitomi, Kazuhiko
2004-01-01
JAERI is conducting R and D on the power conversion system of the GTHTR300 plant, in parallel with plant design work. The design of the power conversion system is based on a regenerative, non-intercooled, closed Brayton cycle with helium gas as the working fluid. A single-shaft, axial-flow turbo-compressor and a directly coupled electric generator run on magnetic bearings. Major R and D issues for the power conversion system are aerodynamic performance of the helium gas compressor, high load capacity magnetic bearings and performance of magnetic bearing supported rotor, and operability and controllability of the closed-cycle gas turbine system. Three test plans were set up to address theses issues, aiming at verifying the design of the GTHTR300 power conversion system and establishing key technologies of a closed-cycle helium gas turbine system. The compressor aerodynamic performance test is aiming at verifying the aerodynamic performance and design method of the helium compressor. A 1/3-scale, four-stage compressor test model and a helium gas loop were designed and fabricated. The model was designed to simulate the repeating stage flow, and at the same time have satisfactorily high machining precision, Reynolds number and measurement accuracy. The helium gas operating pressure is varied to investigate the effects of the Reynolds number on the efficiency and surge margin. Two sets of blades were fabricated to evaluate the effects of the end-wall over-camber angle. Test results will provide the basis for further improvement in the GTHTR300 compressor design. The magnetic bearing development test is aiming at developing the technology of the magnetic bearing supported rotor system. The test rig composed of 1/3-scale turbo-compressor and generator rotor models that are connected together by a flexible coupling. Each rotor models are supported by two radial magnetic bearings with a high load capacity that is about 1/10 of the GTHTR300 design. The rotor models were
International Nuclear Information System (INIS)
Weisman, J.
1976-11-01
Transient pressure drops across abrupt area changes are being determined in a series of blowdown experiments. These tests are being conducted with Freon 113 as the test fluid in a well instrumented apparatus. During this period, test runs were obtained with the first abrupt expansion test section. Test data from two typical runs are included in this report. Additional progress was made in developing the computer programs which were to be used in analyzing this data but funding of this analytical effort has been suspended
40 CFR 745.113 - Certification and acknowledgment of disclosure.
2010-07-01
... disclosure. 745.113 Section 745.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... may produce permanent neurological damage, including learning disabilities, reduced intelligence... required by § 745.110(a); or (ii) Waived the opportunity. (6) When one or more agents are involved in the...
Directory of Open Access Journals (Sweden)
A. Zodge
2017-10-01
Full Text Available One of the major drawbacks of diastereomeric salt precipitation based enantioseparation is the time and solvent requirement of crystallization. In the gas antisolvent (GAS approach, supercritical carbon dioxide is applied as an antisolvent, and the precipitation takes place in a couple of minutes. By setting the process parameters diastereomeric excess, yields, and selectivity can be controlled. Applicability of the process is demonstrated on the resolution of racemic 2-methoxyphenylacetic acid with enantiopure (R-(−-1-cyclohexylethylamine. Diastereomeric excess values over 55 % along with 80 % yields were achieved at optimal conditions in a single step.
9 CFR 113.42 - Detection of lymphocytic choriomeningitis contamination.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of lymphocytic choriomeningitis contamination. 113.42 Section 113.42 Animals and Animal Products ANIMAL AND PLANT HEALTH... contamination. The test for detection of lymphocytic choriomeningitis (LCM) virus provided in this section shall...
9 CFR 113.207 - Encephalomyelitis Vaccine, Eastern, Western, and Venezuelan, Killed Virus.
2010-01-01
..., Western, and Venezuelan, Killed Virus. 113.207 Section 113.207 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.207 Encephalomyelitis...
Pappas, Constantine C.; Ukuno, Arthur F.
1960-01-01
Measurements of average skin friction of the turbulent boundary layer have been made on a 15deg total included angle cone with foreign gas injection. Measurements of total skin-friction drag were obtained at free-stream Mach numbers of 0.3, 0.7, 3.5, and 4.7 and within a Reynolds number range from 0.9 x 10(exp 6) to 5.9 x 10(exp 6) with injection of helium, air, and Freon-12 (CCl2F2) through the porous wall. Substantial reductions in skin friction are realized with gas injection within the range of Mach numbers of this test. The relative reduction in skin friction is in accordance with theory-that is, the light gases are most effective when compared on a mass flow basis. There is a marked effect of Mach number on the reduction of average skin friction; this effect is not shown by the available theories. Limited transition location measurements indicate that the boundary layer does not fully trip with gas injection but that the transition point approaches a forward limit with increasing injection. The variation of the skin-friction coefficient, for the lower injection rates with natural transition, is dependent on the flow Reynolds number and type of injected gas; and at the high injection rates the skin friction is in fair agreement with the turbulent boundary layer results.
The development of a solvent-free approach for the determination of petroleum hydrocarbons in water
International Nuclear Information System (INIS)
Ehntholt, D.J.; Bodek, I.; Miseo, E.V.
1995-01-01
Current analytical methods for analysis of total petroleum hydrocarbons or oil and grease in water use extraction of 1.5 liters of the aqueous sample with three aliquots of Freon 113, drying with silica gel and subsequent analysis by infrared spectroscopy at 2,930 cm -1 . The use of chlorofluorocarbons is unacceptable based on environmental concerns regarding the degradation of the ozone layer by photochemical reactions of halocarbons. Due to these environmental concerns, various international agreements have resulted in a plan to eliminate CFCs by the year 2000. A new approach relies on a solid/liquid extraction with thermal desorption of the analytes into a gas stream. The gas stream is analyzed by infrared spectroscopy and the analytes quantified. The steps in the analysis are presented. A known volume of aqueous sample (typically between 10 and 50 ml) is passed through a selectively absorbent resin such as XAD-16. The analytes are absorbed onto the resin, while the water passes through. The analytes are thermally desorbed using a stream of IR transparent gas such as N 2 , At or He which flushes the analytes into a suitable gas cell. The spectrum of the sample is either collected using a Fourier transform spectrometer and commercially available GC/IR or kinetic data collection software or a single wavelength measurement is made using a filter or prism instrument. By integrating the area under the curve for the infrared response versus desorption time, the concentration of the analytes can be calculated
13 CFR 113.535 - Effect of state or local law or other requirements.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of state or local law or other requirements. 113.535 Section 113.535 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... obligation to comply with §§ 113.500 through 113.550 is not obviated or alleviated by the existence of any...
14 CFR 1221.113 - Use of the NASA Flags.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Flags. 1221.113 Section 1221.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...
27 CFR 22.113 - Receipt of tax-free alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Receipt of tax-free alcohol. 22.113 Section 22.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Withdrawal and...
9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.
2010-01-01
... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus...
Advanced Liquid Feed Experiment
Distefano, E.; Noll, C.
1993-06-01
The Advanced Liquid Feed Experiment (ALFE) is a Hitchhiker experiment flown on board the Shuttle of STS-39 as part of the Space Test Payload-1 (STP-1). The purpose of ALFE is to evaluate new propellant management components and operations under the low gravity flight environment of the Space Shuttle for eventual use in an advanced spacecraft feed system. These components and operations include an electronic pressure regulator, an ultrasonic flowmeter, an ultrasonic point sensor gage, and on-orbit refill of an auxiliary propellant tank. The tests are performed with two transparent tanks with dyed Freon 113, observed by a camera and controlled by ground commands and an on-board computer. Results show that the electronic pressure regulator provides smooth pressure ramp-up, sustained pressure control, and the flexibility to change pressure settings in flight. The ultrasonic flowmeter accurately measures flow and detects gas ingestion. The ultrasonic point sensors function well in space, but not as a gage during sustained low-gravity conditions, as they, like other point gages, are subject to the uncertainties of propellant geometry in a given tank. Propellant transfer operations can be performed with liquid-free ullage equalization at a 20 percent fill level, gas-free liquid transfer from 20-65 percent fill level, minimal slosh, and can be automated.
14 CFR 135.113 - Passenger occupancy of pilot seat.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Passenger occupancy of pilot seat. 135.113... Operations § 135.113 Passenger occupancy of pilot seat. No certificate holder may operate an aircraft type certificated after October 15, 1971, that has a passenger seating configuration, excluding any pilot seat, of...
7 CFR 760.113 - Refunds; joint and several liability.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Refunds; joint and several liability. 760.113 Section... Agricultural Disaster Assistance Programs § 760.113 Refunds; joint and several liability. (a) In the event that... provided that interest will in all cases run from the date of the original disbursement. (b) All persons...
The contribution of the DOE's R ampersand D budget in natural gas to energy price security
International Nuclear Information System (INIS)
Sutherland, R.J.
1992-01-01
The energy price volatility model suggests that some of the proposed natural gas programs can contribute to energy price stability. The sector most vulnerable to fuel price variations is, of course, the transportation sector. The most effective strategy to achieve energy pace stability is to reduce petroleum consumption in this sector. The natural gas vehicle program is therefore recommended as potentially important and worthy of further consideration. At this point, distinguishing the merits of various subprograms is not feasible. This result farther supports the conclusion that the DOE's energy R ampersand D portfolio is not efficiently balanced and an increase in oil and gas research should be a high priority. The DOE has responded favorably and has significantly increased its proposed research with the explicit objective of displacing oil in the transportation sector. The enhanced research and development program for energy security, in the NES, proposes major funding, increases in this area. To recommend the further increases proposed by the industry, a careful analysis of incremental benefits and costs is required. The proposed natural as supply program is intended to enhance the future supply of natural gas. As explained above, enhanced gas supplies can reduce the volatility of gas prices and severe the link between gas and oil prices. The gas supply program is recommended as a potentially important strategy to ensure energy price stability. The importance of this point merits restatement. Oil price volatility affects directly the transportation and industrial sectors. The residential, commercial and electric utility sectors are not highly oil dependent. However, oil prices have affected gas prices and gas is used extensively the residential, commercial, industrial and electric utility sectors. Energy price stability is enhanced in these sectors by severing, the link, between oil and gas prices
113Cd NMR as a Probe of the Active Sites of Metalloenzymes
Armitage, Ian M.; Schoot Uiterkamp, Antonius J.M.; Chlebowski, Jan F.; Coleman, Joseph E.
1978-01-01
113Cd NMR has been used to study the active site metal ion(s) of the 113Cd(II) derivatives of four Zn(II) metalloenzymes, carboxypeptidase A, carbonic anhydrases, alkaline phosphatase, and superoxide dismutase. The resonances of the enzyme-bound 113Cd(II) ions are extremely sensitive to ligand
13 CFR 113.425 - Counseling and use of appraisal and counseling materials.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Counseling and use of appraisal and counseling materials. 113.425 Section 113.425 Business Credit and Assistance SMALL BUSINESS... Activities Prohibited § 113.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A...
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
This publication describes the major components of the research and development programs of the Department of Energy`s Office of Natural Gas and Petroleum Technology. These programs are commonly referred to collectively as the `Oil and Gas Program.` This document provides customers with a single source of information describing the details of the individual technology program components. This document reflects the results of a planning cycle that began in early 1996 with the development of a scenario analysis for the programs, followed by the development of the coordinated strategic plan. The technology program plans, which are the most recent products of the planning cycle, expand on the program descriptions presented in the coordinated strategic plan, and represent an initial effort to coordinate the Oil and Gas Program exploration and production programs and budgets. Each technology program plan includes a `roadmap` that summarizes the progress of the program to the present and indicates its future direction. The roadmaps describe the program drivers, vision, mission, strategies, and measures of success. Both the individual technology program plans and the strategic plan are dynamic and are intended to be updated regularly.
R + D work on gas-cooled breeder development
International Nuclear Information System (INIS)
Dalle Donne, M.; Dorner, S.; Jacobs, G.; Meyer, L.; Rehme, K.; Schumacher, G.; Wilhelm, D.
1978-01-01
The development work for the gas-cooled breeder in the Karlsruhe Nuclear Research Center may be assigned to two different groups: a) Investigations on fuel elements. b) Studies concerning the safety of gas-cooled fast breeder reactors. To the first group there belongs the work related to the: - heat transfer between fuel elements and coolant gas, - influence of increased content of water vapor in helium or the fuel rods. The second group concerns: - establishing a computer code for transient calculations in the primary and secondary circuit of a gas-cooled fast breeder reactor, - steam reactivity coefficients, - the core destruction phase of hypothetical accidents, - the core-catcher using borax. (orig./RW) [de
Conception of dismantling cell for glove box with alpha contamination
International Nuclear Information System (INIS)
Mangin, D.
1987-01-01
The new dismantling cell of Valduc treats particularly alpha glove boxes. This cell is conceived to reduce the intervention inside for man with ventilated clothes and to reduce the volume of alpha wastes by utilization of manipulators and appropriate tools. The respect of low level norms (0.1 Ci/ton) for storage of alpha wastes conductes us to make a first decontamination, to ameliorate the detection in quantity of plutonium in the wastes and for wastes with a level upper the norm to make studies on decontamination by Freon 113 [fr
Union Gas Limited 2000 annual report
International Nuclear Information System (INIS)
2000-01-01
Financial information from Union Gas was presented along with a review of their operations throughout 2000. Union Gas is a major Canadian natural gas utility providing energy services to more than 1.1 million residential, commercial and industrial customers in more than 400 communities in Ontario. The company also provides natural gas storage and transportation services for other utilities and energy market participants in Ontario, Quebec and the United States. Revenue for 2000 was reported to be $1.6 billion, net income was $113 million and assets totaled $3.9 billion. Total throughput for 2000 was 35.8 billion cubic meters. Union Gas is a wholly-owned subsidiary of Westcoast Energy Inc. of Vancouver, British Columbia. In 2000, progress was made toward the introduction of performance-based regulation to replace the cost of service regulation currently in use. This initiative will enable the company to provide competitively priced services to customers, allowing them, along with shareholders to benefit from efficiency enhancements and new service offerings. tabs., figs
9 CFR 113.25 - Culture media for detection of bacteria and fungi.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Culture media for detection of bacteria and fungi. 113.25 Section 113.25 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Standard Procedures § 113.25 Culture media for detection of bacteria and fungi. (a...
Beta-delayed proton emitter $^{113}Xe$
Hagberg, E; Jonson, B; Jørgensen, B; Kugler, E; Mowinckel, T
1973-01-01
The ISOLDE facility at the CERN synchrocyclotron has been used for extending the series of beta -delayed proton emitters in xenon to masses lighter than those previously observed (/sup 115,117/Xe). Owing to the rapid decrease of the yields, experiments with solid-state counters were inconclusive, and instead a new and much more sensitive method based on nuclear emulsions was developed. The mass range 111-114 showed one new activity, /sup 113/Xe, with a half-life of 2.8+or-0.2 sec. From measurements of the track lengths for a total of 1130 protons from /sup 113/Xe it was possible to determine the energy spectrum. The results extend the systematics of beta -strength functions in the light xenon isotopes. (19 refs).
19 CFR 113.1 - Authority to require security or execution of bond.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Authority to require security or execution of bond. 113.1 Section 113.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS General Provisions § 113.1 Authority to require security or...
Solid Waste Operations Complex W-113, Detail Design Report (Title II). Volume 3: Specifications
International Nuclear Information System (INIS)
1995-09-01
The Solid Waste Retrieval Facility--Phase 1 (Project W113) will provide the infrastructure and the facility required to retrieve from Trench 04, Burial ground 4C, contact handled (CH) drums and boxes at a rate that supports all retrieved TRU waste batching, treatment, storage, and disposal plans. This includes (1) operations related equipment and facilities, viz., a weather enclosure for the trench, retrieval equipment, weighing, venting, obtaining gas samples, overpacking, NDE, NDA, shipment of waste and (2) operations support related facilities, viz., a general office building, a retrieval staff change facility, and infrastructure upgrades such as supply and routing of water, sewer, electrical power, fire protection, roads, and telecommunication. Title I design for the operations related equipment and facilities was performed by Raytheon/BNFL, and that for the operations support related facilities including infrastructure upgrade was performed by KEH. These two scopes were combined into an integrated W113 Title II scope that was performed by Raytheon/BNFL. Volume 3 is a compilation of the construction specifications that will constitute the Title II materials and performance specifications. This volume contains CSI specifications for non-equipment related construction material type items, performance type items, and facility mechanical equipment items. Data sheets are provided, as necessary, which specify the equipment overall design parameters
Solid Waste Operations Complex W-113, Detail Design Report (Title II). Volume 3: Specifications
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-09-01
The Solid Waste Retrieval Facility--Phase 1 (Project W113) will provide the infrastructure and the facility required to retrieve from Trench 04, Burial ground 4C, contact handled (CH) drums and boxes at a rate that supports all retrieved TRU waste batching, treatment, storage, and disposal plans. This includes (1) operations related equipment and facilities, viz., a weather enclosure for the trench, retrieval equipment, weighing, venting, obtaining gas samples, overpacking, NDE, NDA, shipment of waste and (2) operations support related facilities, viz., a general office building, a retrieval staff change facility, and infrastructure upgrades such as supply and routing of water, sewer, electrical power, fire protection, roads, and telecommunication. Title I design for the operations related equipment and facilities was performed by Raytheon/BNFL, and that for the operations support related facilities including infrastructure upgrade was performed by KEH. These two scopes were combined into an integrated W113 Title II scope that was performed by Raytheon/BNFL. Volume 3 is a compilation of the construction specifications that will constitute the Title II materials and performance specifications. This volume contains CSI specifications for non-equipment related construction material type items, performance type items, and facility mechanical equipment items. Data sheets are provided, as necessary, which specify the equipment overall design parameters.
13 CFR 113.135 - Designation of responsible employee and adoption of grievance procedures.
2010-01-01
... employee and adoption of grievance procedures. 113.135 Section 113.135 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES... Programs or Activities Receiving Federal Financial Assistance Introduction § 113.135 Designation of...
Tank 241-TX-113 rotary mode core sampling and analysis plan
International Nuclear Information System (INIS)
McCain, D.J.
1998-01-01
This sampling and analysis plan (SAP) identities characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for push mode core samples from tank 241-TX-113 (TX-113). The Tank Characterization Technical Sampling Basis document identities Retrieval, Pretreatment and Immobilization as an issue that applies to tank TX-113. As a result, a 150 gram composite of solids shall be made and archived for that program. This tank is not on a Watch List
Advanced conceptual design report solid waste retrieval facility, phase I, project W-113
International Nuclear Information System (INIS)
Smith, K.E.
1994-01-01
Project W-113 will provide the equipment and facilities necessary to retrieve suspect transuranic (TRU) waste from Trench 04 of the 218W-4C burial ground. As part of the retrieval process, waste drums will be assayed, overpacked, vented, head-gas sampled, and x-rayed prior to shipment to the Phase V storage facility in preparation for receipt at the Waste Receiving and Processing Facility (WRAP). Advanced Conceptual Design (ACD) studies focused on project items warranting further definition prior to Title I design and areas where the potential for cost savings existed. This ACD Report documents the studies performed during FY93 to optimize the equipment and facilities provided in relation to other SWOC facilities and to provide additional design information for Definitive Design
9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed Virus. 113.215 Section 113.215 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...
Bhati, Vijendra Singh; Ranwa, Sapana; Rajamani, Saravanan; Kumari, Kusum; Raliya, Ramesh; Biswas, Pratim; Kumar, Mahesh
2018-04-04
We report enhanced hydrogen-gas-sensing performance of a Ni-doped ZnO sensor decorated with the optimum concentration of reduced graphene oxide (rGO). Ni-doped ZnO nanoplates were grown by radio frequency sputtering, rGO was synthesized by Hummer's method and decorated by the drop cast method of various concentration of rGO (0-1.5 wt %). The current-voltage characteristics of the rGO-loaded sensor are highly influenced by the loading concentration of rGO, where current conduction decreases and sensor resistance increases as the rGO concentration is increased up to 0.75 wt % because of the formation of various Schottky heterojunctions at rGO/ZnO interfaces. With the combined effect of more active site availability and formation of various p-n heterojunctions due to the optimum loading concentration of rGO (0.75 wt %), the sensor shows the maximum sensing response of ∼63.8% for 100 ppm hydrogen at moderate operating temperature (150 °C). The rGO-loaded sensors were able to detect a minimum of 1 ppm hydrogen concentration and showed high selectivity. However, a further increase in the rGO concentration (1.5 wt %) leads to the reduction of the relative response of hydrogen gas, ascribed to the formation of interconnections of rGO between electrodes. Therefore, it reduces the total resistance of the sensor and minimizes the effect of p-n heterojunction on sensor response.
A description of the ITER's gas injection systems and current R and D activities
International Nuclear Information System (INIS)
Li, W.; Li, B.; Maruyama, S.; Jiang, T.; Yang, Y.; Xia, Z.W.; Zhang, Y.X.; Lu, J.
2012-01-01
The gas injection system (GIS) is an indispensable part of ITER fueling system. It deliveries the necessary gas species from tritium plant to vacuum vessel, pellet injection system or neutral beam for plasma operation and fusion power shutdown. In this paper, the current design status of GIS, including the previous design changes, is briefly described. As the GIS design justification and support, the experimental study on GIS response time is illustrated. The factors delayed the GIS response time are identified, and two kinds of control mode are proved to be effective for improving the GIS response time. The exploration on magnetic shield design shows the discrepancy of shielding performance occurs in the case of the paralleling external magnetic field to the sample cylinder. These R and D works prove the design feasibility in some ways, and support possible solutions for design challenges as alternative design options.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
As to 'the R and D of the comprehensive development/utilization technology of gas hydrate resource,' assessment was conducted and reported from an aspect of the third party. This R and D is a timely project being aimed at establishing the basic technology on gas hydrate from both aspects of fundamental research and practical research. In the development of gas hydrate resource in the tundra zone, the development of measuring methods for thermal conductivity and dielectric constants advanced the establishment of a guide for exploration and possibilities of assessment of the resource amount. In the development/production, it can be said that the knowledge/information collected by exchanging methane in gas hydrate with CO2 means no needs for new supply of heat and also contributes to the isolation of CO2. As to the utilization technology, the results were rated very high also internationally of tackling the quantitative evaluation method at molecular levels of the gas included in hydrate using Raman spectroscopy to establish the industrial gas separation method using the low-temperature environment in the tundra zone. (NEDO)
Czech Academy of Sciences Publication Activity Database
Kopecká, J.; Mrlík, M.; Olejník, R.; Kopecký, D.; Vrňata, M.; Prokeš, J.; Bober, Patrycja; Morávková, Zuzana; Trchová, Miroslava; Stejskal, Jaroslav
2016-01-01
Roč. 16, č. 11 (2016), s. 1-13, č. článku 1917. ISSN 1424-8220 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : polypyrrole nanotube * carbon nanotube * carbonization Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.677, year: 2016
Mechanism of Edge Localized Mode Mitigation by Resonant Magnetic Perturbations
Czech Academy of Sciences Publication Activity Database
Bécoulet, M.; Orain, F.; Huijsmans, G.T.A.; Pamela, S.; Cahyna, Pavel; Hoelzl, M.; Garbet, X.; Franck, E.; Sonnendruecker, E.; Dif-Pradalier, G.; Passeron, C.; Latu, G.; Morales, J.; Nardon, E.; Fil, A.; Nkonga, B.; Ratnani, A.; Grandgirard, V.
2014-01-01
Roč. 113, č. 11 (2014), s. 115001-115001 ISSN 0031-9007 R&D Projects: GA ČR GAP205/11/2341 Institutional support: RVO:61389021 Keywords : tokamak * ELMs Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 7.512, year: 2014
Surface-Induced Near-Field Scaling in the Knudsen Layer of a Rarefied Gas
Gazizulin, R. R.; Maillet, O.; Zhou, X.; Cid, A. Maldonado; Bourgeois, O.; Collin, E.
2018-01-01
We report on experiments performed within the Knudsen boundary layer of a low-pressure gas. The noninvasive probe we use is a suspended nanoelectromechanical string, which interacts with He 4 gas at cryogenic temperatures. When the pressure P is decreased, a reduction of the damping force below molecular friction ∝P had been first reported in Phys. Rev. Lett. 113, 136101 (2014), 10.1103/PhysRevLett.113.136101 and never reproduced since. We demonstrate that this effect is independent of geometry, but dependent on temperature. Within the framework of kinetic theory, this reduction is interpreted as a rarefaction phenomenon, carried through the boundary layer by a deviation from the usual Maxwell-Boltzmann equilibrium distribution induced by surface scattering. Adsorbed atoms are shown to play a key role in the process, which explains why room temperature data fail to reproduce it.
A Simplified Method for Laboratory Preparation of Organ Specific Indium 113m Compounds
Energy Technology Data Exchange (ETDEWEB)
Adatepe, M H; Potchen, E James [Washington University School of Medicine, St. Louis (United States)
1969-03-15
Generator systems producing short lived nuclides from longer lived parents have distinct clinical advantages. They are more economical, result in a lower radiation dose, and can make short lived scanning readily available even in areas remote from rapid radiopharmaceutical delivery services. The {sup 113}Sn-{sup 113m}In generator has the additional advantage that, as a transition metal, Indium can be readily complexed into organ specific preparations. 113Sn, a reactor produced nuclide with a 118 day half life, is absorbed on a zirconium or silica gel column. the generator is eluded with 5 to 8 ml of 0.05 N HCL solution at pH 1.3-1.4. The daughter nuclide, {sup 113m}In, has a half life of 1.7 hours and emits a 393 Kev monoenergetic gamma ray. Previous methods for labeling organ specific complexes with {sup 113m}In required terminal autoclaving before injection. With the recent introduction of sterile, apyrogenic {sup 113}Sn-{sup 113m}In generators, we have developed a simplified technique for the laboratory preparation of Indium labeled compounds. This method eliminates autoclaving and titration enabling us to pre-prepare organ specific complexes for blood pool, liver, spleen, brain, kidney and lung scanning.
7 CFR 1221.113 - Financial statements.
2010-01-01
... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.113 Financial statements. (a) As requested by the Secretary, the Board shall prepare...
International Nuclear Information System (INIS)
Gobble, Chase; Chickos, James S.
2016-01-01
Highlights: • The vaporization enthalpy and vapor pressure of R-(+) menthofuran is evaluated. • The normal boiling temperature is predicted and compared to experimental and predicted values. • A vapor pressure equation as a function of temperature for menthofuran is evaluated. - Abstract: The vapor pressure as a function of temperature and its vaporization enthalpy at T = 298.15 K of R-(+)-menthofuran, a substance metabolically derived from R-(+)-pulegone that is both a flavoring agent at low concentrations and a hepatotoxin at larger ones, is evaluated by correlation-gas chromatography. A vapor pressure p/Pa = (36 ± 12) has been evaluated at T = 298.15 K, and a normal boiling temperature of T_b/K = 482.4 K is predicted. A boiling temperature of T_b/K = 374.3 compares with the literature value of T_b/K = 371.2 at reduced pressure, p/kPa = 2.93. The vaporization enthalpy of (56.5 ± 3.0) kJ·mol"−"1 compares to an estimated value of (57.8 ± 2.9) kJ·mol"−"1.
Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate
Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.
2014-01-01
This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197
CRC-113 gene expression signature for predicting prognosis in patients with colorectal cancer.
Nguyen, Minh Nam; Choi, Tae Gyu; Nguyen, Dinh Truong; Kim, Jin-Hwan; Jo, Yong Hwa; Shahid, Muhammad; Akter, Salima; Aryal, Saurav Nath; Yoo, Ji Youn; Ahn, Yong-Joo; Cho, Kyoung Min; Lee, Ju-Seog; Choe, Wonchae; Kang, Insug; Ha, Joohun; Kim, Sung Soo
2015-10-13
Colorectal cancer (CRC) is the third leading cause of global cancer mortality. Recent studies have proposed several gene signatures to predict CRC prognosis, but none of those have proven reliable for predicting prognosis in clinical practice yet due to poor reproducibility and molecular heterogeneity. Here, we have established a prognostic signature of 113 probe sets (CRC-113) that include potential biomarkers and reflect the biological and clinical characteristics. Robustness and accuracy were significantly validated in external data sets from 19 centers in five countries. In multivariate analysis, CRC-113 gene signature showed a stronger prognostic value for survival and disease recurrence in CRC patients than current clinicopathological risk factors and molecular alterations. We also demonstrated that the CRC-113 gene signature reflected both genetic and epigenetic molecular heterogeneity in CRC patients. Furthermore, incorporation of the CRC-113 gene signature into a clinical context and molecular markers further refined the selection of the CRC patients who might benefit from postoperative chemotherapy. Conclusively, CRC-113 gene signature provides new possibilities for improving prognostic models and personalized therapeutic strategies.
Rankine cycle generators using geothermal fluids. Final progress report
Energy Technology Data Exchange (ETDEWEB)
1981-01-01
The Rankine Cycle generator was delivered and installed at Gila Hot Springs. Trial runs were made at that time, using Freon 12 as the expansion fluid. These tests showed that the boiler capacity was inadequate. It could not extract enough heat to generate sufficient volumes of Freon gas at the heat and pressure necessary to operate the system at an acceptable level. Increasing and decreasing the flow of hot water had a direct influence on efficiency, but it was not a linear relationship. Added amounts of hot water increased the power very little, but raised the water temperature at the discharge point. This implied that the heat exchange capacity of the boiler was saturated. The reverse was found in the condenser system. There was little increase in pressure of the condenser when we switched from static to run mode. Efficiency was maintained even when the cold water flow was reduced as much as 40%. The tests using Freon 12 resulted in the conclusion that the boiler volume needs to be increased and/or the configuration changed to radically increase its efficiency.
Statefinder diagnostic for modified Chaplygin gas cosmology in f(R,T) gravity with particle creation
Singh, J. K.; Nagpal, Ritika; Pacif, S. K. J.
In this paper, we have studied flat Friedmann-Lemaître-Robertson-Walker (FLRW) model with modified Chaplygin gas (MCG) having equation of state pm = Aρ ‑ B ργ, where 0 ≤ A ≤ 1, 0 ≤ γ ≤ 1 and B is any positive constant in f(R,T) gravity with particle creation. We have considered a simple parametrization of the Hubble parameter H in order to solve the field equations and discussed the time evolution of different cosmological parameters for some obtained models showing unique behavior of scale factor. We have also discussed the statefinder diagnostic pair {r,s} that characterizes the evolution of obtained models and explore their stability. The physical consequences of the models and their kinematic behaviors have also been scrutinized here in some detail.
The European gas industry at a corner of its history
International Nuclear Information System (INIS)
Gadonneix, P.
1996-01-01
The closing session of the 113. gas conference has been delivered by Mr Pierre Gadonneix, chairman of Gaz de France. This session has been held when the discussion on the European Union gaseous organization begins. This discussion has to determine the environment of Gaz de France for the future years. (O.M.)
Sources, sinks, trends, and opportunities
International Nuclear Information System (INIS)
Ciborowski, P.
1989-01-01
Each year the emission of greenhouse gases commits the earth to a warming of 0.02 to 0.06 degrees C. Many of these gases are released as by-products of fossil fuel combustion. The remainder are produced as a result of forest clearing in the tropics or agriculture or industrial activities. Carbon dioxide (CO 2 ) is the most important greenhouse gas, contributing about half of global heating. In addition, there are what are known as the non-CO 2 greenhouse gases: methane (CH 4 ), nitrous oxide (N 2 O), freon CFC-12 (CF 2 Cl 2 ), freon CFC-11 (CF 3 Cl), and tropospheric ozone (O 3 ). Carbon monoxide and the nitrogen gases, increase the amount of methane and ozone in the troposphere. There are also about 15 or 20 other greenhouse gases of lesser importance. This paper reviews the sources of some of these greenhouse gases, analyzes trends in their emissions, and suggests means through which greenhouse gas emissions can be limited
13 CFR 113.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...
9 CFR 113.202 - Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus.
2010-01-01
... Type 2 Vaccine, Killed Virus. 113.202 Section 113.202 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.202 Canine Hepatitis and Canine...
9 CFR 3.113 - Primary enclosures used to transport marine mammals.
2010-01-01
... marine mammals. 3.113 Section 3.113 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... the animals, their handlers, or other persons. (d) Marine mammals transported in the same primary... used. Within the primary enclosures used to transport marine mammals, the animals will be maintained on...
Field dependence of T1 for hyperpolarized [1-13C]pyruvate
DEFF Research Database (Denmark)
Chattergoon, N.; Martnez-Santiesteban, F.; Handler, W. B.
2013-01-01
conformation and properties of the dissolution media such as buffer composition, solution pH, temperature and magnetic field. We have measured the magnetic field dependence of the spin–lattice relaxation time of hyperpolarized [1-13C]pyruvate using field-cycled relaxometry. [1-13C]pyruvate was hyperpolarized...
Experimental study on the critical heat flux in a varying acceleration field, (1)
International Nuclear Information System (INIS)
Kusunoki, Tsuyoshi; Yokomura, Takeyoshi; Otsuji, Tomoo; Ikawa, Masahiro; Kurosawa, Akira.
1988-12-01
It is very important for the thermohydraulic design and for the safety assesement of marine reactors, to understand the effect of varying acceleration induced by ship motion on critical heart flux. The purpose of this joint study is to examine quantitatively the influence of varying acceleration on the behavior of bubbles. In the experiment, FREON-113 was used as working fluid. This report describes some experimental results; measurements of void fraction and bubble velocity near the heat transfer surface, measurement of bubble size under stationary acceleration field and observation of bubble behavior under varying acceleration field. (author)
Czech Academy of Sciences Publication Activity Database
Stenger, B.L.S.; Clark, M.E.; Kváč, Martin; Khan, E.; Giddings, C.W.; Dyer, N.W.; Schultz, J.L.; McEvoy, J.M.
2015-01-01
Roč. 32, JUN 2015 (2015), s. 113-123 ISSN 1567-1348 R&D Projects: GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 Keywords : Cryptosporidium * Paralogy * 18S rRNA * 18S rDNA Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.591, year: 2015
Scintigraphy of the Placenta With {sup 113m}In
Energy Technology Data Exchange (ETDEWEB)
Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)
1969-05-15
The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)
Solomin, I. N.; Daminov, A. Z.; Sadykov, R. A.
2017-11-01
Results of experimental and analytical studies of the plant main element - plant turbomachine (turbo-expander) operating on organic Rankine cycle were obtained for facilities of the heat supply systems of small-scale power generation. At simultaneous mathematical modeling and experimental studies it was found that the best working medium to be used in the turbomachines of these plants is Freon R245fa which has the most suitable calorimetric properties to be used in the cycle. The mathematical model of gas flow in the turbomachine was developed. The main engineering dependencies to calculate the optimal design parameters of the turbomachine were obtained. The engineering problems of providing the minimum axial size of the turbomachine impeller were solved and the main design elements were unified.
Czech Academy of Sciences Publication Activity Database
Shestivska, Violetta; Španěl, Patrik; Dryahina, Kseniya; Sovová, Kristýna; Smith, D.; Musílek, M.; Němec, A.
2012-01-01
Roč. 113, č. 3 (2012), s. 701-713 ISSN 1364-5072 R&D Projects: GA ČR GA203/09/0256 Institutional support: RVO:61388955 Keywords : breath analysis * cystic fibrosis * gas chromatography mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.196, year: 2012
7 CFR 1463.113 - Issuance of payments in event of death.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Issuance of payments in event of death. 1463.113 Section 1463.113 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS 2005-2014 TOBACCO TRANSITION PROGRAM Tobacco Transition Payment Program ...
R & D of a Gas-Filled RF Beam Profile Monitor for Intense Neutrino Beam Experiments
Energy Technology Data Exchange (ETDEWEB)
Yonehara, K. [Fermilab; Backfish, M. [Fermilab; Moretti, A. [Fermilab; Tollestrup, A. V. [Fermilab; Watts, A. [Fermilab; Zwaska, R. M. [Fermilab; Abrams, R. [MUONS Inc., Batavia; Cummings, M. A.; Dudas, A. [MUONS Inc., Batavia; Johnson, R. P. [MUONS Inc., Batavia; Kazakevich, G. [MUONS Inc., Batavia; Neubauer, M. [MUONS Inc., Batavia; Liu, Q. [Case Western Reserve U.
2017-05-01
We report the R&D of a novel radiation-robust hadron beam profile monitor based on a gas-filled RF cavity for intense neutrino beam experiments. An equivalent RF circuit model was made and simulated to optimize the RF parameter in a wide beam intensity range. As a result, the maximum acceptable beam intensity in the monitor is significantly increased by using a low-quality factor RF cavity. The plan for the demonstration test is set up to prepare for future neutrino beam experiments.
13 CFR 113.525 - Fringe benefits.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fringe benefits. 113.525 Section... benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit, service, policy or plan, any...
36 CFR 11.3 - Power to revoke.
2010-07-01
... AND PARKSCAPE SYMBOLS § 11.3 Power to revoke. Permission granted under this part by the Director may... injurious to their integrity or inconsistent with the purposes of the National Park Service in the fields of...
International Nuclear Information System (INIS)
1995-09-01
The Solid Waste Retrieval Facility--Phase 1 (Project W113) will provide the infrastructure and the facility required to retrieve from Trench 04, Burial ground 4C, contact handled (CH) drums and boxes at a rate that supports all retrieved TRU waste batching, treatment, storage, and disposal plans. This includes (1) operations related equipment and facilities, viz., a weather enclosure for the trench, retrieval equipment, weighing, venting, obtaining gas samples, overpacking, NDE, NDA, shipment of waste and (2) operations support related facilities, viz., a general office building, a retrieval staff change facility, and infrastructure upgrades such as supply and routing of water, sewer, electrical power, fire protection, roads, and telecommunication. Title I design for the operations related equipment and facilities was performed by Raytheon/BNFL, and that for the operations support related facilities including infrastructure upgrade was performed by KEH. These two scopes were combined into an integrated W113 Title II scope that was performed by Raytheon/BNFL. The following Code Evaluation analyzes the applicable sections of the National Fire Protection Association (NFPA) 101, Life Safety Code, 1994 Edition and the 1994 Edition of the Uniform Building Code (UBC) to the W113 Trench Enclosure. A Building Code Analysis generally establishes four primary design criteria: occupancy classification; separation requirements; egress requirements; and construction type. The UBC establishes requirements for all criteria. This analysis is limited to the Trench Enclosure Building. The General Office Building and the Retrieval Staff Change Building is not within the scope of this analysis
International Nuclear Information System (INIS)
Holtberg, P.D.; Webb, D.O.
1990-11-01
Although the significance of Iraq's invasion of Kuwait is indeterminate, a move toward more efficient use of energy in end use applications and increased reliance on domestic energy sources is anticipated. The short and long term potential for natural gas to displace oil in end use applications is analyzed and R and D initiatives are proposed that would accelerate the development of technology by GRI and the gas industry necessary to maximize the substitution of gas for oil
14 CFR 61.113 - Private pilot privileges and limitations: Pilot in command.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Private pilot privileges and limitations: Pilot in command. 61.113 Section 61.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND...
47 CFR 74.113 - Supplementary reports with application for renewal of license.
2010-10-01
... renewal of license. 74.113 Section 74.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... covered. (4) Power employed, field intensity measurements and visual and aural observations and the types... respective types of transmissions. (5) Estimated degree of public participation in reception and the results...
Genome Sequence of the Biocontrol Strain Pseudomonas fluorescens F113
Redondo-Nieto, Miguel; Barret, Matthieu; Morrisey, John P.; Germaine, Kieran; Martínez-Granero, Francisco; Barahona, Emma; Navazo, Ana; Sánchez-Contreras, María; Moynihan, Jennifer A.; Giddens, Stephen R.; Coppoolse, Eric R.; Muriel, Candela; Stiekema, Willem J.; Rainey, Paul B.; Dowling, David; O'Gara, Fergal; Martín, Marta
2012-01-01
Pseudomonas fluorescens F113 is a plant growth-promoting rhizobacterium (PGPR) that has biocontrol activity against fungal plant pathogens and is a model for rhizosphere colonization. Here, we present its complete genome sequence, which shows that besides a core genome very similar to those of other strains sequenced within this species, F113 possesses a wide array of genes encoding specialized functions for thriving in the rhizosphere and interacting with eukaryotic organisms. PMID:22328765
van Grinsven, Janneke; van Brunschot, Sandra; van Baal, Mark C; Besselink, Marc G; Fockens, Paul; van Goor, Harry; van Santvoort, Hjalmar C; Bollen, Thomas L
2018-05-11
Decision-making on invasive intervention in patients with clinical signs of infected necrotizing pancreatitis is often related to the presence of gas configurations and the degree of encapsulation in necrotic collections on imaging. Data on the natural history of gas configurations and encapsulation in necrotizing pancreatitis are, however, lacking. A post hoc analysis was performed of a previously described prospective cohort in 21 Dutch hospitals (2004-2008). All computed tomography scans (CTs) performed during hospitalization for necrotizing pancreatitis were categorized per week (1 to 8, and thereafter) and re-assessed by an abdominal radiologist. A total of 639 patients with necrotizing pancreatitis were included, with median four (IQR 2-7) CTs per patient. The incidence of first onset of gas configurations varied per week without a linear correlation: 2-3-13-11-10-19-12-21-12%, respectively. Overall, gas configurations were found in 113/639 (18%) patients and in 113/202 (56%) patients with infected necrosis. The incidence of walled-off necrosis increased per week: 0-3-12-39-62-76-93-97-100% for weeks 1-8 and thereafter respectively. Clinically relevant walled-off necrosis (largely or fully encapsulated necrotic collections) was seen in 162/379 (43%) patients within the first 3 weeks. Gas configurations occur in every phase of the disease and develop in half of the patients with infected necrotizing pancreatitis. Opposed to traditional views, clinically relevant walled-off necrosis occurs frequently within the first 3 weeks.
Interictal rCBF SPECT, MRI and Surgical Outcome of Intractable Temporal Lobe Epilepsy
International Nuclear Information System (INIS)
Zeon, Seok Kil; Joo, Yang Goo; Lee, Sang Doe; Son, Eun Ik; Lee, Young Hwan
1994-01-01
Interictal single photon emission computed tomography of regional cerebral blood flow (rCBF SPECT) in 18 intractable temporal lobe epilepsy patients (8 male and 10 female patients: average 23.5 years old) were compared with 2.0 T magnetic resonance imaging (MRI). And surgical outcome was analysed with the findings, symptom duration and lateralization of temporal lobe. Preoperatively rCRF SPECT was done in all 18 patients with intravenous injection of 740 MRq 99 m T c-HMPAO. MRI was also done preoperatively in 13 patients. Surgical outcome was classified by Engel's outcome classification (four part classification recommended at the first Palm Desert conference). rCRF SPECT detected correctly lateralising abnormality of temporal lobe hypoperfusion in 13/ 18 (72.2%), contralateral temporal lobe hypoperfusion in 2/18 (11.1%) and showed no definite abnormality in 3/18 (16.7%). The positive predictive value of unilateral temporal lobe hypoperfusion was 87%. MRI detected correct localising abnormality in 8/13 (61.5%), such as hippocampal atrophy (7/13), asymmetric temporal horn (6/13), anterior temporal lobe atrophy (1/13), increased signal intensity from hippocampus (1/13) and calcific density (1/13), and no abnormal finding was noted in 5/13 (38.5%), There was no false positive findings and the positive predictive value of MRI was 100%, Only 2 cases showed same lateralization findings in rCBF SPECT and MRI. There was no significant correlation between symptom duration and no abnormal findings on SPECT or MRI. Surgical outcome showed class I in 15/18 (83.3%), and class II in 2/18 (11.1%). One case of no abnormal finding in both SPECT and MRI showed class III surgical outcome. No class IV surgical out.come was noted. Surgical outcome, lateralization of epileptic focus in temporal lobe and abnormal findings in rCBR SPECT or MRI were not significantly correlated.
Dipole-modified graphene with ultrahigh gas sensibility
Jia, Ruokun; Xie, Peng; Feng, Yancong; Chen, Zhuo; Umar, Ahmad; Wang, Yao
2018-05-01
This study reports the supramolecular assembly of functional graphene-based materials with ultrahigh gas sensing performances which are induced by charge transfer enhancement. Two typical Donor-π-Accepter (D-π-A) structure molecules 4-aminoquinoline (4AQ, μ = 3.17 Debye) and 4-hydroxyquinoline (4HQ, μ = 1.98 Debye), with different charge transfer enhancing effects, were selected to modify reduce oxide graphene (rGO) via supramolecular assembly. Notably, compared to the 4HQ-rGO, the 4AQ-rGO exhibits more significant increase of gas response (Ra/Rg = 3.79) toward 10 ppm NO2, which is ascribed to the larger dipole moment (μ) of 4AQ and hence the more intensive enhancing effect of charge transfer on the interface of rGO. Meanwhile, 4AQ-rGO sensors also reveal superior comprehensive gas sensing performances, including excellent gas sensing selectivity, linearity, repeatability and stability. It is believed that the present work demonstrates an effective supramolecular approach of modifying rGO with strong dipoles to significantly improve gas sensing properties of graphene-based materials.
Digital Repository Service at National Institute of Oceanography (India)
Ramprasad, T.
, not all of them are white like snow. Some hydrates from the deep Gulf of Mexico are richly colored in shades of yellow, orange, or even red. The ice-like masses are beautiful, and contrast with the dull gray of deep sea muds. Hydrates from the Blake... volcanoes and associated gas hydrates: Marine Geology, v. 167, p. 29-42. Milkov, A.V. and R. Sassen, 2001a, Estimate of gas hydrate resource, northwestern Gulf of Mexico continental slope: Marine Geology, v. 179, pp. 71-83. Milkov, A.V., Sassen, R...
48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.
2010-10-01
... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and Health...
Nakai, K.; Hamada, K.; Satoh, Y.; Yoshiie, T.
2011-01-01
The growth and shrinkage of interstitial clusters on {113} planes were investigated in electron irradiated Czochralski grown silicon (Cz-Si), floating-zone silicon (Fz-Si), and impurity-doped Fz-Si (HT-Fz-Si) using a high voltage electron microscope. In Fz-Si, {113} interstitial clusters were formed only near the beam incident surface after a long incubation period, and shrank on subsequent irradiation from the backside of the specimen. In Cz-Si and HT-Fz-Si, {113} interstitial clusters nucleated uniformly throughout the specimen without incubation, and began to shrink under prolonged irradiation at higher electron beam intensity. At lower beam intensity, however, the {113} interstitial cluster grew stably. These results demonstrate that the {113} interstitial cluster cannot grow without a continuous supply of impurities during electron irradiation. Detailed kinetics of {113} interstitial cluster growth and shrinkage in silicon, including the effects of impurities, are proposed. Then, experimental results are analyzed using rate equations based on these kinetics.
Directory of Open Access Journals (Sweden)
Kuang-Ting Cheng
2018-03-01
Full Text Available P-113, which was originally derived from the human saliva protein histatin 5, is a histidine-rich antimicrobial peptide with the sequence AKRHHGYKRKFH. P-113 is currently undergoing phase II clinical trial as a pharmaceutical agent to fight against fungal infections in HIV patients with oral candidiasis. Previously, we developed a new procedure for the high-yield expression and purification of hG31P, an analogue and antagonist of human CXCL8. Moreover, we have successfully removed lipopolysaccharide (LPS, endotoxin associated with hG31P in the expression with Escherichia coli. In this paper, we have used hG31P as a novel fusion protein for the expression and purification of P-113. The purity of the expressed P-113 is more than 95% and the yield is 4 mg P-113 per liter of E. coli cell culture in Luria-Bertani (LB medium. The antimicrobial activity of the purified P-113 was tested. Furthermore, we used circular dichroism (CD and nuclear magnetic resonance (NMR spectroscopy to study the structural properties of P-113. Our results indicate that using hG31P as a fusion protein to obtain large quantities of P-113 is feasible and is easy to scale up for commercial production. An effective way of producing enough P-113 for future clinical studies is evident in this study.
Method of separation of gas mixtures
Energy Technology Data Exchange (ETDEWEB)
Berlin, M.A.; Potapov, V.F.; Potapova, M.S.
1980-04-05
Gas mixtures are separated in a rectification tower by repeated counterflow contact of the heated gas flow and cool condensate as the pressure drops in each stage of separation (StR) and when condensate is added from StR with lower pressure to the StR with higher pressure. In order to reduce energy consumption noncondensing gas in amounts of 5-15 percent by weight of the amount of incoming gases are added. Hydrocarbon or carbon dioxide gas can be used as the latter. Example. To separate natural gas of the Shatlyk deposit of composition, percent by mo1: C1 -- 94.960; C2 -- 4.260; C3 -- 0.200; C4 -- 0.08; C4+B -- 0.51. It is enriched with carbon dioxide gas in an amount of 10 percent by weight. Upon rectification of the enriched hydrocarbon mixture separation is achieved at lower pressures of the gas mixture and less cold. This leads to reduction of energy consumption by 10-12 percent.
9 CFR 113.102 - Leptospira Icterohaemorrhagiae Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Icterohaemorrhagiae... REQUIREMENTS Inactivated Bacterial Products § 113.102 Leptospira Icterohaemorrhagiae Bacterin. Leptospira Icterohaemorrhagiae Bacterin shall be produced from a culture of Leptospira icterohaemorrhagiae which has been...
Localization of the placenta on gamma chamber with 113m In-lambratene
International Nuclear Information System (INIS)
Shejretova, E.; Blazheva, P.; Kovacheva, S.; Tsanev, Ts.
1977-01-01
The authors describe their experience in applying the radioisotopic method for localization of the placenta on gamma chamber by means of 113m In-lambratene (113m In-cysteamine). This complex is chosen due to its valuable physical characteristics of 113m In as shortliving, with whom lambratene is labelled, with proven irradiation protective properties, with the purpose of lowering irradiation load of the fetus. The authors use unique apparatus, gamma chamber Pho-Gamma HP and conventional scanner during injection of 2 mCi 113m In-lambratene. The authors examined 81 women, 42 of whom were pregnant at 6 to 10 months of gestation and 39 women from the third to the fifth month of gestation because of bleedings, Rh isoimmunization with forthcoming amniocentesis, and state after cesarian section for the first group and impending interruption of pregnancy for the second group. The diagnosis of the placenta localization was supported by cesarian section, delivery and interruption of pregnancy. There was 100% coincidence of the diagnosis. (author)
Clinical evaluation of R202Q alteration of MEFV genes in Turkish children.
Comak, Elif; Akman, Sema; Koyun, Mustafa; Dogan, Cagla Serpil; Gokceoglu, Arife Uslu; Arikan, Yunus; Keser, Ibrahim
2014-12-01
To date, over 200 alterations have been reported in Mediterranean fever (MEFV) genes, but it is not clear whether all these alterations are disease-causing mutations. This study aims to evaluate the clinical features of the children with R202Q alteration. The medical records of children with R202Q alteration were reviewed retrospectively. A total of 225 children, with 113 males, were included. Fifty-five patients were heterozygous, 30 patients were homozygous for R202Q, and 140 patients were compound heterozygous. Classical familial Mediterranean fever (FMF) phenotype was present in 113 patients: 2 heterozygous and 7 homozygous R202Q, 46 double homozygous R202Q and M694V, and 58 compound heterozygous. The main clinical characteristics of the patients were abdominal pain in 71.5 %, fever in 37.7 %, arthralgia/myalgia in 30.2 %, arthritis in 10.2 %, chest pain in 14.6 % and erysipelas-like erythema in 13.3 %. The frequency of abdominal pain was significantly lower in patients with homozygous R202Q alteration (p = 0.021), whereas patients with heterozygous R202Q mutations, though not statistically significant, had a higher frequency of arthralgia/myalgia (40.0 %, p = 0.05). R202Q alteration of the MEFV gene leads to symptoms consistent with FMF in some cases. This alteration may be associated with a mild phenotype and shows phenotypic differences other than the common MEFV mutations.
9 CFR 113.452 - Erysipelothrix Rhusiopathiae Antibody.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Antibody... REQUIREMENTS Antibody Products § 113.452 Erysipelothrix Rhusiopathiae Antibody. Erysipelothrix Rhusiopathiae Antibody is a specific antibody product containing antibodies directed against one or more somatic antigens...
Feitzinger, J. V.; Schlosser, W.; Schmidt-Kaler, T.; Winkler, C.
1980-04-01
Photographic observations with the 3,6 m ESO and 0,61 m Bochum telescopes in different colours of the central part of the 30 Doradus Nebula are presented. The structure of the central object R 136 is studied by image analysis methods, i.e. digitalisation and contrast enhancement. The central object R 136 of the supergiant gas nebula 30 Doradus consists of three components; the main component covers an area of (0.7 pc)2. The components show a colour gradient, R 136a being much bluer than R 136c. This composite structure is seen in photographic IR, U and V likewise. A plot of the spectral intensity distribution from λ = 73 cm to 1550 Å of the central 2'.5 × 2'.5 region of 30 Doradus is given. The main contribution in the UV can be attributed to R 136. This object dominates the of the central part of 30 Doradus. It determines together with 16 other bright stars in the center the excitation parameter of the nebula. Its effective temperature lies between 50000 and 55000K and the tipper and lower mass values are 250 and 103 solar masses. The bolometric magnitude is brighter than -l4m. The inner structure of 30 Doradus can be explained as the result of the stellar-wind of R 136.
Molecular analysis of petroleum derived compounds that adsorb onto gas hydrate surfaces
International Nuclear Information System (INIS)
Borgund, Anna E.; Hoiland, Sylvi; Barth, Tanja; Fotland, Per; Askvik, Kjell M.
2009-01-01
Field observations have shown that some streams of water, gas and crude oil do not form gas hydrate plugs during petroleum production even when operating within thermodynamic conditions for hydrate formation. Also, when studied under controlled laboratory conditions, some oils are found to form hydrate dispersed systems whereas others form plugs. Oils with low tendency to form hydrate plugs are believed to contain natural hydrate plug inhibiting components (NICs) that adsorb onto the hydrate surface, making them less water-wet and preventing the particles from agglomerating into large hydrate clusters. The molecular structure of the NICs is currently unknown. In this work, hydrate adsorbing components were extracted from crude oils using freon hydrates as an extraction phase. The fractions were found to be enriched in polar material, and more polar material is associated with hydrates generated in biodegraded crude oils than in non-biodegraded oils. Various fractionation schemes and analytical techniques have been applied in the search for molecular characterisation. The average molecular weights were found to be approximately 500 g/mole. GC-MS chromatograms show a large UCM (Unresolved Complex Mixture). Thus, GC-MS has a limited potential for identification of compounds. A commercial biosurfactant was used as a model compound in the search for similar structures in the extracts. The results from analysis of the hydrate adsorbing components suggest that the type and structure are more important for hydrate morphology than the amount of material adsorbed.
DEFF Research Database (Denmark)
Kofod, Pauli; Bauer, Rogert; Danielsen, Eva
1991-01-01
113Cd nuclear magnetic resonance spectroscopy has been used to investigate the metal binding sites of cadmium-substituted copper,zinc-containing superoxide dismutase from baker's yeast. NMR signals were obtained for 113Cd(II) at the Cu site as well as for 113Cd(II) at the Zn site. The two subunits...
Czech Academy of Sciences Publication Activity Database
Jäger, A.; Vinš, Václav; Gernert, J.; Span, R.; Hrubý, Jan
2013-01-01
Roč. 338, Januar (2013), s. 100-113 ISSN 0378-3812 R&D Projects: GA ČR(CZ) GPP101/11/P046; GA ČR(CZ) GAP101/11/1593 Institutional support: RVO:61388998 Keywords : carbon dioxide * gas hydrate * modeling Subject RIV: BJ - Thermodynamics Impact factor: 2.241, year: 2013 http://www.sciencedirect.com/science/article/pii/S0378381212005158
The Plasmodium protein P113 supports efficient sporozoite to liver stage conversion in vivo.
Offeddu, Vittoria; Rauch, Manuel; Silvie, Olivier; Matuschewski, Kai
2014-02-01
Invasive stages of Plasmodium parasites possess distinct integral and peripheral membrane proteins that mediate host cell attachment and invasion. P113 is an abundant protein in detergent-resistant high molecular weight complexes in Plasmodium schizonts, but is unusual since expression extends to gametocytes and sporozoites. In this study, we tested whether P113 performs important functions for parasite propagation in Plasmodium berghei. We show that pre-erythrocytic expression of P113 displays key signatures of upregulated in infectious sporozoites (UIS) genes, including control by the liver stage master regulator SLARP. Targeted gene deletion resulted in viable blood stage parasites that displayed no signs of blood stage growth defects. p113(-) parasites propagated normally through the life cycle until mature sporozoites, but displayed defects during natural sporozoite transmission, leading to a delay to patency in infected animals. By comparative in vitro and in vivo analysis of pre-erythrocytic development and using a xeno-diagnostic test we show that ablation of P113 results in lower sporozoite to liver stage conversion and, as a consequence, reduced merozoite output in vivo, without delaying liver stage development. We conclude that p113 is dispensable for Plasmodium life cycle progression and plays auxiliary roles during pre-erythrocytic development. Copyright © 2014 Elsevier B.V. All rights reserved.
21 CFR 56.113 - Suspension or termination of IRB approval of research.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Suspension or termination of IRB approval of research. 56.113 Section 56.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... termination of IRB approval of research. An IRB shall have authority to suspend or terminate approval of...
21 CFR 113.83 - Establishing scheduled processes.
2010-04-01
... commercial production runs should be determined on the basis of recognized scientific methods to be of a size... CONTAINERS Production and Process Controls § 113.83 Establishing scheduled processes. Scheduled processes for... production shall be adequately provided for in establishing the scheduled process. Critical factors, e.g...
9 CFR 113.328 - Fowl Laryngotracheitis Vaccine.
2010-01-01
... REQUIREMENTS Live Virus Vaccines § 113.328 Fowl Laryngotracheitis Vaccine. Fowl Laryngotracheitis Vaccine shall be prepared from virus-bearing cell culture fluids or embryonated chicken eggs. Only Master Seed... each serial of modified live virus vaccine shall be tested for safety as provided in this paragraph...
Nucleate boiling heat transfer on horizontal tubes in bundles
International Nuclear Information System (INIS)
Fujital, Y.; Ohta, H.; Hidaka, S.; Nishikawa, K.
1986-01-01
In order to clarify the heat transfer mechanisms of the flooded type horizontal tube bundle evaporator, heat transfer characteristics of tube bundles of experimental scale which consist both of smooth and enhanced tubes were investigated in detail. The experiments of saturated nucleate boiling were performed by using Freon 113 under pressures 0.1 to 1 MPa, and the effects of various parameters, for example, bundle arrangement, heat flux, pressure on the characteristics of an individual tube are clarified. Experimental data is reproduced well by a proposed heat transfer model in which convective heat transfer coefficients due to rising bubbles are estimated as a function of their volumetric flow rate
Performance of a new LMRPC prototype for the STAR MTD system
Energy Technology Data Exchange (ETDEWEB)
Ruan, L.J.; Wang, Y.; Chen, H. S.; Ding, W. C.; Qiu, X. Z.; Wang, J. B.; Zhu, X. L.; Kang, K. J.; Cheng, J. P.; Li, Y. J.; Ruan, L.; Xu, Z.; Asselta, K.; Christie, W.; D' Agostino, C.; Dunlop, J.; Landgraf, J.; Ljubicic, T.; Scheblein, J.; Soja, R.; Tang, A. H.; Ullrich, T.; Crawford, H. J.; Engelage, J.; Sanchez, M. Calderon de la Barca; Reed, R.; Liu, H. D.; Butterworth, J.; Eppley, G.; Geurts, F.; Llope, W. J.; McDonald, D.; Nussbaum, T.; Roberts, J.; Xin, K.; Bridges, L.; Li, J. C.; Qian, S.; Ning, Z.; Chen, H. F.; Huang, B. C.; Li, C.; Shao, M.; Sun, Y. J.; Tang, Z. B.; Wang, X. L.; Xu, Y. C.; Zhang, Z. P.; Zeng, H.; Zhou, Y.; Clarke, R.; Mioduszewski, S.; Davila, A.; Hoffmann, G. W.; Li, L.; Markert, C.; Ray, L.; Schambach, J.; Thein, D.; Wada, M.; Ahammed, Z.; Bhaduri, P. P.; Chattopadhyay, S.; Dubey, A. K.; Dutt-Mazumdar, M. R.; Ghosh, P.; Khan, S. A.; Muhuri, S.; Mohanty, B.; Nayak, T. K.; Pal, S.; Singaraju, R.; Singhal, V.; Tribedy, P.; Viyogi, Y. P.
2011-03-21
A new prototype of a Long-Strip Multi-Gap Resistive Plate Chamber (LMRPC) for the STAR Muon Telescope Detector (MTD) at RHIC has been developed. This prototype has an active area of 52 x 90 cm{sup 2} and consists of six 250 {mu}m wide gaps. Each detector has 12 strips, read-out at both ends, which are each 3.8 cm wide and 90 cm long with 0.6 cm intervals. In cosmic-ray tests, the efficiency was larger than 95% and the time resolution was {approx}75 ps for the 94% Freon, 5% iso-butane, and 1% SF{sub 6} gas mixture. There was good uniformity in the performance across the different strips. The module was also tested in a proton beam at IHEP in Beijing. The efficiency was close to 100% and the best timing resolution achieved was 55 ps for the 90% Freon, 5% iso-butane, and 5% SF6 gas mixture. Trigger scans along and across the strip direction were also performed.
Directory of Open Access Journals (Sweden)
Chabrelie M. F.
2006-12-01
Full Text Available Since the early 1970s, the policies of energy diversification that have been implemented in the industrialized countries and in many developing countries have enabled natural gas to regularly increase its role in the world energy balance. Thus, during the past twenty years, natural gas recorded the highest growth rate among fossil fuels, and its share in the energy market has gradually risen from 18. 9% in 1975 to 23% in 1997. Today, thanks to favorable economic and environmental factors, natural gas has become the fuel of choice on many markets. Indeed, gas is blessed with a certain number of favorable assets (abundant reserves, flexibility, high-performance uses which give it a major role in all energy demand forecast scenarios. The most spectacular development will indisputably take place in the power generation sector. Endowed with a considerable gas potential, the Middle East will represent an essential source of supply for many industrialized countries and several gas export projects, either by LNG tanker or by pipelines are currently being contemplated. During the past decade, the contribution of natural gas to the energy mix also grew substantially in most Middle Eastern countries. The increase in gas demand should continue at a sustained rate, mainly driven by the power generation sector, petrochemicals and energy consumption by the hydrocarbons industry. These promising prospects for gas demand in most of the markets in the region might lead to the development of an intra-regional network. However, although opportunities exist, the region will have to meet many challenges in order to contribute more largely to the world gas balance in the years to come. de diversification énergétique mises en Suvre dans les pays industrialisés et dans de nombreux pays en voie de développement depuis le début des années 1970 ont permis au gaz naturel d'accroître régulièrement sa présence dans le bilan énergétique mondial. Ainsi, au cours des
International Nuclear Information System (INIS)
Adan, L.; Rebollo, D. V.
1978-01-01
The design for the construction of a generator 113 S n -113m l n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs
Energy Technology Data Exchange (ETDEWEB)
Kobayashi, M.; Hosokawa, N.; Watanabe, T. [Tokyo Gas Fundamental Technology Research Lab. (Japan)
2000-07-01
Taking 'damage factor', 'ground response', 'soil pipe interaction', and 'deformability of pipes' as its four key concerns, Tokyo Gas F.T.R.L. is working to clarify the behavior of pipelines during strong earthquakes and improve their earthquake resistance to increase safety levels. In specific terms, Tokyo Gas F.T.R.L. has sought to contribute to earthquake resistance by, for example, conducting pipeline damage forecasts, FEM dynamic response analyses to quantify ground amplification, empirical and analytic studies of forces acting on pipelines, various vibration tests, and tests to determine the deforming behavior of pipes. A further important concern given the limited resources available is the prioritization of the pipes to be made more earthquake resistant. Ultimately, these studies should contribute to more rational and effective seismic design of pipelines and improvement of earthquake resistance both in the case of existing and new facilities and equipment. (authors)
Ksenafontov, Denis N.; Moiseeva, Natalia F.; Khristenko, Lyudmila V.; Karasev, Nikolai M.; Shishkov, Igor F.; Vilkov, Lev V.
2010-12-01
The geometric structure of piracetam was studied by quantum chemical calculations (DFT and ab initio), gas electron diffraction (GED), and FTIR spectroscopy. Two stable mirror symmetric isomers of piracetam were found. The conformation of pyrrolidine ring is an envelope in which the C4 atom deviates from the ring plane, the angle between the planes (C3 sbnd C4 sbnd C5) and (C2 sbnd C3 sbnd C5) is 154.1°. The direction of the deviation is the same as that of the side acetamide group. The piracetam molecule is stabilized in the gas phase by an intramolecular hydrogen bond between the N9H 2 group and the oxygen O6, bonded to C2. The principal structural parameters ( re, Å and ∠e, degrees; uncertainties are 3 σLS values) were found to be: r(С3 sbnd С4) = 1.533(1), r(C4 sbnd C5) = 1.540(1), r(N1 sbnd C5) = 1.456(1), r(C2 sbnd C3) = 1.520(1), r(N1 sbnd C7) = 1.452(1), r(C7 sbnd C8) = 1.537(1), r(N1 sbnd C2) = 1.365(2), r(C8 sbnd N9) = 1.360(2), r(C2 dbnd O6) = 1.229(1), r(C8 dbnd O10) = 1.221(1), ∠C2 sbnd N1 sbnd C5 = 113.4(6), ∠N1 sbnd C2 sbnd C3 = 106.9(6), ∠N1 sbnd C7 sbnd C8 = 111.9(6), ∠C7 sbnd C8 sbnd N9 = 112.5(6), ∠N1 sbnd C2 sbnd O6 = 123.0(4), ∠C3 sbnd N1 sbnd C7 = 120.4(4), ∠C7 sbnd C8 sbnd O10 = 120.2(4), ∠C5 sbnd N1 sbnd C2 sbnd O6 = 170(6), ∠C3 sbnd C2 sbnd N1 sbnd C7 = 178(6), ∠C2 sbnd N1 sbnd C7 sbnd C8 = 84.2, ∠N1 sbnd C7 sbnd C8 sbnd O10 = 111.9.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false What are the special accountability requirements for the gifted and talented program? 39.113 Section 39.113 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE... Talented Programs § 39.113 What are the special accountability requirements for the gifted and talented...
7 CFR 4287.113 - Release of collateral.
2010-01-01
... Loans § 4287.113 Release of collateral. (a) All releases of collateral with a value exceeding $100,000... loan. The Agency may, at its discretion, require an appraisal of the remaining collateral in cases... (a) of this section, lenders may, over the life of the loan, release collateral (other than personal...
An automated system for selective fission product separations; decays of 113-115Pd
International Nuclear Information System (INIS)
Meikrantz, D.H.; Gehrke, R.J.; McIsaac, L.D.; Baker, J.D.; Greenwood, R.C.
1981-01-01
A microcomputer controlled radiochemical separation system has been developed for the isolation and study of fission products with half-lives of approx. >= 10 s. The system is based upon solvent extraction with three centrifugal contactors coupled in series, which provides both rapid and highly efficient separations with large decontamination factors. This automated system was utilized to study the radioactive decays of 113-115 Pd via solvent extraction of the Pd-dimethylglyoxime complex from 252 Cf fission products. As a result of this effort, γ-rays associated with the decay of approx. equal to 90-s sup(113,113m)Pd, 149-s 114 Pd and 47-s 115 Pd have been identified. The isotopic assignments to each of these Pd radioactivities have been confirmed from observation of the growth and decay curves of their respective Ag daughters. In addition, previously unreported Ag γ-rays have been assigned; one to the decay of 69-s 113 Ag, and two to the decay of 19-s 115 Ag. (orig.)
Development of a natural Gas Systems Analysis Model (GSAM)
International Nuclear Information System (INIS)
Godec, M.; Haas, M.; Pepper, W.; Rose, J.
1993-01-01
Recent dramatic changes in natural gas markets have significant implications for the scope and direction of DOE's upstream as well as downstream natural gas R ampersand D. Open access transportation changes the way gas is bought and sold. The end of the gas deliverability surplus requires increased reserve development above recent levels. Increased gas demand for power generation and other new uses changes the overall demand picture in terms of volumes, locations and seasonality. DOE's Natural Gas Strategic Plan requires that its R ampersand D activities be evaluated for their ability to provide adequate supplies of reasonably priced gas. Potential R ampersand D projects are to be evaluated using a full fuel cycle, benefit-cost approach to estimate likely market impact as well as technical success. To assure R ampersand D projects are evaluated on a comparable basis, METC has undertaken the development of a comprehensive natural gas technology evaluation framework. Existing energy systems models lack the level of detail required to estimate the impact of specific upstream natural gas technologies across the known range of geological settings and likely market conditions. Gas Systems Analysis Model (GSAM) research during FY 1993 developed and implemented this comprehensive, consistent natural gas system evaluation framework. Rather than a isolated research activity, however, GSAM represents the integration of many prior and ongoing natural gas research efforts. When complete, it will incorporate the most current resource base description, reservoir modeling, technology characterization and other geologic and engineering aspects developed through recent METC and industry gas R ampersand D programs
Biological effects of tandem shock waves demonstrated on magnetic resonance
Czech Academy of Sciences Publication Activity Database
Beneš, J.; Zeman, J.; Poučková, P.; Zadinová, M.; Šunka, Pavel; Lukeš, Petr
Roč. 113, č. 6 ( 2012 ), s. 335-338 ISSN 0006-9248 R&D Projects: GA ČR GA202/09/1151 Institutional research plan: CEZ:AV0Z20430508 Keywords : electrical discharges in water * focused shock waves * cavitations * tandem shock waves Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.472, year: 2012
Ground state properties of new element Z=113 and its alpha decay chain
International Nuclear Information System (INIS)
Tai Fei; Chen Dinghan; Xu Chang; Ren Zhongzhou
2005-01-01
The authors investigate the ground state properties of the new element 278 113 and of the α-decay chain with different models, where the new element Z=113 has been produced at RIKEN in Japan by cold-fusion reaction. The experimental decay energies are reproduced by the deformed relativistic mean-field model, by the Skyrme-Hartree-Fock (SHF) model, and by the macroscopic-microscopic model. Theoretical half-lives also reasonably agree with the data. Calculations further show that prolate deformation is important for the ground states of the nuclei in the α-decay chain of 278 113. The common points and differences among different models are compared and discussed. (author)
International survey on gas technology organizations
International Nuclear Information System (INIS)
1994-11-01
The International Survey on Gas Technology Organizations has been prepared by the IEA International Centre for Gas Technology Information. 172 companies and R and D Institutions from 41 countries have contributed to the survey. The objective of the Survey is to develop an overview of identified organizations active in the development of new gas technology. As a quick reference guide the survey offers you short descriptions of a number of the most important organizations within gas technology on a world wide basis. Many R and D institutions around the world are working with topics of relevance to the gas industry. New gas technology draws on many different scientific and technical disciplines. This first issue of the survey includes only a part of the numerous organizations and institutions active within the development of new technology of relevance to the gas industry. The preparation of this survey has been a first step in the development of the information activities of the Centre. The information regarding organizations with R and D activities of relevance to the gas industry will continuously be expanded and updated for internal use in the Centre and will also be available to external users. The Centre plans to establish on-line access to these update versions during 1995. (EG)
Characterization of the genome of the dairy Lactobacillus helveticus bacteriophage {Phi}AQ113.
Zago, Miriam; Scaltriti, Erika; Rossetti, Lia; Guffanti, Alessandro; Armiento, Angelarita; Fornasari, Maria Emanuela; Grolli, Stefano; Carminati, Domenico; Brini, Elena; Pavan, Paolo; Felsani, Armando; D'Urzo, Annalisa; Moles, Anna; Claude, Jean-Baptiste; Grandori, Rita; Ramoni, Roberto; Giraffa, Giorgio
2013-08-01
The complete genomic sequence of the dairy Lactobacillus helveticus bacteriophage ΦAQ113 was determined. Phage ΦAQ113 is a Myoviridae bacteriophage with an isometric capsid and a contractile tail. The final assembled consensus sequence revealed a linear, circularly permuted, double-stranded DNA genome with a size of 36,566 bp and a G+C content of 37%. Fifty-six open reading frames (ORFs) were predicted, and a putative function was assigned to approximately 90% of them. The ΦAQ113 genome shows functionally related genes clustered together in a genome structure composed of modules for DNA replication/regulation, DNA packaging, head and tail morphogenesis, cell lysis, and lysogeny. The identification of genes involved in the establishment of lysogeny indicates that it may have originated as a temperate phage, even if it was isolated from natural cheese whey starters as a virulent phage, because it is able to propagate in a sensitive host strain. Additionally, we discovered that the ΦAQ113 phage genome is closely related to Lactobacillus gasseri phage KC5a and Lactobacillus johnsonii phage Lj771 genomes. The phylogenetic similarities between L. helveticus phage ΦAQ113 and two phages that belong to gut species confirm a possible common ancestral origin and support the increasing consideration of L. helveticus as a health-promoting organism.
International Nuclear Information System (INIS)
1995-09-01
The Solid Waste Retrieval Facility--Phase 1 (Project W113) will provide the infrastructure and the facility required to retrieve from Trench 04, Burial ground 4C, contact handled (CH) drums and boxes at a rate that supports all retrieved TRU waste batching, treatment, storage, and disposal plans. This includes (1) operations related equipment and facilities, viz., a weather enclosure for the trench, retrieval equipment, weighing, venting, obtaining gas samples, overpacking, NDE, NDA, shipment of waste and (2) operations support related facilities, viz., a general office building, a retrieval staff change facility, and infrastructure upgrades such as supply and routing of water, sewer, electrical power, fire protection, roads, and telecommunication. Title I design for the operations related equipment and facilities was performed by Raytheon/BNFL, and that for the operations support related facilities including infrastructure upgrade was performed by KEH. These two scopes were combined into an integrated W113 Title II scope that was performed by Raytheon/BNFL. Volume 1 provides a comprehensive narrative description of the proposed facility and systems, the basis for each of the systems design, and the engineering assessments that were performed to support the technical basis of the Title II design. The intent of the system description presented is to provide WHC an understanding of the facilities and equipment provided and the A/E's perspective on how these systems will operate
International Nuclear Information System (INIS)
Bosetti, Valentina; Carraro, Carlo; Massetti, Emanuele; Tavoni, Massimo
2008-01-01
It is now widely recognized that technological change will play a substantial role in reducing GHG emissions without compromising economic growth; hence, any better understanding of the process of technological innovation is likely to increase our knowledge of mitigation possibilities and costs. This paper explores how international knowledge flows affect the dynamics of the domestic R and D sector and the main economic and environmental variables. The analysis is performed using WITCH, a dynamic regional model of the world economy, in which energy-related technological change is endogenous. The focus is on disembodied energy R and D international spillovers. The knowledge pool from which regions draw foreign ideas differs between High Income and Low Income countries. Absorption capacity is also endogenous in the model. The basic questions are as follows. Do knowledge spillovers enhance energy-related technological innovation in different regions of the world? Does the speed of innovation increase? Or do free-riding incentives prevail and international spillovers crowd out domestic R and D efforts? What is the role of domestic absorption capacity and of policies designed to enhance it? Do greenhouse gas stabilization costs drop in the presence of international technological spillovers? The new specification of the WITCH model presented in this paper enables us to answer these questions. Our analysis shows that international knowledge spillovers tend to increase free-riding incentives and decrease the investments in energy R and D. The strongest cuts in energy R and D investments are recorded among High Income countries, where international knowledge flows crowd out domestic R and D efforts. The overall domestic pool of knowledge, and thus total net GHG stabilization costs, remain largely unaffected. International spillovers, however, are also an important policy channel. We therefore analyze the implication of a policy-mix in which climate policy is combined with a
Reagent' sets for the concentration of sup(99m)Tc and sup(113m)In
International Nuclear Information System (INIS)
Bianco de Salas, G.N.; Arciprete, J.; Mitta, A.E.A.
1976-10-01
A simple technique for the concentration of the eluates from 99 Mo/sup(99m)Tc and 113 Sn/sup(113m)In generators is described. The reagents' sets provided by the C.N.E.A. for the labelling of different radiopharmaceuticals can be used by only reducing their volumes proportionally. Both concentration techniques for Tc-99m and In-113m will be supplied to users as reagents' sets. (author) [es
In vivo red blood cell compatibility testing using indium-113m tropolone-labeled red blood cells
International Nuclear Information System (INIS)
Morrissey, G.J.; Gravelle, D.; Dietz, G.; Driedger, A.A.; King, M.; Cradduck, T.D.
1988-01-01
In vivo radionuclide crossmatch is a method for identifying compatible blood for transfusion when allo- or autoantibodies preclude the use of conventional crossmatching techniques. A technique for labeling small volumes of donor red blood cells with [/sup 113m/In]tropolone is reported. The use of /sup 113m/In minimizes the accumulation of background radioactivity and the radiation dose especially so when multiple crossmatches are performed. Labeling red cells with [/sup 113m/In]tropolone is faster and easier to perform than with other radionuclides. Consistently high labeling efficiencies are obtained and minimal /sup 113m/In activity elutes from the labeled red blood cells. A case study involving 22 crossmatches is presented to demonstrate the technique. The radiation dose equivalent from /sup 113m/In is significantly less than with other radionuclides that may be used to label red cells
47 CFR 15.113 - Power line carrier systems.
2010-10-01
....113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL RADIO FREQUENCY DEVICES Unintentional... shall submit the details of all existing systems plus any proposed new systems or changes to existing... operation on electric lines which connect the distribution substation to the customer or house wiring. Such...
Anticandida Activity Is Retained in P-113, a 12-Amino-Acid Fragment of Histatin 5
Rothstein, David M.; Spacciapoli, Peter; Tran, Linh T.; Xu, Tao; Roberts, F. Donald; Dalla Serra, Mauro; Buxton, Deborah K.; Oppenheim, Frank G.; Friden, Phillip
2001-01-01
Through the analysis of a series of 25 peptides composed of various portions of the histatin 5 sequence, we have identified P-113, a 12-amino-acid fragment of histatin 5, as the smallest fragment that retains anticandidal activity comparable to that of the parent compound. Amidation of the P-113 C terminus increased the anticandidal activity of P-113 approximately twofold. The three histidine residues could be exchanged for three hydrophobic residues, with the fragment retaining anticandidal ...
Shear deformation and relaxed lattice constant of (Ga,Mn)As layers on GaAs(113)A
Energy Technology Data Exchange (ETDEWEB)
Dreher, Lukas; Daeubler, Joachim; Glunk, Michael; Schoch, Wladimir; Limmer, Wolfgang; Sauer, Rolf [Institut fuer Halbleiterphysik, Universitaet Ulm, D-89069 Ulm (Germany)
2008-07-01
The shear deformation and the relaxed lattice constant of compressively strained (Ga,Mn)As layers with Mn concentrations of up to 5%, pseudomorphically grown on GaAs(113)A and GaAs(001) substrates by low-temperature molecular-beam epitaxy, have been studied by high resolution X-ray diffraction (HRXRD) measurements. Rocking curves reveal a triclinic distortion of the (113)A layers with a shear direction towards the [001] crystallographic axis, whereas the (001) layers are tetragonally distorted along [001]. The relaxed lattice constants were derived from {omega}-2{theta} scans for the symmetric (113) and (004) Bragg reflections, taking the elastic anisotropy of the cubic system into account. The increase of the lattice constant with Mn content has been found to be smaller for the (113)A layers than for the (001) layers, presumably due to the enhanced amount of excess As in the (113)A layers.
14 CFR 152.113 - Application requirements: Airport planning.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Application requirements: Airport planning....113 Application requirements: Airport planning. (a) Application for Federal assistance. An eligible sponsor or planning agency that desires to obtain Federal aid for eligible airport master planning or...
9 CFR 113.213 - Pseudorabies Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pseudorabies Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.213 Pseudorabies Vaccine, Killed Virus. Pseudorabies Vaccine, Killed...
Nonlinear mirror mode dynamics: Simulations and modeling
Czech Academy of Sciences Publication Activity Database
Califano, F.; Hellinger, Petr; Kuznetsov, E.; Passot, T.; Sulem, P. L.; Trávníček, Pavel
2008-01-01
Roč. 113, - (2008), A08219/1-A08219/20 ISSN 0148-0227 R&D Projects: GA AV ČR IAA300420702; GA AV ČR IAA300420602 Grant - others:PECS(CZ) 98024 Institutional research plan: CEZ:AV0Z30420517 Keywords : mirror instability * nonlinear evolution * numerical simulations * magnetic holes * mirror structures * kinetic plasma instabilities Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.147, year: 2008
Nakai, K.; Hamada, K.; Satoh, Y.; Yoshiie, T.
2011-01-01
The growth and shrinkage of interstitial clusters on {113} planes were investigated in electron irradiated Czochralski grown silicon (Cz-Si), floating-zone silicon (Fz-Si), and impurity-doped Fz-Si (HT-Fz-Si) using a high voltage electron microscope. In Fz-Si, {113} interstitial clusters were formed only near the beam incident surface after a long incubation period, and shrank on subsequent irradiation from the backside of the specimen. In Cz-Si and HT-Fz-Si, {113} interstitial clusters nucle...
International Nuclear Information System (INIS)
Yang Yuqing; Luo Shunzhong; Wang Guanquan; He Jiaheng; Bing Wenzeng; Pu Manfei; Wei Hongyuan; Wang Wenjin
2004-01-01
Apparent partition coefficient in octanol-water and binding percentage to BSA of 153 Sm-NTMP, 153 Sm-HEDTMP, 153 Sm-DCTMP, 153 Sm-EDTMP, 153 Sm-DTPMP, 113,117 Sn m -EDTMP, 113,117 Sn m -HEDTMP, 113,117 Sn m -DTPMP are measured. The results show that there is a linear relationship between the relative magnitude of the apparent partition coefficient in octanol-water and the relative magnitude of the binding percentage to BSA of these 153 Sm( 113,117 Sn m ) complexes. This linear relationship provides a new method for determination of the apparent partition coefficient in octanol-water of 153 Sm( 113,117 Sn m ) complexes of this kind. This linear relationship also implicates that hydrophobic force plays an important role in the binding of 153 Sm( 113,117 Sn m ) complexes to BSA
Directory of Open Access Journals (Sweden)
Hongyan Wang
2018-01-01
Full Text Available Periodontal disease consists of chronic gingival inflammation characterized by both degradation of the periodontal connective tissue and alveolar bone loss. Drug therapy is used as an auxiliary treatment method in severe chronic periodontitis, aggressive periodontitis, and periodontitis-associated systemic disease. Nal-P-113, a modified antimicrobial peptide, specifically replaces the histidine residues of P-113 with the bulky amino acid β-naphthylalanine, and our previous studies have verified that this novel peptide is not toxic to the human body within a certain concentration range. The objective of the present study was to evaluate the effect of Nal-P-113 on periodontal pathogens and periodontal status in clinical studies. In a split-mouth clinical trial, the pocket depth and bleeding index values tended to decrease in the experimental group compared with those in the control group. SEM results verified that Nal-P-113 restrained the maturation of plaque. Based on real-time polymerase chain reaction, the levels of Fusobacterium nucleatum, Streptococcus gordonii, Treponema denticola, and Porphyromonas gingivalis in subgingival plaque were decreased when the subjects were given Nal-P-113. Bacterial growth curve analysis and a biofilm susceptibility assay verified that Nal-P-113 at a concentration of 20 μg/mL restrained the growth of S. gordonii, F. nucleatum, and P. gingivalis and biofilm formation. Therefore, Nal-P-113 effectively reduces periodontal pathogens and ameliorates periodontal status.
9 CFR 113.28 - Detection of mycoplasma contamination.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of mycoplasma contamination... REQUIREMENTS Standard Procedures § 113.28 Detection of mycoplasma contamination. The heart infusion test, using... for mycoplasma contamination is prescribed in an applicable Standard Requirement or in the filed...
20 CFR 726.113 - Disclosure of confidential information.
2010-04-01
... MINE OPERATOR'S INSURANCE Authorization of Self-Insurers § 726.113 Disclosure of confidential... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Disclosure of confidential information. 726... authorized self-insurer or applicant for the authorization of self-insurance obtained by the Office shall be...
7 CFR 1421.113 - Recourse marketing assistance loans.
2010-01-01
... assistance loan collateral may not be delivered or forfeited to CCC in satisfaction of the loan indebtedness... 7 Agriculture 10 2010-01-01 2010-01-01 false Recourse marketing assistance loans. 1421.113 Section... CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS GRAINS AND SIMILARLY HANDLED...
Self-Test Procedures for Gas Sensors Embedded in Microreactor Systems.
Helwig, Andreas; Hackner, Angelika; Müller, Gerhard; Zappa, Dario; Sberveglieri, Giorgio
2018-02-03
Metal oxide (MOX) gas sensors sensitively respond to a wide variety of combustible, explosive and poisonous gases. However, due to the lack of a built-in self-test capability, MOX gas sensors have not yet been able to penetrate safety-critical applications. In the present work we report on gas sensing experiments performed on MOX gas sensors embedded in ceramic micro-reaction chambers. With the help of an external micro-pump, such systems can be operated in a periodic manner alternating between flow and no-flow conditions, thus allowing repetitive measurements of the sensor resistances under clean air, R 0 , and under gas exposure, R g a s , to be obtained, even under field conditions. With these pairs of resistance values, eventual drifts in the sensor baseline resistance can be detected and drift-corrected values of the relative resistance response R e s p = ( R 0 - R g a s ) / R 0 can be determined. Residual poisoning-induced changes in the relative resistance response can be detected by reference to humidity measurements taken with room-temperature-operated capacitive humidity sensors which are insensitive to the poisoning processes operative on heated MOX gas sensors.
23 CFR 635.113 - Bid opening and bid tabulations.
2010-04-01
... CONSTRUCTION AND MAINTENANCE Contract Procedures § 635.113 Bid opening and bid tabulations. (a) All bids... contractors, during the period following the opening of bids and before the award of the contract shall not be...
Energy Technology Data Exchange (ETDEWEB)
Wethington, Jr, John A [Lawrence Radiation Laboratory, University of California, Livermore, CA (United States)
1970-05-15
Decontamination of the products from gas wells stimulated by nuclear explosions requires the removal of T, present as HT, CH{sub 3}T, C{sub 2}H{sub 5}T, etc., and {sup 85}Kr from the production stream. Flaring of large volumes of gas from the Gasbuggy well led to the replacement of radioactive cavity gas with inactive formation gas, but this would not be a satisfactory production procedure because it releases T and {sup 85}Kr into the atmosphere and wastes large amounts of product gas. Exchange reactions appear to offer promise for removing the tritium. For example, water or steam flowing countercurrent to tritiated gas in the presence of a suitable catalyst can participate in the exchange reactions CH{sub 3}T + H{sub 2}O {r_reversible} CH{sub 4} + HTO, HT + H{sub 2}O {r_reversible} H{sub 2} + HTO, resulting in the transfer of T from gas into water. Other possibilities for utilizing exchange reactions include exchange of the gas with ethylene glycol used in the gas dryer, with silicate rocks introduced into the gas stream, or with a countercurrent stream of NH{sub 3} or H{sub 2}S. As another approach, use of the contaminated gas for the manufacture of ammonia synthesis gas has potential for removal of both T and {sup 85}Kr. (author)
Abdelfatah, Eihab; Page, Andrew; Sacks, Justin; Pierorazio, Phillip; Bivalacqua, Trinity; Efron, Jonathan; Terezakis, Stephanie; Gearhart, Susan; Fang, Sandy; Safar, Bashar; Pawlik, Timothy M; Armour, Elwood; Hacker-Prietz, Amy; Herman, Joseph; Ahuja, Nita
2017-06-01
Intraoperative radiotherapy (IORT) has advantages over external beam radiation therapy (EBRT). Few studies have described side effects associated with its addition. We evaluated our institution's experience with abdominopelvic IORT to assess safety by postoperative complication rates. Prospectively collected IRB-approved database of all patients receiving abdominopelvic IORT (via high dose rate brachytherapy) at Johns Hopkins Hospital between November 2006 and May 2014 was reviewed. Patients were discussed in multidisciplinary conferences. Those selected for IORT were patients for whom curative intent resection was planned for which IORT could improve margin-negative resection and optimize locoregional control. Perioperative complications were classified via Clavien-Dindo scale for postoperative surgical complications. A total of 113 patients were evaluated. Most common diagnosis was sarcoma (50/113, 44%) followed by colorectal cancer (45/113, 40%), most of which were recurrent (84%). There were no perioperative deaths. A total of 57% of patients experienced a complication Grade II or higher: 24% (27/113) Grade II; 27% (30/113) Grade III; 7% (8/113) Grade IV. Wound complications were most common (38%), then gastrointestinal (25%). No radiotherapy variables were significantly associated with complications on uni/multi-variate analysis. Our institution's experience with IORT demonstrated historically expected postoperative complication rates. IORT is safe, with acceptable perioperative morbidity. © 2017 Wiley Periodicals, Inc.
Gas-cooled breeder reactor safety
Energy Technology Data Exchange (ETDEWEB)
Chermanne, J.; Burgsmueller, P. [Societe Belge pour l' Industrie Nucleaire, Brussels
1981-01-15
The European Association for the Gas-cooled Breeder Reactor (G B R A), set-up in 1969 prepared between 1972 and 1974 a 1200 MWe Gas-cooled Breeder Reactor (G B R) commercial reference design G B R 4. It was then found necessary that a sound and neutral appraisal of the G B R licenseability be carried out. The Commission of the European Communities (C E C) accepted to sponsor this exercise. At the beginning of 1974, the C E C convened a group of experts to examine on a Community level, the safety documents prepared by the G B R A. A working party was set-up for that purpose. The experts examined a ''Preliminary Safety Working Document'' on which written questions and comments were presented. A ''Supplement'' containing the answers to all the questions plus a detailed fault tree and reliability analysis was then prepared. After a final study of this document and a last series of discussions with G B R A representatives, the experts concluded that on the basis of the evidence presented to the Working Party, no fundamental reasons were identified which would prevent a Gas-cooled Breeder Reactor of the kind proposed by the G B R A achieving a satisfactory safety status. Further work carried out on ultimate accident have confirmed this conclusion. One can therefore claim that the overall safety risk associated with G B R s compares favourably with that of any other reactor system.
Conceptual design and feasibility test of two-phase hydrogen thermal siphon system of CNS in CARR
International Nuclear Information System (INIS)
Bi Qincheng; Chen Tingkuan; Feng Quanke; Du Shejiao; Li Xiaoming; Wei Liang
2004-01-01
Conceptual design of the hydrogen system of cold neutron source (CNS) in China Advanced Research Reactor (CARR) was proposed, and feasibility test was carried out. In order to determine the void fraction in neutron moderator, the circulation ability of the two-phase hydrogen thermal siphon system, and the structure of components of the CNS, the mockup test was performed using Freon-113 as working fluid. To obtain the modeling criterion so that the above experimental results can be applied to the design of CARR, the bubble rising velocities in different liquids were investigated to study the effects of physical properties such as density, viscosity and surface tension on bubble rising velocity, void fraction and circulation ability
The boiling crisis in a subcooled liquid flowing in a vertical annular channel
International Nuclear Information System (INIS)
Passos, J.C.
1989-01-01
Experimental results concerning the critical heat flux density for a variety of forced flow conditions of Freon 113 in a circular annular channel of 3 mm width and 107 mm length when the inside wall is heated are presented. The flow configurations were also visualized prior and during the boiling crisis. For inlet liquid velocities equal or larger than 0.041 m/s, the correlated dimensionless data extends the range of validity of those of Katto for relatively much longer tubes. A simple balance of forces over a bubble attached to the wall shows that, for smaller velocities, the gravity effect has to be taken into account in the establishment of a more general correlation. (author)
9 CFR 113.30 - Detection of Salmonella contamination.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of Salmonella contamination... REQUIREMENTS Standard Procedures § 113.30 Detection of Salmonella contamination. The test for detection of Salmonella contamination provided in this section shall be conducted when such a test is prescribed in an...
9 CFR 113.32 - Detection of Brucella contamination.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of Brucella contamination... REQUIREMENTS Standard Procedures § 113.32 Detection of Brucella contamination. The test for detection of Brucella contamination provided in this section shall be conducted when such a test is prescribed in an...
24 CFR 3280.113 - Glass and glazed openings.
2010-04-01
... glazing material is considered to be any glazing material capable of passing the requirements of Safety... URBAN DEVELOPMENT MANUFACTURED HOME CONSTRUCTION AND SAFETY STANDARDS Planning Considerations § 3280.113... shall meet the requirements of § 3280.403 the “Standard for Windows and Sliding Glass Doors Used in...
Evidence for the presence of Freon 21 in the atmosphere
Energy Technology Data Exchange (ETDEWEB)
Crescentini, G.; Bruner, F.
1979-05-24
Results obtained using gas chromatography-mass fragmentography for the analysis of F21 in atmospheric samples of country areas in the regions of Urbino and Rome are reported. Fifteen samples trapped both in Rome and Urbino were analyzed by GC-mass fragmentography and F21 was found in each sample. These results show that F21 is actually present in the atmosphere and cannot be considered as an experimental artifact.
Gas tagging system development in Japan
International Nuclear Information System (INIS)
Sekiguchi, N.; Rindo, H.; Akiyama, T.; Miyazawa, T.; Heki, H.
1981-05-01
The Gas tagging method has been considered to be most desirable for a failed fuel location system for the fast breeder reactor, regarding the component reduction in the reactor vessel and rapid location during reactor operation. The gas tagging system has been designed by referring to R and D results obtained in Japan and other countries. The designed system is comprised of tag gas filling pins, cover gas sampling system, tag gas recovery and enrichment system, tag gas analyzer and system control and data handling computers. The main specifications for this system have been decided as follows; 1) Main function is location of failed fuels in core and a part of blanket region, 2) Identification capability is each subassembly, 3) Time for identification is within a few days, 4) Continuous operation with automatic start at fuel failure, 5) Detection sensitivity must cover both gas leak and pin burst. In designing the gas tagging system, the following R and D items were selected; 1) System design study, 2) Tag gas capsule development, 3) Modeling the tag gas behavior in reactor primary cooling system, 4) Tag gas recovery and enrichment system, 5) Computer code development for tag gas isotope ratio change estimation. Details of the Japanese gas tagging system development appear in this paper. (author)
International Nuclear Information System (INIS)
Anderson, Crystal N.; Meier, David S.; Ott, Jürgen; Hughes, Annie; Wong, Tony; Looney, Leslie; Henkel, Christian; Chen, Rosie; Indebetouw, Remy; Muller, Erik; Pineda, Jorge L.; Seale, Jonathan
2014-01-01
We present parsec-scale interferometric maps of HCN(1-0) and HCO + (1-0) emission from dense gas in the star-forming region 30 Doradus, obtained using the Australia Telescope Compact Array. This extreme star-forming region, located in the Large Magellanic Cloud (LMC), is characterized by a very intense ultraviolet ionizing radiation field and sub-solar metallicity, both of which are expected to impact molecular cloud structure. We detect 13 bright, dense clumps within the 30 Doradus-10 giant molecular cloud. Some of the clumps are aligned along a filamentary structure with a characteristic spacing that is consistent with formation via varicose fluid instability. Our analysis shows that the filament is gravitationally unstable and collapsing to form stars. There is a good correlation between HCO + emission in the filament and signatures of recent star formation activity including H 2 O masers and young stellar objects (YSOs). YSOs seem to continue along the same direction of the filament toward the massive compact star cluster R136 in the southwest. We present detailed comparisons of clump properties (masses, linewidths, and sizes) in 30Dor-10 to those in other star forming regions of the LMC (N159, N113, N105, and N44). Our analysis shows that the 30Dor-10 clumps have similar masses but wider linewidths and similar HCN/HCO + (1-0) line ratios as clumps detected in other LMC star-forming regions. Our results suggest that the dense molecular gas clumps in the interior of 30Dor-10 are well shielded against the intense ionizing field that is present in the 30 Doradus region.
9 CFR 113.27 - Detection of extraneous viable bacteria and fungi in live vaccines.
2010-01-01
... bacteria and fungi in live vaccines. 113.27 Section 113.27 Animals and Animal Products ANIMAL AND PLANT... bacteria and fungi in live vaccines. Unless otherwise specified by the Administrator or elsewhere exempted... Seed Bacteria shall be tested for extraneous viable bacteria and fungi as prescribed in this section. A...
2010-07-01
... control information label and engine identification number. 91.113 Section 91.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF EMISSIONS FROM... certification—emission control information label and engine identification number. (a) The engine manufacturer...
Measurement of placental blood flow by the sup(113m)In accumulation method
International Nuclear Information System (INIS)
Olkkonen, H.; Suonio, S.
1976-01-01
The present work introduces the use of isotope In-113m in the assessment of placental blood flow. It is almost completely bound to plasma transferrin. Owing to this and its short half-life, In-113m introduces considerably slighter radiation dose to the fetus than Tc-99m. A typical tracer appearance curve is given and the In accumulation index is calculated. (M.S.)
pH-dependent absorption spectra of rhodopsin mutant E113Q: On the role of counterions and protein
Xie, Peng; Zhou, Panwang; Alsaedi, Ahmed; Zhang, Yan
2017-03-01
The absorption spectra of bovine rhodopsin mutant E113Q in solutions were investigated at the molecular level by using a hybrid quantum mechanics/molecular mechanics (QM/MM) method. The calculations suggest the mechanism of the absorption variations of E113Q at different pH values. The results indicate that the polarizations of the counterions in the vicinity of Schiff base under protonation and unprotonation states of the mutant E113Q would be a crucial factor to change the energy gap of the retinal to tune the absorption spectra. Glu-181 residue, which is close to the chromophore, cannot serve as the counterion of the protonated Schiff base of E113Q in dark state. Moreover, the results of the absorption maximum in mutant E113Q with the various anions (Cl-, Br-, I- and NO3-) manifested that the mutant E113Q could have the potential for use as a template of anion biosensors at visible wavelength.
Heat-pump cool storage in a clathrate of freon
Tomlinson, J. J.
Presented are the analytical description and assessment of a unique heat pump/storage system in which the conventional evaporator of the vapor compression cycle is replaced by a highly efficient direct contract crystallizer. The thermal storage technique requires the formation of a refrigerant gas hydrate (a clathrate) and exploits an enthalpy of reaction comparable to the heat of fusion of ice. Additional system operational benefits include cool storage at the favorable temperatures of 4 to 7 C (40 to 45 F), and highly efficient heat transfer ates afforded by he direct contact mechanism. In addition, the experimental approach underway at ORNL to study such a system is discussed.
Energy Technology Data Exchange (ETDEWEB)
Clausen, T.
2006-11-15
In the work presented here Ge nano-structures on Si(113) substrates have been grown by adsorbate-mediated epitaxy at sample temperatures between 400 C and 700 C. The Ge nano-islands and nano-layers have been investigated regarding their atomic reconstruction, morphology, strain state, chemical composition and defect structure. Various in-situ and ex-situ experimental techniques have been used, as there are low-energy electron diffraction, low-energy electron microscopy, X-ray photoemission electron microscopy, spot profile analysis low-energy electron diffraction, grazing incidence X-ray diffraction, scanning tunneling microscopy, atomic force microscopy, scanning electron microscopy and transmission electron microscopy. On a clean Si(113) surface Ge preferentially nucleates at surface step edges and forms a wetting layer exhibiting a Ge-(2 x 2) surface reconstruction. With increasing growth temperature the Ge islands are elongated in the [33 anti 2] direction. Simultaneously, the average island size increases with decreasing island density. From the Arrhenius-like behaviour of the island density, a Ge adatom diffusion barrier height of about 0.53 eV is deduced. At 600 C the Si concentration of the islands amounts to about 41% and the residual lattice strain of the islands is found to about 23 %. The adsorption of Gallium on a clean Si(113) substrate leads to the formation of well ordered surface facets in the [1 anti 10] direction with a periodicity of about 43 nm in the [33 anti 2] direction. From reciprocal space maps in different ({kappa} {sub perpendicular} {sub to} -{kappa} {sub parallel}) planes both facet angles are determined to be about 9.8 with respect to the [113] direction. Thus the facet orientations are identified to be (112) and (115), showing (6 x 1) and (4 x 1) surface reconstructions, respectively. Ge deposition on the faceted Si(113) leads to a high density of ordered 3D Ge nano-islands beaded at the surface facets. The size of these islands is
Energy Technology Data Exchange (ETDEWEB)
Happell, J.D.; Wallace, D.W.R.; Wills, K.D.; Wilke, R.J.; Neill, C.C.
1996-06-01
This report describes an automated, accurate, precise and sensitive capillary column purge- and -trap method capable of quantifying CFC-12, CFC-11, CFC-113, CH{sub 3}CCL{sub 3}, and CCL{sub 4} during a single chromatographic analysis in either water or gas phase samples.
9 CFR 113.10 - Testing of bulk material for export or for further manufacture.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing of bulk material for export or for further manufacture. 113.10 Section 113.10 Animals and Animal Products ANIMAL AND PLANT HEALTH... manufacture. When a product is prepared in a licensed establishment for export in large multiple-dose...
International Nuclear Information System (INIS)
Hohloch, M.
1980-01-01
The complex formation of double labelling of bivalent 113 Sn and reduced, quadrovalent sup(99m)Tc with pyrophosphate (PPi) or ethane hydroxy diphosphorate (EHDP) has been investigated by means of in vivo distribution in the rat. The molar rates of sup(99m)Tc and 113 Sn to PPi resp. EHDP, as well as the pH-value and the initial concentration is varied. Furthermore, both elements were oxidized with H 2 O 2 in the alkaline medium. Four typical sup(99m)Tc and two typical 113 Sn in-vivo distribution patterns can be differentiated: 1. Pertechnetate, characterized by a strong enrichment in the stomach, forms when all Sn-II has been oxidized to Sn-IV in the preparation. 2. One bone-seeking 113 Sn-II PPi (EHDP) complex and a sup(99m)Tc-IV PPi (EHDP) complex each, which are formed at least equimolar ratio of Sn to PPi (EHDP) and suffiently high concentration of PPi (EHDP) in the physiological pH-value. 3. A non-bone-seeking sup(99m)Tc-IV compound, which is enriched in the kidneys instead, is formed in the weakly alkaline medium or at low PPi (EHDP) concentration. This is probably monomeric technetium dioxide dihydrate. 4. A sup(99m)Tc as well as a Sn colloid is formed at deficient ligand concentration (PPi or EHDP to Sn). The chemical composition of the complexes is discussed the possible reaction courses are illustrated in the following diagrams. (orig./MG) [de
Czech Academy of Sciences Publication Activity Database
Crhák Khaitová, Lucie; Werlemark, G.; Kovaříková, Alena; Nybom, H.; Kovařík, Aleš
2014-01-01
Roč. 143, 1-3 (2014), s. 104-113 ISSN 1424-8581 R&D Projects: GA ČR(CZ) GA13-10057S Institutional support: RVO:68081707 Keywords : Asymmetrical meiosis * Dogrose * Interspecies hybrid Subject RIV: BO - Biophysics Impact factor: 1.561, year: 2014
Oblique proton fire hose instability in the expanding solar wind: Hybrid simulations
Czech Academy of Sciences Publication Activity Database
Hellinger, Petr; Trávníček, Pavel M.
2008-01-01
Roč. 113, A10 (2008), A10109/1-A10109/9 ISSN 0148-0227 R&D Projects: GA AV ČR IAA300420702; GA AV ČR IAA300420602 Institutional research plan: CEZ:AV0Z30420517; CEZ:AV0Z10030501 Keywords : kinetic instability * fire hose * solar wind * fire hose instabilities * linear analysis * nonlinear evolution * solar wind Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.147, year: 2008
Measurement of utero-placental blood flow with /sup 113m/In in diabetic pregnancy
International Nuclear Information System (INIS)
Semmler, K.; Kirsch, G.; Zoellner, P.; Fuhrmann, K.; Jutzi, E.; Ernst-Moritz-Arndt-Universitaet, Greifswald
1985-01-01
In 122 diabetic pregnancies the placental blood flow has been estimated determining the half-life of the activity inflow (2 MBq /sup 113m/In-transferrin) into the placenta. A highly sensitive detector (modified pinhole collimator) and a computer-supported evaluation were used. 259 flow measurements were compared to the risk of complication in the course of diabetic pregnancy. The half-life values in the diabetic group, calculated by a gamma camera computer system by means of an iterative regression analysis, were significantly different compared to a control group (12 pregnancies without risk.) Severe diabetic angiopathic complications (classes D, F, and R according to White) are accompanied by higher half-life values (placental blood flow reductions) and perinatal complications. Even in pregnant women with gestational diabetes of disturbances of the carbohydrate metabolism disturbed placental hemodynamics is to be found. (author)
Measurement of utero-placental blood flow with /sup 113m/In in diabetic pregnancy
Energy Technology Data Exchange (ETDEWEB)
Semmler, K.; Kirsch, G.; Zoellner, P.; Fuhrmann, K.; Jutzi, E. (Zentralinstitut fuer Diabetes, Karlsburg (German Democratic Republic); Ernst-Moritz-Arndt-Universitaet, Greifswald (German Democratic Republic). Radiologische Klinik)
1985-01-01
In 122 diabetic pregnancies the placental blood flow has been estimated determining the half-life of the activity inflow (2 MBq /sup 113m/In-transferrin) into the placenta. A highly sensitive detector (modified pinhole collimator) and a computer-supported evaluation were used. 259 flow measurements were compared to the risk of complication in the course of diabetic pregnancy. The half-life values in the diabetic group, calculated by a gamma camera computer system by means of an iterative regression analysis, were significantly different compared to a control group (12 pregnancies without risk.) Severe diabetic angiopathic complications (classes D, F, and R according to White) are accompanied by higher half-life values (placental blood flow reductions) and perinatal complications. Even in pregnant women with gestational diabetes of disturbances of the carbohydrate metabolism disturbed placental hemodynamics is to be found.
21 CFR 20.113 - Voluntary product defect reports.
2010-04-01
... confidential commercial or financial information and in § 20.63 for personal privacy. (b) If the report is... would identify the person submitting the report and any data or information falling within the exemption... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Voluntary product defect reports. 20.113 Section...
19 CFR 200.735-113 - Miscellaneous statutory provisions.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Miscellaneous statutory provisions. 200.735-113... Government Service.” (b) Chapter 11 of Title 18, United States Code, relating to bribery, graft, and... agent of a foreign principal registered under the Foreign Agents Registration Act (18 U.S.C. 219). [31...
International Nuclear Information System (INIS)
Denten, J.G.; Ishii, M.
1988-11-01
A visual study of film boiling using still photographic and high- speed motion picture methods was carried out in order to analyze the post-CHF hydrodynamics for steady-state inlet pre-CHF two-phase flow regimes. Pre-CHF two-phase flow regimes were established by introducing Freon 113 liquid and nitrogen gas into a jet core injection nozzle. An idealized, post-CHF two-phase core initial flow geometry (cylindrical multiphase jet core surrounded by a coaxial annulus of gas) was established at the nozzle exit by introducing nitrogen gas into the annular gap between the jet nozzle two-phase effluent and the heated test section inlet. For the present study three basic post-CHF flow regimes have been observed: the rough wavy regime (inverted annular flow preliminary break down), the agitated regime (transition between inverted annular and dispersed droplet flow), and the dispersed ligament/droplet regime. For pre-CHF bubbly flow in the jet nozzle, the post-CHF flow (beginning from jet nozzle exit/heated test section inlet) consists of the rough wavy regime, followed by the agitated and then the dispersed ligament/droplet regime. In the same way, for pre-CHF slug flow in the jet core, the post-CHF flow is comprised of the agitated regime at the nozzle exit, followed by the dispersed regime. Pre-CHF annular jet core flow results in a small, depleted post-CHF agitated flow regime at the nozzle exit, immediately followed by the dispersed ligament/droplet regime. Observed post dryout hydrodynamic behavior is reported, with particular attention given to the transition flow pattern between inverted annular and dispersed droplet flow. 43 refs., 20 figs., 5 tabs
9 CFR 113.214 - Parvovirus Vaccine, Killed Virus (Canine).
2010-01-01
... REQUIREMENTS Killed Virus Vaccines § 113.214 Parvovirus Vaccine, Killed Virus (Canine). Parvovirus Vaccine... antibody against canine parvovirus to determine susceptibility. A constant virus-varying serum... vaccinates and the controls shall be challenged with virulent canine parvovirus furnished or approved by...
International Nuclear Information System (INIS)
El-Morsi, Mohamed
2015-01-01
This study presents a comparison of energetic and exergetic performance of a vapour compression refrigeration system using pure HC (hydrocarbon) refrigerants. In this study, three different pure HCs propane (R290), butane (R600) and commercial LPG (liquefied petroleum gas) are used in the theoretical analysis. R134a is also used in the analysis as a reference refrigerant. The evaporator temperature ranges from −30 to 0 °C while the condenser ranges from 30 to 50 °C. MATLAB software is used for solving the thermodynamic equations, while the thermo-physical properties are calculated using REFPROP software. The results show that R600 has the highest COP c and exergetic efficiency, while LPG has the lowest. When compared to R134a, the COP c for R134a is higher than that for LPG by 10%. Also, the exergetic efficiency is higher by 5%. However, LPG has the advantage of being not expensive, available in large amounts and zero ozone depletion potential and low global warming potential. - Highlights: • The results show that R600 has the highest COP c & exergy efficiency, and the lowest irreversibility. • LPG has the lowest COP c & exergy efficiency, and the highest irreversibility. • Compared to R134a, LPG has a lower COP c and exergy efficiency by an average of 10% and 5%, respectively
Gas Research Institute, Annual report 1992
International Nuclear Information System (INIS)
1993-01-01
Technology is playing a major role in helping the gas industry meet the challenge of change, and as the focal point for gas industry R ampersand D, the authors at GRI are focusing their efforts on the real-world problems facing our member companies. They haven't forsaken longer range research, but they must stress the development and deployment of technology that can be put to work in the near term or they will fail in their mission. The pages that follow show how they put R ampersand D to work to meet the five key gas industry needs that will dominate the future: Developing new markets and new opportunities; Competing with electricity in selected markets; Tackling new regulations; Controlling the cost of gas delivery; Providing reliable and cost-competitive supplies of natural gas that allow reasonable returns to producers
A streamer tube detector for operation at high rates in the CPLEAR experiment at CERN
International Nuclear Information System (INIS)
Bennet, J.M.; Carroll, M.; Cawley, E.L.; Dodgson, M.; Fry, J.R.; Gabathuler, E.; Gamet, R.; Harrison, P.; Harrison, P.F.; Haselden, A.R.; Hayman, P.J.; King, D.; Maley, P.D.; Sacks, L.E.; Sanders, P.M.
1996-01-01
The design and instrumentation of a streamer tube detector for operation in the high rate environment of the CPLEAR experiment at CERN is described. A study of gas mixtures for use in the streamer tube is discussed. The final mixture of 46% argon, 50% isobutane, 4% methylal and 0.01% freon produces an axial resolution of 1.5 cm with an efficiency of 98% per layer. (orig.)
Gas in Attack and Gas in Defense
1919-07-01
and to the fact that it affects the skin, the eyes, the throat and lungs, as well as the digestive’ tract if’ food be eaten that has been exposed to...zfYx~r its firat uzje by the Germanic before tile first Allied mustard gas at- $ack took place, This was made by the Franch in the vicinity of Com...of bicarbonate of soda &Uxr and their eyes, ears, mouth and nasal pasa gee washed with the same, PROTECTING FOOD FROM MUSTARD GAS, ‘9 It was very
Czech Academy of Sciences Publication Activity Database
Šimek, Miloslav; Virtanen, S.; Krištůfek, Václav; Simojoki, A.; Yli-Halla, M.
2011-01-01
Roč. 140, 1-2 (2011), s. 113-122 ISSN 0167-8809 R&D Projects: GA ČR GA526/09/1570; GA MŠk LC06066 Institutional research plan: CEZ:AV0Z60660521 Keywords : acid sulphate soil * microorganisms * carbon Subject RIV: EH - Ecology, Behaviour Impact factor: 3.004, year: 2011
Two Instances of Mundus Inversus in Psalm 113
Directory of Open Access Journals (Sweden)
A. Basson
2009-07-01
Full Text Available The psalms often praise Yahweh for his transformative and restorative interventions both in the past and in all times. They portray the deity as the one who offers protection to the weak and defenceless members of society. He uplifts the downtrodden and affords them a place in structure where they gain a new status. In Psalm 113:7-9, Yahweh changes the circumstances of the poor and needy and the childless woman. Social outcasts have their dignity and honour restored. This article explicates these divine acts in terms of the topos of mundus inversus (world-upside down. This cultural phenomenon, which finds expression in artistic, socio-political and religious spheres, accentuates the possibility of another reality by inverting the status quo. Psalm 113 praises Yahweh as the incomparable God who inverts the situation of those condemned to a life of suffering. His incomparability is linked with his power to create a mundus inversus in which the poor and needy have a banquet with nobles and a barren woman takes pleasure in motherhood.
Alternative ways to transport natural gas; Transporte alternativo de gas natural
Energy Technology Data Exchange (ETDEWEB)
Moura, N.R.; Campos, F.B. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil). Centro de Pesquisas (CENPES)
2008-07-01
The Brazilian energy matrix has been showing a huge increase in the demand of natural gas due mainly to industries and power plants. Today the Brazilian gas market is supplied with gas produced by PETROBRAS and imported from Bolivia. To increase the Brazilian gas supply, on the short and middle term, PETROBRAS will import LNG (liquefied natural gas) and exploit the new offshore fields discovered on the pre-salt area. The only proven technology available today to bring this offshore gas to the market is the pipeline, but its costs for the pre-salt area are high enough to keep the solution economically attractive. So, PETROBRAS are evaluating and developing alternative ways to transport offshore gas, such as LNG, CNG (Compressed Natural Gas), GTS (Gas-to-Solids or Natural Gas Hydrates) and ANG (Adsorbed Natural Gas). Using information available in the literature, this paper analyses the main concepts of CNG and LNG floating unities. This paper also presents the PETROBRAS R and D results on ANG and GTS aiming at offshore application. (author)
Yang, Shengxue; Jiang, Chengbao; Wei, Su-huai
2017-06-01
Two-dimensional (2D) layered inorganic nanomaterials have attracted huge attention due to their unique electronic structures, as well as extraordinary physical and chemical properties for use in electronics, optoelectronics, spintronics, catalysts, energy generation and storage, and chemical sensors. Graphene and related layered inorganic analogues have shown great potential for gas-sensing applications because of their large specific surface areas and strong surface activities. This review aims to discuss the latest advancements in the 2D layered inorganic materials for gas sensors. We first elaborate the gas-sensing mechanisms and introduce various types of gas-sensing devices. Then, we describe the basic parameters and influence factors of the gas sensors to further enhance their performance. Moreover, we systematically present the current gas-sensing applications based on graphene, graphene oxide (GO), reduced graphene oxide (rGO), functionalized GO or rGO, transition metal dichalcogenides, layered III-VI semiconductors, layered metal oxides, phosphorene, hexagonal boron nitride, etc. Finally, we conclude the future prospects of these layered inorganic materials in gas-sensing applications.
Evaluation of Portable Multi-Gas Analyzers for use by Safety Personnel
Lueck, D. E.; Meneghelli, B. J.; Bardel, D. N.
1998-01-01
During confined space entry operations as well as Shuttle-safing operations, United Space Alliance (USA)/National Aeronautics and Space Administration (NASA) safety personnel use a variety of portable instrumentation to monitor for hazardous levels of compounds such as nitrogen dioxide (N%), monomethylhydrazine (NMM), FREON 21, ammonia (NH3), oxygen (O2), and combustibles (as hydrogen (H2)). Except for O2 and H2, each compound is monitored using a single analyzer. In many cases these analyzers are 5 to 10 years old and require frequent maintenance. In addition, they are cumbersome to carry and tend to make the job of personnel monitoring physically taxing. As part of an effort to upgrade the sensor technology background information was requested from a total of 27 manufacturers of portable multi-gas instruments. A set of criteria was established to determine which vendors would be selected for laboratory evaluation. These criteria were based on requests made by USA/NASA Safety personnel in order to meet requirements within their respective areas for confined-space and Shuttle-safing operations. Each of the 27 manufacturers of multi-gas analyzers was sent a copy of the criteria and asked to fill in the appropriate information pertaining to their instrumentation. Based on the results of the sensor criteria worksheets, a total of 9 vendors out of 27 surveyed manufacturers were chosen for evaluation. Each vendor included in the final evaluation process was requested to configure each of two analyzers with NO2, NH3, O2, and combustible sensors. A set of lab tests was designed in order to determine which of the multi-gas instruments under evaluation was best suited for use in both shuttle and confined space operations. These tests included linearity/repeatability, zero/span drift response/recovery, humidity, interference, and maintenance. At the conclusion of lab testing three vendors were selected for additional field testing. Based on the results of both the lab and
Bioenvironmental Engineer’s Guide to TVA-1000B Toxic Vapor Analyzer
2014-01-01
Dichloroethene 9.66 Freon 11 (trichlorofluoromethane) 11.77 Dibromomethane 10.49 E Freon 112 (1,1,2,2- tetrachloro-1,2- difluoroethane ) 11.30...Terphenyls 7.78 Pheneloic 8.18 1,1,2,2-Tetrachloro-1,2- difluoroethane (Freon 112) 11.30 Phenol 8.50 1,1,1-Trichloroethane 11.00 Phenyl ether
Effects of the small molecule HERG activator NS1643 on Kv11.3 channels.
Directory of Open Access Journals (Sweden)
Arne Bilet
Full Text Available NS1643 is one of the small molecule HERG (Kv11.1 channel activators and has also been found to increase erg2 (Kv11.2 currents. We now investigated whether NS1643 is also able to act as an activator of Kv11.3 (erg3 channels expressed in CHO cells. Activation of rat Kv11.3 current occurred in a dose-dependent manner and maximal current increasing effects were obtained with 10 µM NS1643. At this concentration, steady-state outward current increased by about 80% and the current increase was associated with a significant shift in the voltage dependence of activation to more negative potentials by about 15 mV. In addition, activation kinetics were accelerated, whereas deactivation was slowed. There was no significant effect on the kinetics of inactivation and recovery from inactivation. The strong current-activating agonistic effect of NS1643 did not result from a shift in the voltage dependence of Kv11.3 channel inactivation and was independent from external Na(+ or Ca(2+. At the higher concentration of 20 µM, NS1643 induced clearly less current increase. The left shift in the voltage dependence of activation reversed and the voltage sensitivity of activation dramatically decreased along with a slowing of Kv11.3 channel activation. These data show that, in comparison to other Kv11 family members, NS1643 exerts distinct effects on Kv11.3 channels with especially pronounced partial antagonistic effects at higher concentration.
Solid Waste Operations Complex W-113: Project cost estimate. Preliminary design report. Volume IV
International Nuclear Information System (INIS)
1995-01-01
This document contains Volume IV of the Preliminary Design Report for the Solid Waste Operations Complex W-113 which is the Project Cost Estimate and construction schedule. The estimate was developed based upon Title 1 material take-offs, budgetary equipment quotes and Raytheon historical in-house data. The W-113 project cost estimate and project construction schedule were integrated together to provide a resource loaded project network
9 CFR 113.204 - Mink Enteritis Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mink Enteritis Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.204 Mink Enteritis Vaccine, Killed Virus. Mink Enteritis Vaccine...
9 CFR 113.212 - Bursal Disease Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bursal Disease Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.212 Bursal Disease Vaccine, Killed Virus. Bursal Disease Vaccine...
27 CFR 20.113 - Proprietary solvents general-use formula.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Proprietary solvents... Formulas and Statements of Process General-Use Formulas § 20.113 Proprietary solvents general-use formula. (a) A proprietary solvent is any article made with any other ingredients combined with the...
Energy Technology Data Exchange (ETDEWEB)
Zhang, Guyu; Sun, Yabing, E-mail: sybnju@163.com; Zhang, Chunxiao; Yu, Zhongqing
2017-02-05
Highlights: • Graphene Oxide-based catalyst was first applied with dielectric barrier discharge plasma. • The TiO{sub 2}-rGO showed efficient synergistic effect with gas phase dielectric barrier discharge plasma. • The property changes of TiO{sub 2}-rGO nanocomposite after plasma treatment were characterized. • The mechanism and possible pathways of APAP degradation in plasma/TiO{sub 2}-rGO system were proposed. - Abstract: Acetaminophen (APAP) served as the model pollutant to evaluate the feasibility of pollutant removal by gas phase dielectric barrier discharge plasma combined with the titanium dioxide-reduced Graphene Oxide (TiO{sub 2}-rGO) nanocomposite. TiO{sub 2}-rGO nanocomposite was prepared using the modified hydrothermal method and characterized by TEM and XPS before and after plasma process. The results indicated that the APAP degradation efficiency was significantly improved to 92% after 18 min of discharge plasma treatment coupling 0.25 g L{sup −1} TiO{sub 2}-rGO 5% wt at 18 kV, compared with the plasma alone and plasma combined with P25 TiO{sub 2}. The degradation mechanism for APAP in this system was studied by investigating the effects of the operational variables (e.g. discharge voltage and pH value) and the amount of the generated active species; and the results showed that O{sub 3} and H{sub 2}O{sub 2} yields were influenced notably by adding TiO{sub 2}-rGO. Also, it was observed that, compared with unused TiO{sub 2}-rGO, the photocatalytic performance of used TiO{sub 2}-rGO declined after several recirculation times due to the further reduction of Graphene Oxide in plasma system. Finally, intermediate products were analyzed by UV–vis spectrometry and HPLC/MS, and possible transformation pathways were identified with the support of theoretically calculating the frontier electron density of APAP.
Energy Technology Data Exchange (ETDEWEB)
Adan, L; Rebollo, D V
1978-07-01
The design for the construction of a generator 113{sup S}n -113m{sup l}n is described. A systematic assay for de adequate adsorbents has been made, to obtain solutions of high radiochemical purity, as it is required for the radiopharmaceutical preparations. The control of purity is carried on by qualitative and quantitative analysis of the solutions, complemented by radiochemical techniques. The following physico-chemical parameters has been determinate; consecutive equilibrium constants, pH, distribution constants, separation factors and electrophoretic factors. It has been considered the measure of these parameters for the best quality In the preparation of the radiopharmaceutical compounds. (Author) 53 refs.
Description of new element Z=113 and its α-decay chain
International Nuclear Information System (INIS)
Tai Fei; Chen Dinghan; Xu Chang; Ren Zhongzhou; National Laboratory of Heavy Ion Accelerator, Lanzhou
2005-01-01
RIKEN has produced a new element Z=113 by cold-fusion reaction. Here we systematically study the new nuclide 278 113 and its α-Decay chain using deformed relativistic mean-field theory with three sets of force parameters, TMA, NL-Z2 and NL3. The results are compared with those of the Skyrme-Hartree-Fock model, Moeller et al and also with the new experimental data. The experimental decay energies are well reproduced with RMF. This not only shows the validity of self-consistent field theoretical model in researching the ground state properties of superheavy nuclei, but also shows that prolate deformation is important for the ground state of these nuclei. (authors)
Local Fission Gas Release and Swelling in Water Reactor Fuel during Slow Power Transients
DEFF Research Database (Denmark)
Mogensen, Mogens Bjerg; Walker, C.T.; Ray, I.L.F.
1985-01-01
Gas release and fuel swelling caused by a power increase in a water reactor fuel (burn-up 2.7–4.5% FIMA) is described. At a bump terminal level of about 400 W/cm (local value) gas release was 25–40%. The formation of gas bubbles on grain boundaries and their degree of interlinkage are the two...... factors that determine the level of fission gas release during a power bump. Release begins when gas bubbles on grain boundaries start o interlink. This occurred at r/r0 ~ 0.75. Release tunnels were fully developed at r/r0 ~ 0.55 with the result that gas release was 60–70% at this position....
26 CFR 509.113 - Government wages, salaries, and pensions.
2010-04-01
... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Government wages, salaries, and pensions. 509...) REGULATIONS UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.113 Government wages, salaries, and pensions. (a) General. Under Article XI of the convention any wage, salary, or similar compensation, or any...
9 CFR 113.201 - Canine Distemper Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine, Killed Virus... REQUIREMENTS Killed Virus Vaccines § 113.201 Canine Distemper Vaccine, Killed Virus. Canine Distemper Vaccine... canine distemper susceptible dogs (20 vaccinates and 5 controls) shall be used as test animals. Blood...
Energy Technology Data Exchange (ETDEWEB)
Palmer, E. [Westinghouse Savannah River Company, AIKEN, SC (United States)
1996-03-01
Gunsite 113 Access Road Unit is located in the northeast corner of SRS. In the mid 1980`s, sparse vegetation, dead trees, and small mounds of soil were discovered on a portion of the road leading to Gunsite 113. This area became the Gunsite 113 Access Road Unit (Gunsite 113). The unit appears to have been used as a spoil dirt and / or road construction debris disposal area. There is no documentation or record of any hazardous substance management, disposal, or any type of waste disposal at this unit. Based upon the available evidence, there are no potential contaminants of concern available for evaluation by a CERCLA baseline risk assessment. Therefore, there is no determinable health risk associated with Gunsite 113. In addition, it is also reasonable to conclude that, since contamination is below risk-based levels, the unit presents no significant ecological risk. It is recommended that no further remedial action be performed at this unit.
International Nuclear Information System (INIS)
Palmer, E.
1996-03-01
Gunsite 113 Access Road Unit is located in the northeast corner of SRS. In the mid 1980's, sparse vegetation, dead trees, and small mounds of soil were discovered on a portion of the road leading to Gunsite 113. This area became the Gunsite 113 Access Road Unit (Gunsite 113). The unit appears to have been used as a spoil dirt and / or road construction debris disposal area. There is no documentation or record of any hazardous substance management, disposal, or any type of waste disposal at this unit. Based upon the available evidence, there are no potential contaminants of concern available for evaluation by a CERCLA baseline risk assessment. Therefore, there is no determinable health risk associated with Gunsite 113. In addition, it is also reasonable to conclude that, since contamination is below risk-based levels, the unit presents no significant ecological risk. It is recommended that no further remedial action be performed at this unit
32 CFR Appendix C to Part 113 - Sample DD Form 2653, “Involuntary Allotment Application”
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Sample DD Form 2653, âInvoluntary Allotment Applicationâ C Appendix C to Part 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE... Part 113—Sample DD Form 2653, “Involuntary Allotment Application” ER05JA95.002 ER05JA95.003 ...
The Use of rLH, HMG and hCG in Controlled Ovarian Stimulation for Assisted Reproductive Technologies
2012-11-21
responders involves the use of the microdose flare protocol. This protocol avoids the profound suppression of endogenous LH and FSH in the early...follicular phase normally achieved with long luteal downregulation protocols. Scott and Novat’s initial investigation of the microdose flare found it to...protocol increases live birth rates (113-116). One RCT did not show any benefit to adding either rLH or low-dose rHCG to a microdose flare protocol for
Study on the thermohydraulic characteristic of marine nuclear reactors, 6
International Nuclear Information System (INIS)
Kurosawa, Akira; Otsuji, Tomoo; Iwahori, Koji
1981-01-01
The objective of this research was to observe the bubble behaviour at the location of boiling crisis, middle stream, upper stream in low pressure, subcooled flow boiling with high speed motion and still photography. The observations included measurements from photographs of bubbles and photographic records of the flow structure before, during, and after DNB for Freon-113, 1 ton/hr 45 0 C subcooling at 3 kg/cm 2 . The experimental conditions covered the gravity acceleration, flow modulation and steady state condition. The dominant flow mechanisms at DNB in each case were compared for conditions tested on the basis of the photographic information. The phenomena of CHF decrease by gravity acceleration condition were observed and judged. The necessity for still more useful quantitative informations was cleared. (author)
Modeling VOC transport in simulated waste drums
International Nuclear Information System (INIS)
Liekhus, K.J.; Gresham, G.L.; Peterson, E.S.; Rae, C.; Hotz, N.J.; Connolly, M.J.
1993-06-01
A volatile organic compound (VOC) transport model has been developed to describe unsteady-state VOC permeation and diffusion within a waste drum. Model equations account for three primary mechanisms for VOC transport from a void volume within the drum. These mechanisms are VOC permeation across a polymer boundary, VOC diffusion across an opening in a volume boundary, and VOC solubilization in a polymer boundary. A series of lab-scale experiments was performed in which the VOC concentration was measured in simulated waste drums under different conditions. A lab-scale simulated waste drum consisted of a sized-down 55-gal metal drum containing a modified rigid polyethylene drum liner. Four polyethylene bags were sealed inside a large polyethylene bag, supported by a wire cage, and placed inside the drum liner. The small bags were filled with VOC-air gas mixture and the VOC concentration was measured throughout the drum over a period of time. Test variables included the type of VOC-air gas mixtures introduced into the small bags, the small bag closure type, and the presence or absence of a variable external heat source. Model results were calculated for those trials where the VOC permeability had been measured. Permeabilities for five VOCs [methylene chloride, 1,1,2-trichloro-1,2,2-trifluoroethane (Freon-113), 1,1,1-trichloroethane, carbon tetrachloride, and trichloroethylene] were measured across a polyethylene bag. Comparison of model and experimental results of VOC concentration as a function of time indicate that model accurately accounts for significant VOC transport mechanisms in a lab-scale waste drum
Czech Academy of Sciences Publication Activity Database
Kabátková, Markéta; Svobodová, Jana; Pěnčíková, K.; Mohatad, D.S.; Šmerdová, Lenka; Kozubík, Alois; Machala, M.; Vondráček, Jan
2015-01-01
Roč. 232, č. 1 (2015), s. 113-121 ISSN 0378-4274 R&D Projects: GA ČR(CZ) GAP503/11/1227; GA ČR(CZ) GA13-07711S Institutional support: RVO:68081707 Keywords : PAHs * Inflammation * Cell proliferation Subject RIV: BO - Biophysics Impact factor: 3.522, year: 2015
Improvements for energy conservation at the Coeur d'Alene Nursery
Aram Eramian
2009-01-01
In 2002, the USDA Forest Service Coeur d'Alene Nursery in Idaho began to evaluate ways to reduce energy consumption in lighting, refrigeration, and heating and cooling of facility workspace. The primary factor leading up to this was the inefficiency of the nursery's Freon(R)-based refrigeration system. Energy costs and maintenance of the system were becoming...
14 CFR 129.113 - Fuel tank system maintenance program.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fuel tank system maintenance program. 129... Continued Airworthiness and Safety Improvements § 129.113 Fuel tank system maintenance program. (a) Except... on which an auxiliary fuel tank is installed under a field approval, before June 16, 2008, the...
A Rapid Process for Fabricating Gas Sensors
Directory of Open Access Journals (Sweden)
Chun-Ching Hsiao
2014-07-01
Full Text Available Zinc oxide (ZnO is a low-toxicity and environmentally-friendly material applied on devices, sensors or actuators for “green” usage. A porous ZnO film deposited by a rapid process of aerosol deposition (AD was employed as the gas-sensitive material in a CO gas sensor to reduce both manufacturing cost and time, and to further extend the AD application for a large-scale production. The relative resistance change (△R/R of the ZnO gas sensor was used for gas measurement. The fabricated ZnO gas sensors were measured with operating temperatures ranging from 110 °C to 180 °C, and CO concentrations ranging from 100 ppm to 1000 ppm. The sensitivity and the response time presented good performance at increasing operating temperatures and CO concentrations. AD was successfully for applied for making ZnO gas sensors with great potential for achieving high deposition rates at low deposition temperatures, large-scale production and low cost.
Application of Gas Sensor Arrays in Assessment of Wastewater Purification Effects
Directory of Open Access Journals (Sweden)
Łukasz Guz
2014-12-01
Full Text Available A gas sensor array consisting of eight metal oxide semiconductor (MOS type gas sensors was evaluated for its ability for assessment of the selected wastewater parameters. Municipal wastewater was collected in a wastewater treatment plant (WWTP in a primary sedimentation tank and was treated in a laboratory-scale sequential batch reactor (SBR. A comparison of the gas sensor array (electronic nose response to the standard physical-chemical parameters of treated wastewater was performed. To analyze the measurement results, artificial neural networks were used. E-nose—gas sensors array and artificial neural networks proved to be a suitable method for the monitoring of treated wastewater quality. Neural networks used for data validation showed high correlation between the electronic nose readouts and: (I chemical oxygen demand (COD (r = 0.988; (II total suspended solids (TSS (r = 0.938; (III turbidity (r = 0.940; (IV pH (r = 0.554; (V nitrogen compounds: N-NO3 (r = 0.958, N-NO2 (r = 0.869 and N-NH3 (r = 0.978; (VI and volatile organic compounds (VOC (r = 0.987. Good correlation of the abovementioned parameters are observed under stable treatment conditions in a laboratory batch reactor.
Giacometti, Andrea; Cirioni, Oscar; Kamysz, Wojciech; D'Amato, Giuseppina; Silvestri, Carmela; Prete, Maria Simona Del; Licci, Alberto; Riva, Alessandra; Łukasiak, Jerzy; Scalise, Giorgio
2005-01-01
The in vitro activity of the histatin derivative P-113, alone or combined with eight antibiotics, was investigated against multidrug-resistant strains isolated from clinical specimens of immunocompromised patients with pneumonia. The gram-negative isolates were susceptible to P-113. S. aureus showed less susceptibility. Synergy was demonstrated when P-113 was combined with beta-lactams against gram-negative organisms.
Go, Maybelle K; Malabanan, M Merced; Amyes, Tina L; Richard, John P
2010-09-07
Bovine serum albumin (BSA) in D(2)O at 25 degrees C and pD 7.0 was found to catalyze the deuterium exchange reactions of [1-(13)C]glycolaldehyde ([1-(13)C]GA) to form [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA. The formation of [1-(13)C,2-(2)H]GA and [1-(13)C,2,2-di-(2)H]GA in a total yield of 51 +/- 3% was observed at early reaction times, and at later times, [1-(13)C,2-(2)H]GA was found to undergo BSA-catalyzed conversion to [1-(13)C,2,2-di-(2)H]GA. The overall second-order rate constant for these deuterium exchange reactions [(k(E))(P)] equals 0.25 M(-1) s(-1). By comparison, (k(E))(P) values of 0.04 M(-1) s(-1) [Go, M. K., Amyes, T. L., and Richard, J. P. (2009) Biochemistry 48, 5769-5778] and 0.06 M(-1) s(-1) [Go, M. K., Koudelka, A., Amyes, T. L., and Richard, J. P. (2010) Biochemistry 49, 5377-5389] have been determined for the wild-type- and K12G mutant TIM-catalyzed deuterium exchange reactions of [1-(13)C]GA, respectively, to form [1-(13)C,2,2-di-(2)H]GA. These data show that TIM and BSA exhibit a modest catalytic activity toward deprotonation of the alpha-hydroxy alpha-carbonyl carbon. We suggest that this activity is intrinsic to many globular proteins, and that it must be enhanced to demonstrate meaningful de novo design of protein catalysts of proton transfer at alpha-carbonyl carbon.
Energy Technology Data Exchange (ETDEWEB)
Sun, K.H.; Jung, H.C. [Kyung Hee University, Seoul (Korea, Republic of); Kim, K.S. [Daebul University (Korea, Republic of)
1997-03-01
The goal of this paper is to measure and compare the performance of solar heat pump for school classroom heating. To accomplish the goal, solar heat pump with aluminum roll bond type evaporator and indoor heat exchanger(condenser) was built and fully instrumented with thermocouples and pressure transducers etc. The test results showed that the COP and capacity of R-134a(CF{sub 3}CH{sub 2}F) were higher than those of R-12(CF{sub 2}Cl{sub 2}). The solar heat pump system for room heating was designed to show the best efficiency that the room temperature make 18{approx}20{sup o} C and 23{approx}25{sup o} C in Seoul during November, December, and January. (author) 12 refs., 4 figs., 2 tabs.
2010-10-01
....113 Individual's duty to furnish data on prior safety conduct as an employee of a different railroad... 49 Transportation 4 2010-10-01 2010-10-01 false Individual's duty to furnish data on prior safety conduct as an employee of a different railroad. 240.113 Section 240.113 Transportation Other Regulations...
Policies for technical innovations to promote natural gas market development
International Nuclear Information System (INIS)
Leblanc, M.B.
1997-01-01
Short-term and long-term perspectives of the natural gas market worldwide are discussed, covering demand and supply trends. Technologies determining the future of the natural gas market, and R and D needs for implementing future technological challenges are considered. (R.P.)
Fundamentals of gas particle flow
Rudinger, G
1980-01-01
Fundamentals of Gas-Particle Flow is an edited, updated, and expanded version of a number of lectures presented on the "Gas-Solid Suspensions course organized by the von Karman Institute for Fluid Dynamics. Materials presented in this book are mostly analytical in nature, but some experimental techniques are included. The book focuses on relaxation processes, including the viscous drag of single particles, drag in gas-particles flow, gas-particle heat transfer, equilibrium, and frozen flow. It also discusses the dynamics of single particles, such as particles in an arbitrary flow, in a r
Apparent rate constant mapping using hyperpolarized [1-(13) C]pyruvate
DEFF Research Database (Denmark)
Khegai, O.; Schulte, R. F.; Janich, M. A.
2014-01-01
Hyperpolarization of [1-13C]pyruvate in solution allows real-time measurement of uptake and metabolism using MR spectroscopic methods. After injection and perfusion, pyruvate is taken up by the cells and enzymatically metabolized into downstream metabolites such as lactate, alanine, and bicarbona...
Guthoff, Rainer; Guthoff, Tanja; Meigen, Thomas; Goebel, Winfried
2011-01-01
To investigate the benefit of adding bevacizumab to intravitreal recombinant tissue plasminogen activator (rTPA) and gas as initial therapy in subretinal hemorrhage and choroidal neovascularization because of age-related macular degeneration. Thirty-eight consecutive patients with recent (1-31 days) subretinal hemorrhage who were treated with intravitreal rTPA and gas (26 patients) or with intravitreal bevacizumab, rTPA, and gas (12 patients) were included in this retrospective analysis. In all patients, a standardized antivascular endothelial growth factor therapy was followed. Testing of best-corrected visual acuity, biomicroscopy, and fundus examination were performed at 4 weeks and 7 months. The mean pretreatment best-corrected visual acuity in the rTPA/gas group was 0.08 ± 0.09 and 0.12 ± 0.13 in the bevacizumab/rTPA/gas group. After 4 weeks, it was significantly higher in the bevacizumab/rTPA/gas group (0.25 ± 0.26) than in the rTPA/gas (0.08 ± 0.1) group (P gas group (0.07 ± 0.07 vs. 0.24 ± 0.35; P gas) versus 50% (bevacizumab/rTPA/gas). Stabilization (0 ± 2 lines) or improvement of best-corrected visual acuity was obtained in 62% (rTPA/gas) versus 84% (bevacizumab/rTPA/gas). From our retrospective pilot study, there is a strong indication that the addition of intravitreal bevacizumab is safe and superior to the displacement of submacular hemorrhages alone with rTPA and gas.
International Nuclear Information System (INIS)
Grolier, Jean-Pierre E.; Randzio, Stanislaw L.
2012-01-01
Highlights: ► The PVT-vibrating wire technique and PVT-scanning transitiometry. ► Polymer swelling with measured gas sorption and gas–polymer interaction energies. ► Experimental measurements up to 373 K and 100 MPa. ► Hydrostatic and plasticization effects under high pressure gas and induced T g -shifts. ► Thermodynamic study of the (gas + polymer) systems polystyrene with CO 2 , N 2 , and freons. - Abstract: Foaming constitutes one of the most important industrial activities in polymer engineering to produce efficient thermal insulating materials. In particular, rigid insulating boards are produced worldwide on a large scale using blowing agents which eventually are released in the environment where they adversely impact the natural friendly stratospheric ozone layer. Concomitantly, the chemicals used as blowing agents contribute to the creation of the unfriendly tropospheric ozone layer generating the disastrous green house effect around our planet. The traditional foaming intermediates currently named freons, like chlorofluorocarbons (CFCs) currently used as blowing agents as well as the hydrochlorofluorocarbons (HCFCs) often considered as alternative blowing agents, must be banned from industrial processes and new (friendly) foaming agents have to be suggested and evaluated in terms of both easy engineering and environmental neutrality. Undoubtedly thermodynamics plays a major role in assessing the effective capability of those chemicals. Some CFCs still accepted and other possible simple gases like carbon dioxide and nitrogen have been considered. The in-depth thermodynamic investigation has been made possible thanks to new experimental developments to determine gas solubility in polymers and associated swelling as well as the thermodynamic properties of (gas + polymer) systems, including the thermophysical properties of polymers under gas sorption. Pertinent data have been generated for such properties over extended T and p ranges.
Method for detecting trace impurities in gases
Freund, S.M.; Maier, W.B. II; Holland, R.F.; Beattie, W.H.
A technique for considerably improving the sensitivity and specificity of infrared spectrometry as applied to quantitative determination of trace impurities in various carrier or solvent gases is presented. A gas to be examined for impurities is liquefied and infrared absorption spectra of the liquid are obtained. Spectral simplification and number densities of impurities in the optical path are substantially higher than are obtainable in similar gas-phase analyses. Carbon dioxide impurity (approx. 2 ppM) present in commercial Xe and ppM levels of Freon 12 and vinyl chloride added to liquefied air are used to illustrate the method.
Czech Academy of Sciences Publication Activity Database
Crhák Khaitová, Lucie; Werlemark, G.; Nybom, H.; Kovařík, Aleš
2010-01-01
Roč. 104, č. 1 (2010), s. 113-120 ISSN 0018-067X R&D Projects: GA ČR(CZ) GA521/07/0116; GA MŠk(CZ) LC06004; GA ČR(CZ) GD204/09/H002 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : polyploidy * rDNA genes * Rosaceae Subject RIV: BO - Biophysics Impact factor: 4.569, year: 2010
Recent status of purging SO2 and NOx in flue gas by EB and R and D of electron accelerator in China
International Nuclear Information System (INIS)
Liu Zhenhao
2005-01-01
The main energy resource is coal in China. Flue gas from burning coal is the most fearful pollution. Chinese Government pays more attention to reduction of SO 2 in flue gas from 1990's. Various technical facilities of reducing SO 2 have been imported from developed countries especially from Japanese companies. For example, A largest project is that Chongqing-luohuang electric power station imported limestone-gypsum process FGD technology and facility from Mitsubishi of Japan in 1980s for 300 MW generator spending 36.4 million US$ and 27.3 million RMB. Recently an example is EBA technology in Chengdu thermal plant. Some of Chinese institute is going to improve the technology to treat larger amount of flue gas from one generator such as 200 - 300 MW generator. And an R and D program of manufacturing higher voltage accelerator is being implemented. Otherwise, electron accelerator of industry application has been successfully made from 20 kW - 100 kW with 2.5 MeV energy in China. (author)
Gas hydrate cool storage system
Ternes, M.P.; Kedl, R.J.
1984-09-12
The invention presented relates to the development of a process utilizing a gas hydrate as a cool storage medium for alleviating electric load demands during peak usage periods. Several objectives of the invention are mentioned concerning the formation of the gas hydrate as storage material in a thermal energy storage system within a heat pump cycle system. The gas hydrate was formed using a refrigerant in water and an example with R-12 refrigerant is included. (BCS)
International Nuclear Information System (INIS)
1992-02-01
This book introduces business strategy to save the earth, which are foundation of system in the company, collection of disposable camera, resort which don't destroy environment, core strategy of item project, cutback of Freon gas, production of plastic which is degraded, export of pollution prevention technology, increasing waste and changing waste, rule on construction waste, responsibility of business and waste problems, recycling of aluminum can and responsibility on environmental problems.
2010-01-01
..., religion, sex, marital status, handicap, or national origin. 113.3-1 Section 113.3-1 Business Credit and... of race, color, religion, sex, marital status, handicap, or national origin. (a) This regulation does not prohibit the consideration of race, color, religion, sex, marital status, handicap, or national...
Concentrations of sup(113m)Cd in the marine environment
International Nuclear Information System (INIS)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.
1980-01-01
A preliminary report is presented of sup(113m)Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atols in the Marshall Islands which are considered to be representative of the levels expected at these latitudes from global fallout deposition. (U.K.)
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Modification of contracts to prevent environmental damage or to conform to forest plans. 223.113 Section 223.113 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM...
Parity-non-conserving internucleon potentials studied in the 113Cd (n, γ) 114Cd reaction
DEFF Research Database (Denmark)
Warming, Inge Elisabeth; Stecher-Rasmussen, F.; Ratynski, W.
1967-01-01
The asymmetry in the gamma intensity after capture of polarized neutrons in 113Cd was investigated. An upper limit to a possible asymmetry A was determined of |A| <4.7 times 10-4. This result does not agree with that of Abov et al.......The asymmetry in the gamma intensity after capture of polarized neutrons in 113Cd was investigated. An upper limit to a possible asymmetry A was determined of |A|
Energy Technology Data Exchange (ETDEWEB)
Maliska, C.; D' Almeida, J.; Pellegrini, P.M.; Schimit, T.S. [Hospital Central do Exercito (HCE), Rio de Janeiro, RJ (Brazil). Servico de Medicina Nuclear; Pinho, W.R. [Centro de Ensino Superior, Valenca, RJ (Brazil). Fac. de Medicina Veterinaria; Lima, J.E.T. [Instituto Nacional do Cancer (INCa), Rio de Janeiro, RJ (Brazil). Servico de Medicina Nuclear
2009-07-01
The glomerular filtration rate was determined in nine healthy horses, six male and three female, aged two to 12-year-old, by means of {sup 51}Cr and {sup 113m}In labeled EDTA single injection technique. The glomerular filtration rate was calculated from the plasma disappearance curve and the volume of distribution of the radiotracer, {sup 51}Cr-EDTA or {sup 113m}In-EDTA. The result (mean +- standard deviation) was 148.80 +- 26.42 m L.min{sup -1}.100 kg. It is concluded that the measurement of glomerular filtration rate by {sup 51}Cr-EDTA or {sup 113m}In-EDTA by single injection technique eliminates the bladder catheterization, and for its simplicity, convenience, accuracy, and low dose of radiation, can be used in horses as a method of choice in clinical routine. (author)
29 CFR 102.113 - Methods of service of process and papers by the Agency; proof of service.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Methods of service of process and papers by the Agency; proof of service. 102.113 Section 102.113 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS... process and papers by the Agency; proof of service. (a) Service of complaints and compliance...
International Nuclear Information System (INIS)
Pine, G.D.; Rinholm, R.C.
1990-08-01
Conducted in cooperation with gas industry partners, GRI's R and D program brought 93 gas products, processes and techniques, and 53 information items to the marketplace during 1987-1990. Quantitative estimates of economic benefits to the gas industry and its customers are provided for 60 of the technologies. The net present value is approximately $7.4 billion. While not accounting for R and D efforts in progress, the figure is 4.3 times the cumulative net present value of the cost of the entire GRI R and D program from its inception and represents a rate of return to ratepayers of almost 20%. When compared with the cost of completed R and D, the benefit-to-cost ratio is 8.1 to 1
Overview of Gas Research Institute environmental research programs
International Nuclear Information System (INIS)
Evans, J.M.
1991-01-01
The Gas Research Institute (GRI) is a private not-for-profit membership organization of natural gas pipelines, distribution companies and natural gas producers. GRI's purpose is to plan, to manage and to develop financing for a gas-related research and development (R and D) program on behalf of its members and their customers. GRI does not do any research itself. GRI's R and D program is designed to provide advanced technologies for natural gas supply, transport, storage, distribution and end-use applications in all markets. In addition, basic research is conducted for GRI in these areas to build a foundation for future technology breakthroughs. Work in the Environment and Safety Research Department includes sections interested in: supply related research, air quality research, end use equipment safety research, gas operations safety research, and gas operations environmental research. The Natural Gas Supply Program has research ongoing in such areas as: restoration of pipeline right-of-ways; cleaning up town gas manufacturing sites; the development of methanogenic bacteria for soil and groundwater cleanup; development of biological fluidized carbon units for rapid destruction of carbonaceous compounds; research on liquid redox sulfur recovery for sulfur removal from natural gas; research on produced water and production wastes generated by the natural gas industry; environmental effects of coalbed methane production; and subsurface effects of natural gas operations. The western coalbed methane and ground water programs are described
Deregulation of natural gas in Georgia
International Nuclear Information System (INIS)
Wise, S.
2002-01-01
The Natural Gas Competition and Deregulation Act of 1997 in Georgia is discussed. New legislation passed the Natural Gas Consumer Relief Act in 2002 legislative session to provide additional protection and increase competition. This Act and its impacts are discussed in detail. Additional commission responsibilities are summarized. (R.P.)
Highly selective gas sensor arrays based on thermally reduced graphene oxide.
Lipatov, Alexey; Varezhnikov, Alexey; Wilson, Peter; Sysoev, Victor; Kolmakov, Andrei; Sinitskii, Alexander
2013-06-21
The electrical properties of reduced graphene oxide (rGO) have been previously shown to be very sensitive to surface adsorbates, thus making rGO a very promising platform for highly sensitive gas sensors. However, poor selectivity of rGO-based gas sensors remains a major problem for their practical use. In this paper, we address the selectivity problem by employing an array of rGO-based integrated sensors instead of focusing on the performance of a single sensing element. Each rGO-based device in such an array has a unique sensor response due to the irregular structure of rGO films at different levels of organization, ranging from nanoscale to macroscale. The resulting rGO-based gas sensing system could reliably recognize analytes of nearly the same chemical nature. In our experiments rGO-based sensor arrays demonstrated a high selectivity that was sufficient to discriminate between different alcohols, such as methanol, ethanol and isopropanol, at a 100% success rate. We also discuss a possible sensing mechanism that provides the basis for analyte differentiation.
International Nuclear Information System (INIS)
Teixeira, G.
2000-05-01
Natural gas in Canada represents 29% of the primary energy and 42% of the energy used in the industrial sector. The biggest users are the manufacturing industries for which the low cost of natural gas and the quality of products resulting from its use represent a serious advantage in a more and more competitive market. This document takes stock of the situation of natural gas and gas-related technologies in Quebec. The first part recalls the historical evolution of the gas distribution network in Quebec and its present day situation. Then, some technical-economical data about the consumption of natural gas in Quebec are presented according to the sectors of use. The third part treats of the R and D activities linked with the gas sector, in particular the activities of the two main research organizations: the technical centre of natural gas and the research group in gas technologies of the Polytechnique school of Montreal. (J.S.)
9 CFR 113.200 - General requirements for killed virus vaccines.
2010-01-01
... completed product from each serial shall be tested for safety in guinea pigs as prescribed in § 113.38 and... an applicable Standard Requirement or in the filed Outline of Production, a killed virus vaccine.... Suitable tests to assure complete inactivation shall be written into the filed Outline of Production. (b...
9 CFR 113.100 - General requirements for inactivated bacterial products.
2010-01-01
... instances, the guinea pig safety test provided in § 113.38 shall be conducted in place of the mouse safety... Outline of Production, an inactivated bacterial product shall meet the applicable requirements in this... in poultry as defined in the specific Standard Requirement or Outline of Production for the product...
International Nuclear Information System (INIS)
Asih Kurniawati
2007-01-01
In-vitro gas production technique can be used to predict feed quality. The effect of molasses supplementation as a source of degradable carbohydrate to protein source red clover silage has been done using this technique. Data showed there were positive correlation between total volume gas produced and feed degradability (r = 0.96), between total volume gas produced and microbial biomass (r = 0,96). Dry matter degradability, dry matter degraded, microbial biomass production and efficiency of nitrogen utilization, highly significant (P<0,01) increased due to increasing of degradable carbohydrate. The addition of 0.3 g molasses gave the best result whereas the addition of 0.15 g and 0.225 g have better effect than 0.0625 g molasses addition and red clover only. This result suggested that In-vitro production technique can be used as tool for feed evaluation. (author)
2010-04-01
... yachts imported for sale at United States boat shows. 113.75 Section 113.75 Customs Duties U.S. CUSTOMS... Customs Bond Conditions § 113.75 Bond conditions for deferral of duty on large yachts imported for sale at....C. 1484b for a dutiable large yacht imported for sale at a United States boat show must conform to...
Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe
Energy Technology Data Exchange (ETDEWEB)
Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.
1982-09-01
Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available.
Measurement of left ventricular ejection fraction with ionic sup(113m)In and a cardiac probe
International Nuclear Information System (INIS)
Liu, X.; Harrison, K.S.; Wagner, H.N. Jr.
1982-01-01
Left ventricular ejection fraction (LVEF) was measured with a cardiac probe (Nuclear Stethoscope. Bios Inc., Valhalla, New York) and sup(113m)In in 28 normal subjects and 86 patients with coronary artery disease (CAD). In 20 normal subjects sup(99m)TC-RBCs were compared with sup(113m)In, which binds to transferrin after IV injection. With sup(99m)Tc-RBCs average LVEF was 57+-7% (1 SD); with sup(113m)In, average LEVF was 55+-8% (N.S.). Sequential measurements at different times over 60 min revealed good reproducibility. Comparison of LVEF's obtained using sup(99m)Tc-RBCs with a gamma camera and cardiac probe revealed a good correlation. The correlation coefficients were 0.92 in 25 patients with CAD and 0.95 in 10 patients with LV wall motion abnormalities. The LVEF obtained using a cardiac probe and sup(113m)In increased in 28 normals from 57+-9% to 64+-13% (P<0.001) during handgrip exercise, while the LVEF decreased from 45+-9% to 41+-10% (P<0.01) in patients with acute myocardial infarction 4-7 weeks after episode, from 48+-11 to 40+-12% (P<0.001) in patients with old myocardial infarction, and from 52+-9 to 42+-9% (P<0.001) in patients with angina pectoris. The cardiac probe and sup(113m)In provide a useful alternate means of determining left ventricular dysfunction in facilities where sup(99m)Tc and a gamma camera computer system are not readily available. (orig.)
Directory of Open Access Journals (Sweden)
Chin M. Lee
2017-09-01
Full Text Available Gas vesicles (GVs are proteinaceous, gas-filled organelles used by some bacteria to enable upward movement into favorable air/liquid interfaces in aquatic environments. Serratia sp. ATCC39006 (S39006 was the first enterobacterium discovered to produce GVs naturally. The regulation of GV assembly in this host is complex and part of a wider regulatory network affecting various phenotypes, including antibiotic biosynthesis. To identify new regulators of GVs, a comprehensive mutant library containing 71,000 insertion mutants was generated by random transposon mutagenesis and 311 putative GV-defective mutants identified. Three of these mutants were found to have a transposon inserted in a LacI family transcription regulator gene (rbsR of the putative ribose operon. Each of these rbsR mutants was GV-defective; no GVs were visible by phase contrast microscopy (PCM or transmission electron microscopy (TEM. GV deficiency was caused by the reduction of gvpA1 and gvrA transcription (the first genes of the two contiguous operons in the GV gene locus. Our results also showed that a mutation in rbsR was highly pleiotropic; the production of two secondary metabolites (carbapenem and prodigiosin antibiotics was abolished. Interestingly, the intrinsic resistance to the carbapenem antibiotic was not affected by the rbsR mutation. In addition, the production of a siderophore, cellulase and plant virulence was reduced in the mutant, whereas it exhibited increased swimming and swarming motility. The RbsR protein was predicted to bind to regions upstream of at least 18 genes in S39006 including rbsD (the first gene of the ribose operon and gvrA. Electrophoretic mobility shift assays (EMSA confirmed that RbsR bound to DNA sequences upstream of rbsD, but not gvrA. The results of this study indicate that RbsR is a global regulator that affects the modulation of GV biogenesis, but also with complex pleiotropic physiological impacts in S39006.
Spraying of metallic powders by hybrid gas/water torch and the effects of inert gas shrouding
Czech Academy of Sciences Publication Activity Database
Kavka, Tetyana; Matějíček, Jiří; Ctibor, Pavel; Hrabovský, Milan
2012-01-01
Roč. 21, 3-4 (2012), s. 695-705 ISSN 1059-9630 R&D Projects: GA MPO FR-TI2/702; GA MPO FR-TI2/561 Institutional research plan: CEZ:AV0Z20430508 Keywords : copper * tungsten * hybrid water-gas torch * plasma facing materials * plasma spraying * gas shroud Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.481, year: 2012 http://www.springerlink.com/content/j07t3222hnv87882/fulltext.pdf
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-01-01
For the purpose of developing a 10MW class demonstrative plant for geothermal binary power generation, the R and D were carried out, and the results obtained from FY 1995 to FY 1999 were summed up. In the interim evaluation made in July 1994, study was to be phasedly proceeded with for the main three systems (hydrothermal system, medium system and power generation system) which compose the 10MW class binary cycle power plant. The test on the hydrothermal system was started in FY 1995. In the R and D, the following were conducted for evaluation: design/manufacture/installation of the test device for the hydrothermal system, manufacture of demonstrative downhole pump (DHP) No.3 and test at plant, test on the hydrothermal system. As to the turbine working medium suitable for binary power plant, the specified freon/substitute freon have been used, but it seems that hydrocarbons such as butane and pentane can be effective in future. In the study of the economical efficiency, it was pointed out that for the commercialization, it is important to improve durability of DHP and further reduce the cost of DHP equipment and cost of repairs. (NEDO)
International Nuclear Information System (INIS)
Barsony, Mary; Wolf-Chase, Grace A.; Ciardi, David R.; O'Linger, JoAnn
2010-01-01
The outflow driven by the Class 0 protostar, IRAS 16253-2429, is associated with bipolar cavities visible in scattered mid-infrared light, which we refer to as the Wasp-Waist Nebula. InfraRed Spectometer (IRS) scan mapping with the Spitzer Space Telescope of a ∼1' x 2' area centered on the protostar was carried out. The outflow is imaged in six pure rotational (0-0 S(2) through 0-0 S(7)) H 2 lines, revealing a distinct, S-shaped morphology in all maps. A source map in the 11.3 μm polycyclic aromatic hydrocarbon (PAH) feature is presented in which the protostellar envelope appears in absorption. This is the first detection of absorption in the 11.3 μm PAH feature. Spatially resolved excitation analysis of positions in the blue- and redshifted outflow lobes, with extinction-corrections determined from archival Spitzer 8 μm imaging, shows remarkably constant temperatures of ∼1000 K in the shocked gas. The radiated luminosity in the observed H 2 transitions is found to be 1.94 ± 0.05 x 10 -5 L sun in the redshifted lobe and 1.86 ± 0.04 x 10 -5 L sun in the blueshifted lobe. These values are comparable to the mechanical luminosity of the flow. By contrast, the mass of hot (T ∼ 1000 K) H 2 gas is 7.95 ± 0.19 x 10 -7 M sun in the redshifted lobe and 5.78 ± 0.17 x 10 -7 M sun in the blueshifted lobe. This is just a tiny fraction, of order 10 -3 , of the gas in the cold (30 K), swept-up gas mass derived from millimeter CO observations. The H 2 ortho/para ratio of 3:1 found at all mapped points in this flow suggests previous passages of shocks through the gas. Comparison of the H 2 data with detailed shock models of Wilgenbus et al. shows the emitting gas is passing through Jump (J-type) shocks. Pre-shock densities of 10 4 cm -3 ≤ n H ≤ 10 5 cm -3 are inferred for the redshifted lobe and n H ≤ 10 3 cm -3 for the blueshifted lobe. Shock velocities are 5 km s -1 ≤ v s ≤ 10 km s -1 for the redshifted gas and v s = 10 km s -1 for the blueshifted gas
32 CFR Appendix D to Part 113 - Sample DD Form 2654, “Involuntary Allotment Notice and Processing”
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Sample DD Form 2654, âInvoluntary Allotment Notice and Processingâ D Appendix D to Part 113 National Defense Department of Defense OFFICE OF THE..., App. D Appendix D to Part 113—Sample DD Form 2654, “Involuntary Allotment Notice and Processing...
Peak pool boiling heat flux from horizontal cylinders in subcooled liquids
International Nuclear Information System (INIS)
Elkassabgi, Y.
1986-01-01
The peak pool boiling heat flux is observed on horizontal cylindrical heaters in acetone, Freon-113, methanol, and isopropanol over ranges of subcooling from zero to 120 0 C. Photographs, and the data themselves, reveal that there are three distinct burnout mechanisms at different levels of subcooling. Three interpretive models provide the basis for accurate correlations of the present data, and data from the literature, in each of the three regimes. Burnout is dictated by condensation on the walls of the vapor jets and columns at low subcooling. In the intermediate regime, burnout is limited by natural convection which becomes very effective as vapor near the heater reduces boundary layer resistance. Burnout in the high-subcooling regime is independent of the level of subcoooling and is limited by the process of molecular effusion
13 CFR 113.440 - Health and insurance benefits and services.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Health and insurance benefits and....440 Health and insurance benefits and services. Subject to § 113.235(d), in providing a medical, hospital, accident, or life insurance benefit, service, policy, or plan to any of its students, a recipient...
Self-Test Procedures for Gas Sensors Embedded in Microreactor Systems
Helwig, Andreas; Hackner, Angelika; Zappa, Dario; Sberveglieri, Giorgio
2018-01-01
Metal oxide (MOX) gas sensors sensitively respond to a wide variety of combustible, explosive and poisonous gases. However, due to the lack of a built-in self-test capability, MOX gas sensors have not yet been able to penetrate safety-critical applications. In the present work we report on gas sensing experiments performed on MOX gas sensors embedded in ceramic micro-reaction chambers. With the help of an external micro-pump, such systems can be operated in a periodic manner alternating between flow and no-flow conditions, thus allowing repetitive measurements of the sensor resistances under clean air, R0, and under gas exposure, Rgas, to be obtained, even under field conditions. With these pairs of resistance values, eventual drifts in the sensor baseline resistance can be detected and drift-corrected values of the relative resistance response Resp=(R0−Rgas)/R0 can be determined. Residual poisoning-induced changes in the relative resistance response can be detected by reference to humidity measurements taken with room-temperature-operated capacitive humidity sensors which are insensitive to the poisoning processes operative on heated MOX gas sensors. PMID:29401673
Performance of Fluidized bed Fenton process in Degrading Acid Blue 113
Bello, M. M.; Raman, A. A.
2017-06-01
The performance of a fluidized bed Fenton process in degrading Acid Blue 113 (AB 113) was investigated. Fluidized bed Fenton process is a modification of conventional Fenton oxidation, aimed at reducing sludge generation and improving process performance. Response surface methodology was used to study the effects of operational parameter on the color removal from the dye. Dimensionless factors, Dye/Fe2+, H2O2/Fe2+ and pH were used as the independent variables in Box-Behnken Design (BDD). Reduced quadratic model was developed to predict the color removal. The process could remove up to 99 % of the initial color. The most significant factor for color removal was found to be Dye/Fe2+, followed by H2O2/Fe2+. Unlike conventional Fenton, the initial pH of the solution does not have a significant effect on the color removal.
The influence of zirconium on the labelling stability of albumin macroaggregates with indium-113m
International Nuclear Information System (INIS)
Caro, R.A.; Ciscato, V.A.; Ihlo, J.E.; Nicolini, J.O.; Palcos, M.C.; Radicella, R.
1975-01-01
Physicochemical and biological studies are described to standardize the preparation of sup(113m)In labelled albumin macroaggregates (MAA), for its utilization as a tracer in lung scintiscannings. It was demonstrated that the presence of 20 μg of Zr(IV) and 4 mg of Na 2 PO 4 H per milliliter of suspension are necessary in order to fix the sup(113m)In to the MAA and to minimize its separation ''in vivo'' owing to the presence of plasma transferrin. (author)
19 CFR 113.67 - Commercial gauger and commercial laboratory bond conditions.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Commercial gauger and commercial laboratory bond... SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS Customs Bond Conditions § 113.67 Commercial gauger and commercial laboratory bond conditions. Commercial Gauger Bond Conditions (a) Commercial gauger bond...
46 CFR 113.35-13 - Mechanical engine order telegraph systems; operation.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems; operation...) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-13 Mechanical engine order telegraph systems; operation. If more than one transmitter operates a...
46 CFR 113.35-15 - Mechanical engine order telegraph systems; application.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems; application...) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-15 Mechanical engine order telegraph systems; application. If a mechanical engine order telegraph...
Construction of symmetric Hadamard matrices of order 4v for v = 47, 73, 113
Directory of Open Access Journals (Sweden)
Balonin N. A.
2018-01-01
Full Text Available We continue our systematic search for symmetric Hadamard matrices based on the so called propus construction. In a previous paper this search covered the orders 4v with odd v ≤ 41. In this paper we cover the cases v = 43, 45, 47, 49, 51. The odd integers v < 120 for which no symmetric Hadamard matrices of order 4v are known are the following: 47, 59, 65, 67, 73, 81, 89, 93, 101, 103, 107, 109, 113, 119. By using the propus construction, we found several symmetric Hadamard matrices of order 4v for v = 47, 73, 113.
The R.D.F. gasifier of Florentine area
Energy Technology Data Exchange (ETDEWEB)
Barducci, G. [Studio Tecnico di Ingegneria Ambientale, Firenze (Italy)
1993-12-31
L.E.G. (Low Energy Gas) from large biomass gasification plants, to be used as a fuel for electricity production, is a suitable means for adding value -- from an energetic point of view -- to the R.D.F. (Refuse Derived Fuel) and to the agricultural and forestry residues. R.D.F. can be converted to a clean gas turbine fuel by gasification that consists in a partial combustion with oxygen or air and steam. In that sense it seems worthwhile to analyze the capacity of a gasifier such as the Greve in Chianti`s recirculating fluidized bed gasifier. The world`s first full-scale R.D.F. gasification plant has been designed in Florence; it is now realized in Greve in Chianti and, at the moment, is starting the industrial management. The plant is designed to gasify 200 t/d of pelletized R.D.F. producing about 17.000/19.000 Nmc/h of low energy gas (LEG) with a net calorific value (NCV) of about 5 MJ/Nmc and a total energy content (at the outlet of the gasifiers) of about 7.5 MJ/Nmc. The produced LEG will be partly burned on site for power production while partly will be cooled, dedusted and transported to the kiln of the adjacent cement factory. The design idea of R.D.F. gasification starts from field of waste treatment and recycling and develops new, advanced technical and economical sinergy with the field of industrial production and electric power generation. The gasification of fuels derived from selected wastes (and/or industrial refuse) and the exploitation of the lean gas produced is the most advanced point in the development of heat conversion processes.
Sudden death caused by 1,1-difluoroethane inhalation.
Xiong, Zhenggang; Avella, Joseph; Wetli, Charles V
2004-05-01
A 20-year-old man was found dead on the floor next to a computer, with a nearly full can of "CRC Duster" dust remover located next to the deceased on the floor, and an empty can of the same product on the computer desk. Toxicologic evaluation using either gas chromatography/mass spectrometry (GC/MS) or gas chromatography/flame ionization detector (GC/FID) method identified the active ingredient 1,1-difluoroethane (Freon 152a) in all tissues analyzed. Tissue distribution studies revealed highest concentration in central blood, lung, and liver. It is believed that the 1,1-difluoroethane inhalation was the cause of death.
Study of the effect of water vapor on a resistive plate chamber with glass electrodes
Sakai, H H; Teramoto, Y; Nakano, E E; Takahashi, T T
2002-01-01
We studied the effects of water vapor on the efficiencies of resistive plate chambers with glass electrodes, operated in the streamer mode. With moisture in the chamber gas that has freon as a component (water vapor approx 1000 ppm), a decrease in the efficiency (approx 20%) has been observed after operating for a period of several weeks to a few months. From our study, the cause of the efficiency decrease was identified as a change on the cathode surface. In addition, a recovery method was found: flushing for 1 day with argon bubbled through water containing >=3% ammonia, followed by a few weeks of training with dry gas.
Multisite Kinetic Modeling of 13C Metabolic MR Using [1-13C]Pyruvate
Directory of Open Access Journals (Sweden)
Pedro A. Gómez Damián
2014-01-01
Full Text Available Hyperpolarized 13C imaging allows real-time in vivo measurements of metabolite levels. Quantification of metabolite conversion between [1-13C]pyruvate and downstream metabolites [1-13C]alanine, [1-13C]lactate, and [13C]bicarbonate can be achieved through kinetic modeling. Since pyruvate interacts dynamically and simultaneously with its downstream metabolites, the purpose of this work is the determination of parameter values through a multisite, dynamic model involving possible biochemical pathways present in MR spectroscopy. Kinetic modeling parameters were determined by fitting the multisite model to time-domain dynamic metabolite data. The results for different pyruvate doses were compared with those of different two-site models to evaluate the hypothesis that for identical data the uncertainty of a model and the signal-to-noise ratio determine the sensitivity in detecting small physiological differences in the target metabolism. In comparison to the two-site exchange models, the multisite model yielded metabolic conversion rates with smaller bias and smaller standard deviation, as demonstrated in simulations with different signal-to-noise ratio. Pyruvate dose effects observed previously were confirmed and quantified through metabolic conversion rate values. Parameter interdependency allowed an accurate quantification and can therefore be useful for monitoring metabolic activity in different tissues.
Accelerated Fractional Ventilation Imaging with Hyperpolarized Gas MRI
Emami, Kiarash; Xu, Yinan; Hamedani, Hooman; Profka, Harrilla; Kadlecek, Stephen; Xin, Yi; Ishii, Masaru; Rizi, Rahim R.
2013-01-01
PURPOSE To investigate the utility of accelerated imaging to enhance multi-breath fractional ventilation (r) measurement accuracy using HP gas MRI. Undersampling shortens the breath-hold time, thereby reducing the O2-induced signal decay and allows subjects to maintain a more physiologically relevant breathing pattern. Additionally it may improve r estimation accuracy by reducing RF destruction of HP gas. METHODS Image acceleration was achieved by using an 8-channel phased array coil. Undersampled image acquisition was simulated in a series of ventilation images and images were reconstructed for various matrix sizes (48–128) using GRAPPA. Parallel accelerated r imaging was also performed on five mechanically ventilated pigs. RESULTS Optimal acceleration factor was fairly invariable (2.0–2.2×) over the range of simulated resolutions. Estimation accuracy progressively improved with higher resolutions (39–51% error reduction). In vivo r values were not significantly different between the two methods: 0.27±0.09, 0.35±0.06, 0.40±0.04 (standard) versus 0.23±0.05, 0.34±0.03, 0.37±0.02 (accelerated); for anterior, medial and posterior slices, respectively, whereas the corresponding vertical r gradients were significant (P fractional ventilation measurement with HP gas MRI. PMID:23400938
International Nuclear Information System (INIS)
Cohen-Addad, C.; Savariault, J.-M.; Lehmann, M.S.
1981-01-01
The structure of 2-(2-chlorobenzoylimino)-1,3-thiazolidine, C 10 H 9 ClN 2 OS, has been redetermined by neutron diffraction at 113 K. The space group is P2 1 /c with lattice parameters a = 19.950 (4), b = 7.420 (2), c = 11.566 (3) A, β = 109.10 (3) 0 , Z = 4, Msub(r) = 240.7 and dsub(calc) = 1.52 Mg m -3 . The final R(F 2 ) was 0.045 for 1768 reflections. The structural results show unambiguously that the molecule is found in the imino form with an H atom located near the endocyclic N atom of the thiazolidine group. Based on deformation electron density maps and the interatomic distances it is speculated that the difference in geometry between the two tautomeric forms (imino and amino) is small and that the occurrence of one or the other is strongly dependent on the substituents. A short intramolecular S-O contact of 2.68 A is found and is believed to constitute a very weak bond. (Auth.)
Microstructure fibers for gas detection
Czech Academy of Sciences Publication Activity Database
Matějec, Vlastimil; Mrázek, Jan; Hayer, Miloš; Peterka, Pavel; Kaňka, Jiří; Honzátko, Pavel; Berková, Daniela
2006-01-01
Roč. 26, 2/3 (2006), s. 317-321 ISSN 0928-4931. [MADICA 2004. Tunis, 29.11.2004-01.12.2004] R&D Projects: GA ČR(CZ) GA102/02/0779 Institutional research plan: CEZ:AV0Z2067918 Keywords : photonic crystals * crystal microstructure * optical fibres * fibre optic sensors * gas Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.325, year: 2006
Production of kits for the labelling with 113sup(m)In and sup(99m)Tc, at the CNEA
International Nuclear Information System (INIS)
Palcos, M.C.; Kurcbart, Horacio; Nowotny, G.; Ramos, Elsa; Riesgo, J.G.; Mitta, A.E.A.
1978-05-01
The actual state of the production of radiopharmaceuticals in the form of reagents kits at the C.N.E.A. is described. This could allow the users to label compounds with sup(113m)In and sup(99m)Tc in an easy and reproducible way. At present, the following sets are provided routinarily a) To label with sup(99m)Tc: Albumin macroaggregates: calcium gluconate; antimonium sulfide colloid, sodium phytate; sodium calcium DTPA; seroalbumin; sodium pyrophosphate; sodium citrate. b) To label with sup(113m)In: albumin macroaggregates; PVP-bicarbonate; DTPA; human seroalbumin. Regarding products in a developping stage, we have: to labed with sup(99m)Tc: dimercapto-succinic acid, set for the labelling of human erythrocytes, set for sup(113m)In and sup(99m)Tc concentration and bleomicin; to label with sup(113m)In: EDTMP sup(99m)In. (author) [es
Nishida, T; Hayashi, T; Inamoto, T; Kato, R; Ibuki, N; Takahara, K; Takai, T; Yoshikawa, Y; Uchimoto, T; Saito, K; Tanda, N; Kouno, J; Minami, K; Uehara, H; Hirano, H; Nomi, H; Okada, Y; Azuma, H
Hydrogen (H 2 ) and carbon monoxide (CO) gas are both reported to reduce reactive oxygen species and alleviate tissue ischemia-reperfusion (I-R) injury. The present study was conducted to evaluate the effects of a mixture of H 2 gas and CO gas (dual gas) in comparison with hydrogen gas (H 2 : 2%) alone on I-R renal injury (composition of dual gas; N 2 : 77.8%; O 2 : 20.9%; H 2 : 1.30%; CO: 250 parts per million). Adult male Sprague-Dawley rats (body weight 250-280 g) were divided into 5 groups: (1) sham operation control, (2) dual gas inhalation (dual treatment) without I-R treatment, (3) I-R renal injury, (4) H 2 gas alone inhalation (H 2 treatment) with I-R renal injury, and (5) dual treatment with I-R renal injury. I-R renal injury was induced by clamping the left renal artery and vein for 45 minutes followed by reperfusion, and then contralateral nephrectomy was performed 2 weeks later. Renal function was markedly decreased at 24 hours after reperfusion, and thereafter the effects of dual gas were assessed by histologic examination and determination of the superoxide radical, together with functional and molecular analyses. Pathologic examination of the kidney of I-R rats revealed severe renal damage. Importantly, cytoprotective effects of the dual treatment in comparison with H 2 treatment and I-R renal injury were observed in terms of superoxide radical scavenging activity and histochemical features. Rats given dual treatment and I-R renal injury showed significant decreases in blood urea nitrogen. Increased expression of several inflammatory cytokines (tumor necrosis factor-α, interleukin-6, intracellular adhesion molecule-1, nuclear factor-κB, hypoxia inducible factor-1α, and heme oxygenase-1) was attenuated by the dual treatment. Dual gas inhalation decreases oxidative stress and markedly improves I-R-induced renal injury. Copyright © 2017 Elsevier Inc. All rights reserved.
Demand and supply in Russian gas market
International Nuclear Information System (INIS)
Milovidov, K.N.
1997-01-01
The big volume of gas supplies for current and future energy and natural gas balances in Russia is important to understand the likely future dynamics of demand for gas. The path of future demand in Russia is uncertain and the range of possible scenarios is wide. For creating the new gas consumption structure, more deep diversification and development of the gas distribution systems, large investments and considerable periods of time are necessary. The factors usually studied in detail in the conditions of market economy can not be used here as a basis for strategic planning due to several reasons. (R.P.)
Estimating Risk of Natural Gas Portfolios by Using GARCH-EVT-Copula Model.
Tang, Jiechen; Zhou, Chao; Yuan, Xinyu; Sriboonchitta, Songsak
2015-01-01
This paper concentrates on estimating the risk of Title Transfer Facility (TTF) Hub natural gas portfolios by using the GARCH-EVT-copula model. We first use the univariate ARMA-GARCH model to model each natural gas return series. Second, the extreme value distribution (EVT) is fitted to the tails of the residuals to model marginal residual distributions. Third, multivariate Gaussian copula and Student t-copula are employed to describe the natural gas portfolio risk dependence structure. Finally, we simulate N portfolios and estimate value at risk (VaR) and conditional value at risk (CVaR). Our empirical results show that, for an equally weighted portfolio of five natural gases, the VaR and CVaR values obtained from the Student t-copula are larger than those obtained from the Gaussian copula. Moreover, when minimizing the portfolio risk, the optimal natural gas portfolio weights are found to be similar across the multivariate Gaussian copula and Student t-copula and different confidence levels.
Estimating Risk of Natural Gas Portfolios by Using GARCH-EVT-Copula Model
Directory of Open Access Journals (Sweden)
Jiechen Tang
2015-01-01
Full Text Available This paper concentrates on estimating the risk of Title Transfer Facility (TTF Hub natural gas portfolios by using the GARCH-EVT-copula model. We first use the univariate ARMA-GARCH model to model each natural gas return series. Second, the extreme value distribution (EVT is fitted to the tails of the residuals to model marginal residual distributions. Third, multivariate Gaussian copula and Student t-copula are employed to describe the natural gas portfolio risk dependence structure. Finally, we simulate N portfolios and estimate value at risk (VaR and conditional value at risk (CVaR. Our empirical results show that, for an equally weighted portfolio of five natural gases, the VaR and CVaR values obtained from the Student t-copula are larger than those obtained from the Gaussian copula. Moreover, when minimizing the portfolio risk, the optimal natural gas portfolio weights are found to be similar across the multivariate Gaussian copula and Student t-copula and different confidence levels.
Zhang, Xinwen; Hu, Zhen; Zhang, Jian; Fan, Jinlin; Ngo, Huu Hao; Guo, Wenshan; Zeng, Chujun; Wu, Yiwen; Wang, Siyuan
2018-02-01
In this study, a novel aerated surface flow constructed wetland (SFCW) using exhaust gas from biological wastewater treatment was investigated. Compared with un-aerated SFCW, the introduction of exhaust gas into SFCW significantly improved NH 4 + -N, TN and COD removal efficiencies by 68.30 ± 2.06%, 24.92 ± 1.13% and 73.92 ± 2.36%, respectively. The pollutants removal mechanism was related to the microbial abundance and the highest microbial abundance was observed in the SFCW with exhaust gas because of the introduction of exhaust gas from sequencing batch reactor (SBR), and thereby optimizing nitrogen transformation processes. Moreover, SFCW would significantly mitigate the risk of exhaust gas pollution. SFCW removed 20.00 ± 1.23%, 34.78 ± 1.39%, and 59.50 ± 2.33% of H 2 S, NH 3 and N 2 O in the exhaust gas, respectively. And 31.32 ± 2.23% and 32.02 ± 2.86% of bacterial and fungal aerosols in exhaust gas were also removed through passing SFCW, respectively. Copyright © 2017. Published by Elsevier Ltd.
Radiochemistry as a (rho)R Diagnostic with the RAGS Gas Collection System
International Nuclear Information System (INIS)
Nelson, S.L.; Shaughnessy, D.A.; Schneider, D.H.; Stoeffl, W.; Moody, K.J.; Cerjan, C.; Stoyer, M.A.; Bernstein, L.A.; Bleuel, D.L.; Hoffman, R.
2010-01-01
Radiochemical diagnostic techniques such as gas-phase capsule debris analysis may prove to be successful methods for establishing the success or failure of ignition experiments at the National Ignition Facility (NIF). Samples in the gas phase offer the most direct method of collection by simply pumping out the large target chamber following a NIF shot. The target capsules will be prepared with dopants which will produce radioactive noble gas isotopes upon activation with neutrons. We have designed and constructed the Radchem Apparatus for Gas Sampling (RAGS) in order to collect post-shot gaseous samples for NIF capsule diagnostics. The design of RAGS incorporates multiple stages intended to purify, transfer, and count the radioactive decays from gaseous products synthesized in NIF experiments. At the moment the dopant of choice is 124 Xe, which will undergo (n,γ) and (n, 2n) reactions to produce 125 Xe and 123 Xe. The half-lives of each are on the order of multiple hours and are suitable for long-term gamma-counting. These isotopes and the rest of the gases evolved in a NIF shot will be drawn through the NIF turbo pumps, past the temporarily shuttered cryo pumps (to aid our collection efficiency), and towards the first main portion of the RAGS system: the pre-cleaner. The pre-cleaner will consist of a water removal system, a series of heated getter cartridges to remove most other impurities such as N 2 , O 2 , CO 2 , etc., and a residual gas analyzer (RGA) to monitor vacuum quality. The noble gases will flow through the precleaner and into the second stage of the system: the cryo collector. This cryo collector consists of a main cryo head for noble gas collection which will operate for approximately five minutes post-shot. Afterwards a valve will close and isolate the pre-cleaner, while the cryo head warms to release the Xe gas to one of two locations - either a second cryo station for in-situ gamma counting, or to a small cooled gas bottle for removal and
Multi-energy ion implantation from high-intensity laser
Czech Academy of Sciences Publication Activity Database
Cutroneo, Mariapompea; Torrisi, L.; Ullschmied, Jiří; Dudžák, Roman
2016-01-01
Roč. 61, č. 2 (2016), s. 109-113 ISSN 0029-5922. [PLASMA 2015 : International Conference on Research and Applications of Plasmas. Warsaw, 07.09.2015-11.09.2015] R&D Projects: GA MŠk(CZ) LM2011019; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389021 ; RVO:61389005 Keywords : high-intensity laser * implantation * material modification Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BL - Plasma and Gas Discharge Physics (UFP-V) Impact factor: 0.760, year: 2016
Rotation of gas above the galactic disk
International Nuclear Information System (INIS)
Gvaramadze, V.V.; Lominadze, D.G.
1988-01-01
The galactic disk is modeled by an oblate spheroid with confocal spherodial isodensity surfaces. An explicit analytic expression is found for the angular velocity of the gas outside the disk. The parameters of a three-component model of a spiral galaxy (oblate spheroid with central hole, bulge, and massive corona) are chosen in such a way as to obtain in the disk a two-hump rotation curve (as in the Galaxy, M 31, and M 81). It is shown that at heights absolute value z ≤ 2 kpc the gas rotates in the same manner as the disk. However, at greater heights the rotation curve ceases to have two humps. Allowance for the pressure gradient of the gas slightly changes the rotation curve directly above the disk (r r/sub disk/)
Validity and reliability assessment of the Brazilian version of the game addiction scale (GAS).
Lemos, Igor Lins; Cardoso, Adriana; Sougey, Everton Botelho
2016-05-01
The uncontrolled use of video games can be addictive. The Game Addiction Scale (GAS) is an instrument that was developed to assess this type of addiction. The GAS consists of 21 items that are divided into the following seven factors: salience, tolerance, mood modification, relapse, withdrawal, conflict and problems. This study assessed the convergent validity and reliability of the GAS according to measures of internal consistency and test-retest stability. Three hundred and eighty four students completed the GAS, the Internet Addiction Test (IAT), the Liebowitz Social Anxiety Scale (LSAS), the Beck Depression Inventory (BDI) and the Video Game Addiction Test (VAT). A subgroup of the participants (n=76) completed the GAS again after 30days to determine test-retest stability. The GAS demonstrated excellent internal consistency (Cronbach's alpha=0.92), was highly correlated with the VAT (r=0.883) and was moderately correlated with the BDI (r=0.358), the LSAS (r=0.326) and the IAT (r=0.454). In the Brazilian Portuguese population, the GAS shows good internal consistency. These data indicate that the GAS can be used to assess video game addiction due to its demonstrated psychometric validity. Copyright © 2016 Elsevier Inc. All rights reserved.
Natural gas industry and global warming
International Nuclear Information System (INIS)
Staropoli, R.; Darras, M.
1997-01-01
Natural gas has a very good potential compared to other fossil fuels as regard to global warming because of its high content of hydrogen, and its versatility in uses. To take full advantage of this potential, further development of gas designed boilers and furnaces, gas catalytic combustion, fuel cells are needed, but progresses in the recent years have been very promising. The natural gas industry' environmental potential is discussed. Regarding methane emission, progresses have been done is Western Europe on the distribution network, and some improvement are underway. It is however important to rationalize the effort by acting on the most emitting subsystem: this can be achieved by cooperation along the whole gas chain. (R.P.)
International Nuclear Information System (INIS)
Nowotny, G.; Fraga de Suarez, A.H.; Mitta, A.E.A.
1978-05-01
A radiopharmaceutical prepared from ethylendiaminotetrametilenphosphoric acid (E.T.M.P.) is described, which can be labelled with 113 In for its use in bone scintillography. This compound has been tested satisfactorily in animals. Chemical controls for labelling are discussed as well as the biological ones for distribution and toxicity. A radiochemical yield of 95% or higher was obtained and after two hours of administration nearly 30% of dose can be localized is skeleton. (author) [es