WorldWideScience

Sample records for journal.ui.ac.id

  1. Applying Open Researchers and Contributors ID in scholarly journals

    Directory of Open Access Journals (Sweden)

    Jeonghee Im

    2015-02-01

    Full Text Available Open Researchers and Contributors ID (ORCID launched its registry services in October 2012. Consequently, adding personal information to the ORCID registry became routine work for researchers. To add ORCID to an online article, the tag needs to be included in the Journal Article Tag Suite extensible markup language file, if such a file has been produced by the publisher. Subsequently, all co-authors’ ORCID can be easily and conveniently collected and then integrated into the manuscript management system. In the current age of information and the Internet, journals need to keep pace with the surge of new standards and technologies. Editors should be able to accept and apply these new systems rapidly.

  2. Special Issue in Journal of Astrophysics & Astronomy (JAA). All ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 39; Issue 1. Editorial. Samir Mandal Indranil Chattopadhyay Anuj Nandi Santabrata Das. Volume 39 Issue 1 February 2018 Article ID 1. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/joaa/039/01/0001. Abstract ...

  3. Pro Android UI

    CERN Document Server

    Jackson, Wallace

    2014-01-01

    If you're an Android application developer, chances areyou're using fixed, scrolling, swipe-able, and other cutting-edge custom UIDesigns in your Android development projects. These UI Design approaches aswell as other Android ViewGroup UI layout containers are the bread and butterof Pro Android User Interface (UI) design and Android User Experience (UX)design and development.Using a top down approach, Pro Android UI shows you how todesign and develop the best user interface for your app, while taking intoaccount the varying device form factors in the increasingly fragmented Androidenvironment

  4. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  5. jQuery UI cookbook

    CERN Document Server

    Boduch, Adam

    2013-01-01

    Filled with a practical collection of recipes, jQuery UI Cookbook is full of clear, step-by-step instructions that will help you harness the powerful UI framework in jQuery. Depending on your needs, you can dip in and out of the Cookbook and its recipes, or follow the book from start to finish.If you are a jQuery UI developer looking to improve your existing applications, extract ideas for your new application, or to better understand the overall widget architecture, then jQuery UI Cookbook is a must-have for you. The reader should at least have a rudimentary understanding of what jQuery UI is

  6. Kendo UI cookbook

    CERN Document Server

    Ganatra, Sagar

    2014-01-01

    This book is an easy-to-follow guide full of hands-on examples that allows you to learn and build visually compelling web applications using the Kendo UI library. This book will do wonders for web developers having knowledge of HTML and Javascript and want to polish their skills in building applications using the Kendo UI library.

  7. SoapUI cookbook

    CERN Document Server

    Anderson, Rupert

    2015-01-01

    This book is aimed at developers and technical testers who are looking for a quick way to take their SoapUI skills and understanding to the next level. Even if you are new to SoapUI but have basic Java skills and a reasonable grasp of RESTFul and Soap web services, then you should have no problem making use of this book.

  8. Environmental Information System Baden-Wuerttemberg. RK UIS 2015 framework concept 2015; Umweltinformationssystem Baden-Wuerttemberg. RK UIS 2015 Rahmenkonzeption 2015

    Energy Technology Data Exchange (ETDEWEB)

    Weissenbach, Kurt (ed.)

    2016-02-16

    The Baden-Wuerttemberg Environmental Information System (UIS BW), which was set up over 30 years ago, has developed into a strategic national policy instrument for precautionary environmental and climate protection. Its importance will continue to increase as digitalisation progresses. The associated framework concept (RK UIS) has been regularly updated since 1989. The RK UIS 2015 is a fundamental revision of the last framework concept from the year 2006. The legal, technical, technical and organizational requirements that have since been amended have been incorporated and reflected in their impact on the overall conceptual framework. The RK UIS 2015 documents recommendations and development goals for adapting the UIS BW to the changed targets and general conditions. The renewed conceptual framework forms the basis for the further development of the individual UIS components. [German] Das in ueber 30 Jahren aufgebaute Umweltinformationssystem Baden-Wuerttemberg (UIS BW) hat sich zu einem strategischen Instrument der Landespolitik fuer einen vorsorgenden Umwelt- und Klimaschutz entwickelt. Seine Bedeutung wird durch die fortschreitende Digitalisierung weiter zunehmen. Die zugehoerige Rahmenkonzeption (RK UIS) wird seit 1989 regelmaessig fortgeschrieben. Mit der RK UIS 2015 liegt eine grundlegende Ueberarbeitung der letzten Rahmenkonzeption aus dem Jahr 2006 vor. Die seitdem geaenderten rechtlichen, fachlichen, technischen und organisatorischen Anforderungen wurden aufgenommen und in ihren Auswirkungen auf den konzeptionellen Gesamtrahmen reflektiert. Die RK UIS 2015 dokumentiert Empfehlungen und Entwicklungsziele fuer die Anpassung des UIS BW an die veraenderten Zielvorgaben und Rahmenbedingungen. Der erneuerte konzeptionelle Gesamtrahmen bildet die Basis fuer die Weiterentwicklung der einzelnen UIS-Komponenten.

  9. Building UIs with Wijmo

    CERN Document Server

    Zhang, Yuguang

    2013-01-01

    Written with an example-based approach, Building UIs with Wijmo leads you step by step through the implementation and customization of each library component and its associated resources. Reference tables of each configuration option, method, and event for each component are provided, alongside detailed explanations of how each widget is used.Building UIs with Wijmo is targeted at readers who are familiar with HTML, CSS, JavaScript, and jQuery, and have a basic understanding of web development. Although knowledge of jQuery UI is not mandatory, it would be a bonus as it is quite similar to Wijm

  10. Instant forgedUI starter

    CERN Document Server

    Luiz, Joseandro

    2013-01-01

    Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks.The book is a Starter guide to learning ForgedUI. This book will start by unfolding the installation and creating a simple application using Titanium and ForgedUI, followed by taking you through the features to model an engaging UI and generate multi-platform code with Titanium, while covering the best design practice for Apple and Android application development. Last but not least, you will also come across the available resources where you can

  11. Creating dynamic UI with Android fragments

    CERN Document Server

    Wilson, Jim

    2013-01-01

    A fast-paced tutorial that guides you through everything you need to know about dynamic UI design for Android devices.This book is for developers with a basic understanding of Android programming who would like to improve the appearance and usability of their applications. Whether you're looking to create a more interactive user experience, create more dynamically adaptive UIs, provide better support for tablets and smartphones in a single app, reduce the complexity of managing your app UIs, or you are just trying to expand your UI design philosophy, then this book is for you.

  12. Tc99m-pertechnetate thyroid scintigraphy in newborns with neonatal TSH levels > 20uUI/ml, detected in the national program of newborn screening of congenital hypothyroidism (CH)

    International Nuclear Information System (INIS)

    Lobo, G.; Ladron de Guevara, D.; Perez, A.; Donoso, G.; Jimenez, C.; Arnello, F.; Vivanco, X.

    2002-01-01

    The aim of this study was to analyse the thyroid scintigraphy (TS) findings in 279 newborn with neonatal TSH (TSHnn) levels above 20 uUI/ml, detected in the national program of newborn screening of CH and phenylketonuria, and to compare them with: 1) final diagnosis, estimating its positive (PPV) and negative predictive value (NPV) and 2) TSHnn levels. Materials and Method: Thyroid scintigraphy of 279 newborn (57.3% girls) who presented TSHnn levels > 20 uUI/ml were revised, classifying them in eutopic gland (EuG), ectopic gland (EcG) and absence of contrast (AC). EuG was classified by visual and quantitative criteria in: normal contrast and size, goiter, and decreased contrast (DC). Tc99m-pertechnetate TS was performed average at 19th life's day (SD:11 days) with a gammacamera- computer system. The patients were separated according to hormonal confirmatory levels in: CH, hyperthyrotropinaemia (HT) and euthyroid. We compared TS results with final diagnosis and also with TSHnn levels (>= or 50 uUI/ml group (p<0.001). Moreover, the former group presented bigger proportion of CH newborns and of EcG scans than < 50uUI/ml patients (p<0.001). EcG and goiter condition had a PPV for CH of 100% and 79.6%, respectively. The NPV of normal TS was 86.7%. Conclusion: 1) Newborns with TSHnn levels larger than 20 uUI/ml show a high frequency of abnormal TS. 2) The EcG is highly predictive of CH. 3) Goiter and AC associated to TSHnn levels above 50 uUI/ml support strongly CH diagnosis. 4) Normal TS correspond very likely to euthyroid newborn, specially when TSHnn is lower than 50 uUI/ml

  13. Environmental Information System Baden-Wuerttemberg. RK UIS 2015 framework concept 2015

    International Nuclear Information System (INIS)

    Weissenbach, Kurt

    2016-01-01

    The Baden-Wuerttemberg Environmental Information System (UIS BW), which was set up over 30 years ago, has developed into a strategic national policy instrument for precautionary environmental and climate protection. Its importance will continue to increase as digitalisation progresses. The associated framework concept (RK UIS) has been regularly updated since 1989. The RK UIS 2015 is a fundamental revision of the last framework concept from the year 2006. The legal, technical, technical and organizational requirements that have since been amended have been incorporated and reflected in their impact on the overall conceptual framework. The RK UIS 2015 documents recommendations and development goals for adapting the UIS BW to the changed targets and general conditions. The renewed conceptual framework forms the basis for the further development of the individual UIS components. [de

  14. Benzimidazole-functionalized Zr-UiO-66 nanocrystals for luminescent sensing of Fe3+ in water

    International Nuclear Information System (INIS)

    Dong, Yingying; Zhang, Hanzhuo; Lei, Fan; Liang, Mei; Qian, Xuefeng; Shen, Peilian; Xu, Hui; Chen, Zhihui; Gao, Junkuo; Yao, Juming

    2017-01-01

    Zr-based MOF structure UiO-66 exhibits unprecedented high thermal and chemical stability, making it to be one of the most used MOFs in various applications. Yet, the poor photoluminescent (PL) properties of UiO-66 limit its applications in luminescent sensing. Herein, a new benzimidazole-functionalized UiO-66 nanocrystal (UiO-66-BI) was successfully fabricated via microwave synthesis. UiO-66-BI displayed octahedral nanocrystal morphology with a diameter smaller than 200 nm and could disperse well in water and common organic solvents. UiO-66-BI demonstrated extended optical absorption in the visible-light region and efficiently improved PL emission compared with UiO-66 pristine. The sensing properties of UiO-66-BI nanocrystals towards different ions were studied, and the results demonstrated that UiO-66-BI showed excellent selective luminescent sensing of Fe 3+ ions in water.

  15. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  16. Selective adsorption of cationic dyes by UiO-66-NH{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Qi; He, Qinqin; Lv, Mengmeng; Xu, Yanli; Yang, Hanbiao; Liu, Xueting, E-mail: wmlxt@163.com; Wei, Fengyu, E-mail: weifyliuj@163.com

    2015-02-01

    Graphical abstract: - Highlights: • Two Zr(IV)-based MOFs can remove cationic dyes more effectively than anionic dyes. • UiO-66 has higher selectivity for cationic dyes after modification with NH{sub 2}. • The mechanism for adsorption selectivity is rationally proposed. - Abstract: Herein, two zirconium(IV)-based MOFs UiO-66 and UiO-66-NH{sub 2} had been successfully prepared by a facile solvothermal method and were characterized by X-ray diffraction (XRD), field emission transmission electron microscopy (FETEM), N{sub 2} adsorption–desorption (BET), X-ray photoelectron spectroscopy (XPS), and zeta potential. They exhibit small size, large surface area, and can remove cationic dyes from aqueous solution more effectively than anionic dyes. This adsorption selectivity is due to the favorable electrostatic interactions between the adsorbents and cationic dyes. Furthermore, owing to the individual micropore structure of UiO-66-NH{sub 2} and its more negative zeta potential resulted from the charge balance for the protonation of –NH{sub 2}, UiO-66-NH{sub 2} displays much higher adsorption capacity for cationic dyes and lower adsorption capacity for anionic dyes than UiO-66.

  17. Benzimidazole-functionalized Zr-UiO-66 nanocrystals for luminescent sensing of Fe{sup 3+} in water

    Energy Technology Data Exchange (ETDEWEB)

    Dong, Yingying; Zhang, Hanzhuo; Lei, Fan; Liang, Mei; Qian, Xuefeng; Shen, Peilian [The Key laboratory of Advanced Textile Materials and Manufacturing Technology of Ministry of Education, National Engineering Lab for Textile Fiber Materials and Processing Technology (Zhejiang), College of Materials and Textiles, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Xu, Hui, E-mail: huixu@cjlu.edu.cn [Institute of Coordination Bond Metrology and Engineering, College of Materials Science and Engineering, China Jiliang University, Hangzhou 310018 (China); Chen, Zhihui, E-mail: huixu.chen@gmail.com [The Key laboratory of Advanced Textile Materials and Manufacturing Technology of Ministry of Education, National Engineering Lab for Textile Fiber Materials and Processing Technology (Zhejiang), College of Materials and Textiles, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Key Lab of Advanced Transducers and Intelligent Control System, Ministry of Education and Shanxi Province, College of Physics and Optoelectronics, Taiyuan University of Technology, Taiyuan 030024 (China); Gao, Junkuo, E-mail: jkgao@zstu.edu.cn [The Key laboratory of Advanced Textile Materials and Manufacturing Technology of Ministry of Education, National Engineering Lab for Textile Fiber Materials and Processing Technology (Zhejiang), College of Materials and Textiles, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Yao, Juming [The Key laboratory of Advanced Textile Materials and Manufacturing Technology of Ministry of Education, National Engineering Lab for Textile Fiber Materials and Processing Technology (Zhejiang), College of Materials and Textiles, Zhejiang Sci-Tech University, Hangzhou 310018 (China)

    2017-01-15

    Zr-based MOF structure UiO-66 exhibits unprecedented high thermal and chemical stability, making it to be one of the most used MOFs in various applications. Yet, the poor photoluminescent (PL) properties of UiO-66 limit its applications in luminescent sensing. Herein, a new benzimidazole-functionalized UiO-66 nanocrystal (UiO-66-BI) was successfully fabricated via microwave synthesis. UiO-66-BI displayed octahedral nanocrystal morphology with a diameter smaller than 200 nm and could disperse well in water and common organic solvents. UiO-66-BI demonstrated extended optical absorption in the visible-light region and efficiently improved PL emission compared with UiO-66 pristine. The sensing properties of UiO-66-BI nanocrystals towards different ions were studied, and the results demonstrated that UiO-66-BI showed excellent selective luminescent sensing of Fe{sup 3+} ions in water.

  18. UiO-66-NH2/GO Composite: Synthesis, Characterization and CO2 Adsorption Performance

    Directory of Open Access Journals (Sweden)

    Yan Cao

    2018-04-01

    Full Text Available In this work, a new composite materials of graphene oxide (GO-incorporated metal-organic framework (MOF(UiO-66-NH2/GO were in-situ synthesized, and were found to exhibit enhanced high performances for CO2 capture. X-ray diffraction (XRD, scanning electron microscope (SEM, N2 physical adsorption, and thermogravimetric analysis (TGA were applied to investigate the crystalline structure, pore structure, thermal stability, and the exterior morphology of the composite. We aimed to investigate the influence of the introduction of GO on the stability of the crystal skeleton and pore structure. Water, acid, and alkali resistances were tested for physical and chemical properties of the new composites. CO2 adsorption isotherms of UiO-66, UiO-66-NH2, UiO-66/GO, and UiO-66-NH2/GO were measured at 273 K, 298 K, and 318 K. The composite UiO-66-NH2/GO exhibited better optimized CO2 uptake of 6.41 mmol/g at 273 K, which was 5.1% higher than that of UiO-66/GO (6.10 mmol/g. CO2 adsorption heat and CO2/N2 selectivity were then calculated to further evaluate the CO2 adsorption performance. The results indicated that UiO-66-NH2/GO composites have a potential application in CO2 capture technologies to alleviate the increase in temperature of the earth’s atmosphere.

  19. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 3 ... Article ID 40 Research Article ... Article ID 41 Research Article ..... Physical hydrodynamic propulsion model study on creeping viscous flow through a ciliated porous tube.

  20. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 4. Issue front cover ... Article ID 57 Research Article ... Article ID 58 Research Article ..... A study of fractional Schrödinger equation composed of Jumarie fractional derivative.

  1. 76 FR 9052 - Comment Request for Information Collection for the Unemployment Insurance (UI) Facilitation of...

    Science.gov (United States)

    2011-02-16

    ... effectiveness and public accountability by focusing on program results, service quality, and customer satisfaction. Outcome Goal 1.3 in the Department's fiscal year (FY) 2011--2016 Strategic Plan--Help workers who... Measures The UI reemployment GPRA and UI Performs measures are defined as the percentage of all UI...

  2. Learning DHTMLX suite UI

    CERN Document Server

    Geske, Eli

    2013-01-01

    A fast-paced, example-based guide to learning DHTMLX.""Learning DHTMLX Suite UI"" is for web designers who have a basic knowledge of JavaScript and who are looking for powerful tools that will give them an extra edge in their own application development. This book is also useful for experienced developers who wish to get started with DHTMLX without going through the trouble of learning its quirks through trial and error. Readers are expected to have some knowledge of JavaScript, HTML, Document Object Model, and the ability to install a local web server.

  3. The UIS Model for Online Success

    Science.gov (United States)

    Bloemer, Bill

    2009-01-01

    This case study describes the philosophy underlying the delivery of online programs and courses at the University of Illinois-Springfield. The strategies used to implement the UIS model and the measures used to validate its success are outlined. These factors are reviewed in the context of the Sloan-C Five Pillars for quality learning environments.

  4. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 39; Issue 1. Issue front cover thumbnail. Volume 39, Issue 1. February 2018. Article ID 1. Editorial · Samir Mandal Indranil Chattopadhyay Anuj Nandi Santabrata Das · More Details Abstract Fulltext PDF. Article ID 2 Review. High energy transients: The ...

  5. Enhancement of Oxidative Desulfurization Performance over UiO-66(Zr) by Titanium Ion Exchange.

    Science.gov (United States)

    Ye, Gan; Qi, Hui; Li, Xiaolin; Leng, Kunyue; Sun, Yinyong; Xu, Wei

    2017-07-19

    Oxidative desulfurization is considered to be one of the most promising methods for producing ultra-low-sulfur fuels because it can effectively remove refractory sulfur-containing aromatic compounds under mild conditions. In this work, the oxidative desulfurization performance over UiO-66(Zr) is greatly enhanced by Ti ion exchange. This strategy is not only efficient for UiO-66(Zr) with crystal defects but also for UiO-66(Zr) with high crystallinity. In particular, the performance of UiO-66(Zr) with high crystallinity in the oxidative desulfurization of dibenzothiophene can be improved more than 11-fold, which can be mainly attributed to the introduction of active Ti sites. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 5. Issue front cover thumbnail. Volume 88, Issue 5. May 2017. Article ID 74 .... studied over a wide electron temperature range. Article ID 77 Research Article. Dirac equation, hydrogen atom spectrum and the Lamb shift in dynamical non-commutative spaces.

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 87; Issue 3. Issue front cover thumbnail. Volume 87, Issue 3. September 2016. Theme Issue on Higgs Physics. Article ID 1. Preface · Debajyoti Choudhury · More Details Abstract Fulltext PDF. Article ID 35 Special Issue. A review of the discovery of SM-like Higgs boson ...

  8. All-gas-phase synthesis of UiO-66 through modulated atomic layer deposition

    Science.gov (United States)

    Lausund, Kristian Blindheim; Nilsen, Ola

    2016-11-01

    Thin films of stable metal-organic frameworks (MOFs) such as UiO-66 have enormous application potential, for instance in microelectronics. However, all-gas-phase deposition techniques are currently not available for such MOFs. We here report on thin-film deposition of the thermally and chemically stable UiO-66 in an all-gas-phase process by the aid of atomic layer deposition (ALD). Sequential reactions of ZrCl4 and 1,4-benzenedicarboxylic acid produce amorphous organic-inorganic hybrid films that are subsequently crystallized to the UiO-66 structure by treatment in acetic acid vapour. We also introduce a new approach to control the stoichiometry between metal clusters and organic linkers by modulation of the ALD growth with additional acetic acid pulses. An all-gas-phase synthesis technique for UiO-66 could enable implementations in microelectronics that are not compatible with solvothermal synthesis. Since this technique is ALD-based, it could also give enhanced thickness control and the possibility to coat irregular substrates with high aspect ratios.

  9. Database Description - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available abase Description General information of database Database name AcEST Alternative n...hi, Tokyo-to 192-0397 Tel: +81-42-677-1111(ext.3654) E-mail: Database classificat...eneris Taxonomy ID: 13818 Database description This is a database of EST sequences of Adiantum capillus-vene...(3): 223-227. External Links: Original website information Database maintenance site Plant Environmental Res...base Database Description Download License Update History of This Database Site Policy | Contact Us Database Description - AcEST | LSDB Archive ...

  10. Low wage after unemployment - the effect of changes in the UI system

    DEFF Research Database (Denmark)

    Bolvig, Iben

    Low-wage jobs in Denmark are characterized by short durations and a relatively high mobility to higher wage positions, but also to unemployment. This fact might to some extent be attributed to the generous Danish UI system. The theoretical prediction for this relation is twofold. First, a generous...... UI system will increase reservation wages and thereby increase the effective minimum wage. This will exclude the least productive individuals from employment and thereby increase the lowest skill level among employed individuals. Hence, the Danish low-wage earners will tend to be better qualified...... and their duration as low-wage earners will therefore tend to be shorter. Second, the generous benefit system will allow the unemployed person to wait for better jobs, and likewise, force the employing firms to provide jobs with better prospects. By exploiting several tightening of the Danish UI system during...

  11. The role of autophagy in cytotoxicity induced by new oncogenic B-Raf inhibitor UI-152 in v-Ha-ras transformed fibroblasts

    International Nuclear Information System (INIS)

    Ahn, Jun-Ho; Ahn, Soon Kil; Lee, Michael

    2012-01-01

    Highlights: ► We recently discovered a potent and selective B-Raf inhibitor, UI-152. ► UI-152 displayed a selective cytotoxicity toward v-Ha-ras transformed cells. ► UI-152-induced growth inhibition was largely meditated by autophagy. ► UI-152 induced paradoxical activation of Raf-1. -- Abstract: In human cancers, B-Raf is the most frequently mutated protein kinase in the MAPK signaling cascade, making it an important therapeutic target. We recently discovered a potent and selective B-Raf inhibitor, UI-152, by using a structure-based drug design strategy. In this study, we examined whether B-Raf inhibition by UI-152 may be an effective therapeutic strategy for eliminating cancer cells transformed with v-Ha-ras (Ras-NIH 3T3). UI-152 displayed selective cytotoxicity toward Ras-NIH 3T3 cells while having little to no effect on non-transformed NIH 3T3 cells. We found that treatment with UI-152 markedly increased autophagy and, to a lesser extent, apoptosis. However, inhibition of autophagy by addition of 3-MA failed to reverse the cytotoxic effects of UI-152 on Ras-NIH 3T3 cells, demonstrating that apoptosis and autophagy can act as cooperative partners to induce growth inhibition in Ras-NIH 3T3 cells treated with UI-152. Most interestingly, cell responses to UI-152 appear to be paradoxical. Here, we showed that although UI-152 inhibited ERK, it induced B-Raf binding to Raf-1 as well as Raf-1 activation. This paradoxical activation of Raf-1 by UI-152 is likely to be coupled with the inhibition of the mTOR pathway, an intracellular signaling pathway involved in autophagy. We also showed for the first time that, in multi-drug resistant cells, the combination of UI-152 with verapamil significantly decreased cell proliferation and increased autophagy. Thus, our findings suggest that the inhibition of autophagy, in combination with UI-152, offers a more effective therapeutic strategy for v-Ha-ras-transformed cells harboring wild-type B-Raf.

  12. African Journal of Economic Review

    African Journals Online (AJOL)

    The African Journal of Economic Review (AJER) is a refereed, biannual Journal that ... Other websites associated with this journal: http://www.out.ac.tz/ ... Foreign direct investment and natural resources in sub-Saharan Africa: the role of ...

  13. ACE insertion/deletion (I/D) polymorphism and diabetic nephropathy.

    Science.gov (United States)

    Rahimi, Zohreh

    2012-10-01

    Angiotensin converting enzyme (ACE) gene encodes ACE, a key component of renin angiotensin system (RAS), plays an important role in blood pressure homeostasis by generating the vasoconstrictor peptide angiotensin II. Directory of Open Access Journals (DOAJ), Google Scholar, Pubmed (NLM), LISTA (EBSCO) and Web of Science have been searched. The presence of ACE insertion/deletion (I/D) polymorphism affects the plasma level of ACE. ACE DD genotype is associated with the highest systemic and renal ACE levels compared with the lowest ACE activity in carriers of II genotype. In this review focus has been performed on the study of ACE I/D polymorphism in various populations and its influence on the risk of onset and progression of diabetic nephropathy. Also, association between ACE I/D polymorphism and response to ACE inhibitor and angiotensin II receptor antagonists will be reviewed. Further, synergistic effect of this polymorphism and variants of some genes on the risk of development of diabetic nephropathy will be discussed.

  14. Id1 and Id3 expression is associated with increasing grade of prostate cancer: Id3 preferentially regulates CDKN1B

    International Nuclear Information System (INIS)

    Sharma, Pankaj; Patel, Divya; Chaudhary, Jaideep

    2012-01-01

    As transcriptional regulators of basic helix–oop–helix (bHLH) transcription and non-bHLH factors, the inhibitor of differentiation (Id1, Id2, Id3, and Id4) proteins play a critical role in coordinated regulation of cell growth, differentiation, tumorigenesis, and angiogenesis. Id1 regulates prostate cancer (PCa) cell proliferation, apoptosis, and androgen independence, but its clinical significance in PCa remains controversial. Moreover, there is lack of evidence on the expression of Id2 and Id3 in PCa progression. In this study we investigated the expression of Id2 and Id3 and reevaluated the expression of Id1 in PCa. We show that increased Id1 and Id3 protein expression is strongly associated with increasing grade of PCa. At the molecular level, we report that silencing either Id1 or Id3 attenuates cell cycle. Although structurally and mechanistically similar, our results show that both these proteins are noncompensatory at least in PCa progression. Moreover, through gene silencing approaches we show that Id1 and Id3 primarily attenuates CDKN1A (p21) and CDKN1B (p27), respectively. We also demonstrate that silencing Id3 alone significantly attenuates proliferation of PCa cells as compared with Id1. We propose that increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype

  15. eso-na-nceij-ui-y-19-9-7

    Indian Academy of Sciences (India)

    Page 1. Science Smiles. RKLaxman. It saves a lot of bother, If you programme it, it goes about on its own taking pictures of tourist and historical interests, and returns. R -E-S-O-NA-N-C-E-I-J-UI-Y-19-9-7----~-------~~-------------------. 5.

  16. RAY-UI: A powerful and extensible user interface for RAY

    Energy Technology Data Exchange (ETDEWEB)

    Baumgärtel, P., E-mail: peter.baumgaertel@helmholtz-berlin.de; Erko, A.; Schäfers, F. [Institute for Nanometre Optics and Technology Helmholtz Zentrum Berlin für Materialien und Energie Albert-Einstein-Str. 15, 12489 Berlin (Germany); Witt, M. [Department Operation Accelerator BESSY II Helmholtz Zentrum Berlin für Materialien und Energie Albert-Einstein-Str. 15, 12489 Berlin (Germany); Baensch, J.; Fabarius, M.; Schirmacher, H. [Fachbereich VI – Informatik und Medien Beuth Hochschule für Technik Berlin, Luxemburger Str. 10, 13353 Berlin (Germany)

    2016-07-27

    The RAY-UI project started as a proof-of-concept for an interactive and graphical user interface (UI) for the well-known ray tracing software RAY [1]. In the meantime, it has evolved into a powerful enhanced version of RAY that will serve as the platform for future development and improvement of associated tools. The software as of today supports nearly all sophisticated simulation features of RAY. Furthermore, it delivers very significant usability and work efficiency improvements. Beamline elements can be quickly added or removed in the interactive sequence view. Parameters of any selected element can be accessed directly and in arbitrary order. With a single click, parameter changes can be tested and new simulation results can be obtained. All analysis results can be explored interactively right after ray tracing by means of powerful integrated image viewing and graphing tools. Unlimited image planes can be positioned anywhere in the beamline, and bundles of image planes can be created for moving the plane along the beam to identify the focus position with live updates of the simulated results. In addition to showing the features and workflow of RAY-UI, we will give an overview of the underlying software architecture as well as examples for use and an outlook for future developments.

  17. Level 1 COUNTER Compliant Vendor Statistics are a Reliable Measure of Journal Usage A review of: Duy, Joanna and Liwen Vaughan. “Can Electronic Journal Usage Data Replace Citation Data as a Measure of Journal Use? An Empirical Examination.” The Journal of Academic Librarianship 32.5 (Sept. 2006: 512‐17.

    Directory of Open Access Journals (Sweden)

    Gaby Haddow

    2007-06-01

    Full Text Available Objective – To identify valid measures of journal usage by comparing citation data with print and electronic journal use data.Design – Bibliometric study.Setting – Large academic library in Canada.Subjects – Instances of use were collected from 11 print journals of the American Chemical Society (ACS, 9 print journals ofthe Royal Society of Chemistry (RSC, and electronic journals in chemistry and biochemistry from four publishers – ACS, RSC, Elsevier, and Wiley. ACS, Elsevier, and Wiley journals in chemistry‐related subject areas were sampled for Journal Impact Factors and citations data from the Institute for Scientific Information (ISI.Methods – Journal usage data were collected to determine if an association existed between: (1 print and electronic journal use; (2 electronic journal use and citations to journals by authors from the university; and (3 electronic journal use and Journal Impact Factors. Between June 2000 and September 2003, library staff recorded the re‐shelving of bound volumes and loose issues of 20 journal titles published by the ACS and the RSC.Electronic journal usage data were collected for journals published by ACS, RSC, Elsevier, and Wiley within the ISI‐defined chemistry and biochemistry subject area. Data were drawn from the publishers’ Level 1 COUNTER compliant usage statistics. These data equate 1 instance of use with a user viewing an HTML or PDF full text article. The period of data collection varied, but at least 2.5 years of data were collected for each publisher. Journal Impact Factors were collected for all ISI chemistry‐related journals published by ACS, Elsevier, and Wiley for the year 2001. Library Journal Utilization Reports (purchased from ISI were used to determine the number of times researchers at the university cited journals in the same set of chemistry‐related journals over the period 1998 to 2002. The authors call this “local citation data” (512. The results from

  18. Habitat quality and recruitment success of cui-ui in the Truckee River downstream of Marble Bluff Dam, Pyramid Lake, Nevada

    Science.gov (United States)

    Scoppettone, G. Gary; Rissler, Peter H.; Salgado, J. Antonio; Harry, Beverly

    2013-01-01

    We compared cui-ui (Chasmistes cujus) recruitment from two reaches of the Truckee River with histories of severe erosional downcutting caused by a decline in Pyramid Lake surface elevation. In 1975, Marble Bluff Dam (MBD) was constructed 5 kilometers upstream of the extant mouth of the Truckee River to stabilize the upstream reach of the river; the downstream reach of the river remained unstable and consequently unsuitable for cui-ui recruitment. By the early 2000s, there was a decrease in the Truckee River’s slope from MBD to Pyramid Lake after a series of wet years in the 1990s. This was followed by changes in river morphology and erosion abatement. These changes led to the question as to cui-ui recruitment potential in the Truckee River downstream of MBD. In 2012, more than 7,000 cui-ui spawners were passed upstream of MBD, although an indeterminate number of cui-ui spawned downstream of MBD. In this study, we compared cui-ui recruitment upstream and downstream of MBD during a Truckee River low-flow year (2012). Cui-ui larvae emigration to Pyramid Lake began earlier and ended later downstream of MBD. A greater number of cui-ui larvae was produced downstream of MBD than upstream. This also was true for native Tahoe sucker (Catostomus tahoensis) and Lahontan redside (Richardsonius egregius). The improved Truckee River stability downstream of MBD and concomitant cui-ui recruitment success is attributed to a rise in Pyramid Lake's surface elevation. A decline in lake elevation may lead to a shift in stream morphology and substrate composition to the detriment of cui-ui reproductive success as well as the reproductive success of other native fishes.

  19. MOFabric: Electrospun Nanofiber Mats from PVDF/UiO-66-NH2 for Chemical Protection and Decontamination.

    Science.gov (United States)

    Lu, Annie Xi; McEntee, Monica; Browe, Matthew A; Hall, Morgan G; DeCoste, Jared B; Peterson, Gregory W

    2017-04-19

    Textiles capable of capture and detoxification of toxic chemicals, such as chemical-warfare agents (CWAs), are of high interest. Some metal-organic frameworks (MOFs) exhibit superior reactivity toward CWAs. However, it remains a challenge to integrate powder MOFs into engineered materials like textiles, while retaining functionalities like crystallinity, adsorptivity, and reactivity. Here, we present a simple method of electrospinning UiO-66-NH 2 , a zirconium MOF, with polyvinylidene fluoride (PVDF). The electrospun composite, which we refer to as "MOFabric", exhibits comparable crystal patterns, surface area, chlorine uptake, and simulant hydrolysis to powder UiO-66-NH 2 . The MOFabric is also capable of breaking down GD (O-pinacolyl methylphosphonofluoridae) faster than powder UiO-66-NH 2. Half-life of GD monitored by solid-state NMR for MOFabric is 131 min versus 315 min on powder UiO-66-NH 2 .

  20. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 41; Issue 3 ... Asthma is a chronic disease due to inflammation of the airways of lungs that is clinically ... ACE insertion/deletion (I/D) polymorphism, rs4646994, in asthma in Pakistani patients.

  1. 77 FR 37715 - Comment Request for Information Collection for Self-Employment Assistance (SEA) for UI Claimants...

    Science.gov (United States)

    2012-06-22

    ... DEPARTMENT OF LABOR Employment and Training Administration Comment Request for Information Collection for Self-Employment Assistance (SEA) for UI Claimants, Extension Without Revisions AGENCY... changes. Title: Self-Employment Assistance for UI Claimants. OMB Number: 1205-0490. Affected Public: State...

  2. RETRACTED: Association of the ACE I/D gene polymorphism with sepsis susceptibility and sepsis progression.

    Science.gov (United States)

    Yang, Chun-Hua; Zhou, Tian-Biao

    2015-12-01

    This article has been included in a multiple retraction: Chun-Hua Yang and Tian-Biao Zhou Association of the ACE I/D gene polymorphism with sepsis susceptibility and sepsis progression Journal of Renin-Angiotensin-Aldosterone System 1470320314568521, first published on February 3, 2015 doi: 10.1177/1470320314568521 This article has been retracted at the request of the Editors and the Publisher. After conducting a thorough investigation, SAGE found that the submitting authors of a number of papers published in the Journal of the Renin-Angiotensin Aldosterone System ( JRAAS) (listed below) had supplied fabricated contact details for their nominated reviewers. The Editors accepted these papers based on the reports supplied by the individuals using these fake reviewer email accounts. After concluding that the peer review process was therefore seriously compromised, SAGE and the journal Editors have decided to retract all affected articles. Online First articles (these articles will not be published in an issue) Wenzhuang Tang, Tian-Biao Zhou, and Zongpei Jiang Association of the angiotensinogen M235T gene polymorphism with risk of diabetes mellitus developing into diabetic nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563426, first published on December 18, 2014 doi: 10.1177/1470320314563426 Tian-Biao Zhou, Hong-Yan Li, Zong-Pei Jiang, Jia-Fan Zhou, Miao-Fang Huang, and Zhi-Yang Zhou Role of renin-angiotensin-aldosterone system inhibitors in radiation nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563424, first published on December 18, 2014 doi: 10.1177/1470320314563424 Weiqiang Zhong, Zongpei Jiang, and Tian-Biao Zhou Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population Journal of Renin-Angiotensin-Aldosterone System 1470320314566019, first published on January 26, 2015 doi: 10.1177/1470320314566019 Tian-Biao Zhou, Xue-Feng Guo, Zongpei

  3. Pramana – Journal of Physics | News

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 3. An efficient algorithm for computation of solitary wave solutions to nonlinear differential equations. KAMRAN AYUB M YAQUB KHAN QAZI MAHMOOD-UL-HASSAN JAMSHAD AHMAD. Research Article Volume 89 Issue 3 September 2017 Article ID 45 ...

  4. SecurID

    CERN Multimedia

    Now called RSA SecurID, SecurID is a mechanism developed by Security Dynamics that allows two-factor authentication for a user on a network resource. It works on the principle of the unique password mode, based on a shared secret. Every sixty seconds, the component generates a new six-digit token on the screen. The latter comes from the current time (internal clock) and the seed (SecurID private key that is available on the component, and is also from the SecurID server). During an authentication request, the SecurID server will check the entered token by performing exactly the same calculation as that performed by your component. The server knows the two information required for this calculation: the current time and the seed of your component. Access is allowed if the token calculated by the server matches the token you specified.

  5. Thermodynamics of Pore Filling Metal Clusters in Metal Organic Frameworks: Pd in UiO-66

    DEFF Research Database (Denmark)

    Vilhelmsen, Lasse; Sholl, David S.

    2012-01-01

    Metal organic frameworks (MOFs) have experimentally been demonstrated to be capable of supporting isolated transition-metal clusters, but the stability of these clusters with respect to aggregation is unclear. In this letter we use a genetic algorithm together with density functional theory...... calculations to predict the structure of Pd clusters in UiO-66. The cluster sizes examined are far larger than those in any previous modeling studies of metal clusters in MOFs and allow us to test the hypothesis that the physically separated cavities in UiO-66 could stabilize isolated Pd clusters. Our...... calculations show that Pd clusters in UiO-66 are, at best, metastable and will aggregate into connected pore filling structures at equilibrium....

  6. Reflection of a Year Long Model-Driven Business and UI Modeling Development Project

    Science.gov (United States)

    Sukaviriya, Noi; Mani, Senthil; Sinha, Vibha

    Model-driven software development enables users to specify an application at a high level - a level that better matches problem domain. It also promises the users with better analysis and automation. Our work embarks on two collaborating domains - business process and human interactions - to build an application. Business modeling expresses business operations and flows then creates business flow implementation. Human interaction modeling expresses a UI design, its relationship with business data, logic, and flow, and can generate working UI. This double modeling approach automates the production of a working system with UI and business logic connected. This paper discusses the human aspects of this modeling approach after a year long of building a procurement outsourcing contract application using the approach - the result of which was deployed in December 2008. The paper discusses in multiple areas the happy endings and some heartache. We end with insights on how a model-driven approach could do better for humans in the process.

  7. http://journal.eng.unila.ac.id/index.php/mech/article/view/328

    Directory of Open Access Journals (Sweden)

    M. Mirmanto

    2016-03-01

    Full Text Available As the fossil energy has been getting depletion, it is important to utilize alternative energies such as solar energy. An equipment that can be used for capturing and converting solar energy is solar collector. Two identical collectors used in this study were placed facing to the North with an inclination angle of 15°. The collector dimension was 0.8 m x 1 m x 0.05 m. One collector contained 5 parallel pipes and the other contained 7 parallel pipes. The water used in the test was flowed naturally due to the gravity force from a higher tank and was adjusted using a valve fitted at the end of the collector. The water flow rates employed were 200, 250 and 300 cc/minutes and measured using a volume meter and a stop watch. The results showed that the energy coming into the collector, energy absorbed by the absorber and water, increased with an increase in the observation time and reached the peak value at about 2.30 pm. After that, they decreased. The effect of the pipe number is insignificant.

  8. https://journal.unnes.ac.id/sju/index.php/peshr/article/view/6519

    Directory of Open Access Journals (Sweden)

    Jumanto

    2015-08-01

    Full Text Available The purpose of this study was to determine how the implementation of development programs and how-owned facilities and infrastructure to support development programs in Krengseng Sejati School Football. The population in this study were athletes and coaches in Krengseng Sejati School Football , Gringsing sub-district, Batang city. The sample in this study were athletes and coaches in Krengseng Sejati School Football , Gringsing sub-district, Batang city as much as a coach and 30 athletes. Sampling technique used is total sampling. Data collection by survey method with questionnaire. Data from the instrument questionnaire prepared by the method of analytical description of the percentage. From the analysis shows that the pattern Soccer School coaching very well categorized by 4 respondents (19%, categorized either as many as 21 respondents (68%, categorized simply by 4 respondents (13%, and no one category is less and less . The conclusion that can be taken was the average rate of pattern formation Krengseng Sejati School Football , Gringsing sub-district, Batang city was 77%. These results indicate that the pattern of development is in good category.

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  10. Measuring quality of life in patients with stress urinary incontinence: is the ICIQ-UI-SF adequate?

    Science.gov (United States)

    Kurzawa, Zuzanna; Sutherland, Jason M; Crump, Trafford; Liu, Guiping

    2018-05-08

    The International Consultation on Incontinence Questionnaire Short Form (ICIQ-UI-SF) is a widely used four-item patient-reported outcome (PRO) measure. Evaluations of this instrument are limited, restraining user's confidence in the instrument. This study conducts a comprehensive evaluation of the ICIQ-UI-SF on a sample of urological surgery patients in Canada. One hundred and seventy-seven surgical patients with stress urinary incontinence completed the ICIQ-UI-SF pre-operatively. Methods drawing from confirmatory factor analysis (CFA), measures of reliability, item response theory (IRT), and differential item functioning were applied. Ceiling effects were examined. Ceiling effects were identified. In the CFA, the factor loadings of items one and two differed significantly (p McDonald's coefficient (0.65). The IRT found the instrument does not discriminate between individuals with low incontinence-related quality of life. Due to low/moderate reliability, the ICIQ-UI-SF can be used as a complement to other data or used to report aggregated surgical outcomes among surgical patients. If the primary objective is to measure quality of life, other PROs should be considered.

  11. Heat-Treatment of Defective UiO-66 from Modulated Synthesis: Adsorption and Stability Studies

    International Nuclear Information System (INIS)

    Jiao, Yang; Liu, Yang; Zhu, Guanghui; Hungerford, Julian T.; Bhattacharyya, Souryadeep

    2017-01-01

    Defect engineering in metal-organic frameworks (MOFs) is an emerging strategy that can be used to control physical or chemical characteristics of MOFs, including adsorption behavior and textural, mechanical, and conductive properties. Understanding the impact of defects on textural properties and chemical stability of MOFs is imperative to the development of MOFs with tunable defect sites. In this work, systematic adsorption measurements were performed with three adsorbate molecules (SO 2 , benzene, and cyclohexane) to investigate changes in the pore size of defective UiO-66. Compared to the parent UiO-66, the defective UiO-66 shows significant changes in adsorption capacities among the selected adsorbate molecules, demonstrating that pore size is significantly enlarged by the missing cluster defects. BET surface area analysis and DFT calculations were also performed to interrogate the chemical stability of the defective MOFs after exposure to water and acidic environments. This work shows that pore size can be tuned as a function of defect concentration. Further, it is shown that the structural incorporation of trifluoroacetate groups in defective UiO-66 leads to an increase in average pore size without sacrificing chemical stability toward water and acidic species. The results of this work advance the understanding of textural properties and chemical stability of defect-engineered MOFs and also suggest a preparation method for synthesizing defective but stable MOFs.

  12. 235U isotope enrichment in the metastable levels of UI

    International Nuclear Information System (INIS)

    Gagne, J.M.; Demers, Y.; Dreze, C.; Pianarosa, P.

    1983-01-01

    We have used optical pumping to produce a substantial 235 U enrichment in the metastable levels of UI in the discharge afterglow of a hollow-cathode vapor generator. The measured isotope-enrichment factor for the level at 3800 cm -1 is approximately 20

  13. Cerium-based metal organic frameworks with UiO-66 architecture: synthesis, properties and redox catalytic activity.

    Science.gov (United States)

    Lammert, Martin; Wharmby, Michael T; Smolders, Simon; Bueken, Bart; Lieb, Alexandra; Lomachenko, Kirill A; Vos, Dirk De; Stock, Norbert

    2015-08-14

    A series of nine Ce(iv)-based metal organic frameworks with the UiO-66 structure containing linker molecules of different sizes and functionalities were obtained under mild synthesis conditions and short reaction times. Thermal and chemical stabilities were determined and a Ce-UiO-66-BDC/TEMPO system was successfully employed for the aerobic oxidation of benzyl alcohol.

  14. Ag{sub 2}CO{sub 3}/UiO-66(Zr) composite with enhanced visible-light promoted photocatalytic activity for dye degradation

    Energy Technology Data Exchange (ETDEWEB)

    Sha, Zhou [Department of Chemistry, National University of Singapore, 3 Science Drive 3, 117543 (Singapore); NUS Environmental Research Institute, National University of Singapore, 5A Engineering Drive 1, #02-01, 117411 (Singapore); Chan, Hardy Sze On [Department of Chemistry, National University of Singapore, 3 Science Drive 3, 117543 (Singapore); Wu, Jishan, E-mail: chmwuj@nus.edu.sg [Department of Chemistry, National University of Singapore, 3 Science Drive 3, 117543 (Singapore); NUS Environmental Research Institute, National University of Singapore, 5A Engineering Drive 1, #02-01, 117411 (Singapore)

    2015-12-15

    Highlights: • UiO-66 was an outstanding substrate due to its superior properties and stability. • Ag{sub 2}CO{sub 3}/UiO-66 photocatalyst was synthesized by a simple solution method. • Ag{sub 2}CO{sub 3}/UiO-66 had excellent RhB degrading activity under visible-light irradiation. • Higher surface area of Ag{sub 2}CO{sub 3} in Ag{sub 2}CO{sub 3}/UiO-66 led to the enhanced activity. • Diverse active species may participate in the process of RhB degradation. - Abstract: Because of their excellent properties, metal-organic frameworks (MOFs) are considered as ideal materials for the development of visible-light photocatalyst. Particularly, although increasing research interests have been put on MOF based photocatalysts, the MOF supported Ag{sub 2}CO{sub 3} as photocatalyst has not been reported in the field of water treatment. In this study, a zirconium based MOF, UiO-66, was incorporated with Ag{sub 2}CO{sub 3} through a convenient solution method and used for visible-light prompted dye degradation. Compared to the mixture of pristine UiO-66 and Ag{sub 2}CO{sub 3}, the developed Ag{sub 2}CO{sub 3}/UiO-66 composite exhibited enhanced photocatalytic activity to the degradation of rhodamine B (RhB) under visible-light irradiation. It was supposed that the participation of UiO-66 during the synthesis of Ag{sub 2}CO{sub 3} was crucial for such improvement. In addition, the Ag{sub 2}CO{sub 3}/UiO-66 composite demonstrated good structural stability after the degradation experiment, and most of its photocatalytic activity was still preserved after the recycle test. Moreover, the photocatalytic mechanism of the Ag{sub 2}CO{sub 3}/UiO-66 composite was investigated and a possible pathway of RhB degradation was also proposed.

  15. In situ growth of CdS nanoparticles on UiO-66 metal-organic framework octahedrons for enhanced photocatalytic hydrogen production under visible light irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Jian-Jian; Wang, Rong; Liu, Xin-Ling; Peng, Fu-Min [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Li, Chuan-Hao, E-mail: chuanhao.li@yale.edu [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Department of Chemical & Environmental Engineering, Yale University, New Haven 06511 (United States); Teng, Fei [Jiangsu Key Laboratory of Atmospheric Environment Monitoring and Pollution Control, School of Environmental Sciences and Engineering, Nanjing University of Information Science and Technology, Nanjing 210044 (China); Yuan, Yu-Peng, E-mail: yupengyuan@ahu.edu.cn [School of Chemistry and Chemical Engineering and Innovation Lab for Clean Energy & Green Catalysis, Anhui University, Hefei 230601 (China); Jiangsu Key Laboratory of Atmospheric Environment Monitoring and Pollution Control, School of Environmental Sciences and Engineering, Nanjing University of Information Science and Technology, Nanjing 210044 (China)

    2015-08-15

    Graphical abstract: Enhanced photocatalytic hydrogen generation was achieved though constructing the CdS/UiO-66 MOF hybrids. In addition, the resultant hybrids show excellent photostability for hydrogen generation. - Highlights: • CdS nanoparticles were hydrothermally grown on UiO-66 octahedrons. • The resultant CdS/UiO-66 hybrids show enhanced photocatalytic H{sub 2} generation under visible light irradiation. • CdS/UiO-66 hybrids possess excellent photostability for long-term hydrogen generation. - Abstract: CdS nanoparticles acting as photosensitizer was grown in situ upon UiO-66 metal-organic framework octahedrons through a hydrothermal process. The resultant CdS/UiO-66 hybrid photocatalysts show remarkably active hydrogen evolution under visible light irradiation as compared to CdS and UiO-66 alone. The optimum hybrid with 16 wt% CdS loading shows a hydrogen production rate of 235 μmol h{sup −1}, corresponding to 1.2% quantum efficiency at 420 nm. The improved photocatalytic hydrogen production over hybrid CdS/UiO-66 is ascribed to the efficient interfacial charge transfer from CdS to UiO-66, which effectively suppresses the recombination of photogenerated electron-hole pairs and thereby enhancing the photocatalytic efficiency.

  16. Next generation Zero-Code control system UI

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    Developing ergonomic user interfaces for control systems is challenging, especially during machine upgrade and commissioning where several small changes may suddenly be required. Zero-code systems, such as *Inspector*, provide agile features for creating and maintaining control system interfaces. More so, these next generation Zero-code systems bring simplicity and uniformity and brake the boundaries between Users and Developers. In this talk we present *Inspector*, a CERN made Zero-code application development system, and we introduce the major differences and advantages of using Zero-code control systems to develop operational UI.

  17. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 130; Issue 3. Issue front cover ... More Details Abstract Fulltext PDF. Article ID 22. Synthesis and biological evaluation of some bicyclic [2-(2 .... Non-oxidative methane dehydroaromatization reaction over highly active α-MoC1−x ZSM-5 derived from pretreatment.

  18. Dual-Emitting UiO-66(Zr&Eu) Metal-Organic Framework Films for Ratiometric Temperature Sensing.

    Science.gov (United States)

    Feng, Ji-Fei; Liu, Tian-Fu; Shi, Jianlin; Gao, Shui-Ying; Cao, Rong

    2018-06-20

    A novel dual-emitting metal-organic framework based on Zr and Eu, named as UiO-66(Zr&Eu), was built using a clever strategy based on secondary building units. With the use of polymers, the obtained UiO-66(Zr&Eu) was subsequently deposited as thin films that can be utilized as smart thermometers. The UiO-66(Zr&Eu) polymer films can be used for the detection of temperature changes in the range of 237-337 K due to the energy transfer between the lanthanide ions (Eu in clusters) and the luminescent ligands, and the relative sensitivity reaches 4.26% K -1 at 337 K. Moreover, the sensitivity can be improved to 19.67% K -1 by changing the film thickness. In addition, the temperature-sensing performance of the films is superior to that of the powders, and the sensor can be reused 3 times without loss of performance.

  19. Design Evaluation of UIS and In-vessel Fuel Transfer Machine for a 1200MWe SFR

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jae Han; Kim, Seok Hoon; Park, Chang Gyu; Lee, Su Yeon

    2008-11-15

    The report describes the structural applicability of the upper internal structure (UIS) and the in-vessel fuel transfer machine for a 1200MWe sodium cooled fast reactor (SFR) of a pool type. In the conceptual design, a two rotating plug type as a refueling system is considered. For the two rotating plug type, the diameters of large and small rotating plugs are determined by 7.2m and 5.6m, respectively. Through the use of an inner fuel transfer machine and the lift change machine with a fixed arm length of 1.10m installed on a small rotating plug, all the core assemblies are accessed within 7mm accuracy. The UIS diameter is determined by 4.7m, which includes the all control drive lines in upper part, the diameter of UIS lower part is restricted by 4.4 m to secure the rotation angle of a refueling machine.

  20. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 37; Issue 4. Issue front cover thumbnail. Volume 37, Issue 4. December 2016. Science with the Square Kilometre Array: An Indian Perspective. Article ID 25 Review. Probing Statistical Isotropy of Cosmological Radio Sources using Square Kilometre Array.

  1. Association of AGTR1 (A1166C and ACE (I/D Polymorphisms with Breast Cancer Risk in North Indian Population

    Directory of Open Access Journals (Sweden)

    Anukriti Singh

    2018-04-01

    Full Text Available Renin angiotensin system (RAS comprising Angiotensin converting enzyme (ACE, Angiotensin II (Ang II and its receptor Angiotensin II receptor type I (AGTR1, plays a critical role in several diseases including cancer. A single nucleotide polymorphism (SNP A1166C located in 3′ untranslated region (UTR of AGTR1 and an insertion/deletion (I/D polymorphism present in intron 16 of ACE gene have been associated with many diseases, but their association with Breast cancer (BCa is still debatable. Here, we for the first time investigated the association of these polymorphisms in a North Indian BCa cohort including 161 patients and 152 healthy women. The polymorphisms were evaluated by polymerase chain reaction (PCR and restriction fragment length polymorphism (RFLP respectively. The association between these polymorphisms and BCa risk was estimated by calculating Odds Ratio (OR and chi-square (χ2 test. The DD genotype/D allele of ACE (I/D polymorphism and “AC and CC” genotype/C allele of AGTR1 (A1166C polymorphism were associated with higher risk of BCa when evaluated independently. Furthermore, interaction analysis of “AC and CC” and DD genotype and combination of “C and D” alleles of both polymorphisms revealed significantly greater BCa risk than that observed independently. Conclusively, women harboring “AC or CC” genotype/C allele for AGTR1 (A1166C polymorphism and DD genotype/D allele for ACE (I/D polymorphisms have a predisposition to develop more aggressive disease with advanced staging and larger tumor size. Our study indicates importance of genetic screening based on these polymorphisms for women, who may have higher risk of BCa.

  2. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. S V Nakhe. Articles written in Pramana – Journal of Physics. Volume 75 Issue 5 November 2010 pp 953-959 Conributed Papers. Development of a 16 kHz repetition rate, 110 W average power copper HyBrID laser · R Biswal P K Agrawal G K Mishra S V Nakhe S K Dixit J K ...

  3. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. S K Dixit. Articles written in Pramana – Journal of Physics. Volume 75 Issue 5 November 2010 pp 953-959 Conributed Papers. Development of a 16 kHz repetition rate, 110 W average power copper HyBrID laser · R Biswal P K Agrawal G K Mishra S V Nakhe S K Dixit J K ...

  4. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 1. Plane Symmetric Cosmological Model with Quark and Strange Quark Matter in f ( R , T ) Theory of Gravity. P. K. AGRAWAL D. D. PAWAR. Research Article Volume 38 Issue 1 March 2017 Article ID 2 ...

  5. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 126; Issue 5. First discovery of fossil winged seeds of Pinus L. (family Pinaceae) from the Indian Cenozoic and its palaeobiogeographic significance. Mahasin Ali Khan Subir Bera. Volume 126 Issue 5 July 2017 Article ID 63 ...

  6. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 1. Issue front cover thumbnail. Volume 88, Issue 1. January 2017. General editorial on publication ethics · More Details Abstract Fulltext PDF. Article ID 1 Regular. Periodic Hamiltonian hierarchies and non-uniqueness of superpotentials · PARTHA MANDAL ...

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 90; Issue 2. The synchronisation of ... PARIZ ALI KARIMPOUR. Research Article Volume 90 Issue 2 February 2018 Article ID 26 ... In addition, the unpredictability and complexity of the drive systems enhance the security of secure communication. The corresponding ...

  8. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 2. Issue front cover thumbnail. Volume 89, Issue 2. August 2017. Article ID 19 Research Article. Design of multistable systems via partial synchronization · MOHAMMAD ALI KHAN MAYURAKSHI NAG SWARUP PORIA · More Details Abstract Fulltext PDF.

  9. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... Home; Journals; Journal of Biosciences; Search ... part of the email address of all email addresses used by the office of Indian Academy of Sciences, including those of the staff, the journals, various programmes, and Current Science, has changed from 'ias.ernet.in' (or 'academy.ias.ernet.in') to 'ias.ac.in'.

  10. Dissection of Resistance Genes to Pseudomonas syringae pv. phaseolicola in UI3 Common Bean Cultivar.

    Science.gov (United States)

    González, Ana M; Godoy, Luís; Santalla, Marta

    2017-11-23

    Few quantitative trait loci have been mapped for resistance to Pseudomonas syringae pv. phaseolicola in common bean. Two F₂ populations were developed from the host differential UI3 cultivar. The objective of this study was to further characterize the resistance to races 1, 5, 7 and 9 of Psp included in UI3. Using a QTL mapping approach, 16 and 11 main-effect QTLs for pod and primary leaf resistance were located on LG10, explaining up to 90% and 26% of the phenotypic variation, respectively. The homologous genomic region corresponding to primary leaf resistance QTLs detected tested positive for the presence of resistance-associated gene cluster encoding nucleotide-binding and leucine-rich repeat (NL), Natural Resistance Associated Macrophage (NRAMP) and Pentatricopeptide Repeat family (PPR) proteins. It is worth noting that the main effect QTLs for resistance in pod were located inside a 3.5 Mb genomic region that included the Phvul.010G021200 gene, which encodes a protein that has the highest sequence similarity to the RIN4 gene of Arabidopsis, and can be considered an important candidate gene for the organ-specific QTLs identified here. These results support that resistance to Psp from UI3 might result from the immune response activated by combinations of R proteins, and suggest the guard model as an important mechanism in pod resistance to halo blight. The candidate genes identified here warrant functional studies that will help in characterizing the actual defense gene(s) in UI3 genotype.

  11. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 2. Issue front cover thumbnail. Volume 38, Issue 2. June 2017. Article ID 18 Research Article. Gulmarg, Kashmir, India: Potential Site for Optical Astronomical Observations · Ajaz Ahmad Dar Manzoor A. Malik · More Details Abstract Fulltext PDF.

  12. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 3. Issue front cover thumbnail. Volume 38, Issue 3. September 2017. Special issue on "Physics of Neutron Stars and Related Objects". Article ID 36 Editorial. Editorial · Dipankar Bhattacharya K. S. Dwarakanath Sushan Konar · More Details Abstract ...

  13. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 87; Issue 2. Issue front cover thumbnail. Volume 87, Issue 2. August 2016. Article ID 17 Research Article. The ( G ′ / G , 1 / G )-expansion method for solving nonlinear space–time fractional differential equations · EMRULLAH YA¸SAR ILKER BURAK GIRESUNLU.

  14. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 3. Model-free adaptive sliding mode controller design for generalized projective synchronization of the fractional-order chaotic system via radial basis function neural networks. L M WANG. Research Article Volume 89 Issue 3 September 2017 Article ID 38 ...

  15. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... Refresher Courses · Symposia · Live Streaming. Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 1. Issue front cover thumbnail. Volume 89, Issue 1. July 2017. Proceedings of the 3rd E-Workshop/Conference on Computational Condensed Matter Physics and Materials Science. Article ID 1 Special Issue.

  16. Pengalaman Komunikasi Pelanggan Zalora.co.id (Studi Fenomenologi Pelanggan Zalora.co.id)

    OpenAIRE

    Aji, Widya Andhika; Pradekso, Tandiyo; Ulfa, Nurist Surayya

    2013-01-01

    1PENGALAMAN KOMUNIKASI PELANGGAN ZALORA.CO.ID(Studi Fenomenologi Pelanggan Zalora.co.id)Oleh:Widya Andhika AjiFakultas Ilmu Sosial dan Ilmu PolitikUniversitas Diponegoro SemarangABSTRAKPenelitian ini bertujuan untuk menganalisis pengalaman komunikasi danpemahaman penerimaan konsumen terkait pesan komunikasi pemasaran dalamberbelanja di Zalora.co.id. Dengan menggunakan sampel pada lima informandan metode wawancara, dapat ditarik kesimpulan: Pelanggan Zalora.co.idmemiliki pengalaman komunikasi ...

  17. Superior removal of arsenic from water with zirconium metal-organic framework UiO-66

    Science.gov (United States)

    Wang, Chenghong; Liu, Xinlei; Chen, J. Paul; Li, Kang

    2015-01-01

    In this study, water stable zirconium metal-organic framework (UiO-66) has been synthesized and for the first time applied as an adsorbent to remove aquatic arsenic contamination. The as-synthesized UiO-66 adsorbent functions excellently across a broad pH range of 1 to 10, and achieves a remarkable arsenate uptake capacity of 303 mg/g at the optimal pH, i.e., pH = 2. To the best of our knowledge, this is the highest arsenate As(V) adsorption capacity ever reported, much higher than that of currently available adsorbents (5–280 mg/g, generally less than 100 mg/g). The superior arsenic uptake performance of UiO-66 adsorbent could be attributed to the highly porous crystalline structure containing zirconium oxide clusters, which provides a large contact area and plenty of active sites in unit space. Two binding sites within the adsorbent framework are proposed for arsenic species, i.e., hydroxyl group and benzenedicarboxylate ligand. At equilibrium, seven equivalent arsenic species can be captured by one Zr6 cluster through the formation of Zr-O-As coordination bonds. PMID:26559001

  18. Superior removal of arsenic from water with zirconium metal-organic framework UiO-66.

    Science.gov (United States)

    Wang, Chenghong; Liu, Xinlei; Chen, J Paul; Li, Kang

    2015-11-12

    In this study, water stable zirconium metal-organic framework (UiO-66) has been synthesized and for the first time applied as an adsorbent to remove aquatic arsenic contamination. The as-synthesized UiO-66 adsorbent functions excellently across a broad pH range of 1 to 10, and achieves a remarkable arsenate uptake capacity of 303 mg/g at the optimal pH, i.e., pH = 2. To the best of our knowledge, this is the highest arsenate As(V) adsorption capacity ever reported, much higher than that of currently available adsorbents (5-280 mg/g, generally less than 100 mg/g). The superior arsenic uptake performance of UiO-66 adsorbent could be attributed to the highly porous crystalline structure containing zirconium oxide clusters, which provides a large contact area and plenty of active sites in unit space. Two binding sites within the adsorbent framework are proposed for arsenic species, i.e., hydroxyl group and benzenedicarboxylate ligand. At equilibrium, seven equivalent arsenic species can be captured by one Zr6 cluster through the formation of Zr-O-As coordination bonds.

  19. Id-1 and Id-2 genes and products as markers of epithelial cancer

    Science.gov (United States)

    Desprez, Pierre-Yves [El Cerrito, CA; Campisi, Judith [Berkeley, CA

    2008-09-30

    A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.

  20. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... Refresher Courses · Symposia · Live Streaming. Home; Journals; Pramana – Journal of Physics; Volume 87; Issue 2. Effects of particle size and laser wavelength on heating of silver nanoparticles under laser irradiation in liquid. HODA MAHDIYAN MOMEN. Research Article Volume 87 Issue 2 August 2016 Article ID 26 ...

  1. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 37; Issue 2. Issue front cover thumbnail. Volume 37, Issue 2. June 2016. Article ID 8. Stochastic Oscillations of General Relativistic Disks Described by a Fractional Langevin Equation with Fractional Gaussian Noise · Wang Zhi-Yun Chen Pei-Jie · More Details ...

  2. Ab-initio Study of the Electron Mobility in a Functionalized UiO-66 Metal Organic Framework

    Science.gov (United States)

    Musho, Terence D.; Yasin, Alhassan S.

    2018-03-01

    This study leverages density functional theory accompanied with Boltzmann transport equation approaches to investigate the electronic mobility as a function of inorganic substitution and functionalization in a thermally stable UiO-66 metal-organic framework (MOF). The MOFs investigated are based on Zr-UiO-66 MOF with three functionalization groups of benzene dicarboxylate (BDC), BDC functionalized with an amino group (BDC + NH_2 ) and a nitro group (BDC + NO_2 ). The design space of this study is bound by UiO-66(M)-R, [M=Zr , Ti, Hf; R=BDC , BDC+NO_2 , BDC+NH_2 ]. The elastic modulus was not found to vary significantly over the structural modification of the design space for either functionalization or inorganic substitution. However, the electron-phonon scattering potential was found to be controllable by up to 30% through controlled inorganic substitution in the metal clusters of the MOF structure. The highest electron mobility was predicted for a UiO-66(Hf_5Zr_1 ) achieving a value of approximately 1.4× 10^{-3} cm^2 /V s. It was determined that functionalization provides a controlled method of modulating the charge density, while inorganic substitution provides a controlled method of modulating the electronic mobility. Within the proposed design space the electrical conductivity was able to be increased by approximately three times the base conductivity through a combination of inorganic substitution and functionalization.

  3. South African Journal of Higher Education: Contact

    African Journals Online (AJOL)

    Principal Contact. Prof Yusef Waghid Editor-in-Chief South African Journal of Higher Educatio. South African Journal of Higher Education Faculty of Education Stellenbosch University. Private Bag X1 Matieland 7602. Phone: +27 (021) 8082419. Fax: +27 (021) 8082283. Email: yw@sun.ac.za ...

  4. Electrospun UiO-66/polyacrylonitrile nanofibers as efficient sorbent for pipette tip solid phase extraction of phytohormones in vegetable samples.

    Science.gov (United States)

    Yan, Zhiming; Wu, Mei; Hu, Biqing; Yao, Minna; Zhang, Lan; Lu, Qiaomei; Pang, Jie

    2018-03-23

    In this work, metal-organic framework particles incorporated fibers (UiO-66/PAN nanofibers) were used as adsorbent in pipette tip solid phase extraction (PT-SPE) for the first time. The UiO-66/PAN nanofibers were fabricated by a facile electrospinning method and characterized by Fourier transform infrared spectroscopy, scanning electron microscopy, X-ray diffraction and nitrogen adsorption-desorption experiments. The UiO-66/PAN nanofibers were applied to assemble a novel PT-SPE cartridge for determination of four phytohormones followed by high performance liquid chromatography (HPLC). Several experimental parameters such as kinds of UiO-66/PAN nanofibers, the amount of UiO-66/PAN nanofibers, the effect of solution pH, ionic strength and desorption conditions were intensively investigated. Under the optimal conditions, the linear ranges of the phytohormones were in the range of 0.06-60 ng/mL with correlation coefficients above 0.992. The limits of detection were between 0.01 ng/mL to 0.02 ng/mL. The interday and intraday precision (RSD) for three replicate extractions of the four phytohormones (15 ng/mL for each) was in the range of 1.5-5.6%. The established method was successfully applied for the determination of phytohormones in watermelon and mung bean sprouts samples. The results showed that the electrostatic interaction between the positively charged UiO-66 and anionic forms of phytohormones played an important role in the extraction of the phytohormones. Copyright © 2018 Elsevier B.V. All rights reserved.

  5. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 126; Issue 5. Issue front cover thumbnail. Volume 126, Issue 5. July 2017. Article ID 62. Meteorological features associated with unprecedented precipitation over India during 1st week of March 2015 · Naresh Kumar M Mohapatra A K Jaswal · More Details Abstract ...

  6. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 1. Periodic Hamiltonian hierarchies and ... ABHIJIT BANERJEE. Regular Volume 88 Issue 1 January 2017 Article ID 1 ... Abstract. In this article, a family of periodic quantum Hamiltonians, that is subject to a closure condition is considered. In the context of the ...

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 89; Issue 4. Issue front cover thumbnail. Volume 89, Issue 4. October 2017. Proceedings of PHENO1: The First Workshop on Beyond Standard Model Physics at IISER Mohali. Article ID 50 Special Issue. Preface · Charanjit S Aulakh Ketan Patel · More Details Abstract ...

  8. Dissection of Resistance Genes to Pseudomonas syringae pv. phaseolicola in UI3 Common Bean Cultivar

    Directory of Open Access Journals (Sweden)

    Ana M. González

    2017-11-01

    Full Text Available Few quantitative trait loci have been mapped for resistance to Pseudomonas syringae pv. phaseolicola in common bean. Two F2 populations were developed from the host differential UI3 cultivar. The objective of this study was to further characterize the resistance to races 1, 5, 7 and 9 of Psp included in UI3. Using a QTL mapping approach, 16 and 11 main-effect QTLs for pod and primary leaf resistance were located on LG10, explaining up to 90% and 26% of the phenotypic variation, respectively. The homologous genomic region corresponding to primary leaf resistance QTLs detected tested positive for the presence of resistance-associated gene cluster encoding nucleotide-binding and leucine-rich repeat (NL, Natural Resistance Associated Macrophage (NRAMP and Pentatricopeptide Repeat family (PPR proteins. It is worth noting that the main effect QTLs for resistance in pod were located inside a 3.5 Mb genomic region that included the Phvul.010G021200 gene, which encodes a protein that has the highest sequence similarity to the RIN4 gene of Arabidopsis, and can be considered an important candidate gene for the organ-specific QTLs identified here. These results support that resistance to Psp from UI3 might result from the immune response activated by combinations of R proteins, and suggest the guard model as an important mechanism in pod resistance to halo blight. The candidate genes identified here warrant functional studies that will help in characterizing the actual defense gene(s in UI3 genotype.

  9. Vaadin 7 UI design by example beginner's guide

    CERN Document Server

    Duarte, Alejandro

    2013-01-01

    This book is a hands-on Beginner's Guide for developers who are new to Vaadin and/or Vaadin UI components. The book will teach readers through examples to use each of the exciting components to build and add various aspects of the user interface to their web apps.If you have experience with the Java language and want to create web applications that look good without having to deal with HTML, XML, and JavaScript, this book is for you. Basic Java programming skills are required, but no web development knowledge is needed at all.

  10. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 23; Issue 1-2 ... We report the discovery of a decay in the superorbital period of the binary X-ray pulsar LMC X-4. ... This means that each accepted article is being published immediately online with DOI and article citation ID with starting page number 1.

  11. AcEST: BP915821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report -...short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  12. AcEST: DK945353 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  13. AcEST: DK944134 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  14. AcEST: BP920666 [AcEST

    Lifescience Database Archive (English)

    Full Text Available (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report -...short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  15. Direct observations of the MOF (UiO-66) structure by transmission electron microscopy

    KAUST Repository

    Zhu, Liangkui; Zhang, Daliang; Xue, Ming; Li, Huan; Qiu, Shilun

    2013-01-01

    As a demonstration of ab initio structure characterizations of nano metal organic framework (MOF) crystals by high resolution transmission electron microscopy (HRTEM) and electron diffraction tomography methods, a Zr-MOF (UiO-66) structure

  16. AcEST: BP920339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report ... short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  17. AcEST: BP914811 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report ... short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  18. AcEST: BP921297 [AcEST

    Lifescience Database Archive (English)

    Full Text Available blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrE...t.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  19. AcEST: DK945128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value...oo short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  20. AcEST: BP917667 [AcEST

    Lifescience Database Archive (English)

    Full Text Available blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrE...t.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  1. Tailoring the Adsorption and Reaction Chemistry of the Metal-Organic Frameworks UiO-66, UiO-66-NH2, and HKUST-1 via the Incorporation of Molecular Guests.

    Science.gov (United States)

    Ploskonka, Ann M; DeCoste, Jared B

    2017-06-28

    Metal-organic frameworks (MOFs) are versatile materials highly regarded for their porous nature. Depending on the synthetic method, various guest molecules may remain in the pores or can be systematically loaded for various reasons. Herein, we present a study that explores the effect of guest molecules on the adsorption and reactivity of the MOF in both the gas phase and solution. The differences between guest molecule interactions and the subsequent effects on their activity are described for each system. Interestingly, different effects are observed and described in detail for each class of guest molecules studied. We determine that there is a strong effect of alcohols with the secondary building unit of UiO MOFs, while Lewis bases have an effect on the reactivity of the -NH 2 group in UiO-66-NH 2 and adsorption by the coordinatively unsaturated copper sites in HKUST-1. These effects must be considered when determining synthesis and activation methods of MOFs toward various applications.

  2. AcEST: BP917893 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Repo...too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  3. AcEST: BP917876 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Repo...too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  4. AcEST: BP921482 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report...o short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  5. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 38; Issue 1. Abundances of La138 and Ta180 Through ν-Nucleosynthesis in 20 M ⊙ Type II Supernova Progenitor, Guided by Stellar Models for Seeds. N. Lahkar S. Kalita H. L. Duorah K. Duorah. Research Article Volume 38 Issue 1 March 2017 Article ID 8 ...

  6. AcEST: DK946291 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value...ce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  7. AcEST: BP921019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value ...uence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  8. AcEST: BP912385 [AcEST

    Lifescience Database Archive (English)

    Full Text Available wiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value -...ence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  9. AcEST: DK944578 [AcEST

    Lifescience Database Archive (English)

    Full Text Available iss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value...nce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  10. AcEST: DK958455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-valu...uence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  11. AcEST: BP917898 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Re...e too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. Joseph John Thomson (1856-1940). Featured Scientist Volume 2 Issue 12 December 1997 pp 114-114. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/12/0114-0114. Resonance – Journal ...

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 7. Refresher Course in Immunology. Information and Announcements Volume 7 Issue 7 July 2002 pp 92-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/07/0092-0092. Resonance – Journal ...

  14. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 1. Arrows in Chemistry. Abirami Lakshminarayanan. General Article Volume 15 Issue 1 January 2010 pp 51-63. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/015/01/0051-0063. Keywords.

  15. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 7. Physical Research Laboratory. P Sharma. Information and Announcements Volume 4 Issue 7 July 1999 pp 92-96. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/07/0092-0096 ...

  16. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 96; Issue 5. Haldane and modern evolutionary genetics. BRIAN CHARLESWORTH. HALDANE AT 125 Volume 96 Issue 5 November 2017 pp 773-782. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jgen/096/05/0773-0782. Keywords.

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 12. Vikram A Sarabhai (1919-1971). Featured Scientist Volume 6 Issue 12 December 2001 pp 107-107. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/12/0107-0107. Resonance – Journal of ...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 3. Marie Sklodowska Curie (1867-1934). Featured Scientist Volume 6 Issue 3 March 2001 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/03/0098-0098. Resonance – Journal of ...

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 10. Geoffrey Ingram Taylor (1886-1975). Featured Scientist Volume 9 Issue 10 October 2004 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/10/0098-0098. Resonance – Journal of ...

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 2. Jagadis Chandra Bose (1858-1937). Featured Scientist Volume 3 Issue 2 February 1998 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/02/0098-0098. Resonance – Journal of ...

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 9. Ronald Aylmer Fisher (1890-1962). Featured Scientist Volume 2 Issue 9 September 1997 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/09/0098-0098. Resonance – Journal of ...

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 1. Salim Moizuddin Abdul Ali (1896-1987). Featured Scientist Volume 2 Issue 1 January 1997 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/01/0098-0098. Resonance – Journal of ...

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. S S Bhatnagar (1894-1955). Featured Scientist Volume 16 Issue 12 December 2011 pp 1354-1354. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/12/1354-1354. Resonance – Journal of ...

  4. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. Electrons in Condensed Matter. T V Ramakrishnan. General Article Volume 2 Issue 12 December 1997 pp 17-32. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/12/0017-0032 ...

  5. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2011-03-14

    Mar 14, 2011 ... Home; Journals; Journal of Biosciences; Volume 36; Issue 1. Clipboard: New paradigm for ATP synthesis and consumption. C Channakeshava. Volume 36 Issue 1 March 2011 pp 3-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/036/01/0003-0004 ...

  6. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 26; Issue 2. The roots of ancient medicine: an historical outline. B V Subbarayappa. Perspectives Volume 26 Issue 2 June 2001 pp 135-143. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/026/02/0135-0143. Author Affiliations.

  7. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2006-05-06

    May 6, 2006 ... Home; Journals; Journal of Biosciences; Volume 31; Issue 2. Kenneth Raper, Elisha Mitchell and Dictyostelium. Eugene R Katz. Perspectives Volume 31 Issue 2 June 2006 pp 195-200. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/031/02/0195-0200 ...

  8. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 9. Haber Process for Ammonia Synthesis. Jayant M Modak. General Article Volume 7 Issue 9 September 2002 pp 69-77. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/09/0069-0077 ...

  9. AcEST: DK946967 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL ...(release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  10. AcEST: BP919248 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Res...ult : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  11. AcEST: DK945778 [AcEST

    Lifescience Database Archive (English)

    Full Text Available hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX R...esult : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  12. AcEST: BP916007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX R...esult : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  13. AcEST: DK947750 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL... (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  14. Family of the Sun-and-Stars Time-Determining Instruments (Ilseong-jeongsi-ui) Invented During the Joseon Dynasty

    OpenAIRE

    Yong Sam Lee; Sang Hyuk Kim; Byeong-Hee Mihn

    2016-01-01

    We analyze the design and specifications of the Sun-and-Stars Time-Determining group of instruments (Ilseong-jeongsi-ui, 日星定時儀) made during the Joseon dynasty. According to the records of the Sejong Sillok (Veritable Records of King Sejong), Sun-and-Stars Time-Determining Instruments measure the solar time of day and the sidereal time of night through three rings and an alidade. One such instrument, the Simplified Time-Determining Instrument (So-jeongsi-ui, 小定時儀), is made without ...

  15. AcEST: BP917487 [AcEST

    Lifescience Database Archive (English)

    Full Text Available short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link... to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  16. AcEST: DK944187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ort.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - Tr...EMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  17. AcEST: BP916918 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to B...lastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  18. AcEST: DK944823 [AcEST

    Lifescience Database Archive (English)

    Full Text Available hort.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - T...rEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  19. AcEST: BP914408 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to Bla...stX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  20. AcEST: BP920010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to Blas...tX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  1. AcEST: DK947396 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMB...L (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  2. AcEST: BP912800 [AcEST

    Lifescience Database Archive (English)

    Full Text Available short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link... to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  3. AcEST: DK947128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available oo short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report... - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  4. AcEST: DK945758 [AcEST

    Lifescience Database Archive (English)

    Full Text Available short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report -... TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  5. AcEST: BP920957 [AcEST

    Lifescience Database Archive (English)

    Full Text Available hort.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link t...o BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  6. AcEST: DK944158 [AcEST

    Lifescience Database Archive (English)

    Full Text Available o short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report ...- TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  7. AcEST: DK943962 [AcEST

    Lifescience Database Archive (English)

    Full Text Available oo short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report... - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  8. AcEST: BP914639 [AcEST

    Lifescience Database Archive (English)

    Full Text Available too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) ...Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  9. AcEST: DK945775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available oo short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report... - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  10. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 26; Issue 4. Is there a role for contraceptive vaccines in fertility control? A Jagannadha Rao. Volume 26 Issue 4 November 2001 pp 425-427. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/026/04/0425-0427. Keywords. Fertility ...

  11. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 42; Issue 1. What history tells us XLII. A 'new' view of proteins. MICHEL MORANGE. Series Volume 42 Issue 1 March 2017 pp 11-14. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/042/01/0011-0014. Keywords. Allostery ...

  12. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 29; Issue 1. What impact, if any, has feminism had on science? Evelyn Fox Keller. Perspectives Volume 29 Issue 1 March 2004 pp 7-13. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/029/01/0007-0013. Author Affiliations.

  13. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2010-11-09

    Nov 9, 2010 ... Home; Journals; Journal of Biosciences; Volume 35; Issue 4. What history tells us XXII. The French neo-Lamarckians. Michel Morange. Series Volume 35 Issue 4 December 2010 pp 515-517. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/035/04/0515-0517 ...

  14. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 5. Artificial Seeds and their Applications. G V S Saiprasad. General Article Volume 6 Issue 5 May 2001 pp 39-47. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/05/0039-0047 ...

  15. AcEST: DK946752 [AcEST

    Lifescience Database Archive (English)

    Full Text Available uence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value -... Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  16. AcEST: BP912848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) L...ink to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  17. AcEST: DK947104 [AcEST

    Lifescience Database Archive (English)

    Full Text Available e too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Rep...ort - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  18. AcEST: BP915873 [AcEST

    Lifescience Database Archive (English)

    Full Text Available uence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 3...9.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  19. AcEST: DK945751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  20. AcEST: BP916868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (rele...ase 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  1. AcEST: DK947351 [AcEST

    Lifescience Database Archive (English)

    Full Text Available op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  2. AcEST: DK944996 [AcEST

    Lifescience Database Archive (English)

    Full Text Available equence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  3. AcEST: DK945372 [AcEST

    Lifescience Database Archive (English)

    Full Text Available too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Repor...t - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  4. AcEST: DK944574 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - ...Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  5. AcEST: BP920016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available uence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 3...9.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  6. AcEST: DK945105 [AcEST

    Lifescience Database Archive (English)

    Full Text Available uence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value -... Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  7. Mixed Membrane Matrices Based on Nafion/UiO-66/SO3H-UiO-66 Nano-MOFs: Revealing the Effect of Crystal Size, Sulfonation, and Filler Loading on the Mechanical and Conductivity Properties.

    Science.gov (United States)

    Donnadio, Anna; Narducci, Riccardo; Casciola, Mario; Marmottini, Fabio; D'Amato, Roberto; Jazestani, Mehdi; Chiniforoshan, Hossein; Costantino, Ferdinando

    2017-12-06

    Mixed membrane matrices (MMMs) made up with Nafion and nanocrystals of zirconium metal-organic framework (MOF) UiO-66 or the analogous sulfonated SO 3 H-UiO-66 were prepared by varying the filler loading and the size of the crystals. The combined effects of size and loading, together with the presence of sulfonic groups covalently linked to the MOFs, were studied with regard to the conductivity and mechanical properties of the obtained composite matrices. A large screening of membranes was preliminarily made and, on the most promising samples, an accurate conductivity study at different relative humidities and temperatures was also carried out. The results showed that membranes containing large crystals (200 nm average size) in low amounts (around 2%) displayed the best results in terms of proton conductivity values, reaching values by 30% higher than those of pure Nafion, while leaving the mechanical properties substantially unchanged. On the contrary, MMMs containing MOFs of small size (20 nm average size) did not show any conductivity improvements if compared to pure Nafion membranes. The effect of MOF sulfonation was negligible at low filler loading whereas it became important at loading values around 10%. Finally, membranes with a high filler loading (up to 60 wt %) of sulfonated UiO-66 showed a slight reduction of conductivity in comparison with membranes loaded at 20% of nonsulfonated ones.

  8. AcEST: BP920443 [AcEST

    Lifescience Database Archive (English)

    Full Text Available op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (r...elease 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  9. AcEST: DK947324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value... - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  10. AcEST: BP912655 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (...release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  11. AcEST: BP919873 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL... (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  12. AcEST: BP915916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (rel...ease 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  13. Earthdata User Interface Patterns: Building Usable Web Interfaces Through a Shared UI Pattern Library

    Science.gov (United States)

    Siarto, J.

    2014-12-01

    As more Earth science software tools and services move to the web--the design and usability of those tools become ever more important. A good user interface is becoming expected and users are becoming increasingly intolerant of websites and web applications that work against them. The Earthdata UI Pattern Library attempts to give these scientists and developers the design tools they need to make usable, compelling user interfaces without the associated overhead of using a full design team. Patterns are tested and functional user interface elements targeted specifically at the Earth science community and will include web layouts, buttons, tables, typography, iconography, mapping and visualization/graphing widgets. These UI elements have emerged as the result of extensive user testing, research and software development within the NASA Earthdata team over the past year.

  14. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2008-01-31

    Jan 31, 2008 ... Home; Journals; Journal of Biosciences; Volume 33; Issue 1. Biological time is fractal: Early events reverberate over a life time. David Lloyd. Perspectives Volume 33 Issue 1 March 2008 pp 9-19. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jbsc/033/01/0009- ...

  15. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 96; Issue 5. J. B. S. Haldane: the John Innes years. SARAH WILMOT. HALDANE AT 125 Volume 96 Issue 5 November 2017 pp 815-826. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/jgen/096/05/0815-0826. Keywords. J. B. S. ...

  16. Automating the Exchange of Military Personnel Data Among Selected Army Organizations. Volume II. Appendices,

    Science.gov (United States)

    1981-06-30

    w OO Id Sa f3 c c c o AJ -0h C CU 0 L -A- V)’ 0~ uiZ~u ’ w ii C 1a. b. % US %0 0 U4 4 ~ c 0C - = 0 IC a.4 0 0. 0~ 0 >00 ~C U a -60 A f 0 C3T...O 0 o’’ " - _0 3.. T5 4c( #j r. 0 < E C, -. .0 cc1 ,-, ;, 0. .- 0 ". a - c- r-. w 0 . .4 -4 f .%d 00 U a W W)w 44 0 ,U " 0 0 C) Z C4 W oa OC > acCA . 0

  17. Astronomy and Computing: A New Journal for the Astronomical Computing Community

    Science.gov (United States)

    Mann, R. G.; Accomazzi, A.; Budavári, T.; Fluke, C.; Gray, N.; O'Mullane, W.; Wicenec, A.; Wise, M.

    2013-10-01

    We introduce Astronomy and Computing (A&C), a new, peer-reviewed journal for the expanding community of people whose work focuses on the application of computer science and information technology within astronomy, rather than on astronomical research per se. A&C arose from a BoF discussion at the ADASS XX conference in Boston, and from the ADASS community will come many of the people who will write, referee and read the papers published in A&C. In this paper, we outline the aims and scope of A&C, together with a summary of the types of paper we envisage it publishing and the criteria that will be used to referee them, and we invite the ADASS community to help us develop these in more detail and to shape a journal that serves the astronomical computing community well.

  18. Evaluation of an Anti-HER2 Nanobody Labeled with 225Ac for Targeted α-Particle Therapy of Cancer.

    Science.gov (United States)

    Pruszynski, Marek; D'Huyvetter, Matthias; Bruchertseifer, Frank; Morgenstern, Alfred; Lahoutte, Tony

    2018-04-02

    Human epidermal growth factor receptor type 2 (HER2) is overexpressed in numerous carcinomas. Nanobodies (Nbs) are the smallest antibody-derived fragments with beneficial characteristics for molecular imaging and radionuclide therapy. Therefore, HER2-targeting nanobodies could offer a valuable platform for radioimmunotherapy, especially when labeled with α-particle emitters, which provide highly lethal and localized radiation to targeted cells with minimal exposure to surrounding healthy tissues. In this study, the anti-HER2 2Rs15d-nanobody was conjugated with 2-(4-isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid ( p-SCN-Bn-DOTA) and radiolabeled with an α-emitter 225 Ac with a high yield (>90%) and a radiochemical purity above 95%. The 225 Ac-DOTA-Nb binding affinity was 4.12 ± 0.47 nM with an immunoreactive fraction above 80%. Binding to low HER2-expressing MDA-MB-231 cells was negligible, whereas HER2-overexpressing SKOV-3 cells could be blocked with an excess of unlabeled nanobody, confirming the specificity of binding. Noncompeting binding to HER2 was observed in the presence of an excess of trastuzumab. The cell-associated fraction of 225 Ac-DOTA-Nb was 34.72 ± 16.66% over 24 h. In vitro, the radioconjugate was toxic in an HER2-mediated and dose-dependent manner, resulting in IC 50 values of 10.2 and 322.1 kBq/mL for 225 Ac-DOTA-Nb and the 225 Ac-DOTA control, respectively, on SKOV-3 cells, and 282.2 kBq/mL for 225 Ac-DOTA-Nb on MDA-MB-231 cells. Ex vivo biodistribution studies, performed in mice bearing subcutaneous HER2-overexpressing and low HER2-expressing tumors, showed a fast uptake in SKOV-3 tumors compared to MDA-MB-231 (4.01 ± 1.58% ID/g vs 0.49 ± 0.20% ID/g after 2 h), resulting also in high tumor-to-normal tissue ratios. In addition, coinjection of 225 Ac-DOTA-Nb with Gelofusine reduced kidney retention by 70%. This study shows that 225 Ac-DOTA-Nb is a promising new radioconjugate for targeted α-particle therapy

  19. Iodine in Enteral and Parenteral Nutrition

    NARCIS (Netherlands)

    Zimmermann, M.B.; Crill, C.M.

    2010-01-01

    Iodine deficiency (ID) has multiple adverse effects on growth and development due to inadequate thyroid hormone production. Methods for assessment of iodine nutrition in individuals include the urinary iodine concentration (UI), thyroid size and thyroid function tests. The UI measured in several

  20. Data Mining of Acupoint Characteristics from the Classical Medical Text: DongUiBoGam of Korean Medicine

    Directory of Open Access Journals (Sweden)

    Taehyung Lee

    2014-01-01

    Full Text Available Throughout the history of East Asian medicine, different kinds of acupuncture treatment experiences have been accumulated in classical medical texts. Reexamining knowledge from classical medical texts is expected to provide meaningful information that could be utilized in current medical practices. In this study, we used data mining methods to analyze the association between acupoints and patterns of disorder with the classical medical book DongUiBoGam of Korean medicine. Using the term frequency-inverse document frequency (tf-idf method, we quantified the significance of acupoints to its targeting patterns and, conversely, the significance of patterns to acupoints. Through these processes, we extracted characteristics of each acupoint based on its treating patterns. We also drew practical information for selecting acupoints on certain patterns according to their association. Data analysis on DongUiBoGam’s acupuncture treatment gave us an insight into the main idea of DongUiBoGam. We strongly believe that our approach can provide a novel understanding of unknown characteristics of acupoint and pattern identification from the classical medical text using data mining methods.

  1. Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C

    International Nuclear Information System (INIS)

    Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.

    1995-01-01

    The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines

  2. AcEST: DK946983 [AcEST

    Lifescience Database Archive (English)

    Full Text Available quence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ... ... Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-val...ue - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Se

  3. AcEST: DK945375 [AcEST

    Lifescience Database Archive (English)

    Full Text Available quence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ... ... Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-val...ue - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Se

  4. A proposed HTTP service based IDS

    Directory of Open Access Journals (Sweden)

    Mohamed M. Abd-Eldayem

    2014-03-01

    Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 1. Wireless Telegraphic Communication. Guglielmo Marconi. Classics Volume 7 Issue 1 January 2002 pp 95-101. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/01/0095-0101 ...

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 9. Spintronics - Principles. R Srinivasan. General Article Volume 10 Issue 9 September 2005 pp 53-62. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/09/0053-0062. Keywords.

  7. Unusual and highly tunable missing-linker defects in zirconium metal-organic framework UiO-66 and their important effects on gas adsorption.

    Science.gov (United States)

    Wu, Hui; Chua, Yong Shen; Krungleviciute, Vaiva; Tyagi, Madhusudan; Chen, Ping; Yildirim, Taner; Zhou, Wei

    2013-07-17

    UiO-66 is a highly important prototypical zirconium metal-organic framework (MOF) compound because of its excellent stabilities not typically found in common porous MOFs. In its perfect crystal structure, each Zr metal center is fully coordinated by 12 organic linkers to form a highly connected framework. Using high-resolution neutron power diffraction technique, we found the first direct structural evidence showing that real UiO-66 material contains significant amount of missing-linker defects, an unusual phenomenon for MOFs. The concentration of the missing-linker defects is surprisingly high, ∼10% in our sample, effectively reducing the framework connection from 12 to ∼11. We show that by varying the concentration of the acetic acid modulator and the synthesis time, the linker vacancies can be tuned systematically, leading to dramatically enhanced porosity. We obtained samples with pore volumes ranging from 0.44 to 1.0 cm(3)/g and Brunauer-Emmett-Teller surface areas ranging from 1000 to 1600 m(2)/g, the largest values of which are ∼150% and ∼60% higher than the theoretical values of defect-free UiO-66 crystal, respectively. The linker vacancies also have profound effects on the gas adsorption behaviors of UiO-66, in particular CO2. Finally, comparing the gas adsorption of hydroxylated and dehydroxylated UiO-66, we found that the former performs systematically better than the latter (particularly for CO2) suggesting the beneficial effect of the -OH groups. This finding is of great importance because hydroxylated UiO-66 is the practically more relevant, non-air-sensitive form of this MOF. The preferred gas adsorption on the metal center was confirmed by neutron diffraction measurements, and the gas binding strength enhancement by the -OH group was further supported by our first-principles calculations.

  8. 78 FR 12655 - Federal-State Unemployment Insurance (UI) Program; Data Exchange Standardization as Required by...

    Science.gov (United States)

    2013-02-25

    ... elimination of the need to create and mail hard copy documents; Increasing accuracy and reducing errors (in... formatting requirements for the data exchanges of various UI applications that may impose a burden under the...

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 1. Iterated Functions and Intermittency. V Balakrishnan. General Article Volume 6 Issue 1 January 2001 pp 18-27. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/01/0018-0027 ...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 8. Justus Freiherr von Liebig. Gopalpur Nagendrappa. General Article Volume 18 Issue 8 August 2013 pp 691-711. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/018/08/0691-0711. Keywords.

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Ludwig Boltzmann and Entropy. Sriram Ramaswamy. Volume 10 Issue 12 December 2005 pp 176-178. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/12/0176-0178. Author Affiliations.

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 1. A Scientific Autobiography. Sushan Konar. Book Review Volume 21 Issue 1 January 2016 pp 89-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/021/01/0089-0092. Author Affiliations.

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 9. Life at High Temperatures. Ramesh Maheshwari. General Article Volume 10 Issue 9 September 2005 pp 23-36. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/09/0023-0036. Keywords.

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 11. Editorial / Associate Editor's Column. Alladi Sitaram. Editorial Volume 4 Issue 11 November 1999 pp 1-1. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/11/0001-0001. Author Affiliations.

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 4. Editorial / Associate Editor's Column. Rajaram Nityananda. Editorial Volume 5 Issue 4 April 2000 pp 1-3. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/04/0001-0003. Author Affiliations.

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 2. Editorial / Associate Editor's Column. Rajaram Nityananda. Editorial Volume 5 Issue 2 February 2000 pp 1-1. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/02/0001-0001. Author Affiliations.

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 3. Living Science Creatively. A Rajanikanth. Information and Announcements Volume 3 Issue 3 March 1998 pp 93-94. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/03/0093-0094 ...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 1. Elements of Chemistry. Antoine-Laurent Lavoisier. Classics Volume 17 Issue 1 January 2012 pp 92-100. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/01/0092-0100. Author Affiliations.

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 2. Communicating Information. K Viswanath. General Article Volume 7 Issue 2 February 2002 pp 26-32. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/02/0026-0032. Keywords. Entropy ...

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 3. Chemistry of Colours. Jayanthi Chandrasekaran. General Article Volume 6 Issue 3 March 2001 pp 66-75. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/03/0066-0075. Author Affiliations.

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 9. Atomic Warrior. Shabhana Narasimhan. Book Review Volume 6 Issue 9 September 2001 pp 106-109. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/09/0106-0109. Author Affiliations.

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 9. Polarography. V Lakshminarayanan. General Article Volume 9 Issue 9 September 2004 pp 51-61. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/09/0051-0061. Keywords. Polarography ...

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 3. Physical Chemistry. Mohammed Farooq Ahmed. Book Review Volume 3 Issue 3 March 1998 pp 73-75. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/03/0073-0075. Author Affiliations.

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 11. Turbulence and Flying Machines. Rama Govindarajan. General Article Volume 4 Issue 11 November 1999 pp 54-62. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/11/0054-0062 ...

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 9. Sonya Vasilievna Krukovskaya (1850-1891). Featured Scientist Volume 1 Issue 9 September 1996 pp 98-98. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/09/0098-0098. Resonance ...

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 10. Man and Natural Selection. Theodosius Dobzhansky. Reflections Volume 5 Issue 10 October 2000 pp 92-100. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/10/0092-0100 ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 12. The Enigmatic Moon. Biman Nath. Book Review Volume 13 Issue 12 December 2008 pp 1173-1175. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/12/1173-1175. Author Affiliations.

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 2. The Three Colour Problem. Dinoj Surendran. Classroom Volume 4 Issue 2 February 1999 pp 76-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/02/0076-0081. Author Affiliations.

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 11. Spintronics - Devices and Materials. R Srinivasan. General Article Volume 10 Issue 11 November 2005 pp 8-17. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/11/0008-0017. Keywords.

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Nuclear Science Centre. N Madhavan. Information and Announcements Volume 2 Issue 10 October 1997 pp 92-96. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/10/0092-0096 ...

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 7. Workshops on Writing Science. Information and Announcements Volume 22 Issue 7 July 2017 pp 718-718. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/022/07/0718-0718. Abstract ...

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Pollen Grains, Random Walks and Einstein. Sriram Ramaswamy. Volume 10 Issue 12 December 2005 pp 106-124. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/12/0106-0124 ...

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 11. Integration and Polar Coordinates. S Kesavan. General Article Volume 18 Issue 11 November 2013 pp 996-1003. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/018/11/0996-1003. Keywords.

  14. Tinjauan Desain Website Kemlu.Go.Id

    OpenAIRE

    Danu Widhyatmoko

    2013-01-01

    Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...

  15. Electron ID in ATLAS Run 2

    CERN Document Server

    Thais, Savannah Jennifer; The ATLAS collaboration

    2018-01-01

    Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.

  16. Tinjauan Desain Website Kemlu.Go.Id

    Directory of Open Access Journals (Sweden)

    Danu Widhyatmoko

    2013-04-01

    Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.  

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 1. Radio Broadcast Technology. Harsh Vardhan. General Article Volume 7 Issue 1 January 2002 pp 53-63. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/01/0053-0063. Keywords. Hertzian ...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 4. The Evolution of Diesel Engines. U Shrinivasa. General Article Volume 17 Issue 4 April 2012 pp 365-377. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/04/0365-0377. Keywords.

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 9. Hardy's “A Mathematician's Apology”. L J Mordell. Reflections Volume 3 Issue 9 September 1998 pp 83-89. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/09/0083-0089. Author Affiliations.

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 8. Albert Einstein-The Man Behind the Myths. John Stachel. Reflections Volume 3 Issue 8 August 1998 pp 76-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/08/0076-0092 ...

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 3. High-Altitude Cirrus Clouds and Climate. S Veerabuthiran. General Article Volume 9 Issue 3 March 2004 pp 23-32. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/03/0023-0032. Keywords.

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Einstein and the Special Theory of Relativity. Supurna Sinha. Volume 10 Issue 12 December 2005 pp 96-105. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/12/0096-0105 ...

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 12. Introduction to Special Theory of Relativity. Sukanya Sinha. Book Review Volume 4 Issue 12 December 1999 pp 106-107. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/12/0106-0107 ...

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 3. Tinker, Builder, Physicist, and Teacher ! Prajval Shastri. Face to Face Volume 22 Issue 3 March 2017 pp 319-321. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/022/03/0319-0321. Keywords.

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 4. Chemistry Nobel Prize 2002 - Mass Spectrometry. M Vairamani. Research News Volume 8 Issue 4 April 2003 pp 69-76. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/04/0069-0076 ...

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 3. Bessels contain Continued Fractions of Progressions. B Sury. Classroom Volume 10 Issue 3 March 2005 pp 80-87. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/03/0080-0087. Keywords.

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 3. Edwin Powell Hubble. Swara Ravindranath. Article-in-a-Box Volume 14 Issue 3 March 2009 pp 211-213. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/014/03/0211-0213. Author Affiliations.

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 1. A Joyous Romp Through Basic Physics. V Balakrishnan. Book Review Volume 1 Issue 1 January 1996 pp 110-114. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/01/0110-0114 ...

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 8. Quantization of the Radiation Field. Avinash Khare. General Article Volume 8 Issue 8 August 2003 pp 10-16. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/08/0010-0016. Keywords.

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 9. Entropy in Biology. Jayant B Udgaonkar. General Article Volume 6 Issue 9 September 2001 pp 61-66. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/09/0061-0066. Author Affiliations.

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 7. Science - its Philosophy and Spirit. Hermann Bondi. Reflections Volume 1 Issue 7 July 1996 pp 82-95. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/07/0082-0095. Author Affiliations.

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 8. Insect Detectives - Forensic Entomology. P K Sumodan. General Article Volume 7 Issue 8 August 2002 pp 51-58. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/08/0051-0058. Keywords.

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 4. The Origins of Science Thales' Leap. Gangan Prathap. Reflections Volume 1 Issue 4 April 1996 pp 67-73. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/04/0067-0073. Author Affiliations.

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 9. Xylitol: A Sweetener with Special Qualities. Anil Lachke. Research News Volume 11 Issue 9 September 2006 pp 90-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/09/0090-0092 ...

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 12. Mathematics and Sports. Vivek S Borkar. Book Review Volume 4 Issue 12 December 1999 pp 107-108. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/12/0107-0108. Author Affiliations.

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 2. Electrostatics of Atoms and Molecules. G Narahari Sastry. Book Review Volume 7 Issue 2 February 2002 pp 90-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/02/0090-0091 ...

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 1. Complex Numbers and Plane Geometry. Anant R Shastri. General Article Volume 13 Issue 1 January 2008 pp 35-53. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/01/0035-0053 ...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 12. The Wright Family. Roddam Narasimha. Article-in-a-Box Volume 8 Issue 12 December 2003 pp 5-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/12/0005-0005. Author Affiliations.

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 2. Hydrotalcite - The Clay that Cures. N Bejoy. General Article Volume 6 Issue 2 February 2001 pp 57-61. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/02/0057-0061. Author Affiliations.

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 12. Very Long Instruction Word Processors. S Balakrishnan. General Article Volume 6 Issue 12 December 2001 pp 61-68. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/12/0061-0068 ...

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 5. Rotational Rectification of an Alternating Magnetic Field. N Kumar. Classroom Volume 18 Issue 5 May 2013 pp 458-467. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/018/05/0458-0467 ...

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 8. Standard Weights and Measures. Vasant Natarajan. General Article Volume 6 Issue 8 August 2001 pp 44-59. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/08/0044-0059. Author Affiliations.

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. Perkin's Mauve: The History of the Chemistry. Andrew Filarowski. Volume 16 Issue 12 December 2011 pp 1140-1145. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/12/1140-1145 ...

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 4. Cosmology, Mach's Principle and Relativity. R H Dicke. Classics Volume 16 Issue 4 April 2011 pp 372-391. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/04/0372-0391. Author Affiliations.

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 8. On Science Education and Scientific Research. R K Varma. Volume 3 Issue 8 August 1998 pp 8-13. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/08/0008-0013. Author Affiliations.

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 8. Project Lifescape – An Invitation. Madhav Gadgil. Classroom Volume 4 Issue 8 August 1999 pp 80-90. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/08/0080-0090. Author Affiliations.

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 1. Project Lifescape – Diseases:Paddy. R J Ranjit Daniels. Classroom Volume 5 Issue 1 January 2000 pp 93-100. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/01/0093-0100 ...

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 1. Fermi and the Art of Estimation. Rajaram Nityananda. General Article Volume 19 Issue 1 January 2014 pp 73-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/019/01/0073-0081. Keywords.

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 1. International Physics Olympiad'98 – 1. Experiments. Saikat Guha. Classroom Volume 5 Issue 1 January 2000 pp 83-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/01/0083-0092 ...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 6. Drought Signaling in Plants. G Sivakumar Swamy. General Article Volume 4 Issue 6 June 1999 pp 34-44. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/06/0034-0044. Author Affiliations.

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 1. Breaking Rules - Making Bonds. A G Samuelson. General Article Volume 21 Issue 1 January 2016 pp 43-48. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/021/01/0043-0048. Keywords.

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 3. Wallace and Natural Selection, 1858. Sahotra Sarkar. General Article Volume 13 Issue 3 March 2008 pp 236-244. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/03/0236-0244. Keywords.

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 5. What is 'Natural' in Natural Selection? Abhijeet S Bardapurkar. Classroom Volume 18 Issue 5 May 2013 pp 475-482. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/018/05/0475-0482 ...

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 3. Introduction to Game Theory. S Ramasubramanian. Book Review Volume 9 Issue 3 March 2004 pp 81-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/03/0081-0081. Author Affiliations.

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 8. The Age of Extinction. Prasanna Venkhatesh V. Book Review Volume 20 Issue 8 August 2015 pp 748-750. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/020/08/0748-0750. Author Affiliations.

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 8. Prevent or Perish. Prasanna Venkhatesh V. Book Review Volume 20 Issue 8 August 2015 pp 750-752. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/020/08/0750-0752. Author Affiliations.

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 2. Physics Training and Talent Search. Information and Announcements Volume 23 Issue 2 February 2018 pp 244-244. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/023/02/0244-0244. Abstract ...

  18. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy; Volume 34; Issue 1. General Editorial on Publication Ethics. Ram Sagar R. Ramaswamy N. Mukunda. Volume 34 Issue 1 March 2013 pp 1-2. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/joaa/034/01/0001-0002 ...

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 7. Norms and the Conservation of Biodiversity. Sahotra Sarkar. General Article Volume 13 Issue 7 July 2008 pp 627-637. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/07/0627-0637 ...

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 4. The Pursuit of Science : Its Motivations. S Chandrasekhar. Reflections Volume 2 Issue 4 April 1997 pp 82-95. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/04/0082-0095. Author Affiliations.

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 9. The Concept of Experiment in Science. Samir Roy. Classroom Volume 1 Issue 9 September 1996 pp 72-74. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/09/0072-0074. Author Affiliations.

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 12. The Nobel Prize in Physics - 1996. R Srinivasan. Research News Volume 1 Issue 12 December 1996 pp 65-68. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/12/0065-0068 ...

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 4. On Teaching the Theory of Evolution. Rajkumar Radder. Classroom Volume 11 Issue 4 April 2006 pp 100-105. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/04/0100-0105. Keywords.

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 7. Teaching Chemistry through Riddles. Mala Das Sharma. Classroom Volume 9 Issue 7 July 2004 pp 74-76. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/07/0074-0076. Author Affiliations.

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 11. IAP Statement on the Teaching of Evolution. Feature Article Volume 11 Issue 11 November 2006 pp 93-95. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/11/0093-0095. Resonance ...

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 5. Some Reminiscences of My Teaching Career. Arnold Sommerfeld. Classics Volume 20 Issue 5 May 2015 pp 472-475. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/020/05/0472-0475 ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 11. Handbook of Solar Radiation Data for India. Anna Mani. Classics Volume 13 Issue 11 November 2008 pp 1082-1086. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/11/1082-1086 ...

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 11. Can Light Travel Faster than Light? Supurna Sinha. Research News Volume 5 Issue 11 November 2000 pp 90-93. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/11/0090-0093 ...

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 2. Imaging Sensors: Artificial and Natural. Vikram Dhar. General Article Volume 4 Issue 2 February 1999 pp 27-36. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/02/0027-0036 ...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 5. Behavioural View of Language Acquisition. Rajeev Sangal. Book Review Volume 13 Issue 5 May 2008 pp 487-489. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/05/0487-0489 ...

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 9. The Synthesis of Ammonia from its Elements. Fritz Haber. Classics Volume 7 Issue 9 September 2002 pp 86-94. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/09/0086-0094 ...

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 2. Cholesterol and Health. Pravina Piste Vidyadhar Patil. General Article Volume 11 Issue 2 February 2006 pp 74-77. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/02/0074-0077. Keywords.

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 2. Nature's Solar Cell. Stephen Suresh Gautham Nadig. Research News Volume 1 Issue 2 February 1996 pp 102-104. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/02/0102-0104 ...

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 5. Discourses on Algebra. Rajaram Nityananda. Book Review Volume 22 Issue 5 May 2017 pp 509-511. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/022/05/0509-0511. Keywords. Discourses ...

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 5. Contributions of Maxwell to Electromagnetism. P V Panat. General Article Volume 8 Issue 5 May 2003 pp 17-29. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/05/0017-0029. Keywords.

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 2. Matrix Magic: Spin Half Systems. Kovid Goyal. Classroom Volume 8 Issue 2 February 2003 pp 76-79. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/02/0076-0079. Keywords. Quantum ...

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 4. Refresher Course in Earth System Science. Information and Announcements Volume 10 Issue 4 April 2005 pp 91-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/04/0091-0091 ...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 8. Reflections on Software Research. Dennis M Ritchie. Classics Volume 17 Issue 8 August 2012 pp 810-816. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/08/0810-0816. Author Affiliations.

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 8. Game Theory - Conventions and Knowledge. P G Babu. General Article Volume 3 Issue 8 August 1998 pp 46-55. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/08/0046-0055 ...

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 12. Vikram A Sarabhai. Mrinalini Sarabhai. Article-in-a-Box Volume 6 Issue 12 December 2001 pp 5-7. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/12/0005-0007. Author Affiliations.

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. The Theory of Positrons. Richard P Feynman. Classics Volume 2 Issue 12 December 1997 pp 107-107. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/12/0107-0107. Author Affiliations.

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 8. All about the Dirac Delta Function (?). V Balakrishnan. General Article Volume 8 Issue 8 August 2003 pp 48-58. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/08/0048-0058. Keywords.

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 12. Mycorrhiza: The Oldest ... Babita Saha Siraj Datta. General Article Volume 21 Issue 12 December 2016 pp 1093-1104. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/021/12/1093-1104 ...

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 9. Lightning Bugs. B Gajendra Babu M Kannan. General Article Volume 7 Issue 9 September 2002 pp 49-55. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/09/0049-0055. Keywords.

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 5. How Many Equivalent Resistances? Sameen Ahmed Khan. General Article Volume 17 Issue 5 May 2012 pp 468-475. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/05/0468-0475 ...

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 2. George Andrews' Game. Jerold Mathews. General Article Volume 14 Issue 2 February 2009 pp 172-178. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/014/02/0172-0178. Keywords. Fibonacci ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 9. The Isoperimetric Inequality. S Kesavan. General Article Volume 7 Issue 9 September 2002 pp 8-18. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/09/0008-0018. Keywords. Isoperimetric ...

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 1. Life without Water. M K Chattopadhyay. General Article Volume 14 Issue 1 January 2009 pp 60-65. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/014/01/0060-0065. Keywords. Anhydrobiosis ...

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 7. Fermat's Two Squares Theorem Revisited. Bhaskar Bagchi. General Article Volume 4 Issue 7 July 1999 pp 59-67. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/07/0059-0067 ...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 3. On Fermat's Two-Square Theorem. Shailesh A Shirali. Classroom Volume 2 Issue 3 March 1997 pp 69-73. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/03/0069-0073. Author Affiliations.

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 7. Fermat: A Versatile Genius. Utpal Mukhopadhyay. General Article Volume 16 Issue 7 July 2011 pp 648-662. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/07/0648-0662. Keywords. Fermat ...

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 5. Chromatography – An Educational Tool. Rekha Rajiv Vartak. Classroom Volume 6 Issue 5 May 2001 pp 83-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/05/0083-0091 ...

  13. Idékatalog Appetit på maden

    DEFF Research Database (Denmark)

    Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie

    2015-01-01

    Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....

  14. Astronomy and Computing: A New Journal for the Astronomical Computing Community

    NARCIS (Netherlands)

    Mann, R.G.; Accomazzi, A.; Budavári, T.; Fluke, C.; Gray, N.; O'Mullane, W.; Wicenec, A.; Wise, M.

    2013-01-01

    We introduce Astronomy and Computing (A&C), a new, peer-reviewed journal for the expanding community of people whose work focuses on the application of computer science and information technology within astronomy, rather than on astronomical research per se. A&C arose from a BoF discussion at the

  15. 75 FR 52981 - Bluescope Buildings North America, Including Workers Whose Unemployment Insurance (UI) Wages Are...

    Science.gov (United States)

    2010-08-30

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,758] Bluescope Buildings North America, Including Workers Whose Unemployment Insurance (UI) Wages Are Reported Through Butler Manufacturing Company, Laurinburg, NC; Amended Certification Regarding Eligibility To Apply for Worker...

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 6. Life and Times of Bourbaki. C S Yogananda. Book Review Volume 20 Issue 6 June 2015 pp 556-559. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/020/06/0556-0559. Author Affiliations.

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 1. Florence Jessie MacWilliams (1917-1990). Priti Shankar. Article-in-a-Box Volume 10 Issue 1 January 2005 pp 2-3. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/01/0002-0003 ...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 1. Do Trees Tell About the Past? H S Suresh. General Article Volume 17 Issue 1 January 2012 pp 33-43. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/01/0033-0043. Keywords.

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 11. Francis Crick (1916-2004). S Mahadevan. Article-in-a-Box Volume 9 Issue 11 November 2004 pp 3-7. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/11/0003-0007. Author Affiliations.

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 5. Special Relativity – An Exoteric Narrative. S R Madhu Rao. Classroom Volume 3 Issue 5 May 1998 pp 63-72. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/05/0063-0072. Author Affiliations.

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 7. Chelates for Micronutrient Nutrition among Crops. B S Sekhon. General Article Volume 8 Issue 7 July 2003 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/07/0046-0053. Keywords.

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 6. Waring's Problem and the Circle Method. C S Yogananda. General Article Volume 9 Issue 6 June 2004 pp 51-55. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/06/0051-0055. Keywords.

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 1. Prafulla Chandra Rây. Animesh Chakravorty. Article-in-a-Box Volume 6 Issue 1 January 2001 pp 3-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/01/0003-0005. Author Affiliations.

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 7. Gödel's Explorations in Terra Incognita. Vijay Chandru. General Article Volume 6 Issue 7 July 2001 pp 22-28. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/07/0022-0028. Author Affiliations.

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 2. On How to Arrange Infinitely many Marriages! B Sury. Classroom Volume 6 Issue 2 February 2001 pp 71-73. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/02/0071-0073. Author Affiliations.

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 5. Which way does the Flame Point? Jaywant H Arakeri. Classroom Volume 6 Issue 5 May 2001 pp 79-82. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/05/0079-0082. Author Affiliations.

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 6. A Course in Number Theory and Cryptology. Rajat Tandon. Book Review Volume 6 Issue 6 June 2001 pp 91-94. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/06/0091-0094 ...

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 14; Issue 5. The Indian Institute of Science: Marking a Centenary. P Balaram. General Article Volume 14 Issue 5 May 2009 pp 416-429. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/014/05/0416-0429 ...

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 8. A Student Experiment on Photochromism. Arati Tripathi S V Eswaran. Classroom Volume 6 Issue 8 August 2001 pp 90-92. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/08/0090-0092 ...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 4. What's New in Computers? Digital Libraries. T B Rajashekar. Feature Article Volume 2 Issue 4 April 1997 pp 60-73. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/04/0060-0073 ...

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 6. Algebra in Ancient and Modern Times. K B Sinha. Book Review Volume 3 Issue 6 June 1998 pp 80-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/06/0080-0081. Author Affiliations.

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 10. The Story of Nuclear Matter. R Rajaraman. General Article Volume 10 Issue 10 October 2005 pp 8-32. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/010/10/0008-0032. Keywords. Nuclear ...

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 12. Darshana Jolts - The Physical World – 1. V V Raman. Reflections Volume 15 Issue 12 December 2010 pp 1132-1141. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/015/12/1132-1141 ...

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 7. The Present Concept of the Physical World. Homi Jehangir Bhabha. Reflections Volume 3 Issue 7 July 1998 pp 81-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/07/0081-0091 ...

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 4. Project Lifescape – Freshwater Fishes: Catfishes. R J Ranjit Daniels. Classroom Volume 5 Issue 4 April 2000 pp 97-107. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/005/04/0097-0107 ...

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 3. Preparing for the Transit of Venus. N Rathnasree Sanat Kumar. Classroom Volume 9 Issue 3 March 2004 pp 65-75. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/03/0065-0075. Keywords.

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 7. Memory as a Life - Walking down Memory Lanes. S Krishnaswamy. Book Review Volume 1 Issue 7 July 1996 pp 79-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/07/0079-0081 ...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 1. Norbert Wiener and Control Engineering. Vivek S Borkar. Article-in-a-Box Volume 4 Issue 1 January 1999 pp 3-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/01/0003-0004 ...

  19. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 1. Impressions of the 37th IMO 96. Ajay C Ramdoss. Classroom Volume 2 Issue 1 January 1997 pp 60-64. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/01/0060-0064. Author Affiliations.

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 3. Expert Systems : An Introduction. K S R Anjaneyulu. General Article Volume 3 Issue 3 March 1998 pp 46-58. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/03/0046-0058. Author Affiliations.

  1. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 4. Lagrange and Classical Mechanics. N Mukunda. Article-in-a-Box Volume 11 Issue 4 April 2006 pp 5-7. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/04/0005-0007. Author Affiliations.

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 7. Inverting Matrices Constructed from Roots of Unity. A John Wilson. Classroom Volume 11 Issue 7 July 2006 pp 70-76. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/07/0070-0076 ...

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 6. Chemistry Behind the Life of a Transformer. Rashmi Sanghi. General Article Volume 8 Issue 6 June 2003 pp 17-23. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/06/0017-0023. Keywords.

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 1. The Legend of Louis Pasteur. S Mahadevan. General Article Volume 12 Issue 1 January 2007 pp 15-22. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/01/0015-0022. Keywords. Pasteur ...

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 10. GNR – A Tribute. D Balasubramanian. Article-in-a-Box Volume 6 Issue 10 October 2001 pp 2-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/10/0002-0004. Author Affiliations.

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 6. Learning from a Sea Snail: Eric Kandel. Rohini Balakrishnan. Research News Volume 6 Issue 6 June 2001 pp 86-90. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/06/0086-0090 ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 12. Isaac Newton (1642/43-1727). Bikram Phookun. Article-in-a-Box Volume 11 Issue 12 December 2006 pp 3-6. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/12/0003-0006 ...

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 5. TIFRAC, India's First Computer - A Retrospective. P V S Rao. General Article Volume 13 Issue 5 May 2008 pp 420-429. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/013/05/0420-0429 ...

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 8. Wollemi Pine: Living Fossil from Jurassic Landscape. N S Leela. General Article Volume 8 Issue 8 August 2003 pp 43-47. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/08/0043-0047 ...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 11. Where Are All the Typical Numbers–2. B V Rao. General Article Volume 16 Issue 11 November 2011 pp 1029-1038. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/11/1029-1038 ...

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 5. What is New in Computers? - Mobile Computing. L M Patnaik. Feature Article Volume 3 Issue 5 May 1998 pp 48-62. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/05/0048-0062 ...

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 4. Chief Editor's column / Science Smiles. R K Laxman. Science Smiles Volume 1 Issue 4 April 1996 pp 4-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/001/04/0004-0004. Author Affiliations.

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 17; Issue 9. The Bakhshāli Square Root Formula. Shailesh A Shirali. General Article Volume 17 Issue 9 September 2012 pp 884-894. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/017/09/0884-0894 ...

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 8. A Taste of Functional Programming – I. Madhavan Mukund. General Article Volume 12 Issue 8 August 2007 pp 27-48. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/08/0027-0048 ...

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Biodiversity – A Manual for College Teachers. N S Leela. Book Review Volume 2 Issue 10 October 1997 pp 80-81. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/10/0080-0081 ...

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 5. The Indian Monsoon - Physics of the Monsoon. Sulochana Gadgil. Series Article Volume 12 Issue 5 May 2007 pp 4-20. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/05/0004-0020 ...

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 3. The Story of Fermat's Last Theorem. Shailesh A Shirali. Book Review Volume 4 Issue 3 March 1999 pp 81-84. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/03/0081-0084. Author Affiliations.

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 7. A Course on Integration Theory. B J Venkatachala. Book Review Volume 2 Issue 7 July 1997 pp 93-94. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/07/0093-0094. Author Affiliations.

  19. Decoration of Cotton Fibers with a Water-Stable Metal–Organic Framework (UiO-66 for the Decomposition and Enhanced Adsorption of Micropollutants in Water

    Directory of Open Access Journals (Sweden)

    Marion Schelling

    2018-02-01

    Full Text Available We report on the successful functionalization of cotton fabrics with a water-stable metal–organic framework (MOF, UiO-66, under mild solvothermal conditions (80 °C and its ability to adsorb and degrade water micropollutants. The functionalized cotton samples were characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM, energy-dispersive X-ray spectroscopy (EDX, transmission electron microscopy (TEM, Fourier transform infrared spectroscopy (FTIR, and X-ray photoelectron spectroscopy (XPS. UiO-66 crystals grew in a uniform and conformal manner over the surface of the cotton fibers. The cotton fabrics functionalized with UiO-66 frameworks exhibited an enhanced uptake capacity for methylchlorophenoxypropionic acid (MCPP, a commonly used herbicide. The functionalized fabrics also showed photocatalytic activity, demonstrated by the degradation of acetaminophen, a common pharmaceutical compound, under simulated sunlight irradiation. These results indicate that UiO-66 can be supported on textile substrates for filtration and photocatalytic purposes and that these substrates can find applications in wastewater decontamination and micropollutant degradation.

  20. Attitudes toward Learning about and Working with Computers of Students at UiTM

    Science.gov (United States)

    Hashim, Rugayah; Mustapha, Wan Narita

    2004-01-01

    The purpose of this study was to assess the attitudes toward learning about and working with computers of Universiti Teknologi MARA (UiTM), Shah Alam students. Attitudes were studied in an attempt to ascertain factors such as anxiety, confidence, liking and, usefulness at the university level. A total of 300 students at various stages of education…

  1. 77 FR 33490 - Long Elevator & Machine Company, Inc., Including Workers Whose Unemployment Insurance (UI) Wages...

    Science.gov (United States)

    2012-06-06

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-80,525] Long Elevator & Machine Company, Inc., Including Workers Whose Unemployment Insurance (UI) Wages Were Reported Through Kone, Inc... former workers of Long Elevator & Machine Company, Inc., including workers whose unemployment insurance...

  2. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 16; Issue 12. Chemistry of Materials - A Letter to a Young Friend. C N R Rao. Volume 16 Issue 12 December 2011 pp 1110-1119. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/016/12/1110-1119 ...

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 5. On Kepler's First Law - The Law of Ellipses. Shailesh A Shirali. General Article Volume 3 Issue 5 May 1998 pp 30-42. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/05/0030-0042 ...

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 3. Paul Erdös, the Western Ramanujan. C S Yogananda. Article-in-a-Box Volume 3 Issue 3 March 1998 pp 2-4. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/03/0002-0004. Author Affiliations.

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 1. Role of Wind Tunnels in Aircraft Design. S P Govinda Raju. General Article Volume 8 Issue 1 January 2003 pp 72-76. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/01/0072-0076. Keywords.

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 6. Henrietta Leavitt – A Bright Star of Astronomy. Biman Nath. Article-in-a-Box Volume 6 Issue 6 June 2001 pp 2-3. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/06/0002-0003 ...

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 8. Galileo Galilei: Father of Modern Science. C S Yogananda. Article-in-a-Box Volume 6 Issue 8 August 2001 pp 3-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/08/0003-0005 ...

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 3. Why did I opt for Career in Science? Jayant V Narlikar. Personal Reflections Volume 6 Issue 3 March 2001 pp 90-93. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/03/0090-0093 ...

  9. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 8. Paul Adrien Maurice Dirac –An Appreciation. N Mukunda. Article-in-a-Box Volume 8 Issue 8 August 2003 pp 3-6. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/008/08/0003-0006 ...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 4. Gender in Plants Why Do Plants Change Sex? Renee M Borges. General Article Volume 3 Issue 4 April 1998 pp 64-71. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/04/0064-0071 ...

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 1. The Football - From Euclid to Soccer it is... A R Rao. General Article Volume 6 Issue 1 January 2001 pp 28-41. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/01/0028-0041. Author Affiliations.

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 2. Erwin Schrödinger – A Sketch. Virendra Singh. Article-in-a-Box Volume 4 Issue 2 February 1999 pp 3-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/004/02/0003-0005. Author Affiliations.

  13. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 6. Head-on Collision of Two Balls Revisited. Umapati Pattar A W Joshi. Classroom Volume 7 Issue 6 June 2002 pp 67-77. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/06/0067-0077 ...

  14. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 7; Issue 11. Stephen Jay Gould: A View of Life. Renee M Borges. Article-in-a-Box Volume 7 Issue 11 November 2002 pp 2-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/007/11/0002-0005 ...

  15. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 3; Issue 11. On Parallel Computing – Indian Trends. U N Sinha. Article-in-a-Box Volume 3 Issue 11 November 1998 pp 2-5. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/003/11/0002-0005 ...

  16. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 12. What are the shapes of the f - orbitals. K L Sebastian. Think It Over Volume 2 Issue 12 December 1997 pp 88-91. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/002/12/0088-0091 ...

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 5. The Meaning of Integration – II. A K Nandakumaran. General Article Volume 9 Issue 5 May 2004 pp 41-50. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/009/05/0041-0050. Keywords. Riemann ...

  18. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 12; Issue 3. Interactions and Mergers of Galaxies. S M Alladin S N Hasan. General Article Volume 12 Issue 3 March 2007 pp 13-26. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/012/03/0013-0026 ...

  19. Effective UI The Art of Building Great User Experience in Software

    CERN Document Server

    Anderson, Jonathan; Wilson, Robb

    2010-01-01

    People expect effortless, engaging interaction with desktop and web applications, but producing software that generates enjoyable user experiences is much harder than many companies anticipate. With Effective UI, you'll learn proven user-experience strategies that will satisfy your clients and customers, drive business value, and increase brand strength. This book shows you how to capture the collaborative and cooperative spirit among designers, engineers, and management required for building engaging software. You'll also learn valuable methods for maintaining focus throughout the process -

  20. Facts about Infectious Diseases (ID)

    Science.gov (United States)

    ... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...

  1. Thin Film Nanocomposite Membrane Filled with Metal-Organic Frameworks UiO-66 and MIL-125 Nanoparticles for Water Desalination

    Directory of Open Access Journals (Sweden)

    Mohammed Kadhom

    2017-06-01

    Full Text Available Knowing that the world is facing a shortage of fresh water, desalination, in its different forms including reverse osmosis, represents a practical approach to produce potable water from a saline source. In this report, two kinds of Metal-Organic Frameworks (MOFs nanoparticles (NPs, UiO-66 (~100 nm and MIL-125 (~100 nm, were embedded separately into thin-film composite membranes in different weight ratios, 0%, 0.05%, 0.1%, 0.15%, 0.2%, and 0.3%. The membranes were synthesized by the interfacial polymerization (IP of m-phenylenediamine (MPD in aqueous solution and trimesoyl chloride (TMC in an organic phase. The as-prepared membranes were characterized by scanning electron microscopy (SEM, transmission electron microscopy (TEM, contact angle measurement, attenuated total reflection Fourier transform infrared (ATR FT-IR spectroscopy, and salt rejection and water flux assessments. Results showed that both UiO-66 and MIL-125 could improve the membranes’ performance and the impacts depended on the NPs loading. At the optimum NPs loadings, 0.15% for UiO-66 and 0.3% for MIL-125, the water flux increased from 62.5 L/m2 h to 74.9 and 85.0 L/m2 h, respectively. NaCl rejection was not significantly affected (UiO-66 or slightly improved (MIL-125 by embedding these NPs, always at >98.5% as tested at 2000 ppm salt concentration and 300 psi transmembrane pressure. The results from this study demonstrate that it is promising to apply MOFs NPs to enhance the TFC membrane performance for desalination.

  2. One ID Card for the Entire Campus.

    Science.gov (United States)

    Ridenour, David P.; Ferguson, Linda M.

    1986-01-01

    The implementation by Indiana State University of a machine-readable photo ID system for their food services prompted an investigation into the available alternatives and requirements for a more efficient all-University ID card system. The new ID system is described. (AUTHOR/MLW)

  3. Direct observations of the MOF (UiO-66) structure by transmission electron microscopy

    KAUST Repository

    Zhu, Liangkui

    2013-01-01

    As a demonstration of ab initio structure characterizations of nano metal organic framework (MOF) crystals by high resolution transmission electron microscopy (HRTEM) and electron diffraction tomography methods, a Zr-MOF (UiO-66) structure was determined and further confirmed by Rietveld refinements of powder X-ray diffraction. HRTEM gave direct imaging of the channels. © 2013 The Royal Society of Chemistry.

  4. Journal of Language, Technology & Entrepreneurship in Africa ...

    African Journals Online (AJOL)

    ... the Editor at firaki@usiu.ac.ke as email attachment for consideration at any time. ... The journal is a property of the United States International University. ... Use double quotation marks for short quotes but place longer quotes in an indented

  5. Id-1 and Id-2 genes and products as therapeutic targets for treatment of breast cancer and other types of carcinoma

    Science.gov (United States)

    Desprez, Pierre-Yves; Campisi, Judith

    2014-09-30

    A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 6; Issue 7. Life and Work of Kurt Gödel – A Brief Sketch. S M Srivastava. Article-in-a-Box Volume 6 Issue 7 July 2001 pp 2-3. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/006/07/0002-0003 ...

  7. Fabrication of core-shell MIL-101(Cr)@UiO-66(Zr) nanocrystals for hydrogen storage

    CSIR Research Space (South Africa)

    Ren, Jianwei

    2014-09-01

    Full Text Available of the individual metal-organic framework (MOF) components and the coreeshell hybrid crystals were also characterized. The hydrogen storage capacity exhibited by the resulting core eshell nanocrystals was 26% and 60% higher than those of pure phase MIL-101 and Ui...

  8. Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

    Science.gov (United States)

    Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

    2015-10-01

    Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  9. jQuery UI 1.10 the user interface library for jQuery

    CERN Document Server

    Libby, Alex

    2013-01-01

    This book consists of an easy-to-follow, example-based approach that leads you step-by-step through the implementation and customization of each library component.This book is for frontend designers and developers who need to learn how to use jQuery UI quickly. To get the most out of this book, you should have a good working knowledge of HTML, CSS, and JavaScript, and should ideally be comfortable using jQuery.

  10. RETRACTED: Relationship between the ACE I/D gene polymorphism and T1DN susceptibility/risk of T1DM developing into T1DN in the Caucasian population.

    Science.gov (United States)

    Zhou, Tian-Biao; Guo, Xue-Feng; Jiang, Zongpei; Li, Hong-Yan

    2015-12-01

    The following article has been included in a multiple retraction: Tian-Biao Zhou, Xue-Feng Guo, Zongpei Jiang, and Hong-Yan Li Relationship between the ACE I/D gene polymorphism and T1DN susceptibility/risk of T1DM developing into T1DN in the Caucasian population Journal of Renin-Angiotensin-Aldosterone System 1470320314563425, first published on February 1, 2015 doi: 10.1177/1470320314563425 This article has been retracted at the request of the Editors and the Publisher. After conducting a thorough investigation, SAGE found that the submitting authors of a number of papers published in the Journal of the Renin-Angiotensin Aldosterone System ( JRAAS) (listed below) had supplied fabricated contact details for their nominated reviewers. The Editors accepted these papers based on the reports supplied by the individuals using these fake reviewer email accounts. After concluding that the peer review process was therefore seriously compromised, SAGE and the journal Editors have decided to retract all affected articles. Online First articles (these articles will not be published in an issue) Wenzhuang Tang, Tian-Biao Zhou, and Zongpei Jiang Association of the angiotensinogen M235T gene polymorphism with risk of diabetes mellitus developing into diabetic nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563426, first published on December 18, 2014 doi: 10.1177/1470320314563426 Tian-Biao Zhou, Hong-Yan Li, Zong-Pei Jiang, Jia-Fan Zhou, Miao-Fang Huang, and Zhi-Yang Zhou Role of renin-angiotensin-aldosterone system inhibitors in radiation nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563424, first published on December 18, 2014 doi: 10.1177/1470320314563424 Weiqiang Zhong, Zongpei Jiang, and Tian-Biao Zhou Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population Journal of Renin-Angiotensin-Aldosterone System 1470320314566019, first published on January

  11. 75 FR 22630 - Vital Signs Minnesota, Inc., Including Workers Whose Unemployment Insurance (UI) Wages Are Paid...

    Science.gov (United States)

    2010-04-29

    ... Dynamics Corporation, including on-site leased workers of Masterson Personnel and MRCI Workforce..., Inc., Including Workers Whose Unemployment Insurance (UI) Wages Are Paid Through Biomedical Dynamics... Biomedical Dynamics Corporation. Accordingly, the Department is amending this certification to property...

  12. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Since January 2016, the Journal of Astrophysics and Astronomy has moved to Continuous Article Publishing (CAP) mode. This means that each accepted article is being published immediately online with DOI and article citation ID with starting page number 1. Articles are also visible in Web of Science immediately.

  13. Final PHP bench-scale report for the DOE-ID/SAIC sole source contract

    International Nuclear Information System (INIS)

    1997-04-01

    The Plasma Hearth Process (PHP) Technology Development Project was established to develop, test, and evaluate a new concept for treating mixed waste. The new concept uses direct current (dc) transferred-arc plasma torch technology to process mixed waste into a glass-like end-product. Under the cognizance of the US Department of Energy (DOE) Office of Technology Development (OTD) Mixed Waste Focus Area (MWFA), the technology is being explored for its potential to treat mixed waste. Because it is a mature technology, well-understood and commercially available, it is expected to develop rapidly in this new application. This report summarizes the radioactive bench-scale system activities funded under PHP Sole Source Contract DE-AC07-94ID13266 through the end of the contract

  14. The Antibody Response of Pregnant Cameroonian Women to VAR2CSA ID1-ID2a, a Small Recombinant Protein Containing the CSA-Binding Site

    Science.gov (United States)

    Babakhanyan, Anna; Leke, Rose G. F.; Salanti, Ali; Bobbili, Naveen; Gwanmesia, Philomina; Leke, Robert J. I.; Quakyi, Isabella A.; Chen, John J.; Taylor, Diane Wallace

    2014-01-01

    In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8–9% of males had antibodies to full-length VAR2CSA, but 90–96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a. PMID:24505415

  15. The antibody response of pregnant Cameroonian women to VAR2CSA ID1-ID2a, a small recombinant protein containing the CSA-binding site.

    Directory of Open Access Journals (Sweden)

    Anna Babakhanyan

    Full Text Available In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8-9% of males had antibodies to full-length VAR2CSA, but 90-96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a.

  16. AcEST: DK954673 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rEMBL tr_hit_id Q1L0Q7 Definition tr|Q1L0Q7|Q1L0Q7_BOEDR At3g12490-like protein OS=Boechera drummondii Align... producing significant alignments: (bits) Value tr|Q1L0Q7|Q1L0Q7_BOEDR At3g12490-like protein OS=Boechera drummo...3g12490-like protein OS=Boechera drummondii PE=4 SV=1 Length = 231 Score = 188 bits (477), Expect = 3e-46 Id

  17. Evaluation of ID-PaGIA syphilis antibody test.

    Science.gov (United States)

    Naaber, Paul; Makoid, Ene; Aus, Anneli; Loivukene, Krista; Poder, Airi

    2009-01-01

    Laboratory diagnosis of syphilis is usually accomplished by serology. There are currently a large number of different commercial treponemal tests available that vary in format, sensitivity and specificity. To evaluate the ID-PaGIA Syphilis Antibody Test as an alternative to other specific treponemal tests for primary screening or confirmation of diagnosis. Serum samples from healthy adults (n = 100) were used for detection of specificity of ID-PaGIA. To evaluate sensitivity of ID-PaGIA serum samples (n = 101) from patients with confirmed or suspected syphilis were tested for syphilis antibodies with FTA-Abs IgM, ID-PaGIA, ELISA IgM and TPHA tests. No false-positive results were found with ID-PaGIA. Sensitivity of various treponemal tests was the following: FTA-Abs IgM: 95.5%, ID-PaGIA and ELISA IgM: 94%, and TPHA 75%. The positive and negative predictive values of ID-PaGIA were 100 and 89.5%, respectively. Compared with other treponemal tests ID-PaGIA has excellent sensitivity and specificity.

  18. The Academic English Language Needs of Industrial Design Students in UiTM Kedah, Malaysia

    Science.gov (United States)

    Adzmi, Nor Aslah; Bidin, Samsiah; Ibrahim, Syazliyati; Jusoff, Kamaruzaman

    2009-01-01

    The purpose of this study was to analyse the academic English language lacks and needs of Industrial Design students in Universiti Teknologi MARA Kedah (UiTM). It highlights the lacks and needs for English for Academic Purposes in helping the students to succeed in the program through the usage of English language. The research tools used were in…

  19. RETRACTED: Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population.

    Science.gov (United States)

    Zhong, Weiqiang; Jiang, Zongpei; Zhou, Tian-Biao

    2015-12-01

    This article has been included in a multiple retraction: Weiqiang Zhong, Zongpei Jiang, and Tian-Biao Zhou Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population Journal of Renin-Angiotensin-Aldosterone System 1470320314566019, first published on January 26, 2015 doi: 10.1177/1470320314566019 This article has been retracted at the request of the Editors and the Publisher. After conducting a thorough investigation, SAGE found that the submitting authors of a number of papers published in the Journal of the Renin-Angiotensin Aldosterone System ( JRAAS) (listed below) had supplied fabricated contact details for their nominated reviewers. The Editors accepted these papers based on the reports supplied by the individuals using these fake reviewer email accounts. After concluding that the peer review process was therefore seriously compromised, SAGE and the journal Editors have decided to retract all affected articles. Online First articles (these articles will not be published in an issue) Wenzhuang Tang, Tian-Biao Zhou, and Zongpei Jiang Association of the angiotensinogen M235T gene polymorphism with risk of diabetes mellitus developing into diabetic nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563426, first published on December 18, 2014 doi: 10.1177/1470320314563426 Tian-Biao Zhou, Hong-Yan Li, Zong-Pei Jiang, Jia-Fan Zhou, Miao-Fang Huang, and Zhi-Yang Zhou Role of renin-angiotensin-aldosterone system inhibitors in radiation nephropathy Journal of Renin-Angiotensin-Aldosterone System 1470320314563424, first published on December 18, 2014 doi: 10.1177/1470320314563424 Weiqiang Zhong, Zongpei Jiang, and Tian-Biao Zhou Association between the ACE I/D gene polymorphism and T2DN susceptibility: The risk of T2DM developing into T2DN in the Asian population Journal of Renin-Angiotensin-Aldosterone System 1470320314566019, first published on January 26, 2015 doi: 10

  20. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... Since January 2016, the Journal of Astrophysics and Astronomy has moved to Continuous Article Publishing (CAP) mode. This means that each accepted article is being published immediately online with DOI and article citation ID with starting page number 1. Articles are also visible in Web of Science ...

  1. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  2. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  3. AcEST: DK953406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK953406 CL390Contig1 Show DK953406 Clone id TST39A01NGRL0017_K24 Library TST39 Length 5...83 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_K24. 5' end sequence. Accession DK953406...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK953406...ids Res. 25:3389-3402. Query= DK953406|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0017_K24, 5' (583

  4. AcEST: BP917373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

  5. Aterosclerosis subclínica y perfil metabólico en mujeres asintomáticas de edad media, con TSH ≥ 2,5 uUI/mL

    Directory of Open Access Journals (Sweden)

    Rosa M. Pando-Álvarez

    2012-04-01

    Full Text Available El hipotiroidismo subclínico puede contribuir al desarrollo de patologías cardiovasculares y se ha demostrado que a partir de niveles de TSH >2,5uUI/mL se desarrolla disfunción endotelial. Objetivos: Determinar el grosor de la íntima media carotídea (GIMC, la presencia de placas en carótidas y el perfil metabólico en mujeres de edad media asintomáticas con TSH ≥2,5 uUI/mL y compararlas con aquellas con niveles <2,5 uUI/mL. Diseño: Estudio transversal y analítico. Lugar: Hospital Nacional Dos de Mayo e Instituto de Investigaciones Clínicas, Universidad Nacional Mayor de San Marcos, Lima, Perú. Participantes: Mujeres sin historia de enfermedad tiroidea, cardiovascular o diabetes. Intervenciones: En 60 mujeres sin historia de enfermedad tiroidea, cardiovascular o diabetes, con edad promedio de 53,8 ± 5,8 años, se determinó la tirotropina (TSH, colesterol total (CT, colesterol de densidad alta (HDL, triglicéridos (Tg, glucosa (G basal y a los 120 minutos (TTGO, insulina basal (Ins-B; se calculó las fracciones de colesterol de densidad baja (LDL, el nivel de insulinorresistencia (HOMA-IR, la presión arterial, perímetro de cintura abdominal, el índice de masa corporal (IMC y el GIMC mediante ecoDoppler. Principales medidas de resultados: TSH ≥2,5 uUI/mL, perfil metabólico y su relación con GIMC. Resultados: El 38,3% presentó TSH ≥2,5 y 61,7% TSH <2,5 uUI/mL. El 56% de mujeres con TSH ≥2,5 y 65% con TSH <2,5 uUI/ml fueron hipertensas, sin diferencia estadística. El perfil lipídico, G basal, Ins-B e índice HOMA-IR fueron semejantes en ambos grupos. Se observó niveles significativamente más altos del IMC, G a los 120 minutos, el GIMC en carótida izquierda y el mayor entre ambas carótidas en las mujeres con TSH ≥2,5 uUI/mL (p=0,03, p=0,01, p=0,008 y p=0,02, respectivamente. La presencia de placas en la carótida izquierda y en al menos una de las carótidas fue significativamente más frecuente entre aquellas con

  6. AC Initiation System.

    Science.gov (United States)

    An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)

  7. Role of Modulators in Controlling the Colloidal Stability and Polydispersity of the UiO-66 Metal–Organic Framework

    Energy Technology Data Exchange (ETDEWEB)

    Morris, William; Wang, Shunzhi; Cho, David; Auyeung, Evelyn; Li, Peng; Farha, Omar K.; Mirkin, Chad A. (King Abdulaziz); (NWU)

    2017-04-07

    Nanoscale UiO-66 Zr6(OH)4O4(C8O4H4)6 has been synthesized with a series of carboxylic acid modulators, R-COOH (where R = H, CH3, CF3, and CHCl2). The phase purity and size of each MOF was confirmed by powder X-ray diffraction, BET surface area analysis, and scanning transmission electron microscopy (STEM). Size control of UiO-66 crystals from 20 nm to over 1 μm was achieved, and confirmed by STEM. The colloidal stability of each MOF was evaluated by dynamic light scattering and was found to be highly dependent on the modulator conditions utilized in the synthesis, with both lower pKa and higher acid concentration resulting in more stable structures. Furthermore, STEM was carried out on both colloidally stable samples and those that exhibited a large degree of aggregation, which allowed for visualization of the different degrees of dispersion of the samples. The use of modulators at higher concentrations and with lower pKas leads to the formation of more defects, as a consequence of terephthalic acid ligands being replaced by modulator molecules, thereby enhancing the colloidal stability of the UiO-66 nanoparticles. These findings could have a significant impact on nanoscale MOF material syntheses and applications, especially in the areas of catalysis and drug delivery.

  8. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    All correspondence regarding subscription within India should be addressed to the Circulation Department, Indian Academy of Sciences, at the address below, or by e-mail to orders@ias.ac.in. See the Academy journals page for the latest subscription information (PDF file) and 2018 subscription prices (Library, Personal).

  9. AcEST: [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2194Contig1 771 2 Adiantum capillus-veneris contig: CL2194contig1 sequence. Link to clone list...apillus-veneris contig: CL2194contig1 sequence. Link to clone list Link to clone list Clone ID BP915172 DK95

  10. Identification of Staphylococcus species and subspecies with the MicroScan Pos ID and Rapid Pos ID panel systems.

    Science.gov (United States)

    Kloos, W E; George, C G

    1991-01-01

    The accuracies of the MicroScan Pos ID and Rapid Pos ID panel systems (Baxter Diagnostic Inc., MicroScan Division, West Sacramento, Calif.) were compared with each other and with the accuracies of conventional methods for the identification of 25 Staphylococcus species and 4 subspecies. Conventional methods included those used in the original descriptions of species and subspecies and DNA-DNA hybridization. The Pos ID panel uses a battery of 18 tests, and the Rapid Pos ID panel uses a battery of 42 tests for the identification of Staphylococcus species. The Pos ID panel has modified conventional and chromogenic tests that can be read after 15 to 48 h of incubation; the Rapid Pos ID panel has tests that use fluorogenic substrates or fluorometric indicators, and test results can be read after 2 h of incubation in the autoSCAN-W/A. Results indicated that both MicroScan systems had a high degree of congruence (greater than or equal to 90%) with conventional methods for the species S. capitis, S. aureus, S. auricularis, S. saprophyticus, S. cohnii, S. arlettae, S. carnosus, S. lentus, and S. sciuri and, in particular, the subspecies S. capitis subsp. capitis and S. cohnii subsp. cohnii. The Rapid Pos ID panel system also had greater than or equal to 90% congruence with conventional methods for S. epidermidis, S. caprae, S. warneri subsp. 2, S. xylosus, S. kloosii, and S. caseolyticus. For both MicroScan systems, congruence with conventional methods was 80 to 90% for S. haemolyticus subsp. 1, S. equorum, S. intermedius, and S. hyicus; and in addition, with the Rapid Pos ID panel system congruence was 80 to 89% for S. capitis subsp. ureolyticus, S. warneri subsp. 1, S. hominis, S. cohnii subsp. urealyticum, and S. simulans. The MicroScan systems identified a lower percentage (50 to 75%) of strains of S. lugdunensis, S. gallinarum, S. schleiferi, and S. chromogenes, although the addition of specific tests to the systems might increase the accuracy of identification

  11. Image-receptor performance: a comparison of Trophy RVG UI sensor and Kodak Ektaspeed Plus film.

    Science.gov (United States)

    Ludlow, J; Mol, A

    2001-01-01

    Objective. This study compares the physical characteristics of the RVG UI sensor (RVG) with Ektaspeed Plus film. Dose-response curves were generated for film and for each of 6 available RVG modes. An aluminum step-wedge was used to evaluate exposure latitude. Spatial resolution was assessed by using a line-pair test tool. Latitude and resolution were assessed by observers for both modalities. The RVG was further characterized by its modulation transfer function. Exposure latitude was equal for film and RVG in the periodontal mode. Other gray scale modes demonstrated much lower latitude. The average maximum resolution was 15.3 line-pairs per millimeter (lp/mm) for RVG in high-resolution mode, 10.5 lp/mm for RVG in low-resolution mode, and 20 lp/mm for film (P <.0001). Modulation transfer function measurements supported the subjective assessments. In periodontal mode, the RVG UI sensor demonstrates exposure latitude similar to that of Ektaspeed Plus film. Film images exhibit significantly higher spatial resolution than the RVG images acquired in high-resolution mode.

  12. Study on ac losses of HTS coil carrying ac transport current

    International Nuclear Information System (INIS)

    Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan

    2005-01-01

    Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses

  13. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... Journal of Earth System Science; Volume 127; Issue 3. Pedotransfer functions to estimate soil water content at field capacity and permanent wilting point in hot Arid Western India. Priyabrata Santra Mahesh Kumar R N Kumawat D K Painuli K M Hati G B M Heuvelink N H Batjes. Volume 127 Issue 3 April 2018 Article ID 35 ...

  14. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  15. Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS

    CERN Document Server

    Piersa, Monika

    2016-01-01

    The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...

  16. AcEST: DK954065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5. 5' end sequence. DK954065 CL168Contig1 Show DK954065 Clone id TST39A01NGRL0019_H05 Library TST39 Length 6...25 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_H05. 5' end sequence. Accession DK95406... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK95406...ids Res. 25:3389-3402. Query= DK954065|Adiantum capillus-veneris mRNA, clone: TST39A01NGRL0019_H05, 5' (625 ...TST39A01NGRL0019_H05 625 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_H0

  17. AcEST: DK948015 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4. 5' end sequence. DK948015 CL1717Contig1 Show DK948015 Clone id TST38A01NGRL0002_C24 Library TST38 Length ...543 Definition Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_C24. 5' end sequence. Accession DK94801...ids Res. 25:3389-3402. Query= DK948015|Adiantum capillus-veneris mRNA, clone: TST38A01NGRL0002_C24, 5' (486 ...TST38A01NGRL0002_C24 543 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_C2...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  18. AcEST: DK947373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0015_K22 477 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0015_K2...2. 5' end sequence. DK947373 - Show DK947373 Clone id YMU02A01NGRL0015_K22 Library YMU02 Length 477 Definiti...on Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0015_K22. 5' end sequence. Accession DK947373 Tissue t...t (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id P17673 Definition sp|P17673...ams, Nucleic Acids Res. 25:3389-3402. Query= DK947373|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL001

  19. AOM reconciling of crystal field parameters for UCl 3, UBr 3, UI 3 series

    Science.gov (United States)

    Gajek, Z.; Mulak, J.

    1990-07-01

    Available inelastic neutron scattering interpretations of crystal field effect in the uranium trihalides have been verified in terms of Angular Overlap Model. For UCl 3 a good reconciling of both INS and optical interpretations of crystal field effect has been obtained. On the contrary, the parameterizations for UBr 3 and UI 3 were found to be highly artificial and suggestion is given to experimentalists to reinterpret their INS spectra.

  20. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  1. Therapeutic efficacy and toxicity of {sup 225}Ac-labelled vs. {sup 213}Bi-labelled tumour-homing peptides in a preclinical mouse model of peritoneal carcinomatosis

    Energy Technology Data Exchange (ETDEWEB)

    Essler, Markus; Gaertner, Florian C.; Blechert, Birgit; Senekowitsch-Schmidtke, Reingard; Seidl, Christof [Technische Universitaet Muenchen, Department of Nuclear Medicine, Munich (Germany); Neff, Frauke [Helmholtz Zentrum Muenchen, Institute of Pathology, Neuherberg (Germany); Bruchertseifer, Frank; Morgenstern, Alfred [Institute for Transuranium Elements, European Commission, Joint Research Centre, Karlsruhe (Germany)

    2012-04-15

    Targeted delivery of alpha-particle-emitting radionuclides is a promising novel option in cancer therapy. We generated stable conjugates of the vascular tumour-homing peptide F3 both with {sup 225}Ac and {sup 213}Bi that specifically bind to nucleolin on the surface of proliferating tumour cells. The aim of our study was to determine the therapeutic efficacy of {sup 225}Ac-DOTA-F3 in comparison with that of {sup 213}Bi-DTPA-F3. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were determined via clonogenic assays. The therapeutic efficacy of both constructs was assayed by repeated treatment of mice bearing intraperitoneal MDA-MB-435 xenograft tumours. Therapy was monitored by bioluminescence imaging. Nephrotoxic effects were analysed by histology. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were 53 kBq/ml and 67 Bq/ml, respectively. The median survival of control mice treated with phosphate-buffered saline was 60 days after intraperitoneal inoculation of 1 x 10{sup 7} MDA-MB-435 cells. Therapy with 6 x 1.85 kBq of {sup 225}Ac-DOTA-F3 or 6 x 1.85 MBq of {sup 213}Bi-DTPA-F3 prolonged median survival to 95 days and 97 days, respectively. While F3 labelled with short-lived {sup 213}Bi (t{sub 1/2} 46 min) reduced the tumour mass at early time-points up to 30 days after treatment, the antitumour effect of {sup 225}Ac-DOTA-F3 (t{sub 1/2} 10 days) increased at later time-points. The difference in the fraction of necrotic cells after treatment with {sup 225}Ac-DOTA-F3 (43%) and with {sup 213}Bi-DTPA-F3 (36%) was not significant. Though histological analysis of kidney samples revealed acute tubular necrosis and tubular oedema in 10-30% of animals after treatment with {sup 225}Ac-DOTA-F3 or {sup 213}Bi-DTPA-F3, protein casts were negligible (2%), indicating only minor damage to the kidney. Therapy with both {sup 225}Ac-DOTA-F3 and {sup 213}Bi-DTPA-F3 increased survival of mice with peritoneal carcinomatosis. Mild renal toxicity of both

  2. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB593 (Link to dictyBase) - - - Contig-U02438-1 VFB593E (Link...) Clone ID VFB593 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02438-1 Ori...0.009 6 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25...sequence. 46 0.031 2 AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 m...ap 4657875-4914984 strain AX4, complete sequence. 34 0.051 14 AC116960 |AC116960.2 Dictyostelium discoideum

  3. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  4. Expression of Id2 in the Second Heart Field and Cardiac Defects in Id2 Knock-Out Mice

    NARCIS (Netherlands)

    Jongbloed, M. R. M.; Vicente-Steijn, R.; Douglas, Y. L.; Wisse, L. J.; Mori, K.; Yokota, Y.; Bartelings, M. M.; Schalij, M. J.; Mahtab, E. A.; Poelmann, R. E.; Gittenberger-De Groot, A. C.

    2011-01-01

    The inhibitor of differentiation Id2 is expressed in mesoderm of the second heart field, which contributes myocardial and mesenchymal cells to the primary heart tube. The role of Id2 in cardiac development is insufficiently known. Heart development was studied in sequential developmental stages in

  5. AcEST: BP919785 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s-Prot sp_hit_id P09992 Definition sp|P09992|NCAP_LYCVA Nucleoprotein OS=Lymphocytic choriomeningitis virus ...riomeningit... 29 8.4 >sp|P09992|NCAP_LYCVA Nucleoprotein OS=Lymphocytic choriomeningitis

  6. Synnøve des Bouvries karriere ved UiT, 1972–2014: Intervju og bibliografi

    Directory of Open Access Journals (Sweden)

    Per Pippin Aspaas

    2014-11-01

    Full Text Available The career of Synnøve des Bouvrie at the University of Tromsø, 1972–2014: Interview and bibliography. Synnøve des Bouvrie was born in Bussum near Amsterdam on 16 November 1944 as the child of a Norwegian mother and a Dutch father. After studies of classical philology at Leiden, she became one of the first lecturers at the University of Tromsø (UiT in September 1972. A true pioneer, she has fought relentlessly for gender equality and the preservation of the so-called «small» languages at the UiT. Mastering ten languages altogether, Synnøve’s own research has always been internationally oriented. Applying an anthropological perspective on the ancient societies, she has also studied the current study of ancient tragedies from a similar, detached perspective, by means of which she has been able to single out national trends and historical contingency in cutting-edge research. Moreover, this «rare bird in Ultima Thule» is a staunch advocate for the active use of Latin in teaching and research and a prominent member of the Academia Latinitati Fovendae. In Tromsø too, she has been active in another academy, the cross-disciplinary Academia Borealis, of which she is the serving president. Moreover, she has taught and helped establish courses in various subjects outside her field of specialty at the UiT, like a cross-disciplinary course on Graeco-Roman art, archaeology, literature and history (Antikkens kultur and comparative literature (Allmenn litteratur. The interview is highly personal, crammed with anecdotes from Synnøve’s private life and deliberations on how her upbringing may have influenced her choices as an academic. The bibliography lists her publications from 1972 to the present. In the interview she reveals that a monograph on Euripides can be expected to be published soon with an international publisher. In the appendix several illustrations are included, with captions in English.

  7. jQuery UI 1.7 the user interface library for jQuery

    CERN Document Server

    Wellman, Dan

    2009-01-01

    An example-based approach leads you step-by-step through the implementation and customization of each library component and its associated resources in turn. To emphasize the way that jQuery UI takes the difficulty out of user interface design and implementation, each chapter ends with a 'fun with' section that puts together what you've learned throughout the chapter to make a usable and fun page. In these sections you'll often get to experiment with the latest associated technologies like AJAX and JSON. This book is for front-end designers and developers who need to quickly learn how to use t

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB752 (Link to dictyBase) - - - Contig-U14717-1 VFB752E (Link...) Clone ID VFB752 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14717-1 Ori...s: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4,... complete sequence. 1215 0.0 11 AC115594 |AC115594.2 Dictyostelium discoideum chr...omosome 2 map 4071862-4101005 strain AX4, complete sequence. 113 3e-47 8 AC116920 |AC116920.2 Dictyostelium

  9. Pelvic floor muscle training is not effective in women with UI in pregnancy: a randomised controlled trial.

    NARCIS (Netherlands)

    Woldringh, C.; Wijngaart, M.A.G. van den; Albers-Heitner, P.; Lycklama á Nijeholt, A.A.B.; Lagro-Janssen, A.L.M.

    2007-01-01

    The objective of this study was to test the short- and long-term effects of pelvic floor muscle training (PFMT) during pregnancy in women at risk, i.e. women who were already affected by urinary incontinence (UI) during pregnancy. The intervention consisted of three sessions of PFMT between week 23

  10. Pelvic floor muscle training is not effective in women with UI in pregnancy: a randomised controlled trial

    NARCIS (Netherlands)

    Woldringh, C.; Wijngaart, M.A.G. van den; Albers-Heitner, P.; Lycklama á Nijeholt, A.A.B.; Lagro-Janssen, A.L.M.

    2007-01-01

    The objective of this study was to test the short- and long-term effects of pelvic floor muscle training (PFMT) during pregnancy in women at risk, i.e. women who were already affected by urinary incontinence (UI) during pregnancy. The intervention consisted of three sessions of PFMT between week 23

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    https://www.ias.ac.in/article/fulltext/reso/008/07/0022-0032. Keywords. Birds. nesting. territory; coloniality; heronries. ecology; nesting strategies. Author Affiliations. Abdul Jamil Urfi1. Department of Environmental Biology, School of Environmental Studies, University of Delhi, Delhi 110007. Resonance – Journal of Science ...

  12. Improvement of the ID model for quantitative network data

    DEFF Research Database (Denmark)

    Sørensen, Peter Borgen; Damgaard, Christian Frølund; Dupont, Yoko Luise

    2015-01-01

    Many interactions are often poorly registered or even unobserved in empirical quantitative networks. Hence, the output of the statistical analyses may fail to differentiate between patterns that are statistical artefacts and those which are real characteristics of ecological networks. Such artefa......Many interactions are often poorly registered or even unobserved in empirical quantitative networks. Hence, the output of the statistical analyses may fail to differentiate between patterns that are statistical artefacts and those which are real characteristics of ecological networks......)1. This presentation will illustrate the application of the ID method based on a data set which consists of counts of visits by 152 pollinator species to 16 plant species. The method is based on two definitions of the underlying probabilities for each combination of pollinator and plant species: (1), pi...... reproduce the high number of zero valued cells in the data set and mimic the sampling distribution. 1 Sørensen et al, Journal of Pollination Ecology, 6(18), 2011, pp129-139...

  13. ID2 mediates the transforming growth factor-β1-induced Warburg-like effect seen in the peritoneum of women with endometriosis.

    Science.gov (United States)

    Young, Vicky J; Ahmad, Syed F; Brown, Jeremy K; Duncan, W Colin; Horne, Andrew W

    2016-09-01

    Is inhibitor of DNA-binding protein 2 (ID2) a mediator of the transforming growth factor (TGF)-β1-induced Warburg-like effect seen in the peritoneum of women with endometriosis? The TGF-β1-induced changes in the metabolic phenotype of peritoneal mesothelial cells from women with endometriosis are mediated through the ID2 pathway. TGF-β1 induces the metabolic conversion of glucose to lactate via aerobic glycolysis (the 'Warburg effect') in the peritoneum of women with endometriosis, through increased expression of the transcription factor hypoxia inducible factor α (HIF-1α). ID proteins are transcriptional targets of TGF-β1. Expression of ID2 was investigated in luteal phase peritoneal biopsies from women with regular menstrual cycles, with and without endometriosis (n = 8-10 each group) by quantitative RT-PCR (qRT-PCR) and immunohistochemistry. ID2 mRNA expression in primary human peritoneal mesothelial cells (HPMC) and immortalized mesothelial cells (MeT-5A) was assessed by qRT-PCR (n = 6). The effects of TGF-β1 and ID2 siRNA on HIF-1α mRNA expression and lactate secretion was assessed using qRT-PCR and a colorimetric lactate assay. ID2 is localized to peritoneal mesothelial and stromal cells of women with and without endometriosis. ID2 mRNA expression is lower in peritoneum adjacent to the endometriosis lesions compared to distal sites (P endometriosis. None. This work was funded by a Wellbeing of Women research grant (R42533) awarded to A.W.H., J.K.B. and W.C.D.; and an MRC Centre Grant G1002033. V.J.Y. received grant support from Federation of Women Graduates (134225) and a PhD studentship from the College of Medicine and Veterinary Medicine at the University of Edinburgh. There are no competing interests to declare. © The Author 2016. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. AcEST: DK946187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast o...p. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  15. AcEST: BP920319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result ...: TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  16. AcEST: DK946589 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEM...BL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  17. AcEST: BP920622 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : ...TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  18. AcEST: BP920681 [AcEST

    Lifescience Database Archive (English)

    Full Text Available - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result :... TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  19. AcEST: BP916218 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ion - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (...No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  20. AcEST: BP919625 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL... (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  1. AcEST: BP921026 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEM...BL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  2. AcEST: BP912152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available efinition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : Tr...EMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  3. AcEST: BP916111 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast o...p. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  4. AcEST: DK946325 [AcEST

    Lifescience Database Archive (English)

    Full Text Available n length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast o...p. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  5. AcEST: DK945208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ion - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (...No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  6. AcEST: BP916863 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result... : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  7. AcEST: BP911605 [AcEST

    Lifescience Database Archive (English)

    Full Text Available finition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrE...MBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  8. Cyclin D1, Id1 and EMT in breast cancer

    International Nuclear Information System (INIS)

    Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran

    2011-01-01

    Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id

  9. FlowIDS

    OpenAIRE

    Sabolčák, Peter

    2006-01-01

    FlowIDS is system which can detect some of the undesirable traffi c in computer networks (undesirable traffic could be also ie. virus activity or overloading of network) and mostly doing counteraction which are set by administrator. Information about data ows are provided by hardware of network infrastructure, eliminitaion of undesirable activity is done through changes in network hardware settings. Regarding the quantity of solution which are provided on market, I decided to focus on Cisco n...

  10. C-QDs@UiO-66-(COOH)2 Composite Film via Electrophoretic Deposition for Temperature Sensing.

    Science.gov (United States)

    Feng, Ji-Fei; Gao, Shui-Ying; Shi, Jianlin; Liu, Tian-Fu; Cao, Rong

    2018-03-05

    Temperature plays a crucial role in both scientific research and industry. However, traditional temperature sensors, such as liquid-filled thermometers, thermocouples, and transistors, require contact to obtain heat equilibrium between the probe and the samples during the measurement. In addition, traditional temperature sensors have limitations when being used to detect the temperature change of fast-moving samples at smaller scales. Herein, the carbon quantum dots (C-QDs) functionalized metal-organic framework (MOF) composite film, a novel contactless solid optical thermometer, has been prepared via electrophoretic deposition (EPD). Instead of terephthalic acid (H 2 BDC), 1',2',4',5'-benzenetetracarboxylic (H 4 BTEC) acid was employed to construct a UiO-66 framework to present two uncoordinated carboxylic groups decorated on the pore surface. The uncoordinated carboxylic groups can generate negative charges, which facilitates the deposition of film on the positive electrode during the EPD process. Moreover, UiO-66-(COOH) 2 MOFs can absorb C-QDs from the solution and prevent C-QDs from aggregating, and the well-dispersed C-QDs impart fluorescence characteristics to composites. As-synthesized composite film was successfully used to detect temperature change in the range of 97-297 K with a relative sensitivity up to 1.3% K -1 at 297 K.

  11. An UI Layout Files Analyzer for Test Data Generation

    Directory of Open Access Journals (Sweden)

    Paul POCATILU

    2014-01-01

    Full Text Available Prevention actions (trainings, audits and inspections (tests, validations, code reviews are the crucial factors in achieving a high quality level for any software application simply because low investments in this area are leading to significant expenses in terms of corrective actions needed for defect fixing. Mobile applications testing involves the use of various tools and scenarios. An important process is represented by test data generation. This paper proposes a test data generator (TDG system for mobile applications using several sources for test data and it focuses on the UI layout files analyzer module. The proposed architecture aims to reduce time-to-market for mobile applications. The focus is on test data generators based on the source code, user interface layout files (using markup languages like XML or XAML and application specifications. In order to assure a common interface for test data generators, an XML or JSON-based language called Data Specification Language (DSL is proposed.

  12. AcEST: DK944976 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ot sp_hit_id Q65ZG0 Definition sp|Q65ZG0|GN_VZVD Glycoprotein N OS=Varicella-zoster virus (strain Dumas... OS=Varicella-zoster virus (strain Dumas) GN=GN PE=3 SV=1 Length = 87 Score = 28.

  13. AcEST: BP918019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

  14. Impedance and ac conductivity studies of Ba (Pr1/2Nb1/2) O3 ceramic

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 36; Issue 4. Impedance and a.c. conductivity studies of ... Abstract. Impedance and electrical conduction studies of Ba(Pr1/2Nb1/2)O3 ceramic prepared through conventional ceramic fabrication technique are presented. The crystal symmetry, space group and unit cell ...

  15. Aliénation et idéologie

    OpenAIRE

    Kanabus, Benoît; Popa, Délia

    2017-01-01

    Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...

  16. Mixed-linker UiO-66: structure-property relationships revealed by a combination of high-resolution powder X-ray diffraction and density functional theory calculations.

    Science.gov (United States)

    Taddei, Marco; Tiana, Davide; Casati, Nicola; van Bokhoven, Jeroen A; Smit, Berend; Ranocchiari, Marco

    2017-01-04

    The use of mixed-linker metal-organic frameworks (MIXMOFs) is one of the most effective strategies to modulate the physical-chemical properties of MOFs without affecting the overall crystal structure. In many instances, MIXMOFs have been recognized as solid solutions, with random distribution of ligands, in agreement with the empirical rule known as Vegard's law. In this work, we have undertaken a study combining high-resolution powder X-ray diffraction (HR-PXRD) and density functional theory (DFT) calculations with the aim of understanding the reasons why UiO-66-based amino- and bromo-functionalized MIXMOFs (MIXUiO-66) undergo cell expansion obeying Vegard's law and how this behaviour is related to their physical-chemical properties. DFT calculations predict that the unit cell in amino-functionalized UiO-66 experiences only minor expansion as a result of steric effects, whereas major modification to the electronic features of the framework leads to weaker metal-linker interaction and consequently to the loss of stability at higher degrees of functionalization. For bromo-functionalized UiO-66, steric repulsion due to the size of bromine yields a large cell expansion, but the electronic features remain very similar to pristine UiO-66, preserving the stability of the framework upon functionalization. MIXUiO-66 obtained by either direct synthesis or by post-synthetic exchange shows Vegard-like behaviour, suggesting that both preparation methods yield solid solutions, but the thermal stability and the textural properties of the post-synthetic exchanged materials do not display a clear dependence on the chemical composition, as observed for the MOFs obtained by direct synthesis.

  17. ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma

    International Nuclear Information System (INIS)

    Phi, Ji Hoon; Choi, Seung Ah; Lim, Sang-Hee; Lee, Joongyub; Wang, Kyu-Chang; Park, Sung-Hye; Kim, Seung-Ki

    2013-01-01

    The inhibitor of differentiation (ID) genes have been implicated as promoters of tumor progression and metastasis in many human cancers. The current study investigated the expression and functional roles of ID genes in seeding and prognosis of medulloblastoma. ID gene expression was screened in human medulloblastoma tissues. Knockdown of ID3 gene was performed in medulloblastoma cells in vitro. The expression of metastasis-related genes after ID3 knockdown was assessed. The effect of ID3 knockdown on tumor seeding was observed in an animal model in vivo. The survival of medulloblastoma patients was plotted according to the ID3 expression levels. Significantly higher ID3 expression was observed in medulloblastoma with cerebrospinal fluid seeding than tumors without seeding. Knockdown of ID3 decreased proliferation, increased apoptosis, and suppressed the migration of D283 medulloblastoma cells in vitro. In a seeding model of medulloblastoma, ID3 knockdown in vivo with shRNA inhibited the growth of primary tumors, prevented the development of leptomeningeal seeding, and prolonged animal survival. High ID3 expression was associated with shorter survival of medulloblastoma patients, especially in Group 4 medulloblastomas. High ID3 expression is associated with medullolbastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors. ID3 may represent the metastatic/ aggressive phenotype of a subgroup of medulloblastoma

  18. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  19. ID-pilet teeb Tallinnas võidukäiku / Anneli Lepp

    Index Scriptorium Estoniae

    Lepp, Anneli

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 12. jaan. lk 3. Tallinna transpordiameti peaökonomisti Mart Moosuse sõnul moodustas ID-pilet 60,7% ühistranspordi piletituludest, Tartus oli vastav näitaja aga alla 1%. Tartut teenindava bussifirma AS Connex Eesti finantsjuht Tiina Telling peab suure erinevuse põhjuseks asjaolu, et Tallinnas on ID-pilet paberpiletist 40-88% soodsam, Tartus hinnavahe aga puudub või on lausa negatiivne ID-pileti kahjuks. Lisa: ID-pilet

  20. PERSONAL BRANDING PRABOWO SUBIANTO (ANALISIS ISI KUANTITATIF PERSONAL BRANDING PRABOWO SUBIANTO DI SITUS BERITA ONLINE REPUBLIKA.CO.ID DAN TEMPO.CO.ID TANGGAL 9 JUNI - 9 JULI 2014

    Directory of Open Access Journals (Sweden)

    Hendro Agus Prakoso

    2016-09-01

    berita kedua media tersebut. Frekuensi berita berjumlah 107 di Republika.co.id dan 51 berita di Tempo.co.id Ragam berita Republika.co.id didominasi konsep Spesialisasi sebesar 22,4% dari 107 berita, sedangkan pada Tempo.co.id didominasi konsep Nama baik sebesar 23,5% dari 51 berita. Sumber berita pada Republika.co.id mayoritas berasal dari Liputan langsung sebesar 42,9% dari 107 berita sedangkan pada Tempo.co.id mayoritas berasal dari Intelektual sebesar 54,9% dari 51 berita.

  1. AcEST: DK962030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ot sp_hit_id Q6XNL5 Definition sp|Q6XNL5|RDRP_MRNV RNA-directed RNA polymerase OS=Macrobrachium rosenbergii ...ge factor 6 O... 30 8.9 >sp|Q6XNL5|RDRP_MRNV RNA-directed RNA polymerase OS=Macrobrachium rosenberg

  2. AcEST: BP920733 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TrEMBL tr_hit_id B8CKP7 Definition tr|B8CKP7|B8CKP7_9GAMM Putative uncharacterized protein OS=Shewanella piezo...B8CKP7|B8CKP7_9GAMM Putative uncharacterized protein OS=Shewanella piezotolerans

  3. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB886 (Link to dictyBase) - - - Contig-U16382-1 VFB886E (Link...) Clone ID VFB886 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...t alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 2234 0.0 1 AC116957 |AC116957.2 Dict...4, complete sequence. 2107 0.0 3 M14146 |M14146.1 D.discoideum actin 15 gene, complete cds. 2034 0.0 1 AC115579 |AC115579.2 Dict...4 0.0 2 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25

  5. Epigenetic inactivation of inhibitor of differentiation 4 (Id4) correlates with prostate cancer

    International Nuclear Information System (INIS)

    Sharma, Pankaj; Chinaranagari, Swathi; Patel, Divya; Carey, Jason; Chaudhary, Jaideep

    2012-01-01

    The inhibitor of DNA-binding (Id) proteins, Id1–4 are negative regulators of basic helix-loop-helix (bHLH) transcription factors. As key regulators of cell cycle and differentiation, expression of Id proteins are increasingly observed in many cancers and associated with aggressiveness of the disease. Of all the four Id proteins, the expression of Id1, Id2, and to a lesser extent, Id3 in prostate cancer and the underlying molecular mechanism is relatively well known. On the contrary, our previous results demonstrated that Id4 acts as a potential tumor suppressor in prostate cancer. In the present study, we extend these observations and demonstrate that Id4 is down-regulated in prostate cancer due to promoter hypermethylation. We used prostate cancer tissue microarrays to investigate Id4 expression. Methylation specific PCR on bisulfite treated DNA was used to determine methylation status of Id4 promoter in laser capture micro-dissected normal, stroma and prostate cancer regions. High Id4 expression was observed in the normal prostate epithelial cells. In prostate cancer, a stage-dependent decrease in Id4 expression was observed with majority of high grade cancers showing no Id4 expression. Furthermore, Id4 expression progressively decreased in prostate cancer cell line LNCaP and with no expression in androgen-insensitive LNCaP-C81 cell line. Conversely, Id4 promoter hypermethylation increased in LNCaP-C81 cells suggesting epigenetic silencing. In prostate cancer samples, loss of Id4 expression was also associated with promoter hypermethylation. Our results demonstrate loss of Id4 expression in prostate cancer due to promoter hypermethylation. The data strongly support the role of Id4 as a tumor suppressor

  6. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer

    Directory of Open Access Journals (Sweden)

    Phuc Thinh Doan

    2013-06-01

    Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43

  7. AcEST: BP913968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp_hit_id P09311 Definition sp|P09311|US10_VZVD Genes 64/69 protein OS=Varicella-zoster virus (strain Dumas...1.6 OS=C... 30 8.2 >sp|P09311|US10_VZVD Genes 64/69 protein OS=Varicella-zoster virus (strain Dumas

  8. AcEST: BP914624 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t_id B2AIZ9 Definition tr|B2AIZ9|B2AIZ9_CUPTR Fused transposase IS66/IS21 OS=Cupriavidus taiwanensis (strain...Z9|B2AIZ9_CUPTR Fused transposase IS66/IS21 OS=Cupriavidus taiwanensis (strain R1

  9. Comparison of Perinatal Risk Factors Associated with Autism Spectrum Disorder (ASD), Intellectual Disability (ID), and Co-Occurring ASD and ID

    Science.gov (United States)

    Schieve, Laura A.; Clayton, Heather B.; Durkin, Maureen S.; Wingate, Martha S.; Drews-Botsch, Carolyn

    2015-01-01

    While studies report associations between perinatal outcomes and both autism spectrum disorder (ASD) and intellectual disability (ID), there has been little study of ASD with versus without co-occurring ID. We compared perinatal risk factors among 7547 children in the 2006-2010 Autism and Developmental Disability Monitoring Network classified as…

  10. Achieving Payoffs from an Industry Cloud Ecosystem at BankID

    DEFF Research Database (Denmark)

    Eaton, Ben; Hallingby, Hanne Kristine; Nesse, Per-Jonny

    2014-01-01

    BankID is an industry cloud owned by Norwegian banks. It provides electronic identity, authentication and electronic signing capabilities for banking, merchant and government services. More than 60% of the population uses BankID services. As the broader ecosystem around BankID evolved, challenges......—arising from tensions between different parts of the ecosystem—had to be resolved. The four lessons learned from the BankID case will help others to build an industry cloud and establish a healthy ecosystem to service a broad user base....

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB585 (Link to dictyBase) - - - Contig-U09875-1 VFB585Z (Link... to Original site) - - VFB585Z 664 - - - - Show VFB585 Library VF (Link to library) Clone ID VFB585 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09875-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N AC116551 |AC116551.2 Dictyostelium discoi...ces producing significant alignments: (bits) Value AC116551_43( AC116551 |pid:none) Dictyostelium discoideum

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB668 (Link to dictyBase) - G00394 DDB0168247 Contig-U09555-1...brary) Clone ID VFB668 (Link to dictyBase) Atlas ID - NBRP ID G00394 dictyBase ID DDB0168247 Link to Contig ...Contig-U09555-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...uences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dictyostelium discoideum chromo...tein Score E Sequences producing significant alignments: (bits) Value AC117076_25

  13. AcEST: DK962942 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Swiss-Prot sp_hit_id P09287 Definition sp|P09287|UL25_VZVD Virion gene 34 protein OS=Varicella-zoster virus (strain Dumas...in 47 O... 30 8.7 >sp|P09287|UL25_VZVD Virion gene 34 protein OS=Varicella-zoster virus (strain Dumas) GN=34

  14. IMI's CANCER-ID: Status of liquid biopsy standardization

    NARCIS (Netherlands)

    Pantel, Klaus; Terstappen, Leon W. M. M.; Baggiani, Barbara; Krahn, Thomas; Schlange, Thomas

    The CANCER-ID (www.cancer-id.eu) consortium was established in early 2015 with more than 30 partners as part of the Innovative Medicines Initiative (IMI), Europe's largest public-private partnership funded in equal parts by the European Union and the European Federation of Pharmaceutical Industries

  15. Security analysis for biometric data in ID documents

    NARCIS (Netherlands)

    Schimke, S.; Kiltz, S.; Vielhauer, C.; Kalker, A.A.C.M.

    2005-01-01

    In this paper we analyze chances and challenges with respect to the security of using biometrics in ID documents. We identify goals for ID documents, set by national and international authorities, and discuss the degree of security, which is obtainable with the inclusion of biometric into documents

  16. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  17. AcEST: DK956208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t_id B5JPY8 Definition tr|B5JPY8|B5JPY8_9BACT Helix-turn-helix domain protein OS=Verrucomicrobiae bacterium ...5JPY8_9BACT Helix-turn-helix domain protein OS=Verrucomicrobiae bacterium DG1235 GN=VDG1235_3181 PE=4 SV=1 L

  18. 新媒体在科技期刊广告经营中的运用——以《暖通空调》为例%Application of new media in the advertising operation of sci-tech journals: taking Journal of HV & AC as a case

    Institute of Scientific and Technical Information of China (English)

    姜燕梅; 郭晓芳; 王曙明; 刘承军; 陈鑫

    2012-01-01

    Based on the advertising operation experience of Journal of HV & AC, this paper presents in detail the application of new media such as mobile phone messages, websites, microblogs and so on in the advertising operation of sci-tech journals.%以《暖通空调》为例,结合广告经营实践经验,介绍手机短信、网站、微博等新媒体形式在科技期刊广告经营中的运用。

  19. A brief review of revocable ID-based public key cryptosystem

    Directory of Open Access Journals (Sweden)

    Tsu-Yang Wu

    2016-03-01

    Full Text Available The design of ID-based cryptography has received much attention from researchers. However, how to revoke the misbehaviour/compromised user in ID-based public key cryptosystem becomes an important research issue. Recently, Tseng and Tsai proposed a novel public key cryptosystem called revocable ID-based public key cryptosystem (RIBE to solve the revocation problem. Later on, numerous research papers based on the Tseng-Tsai key RIBE were proposed. In this paper, we brief review Tseng and Tsai's RIBE. We hope this review can help the readers to understand the Tseng and Tsai's revocable ID-based public key cryptosystem.

  20. AcEST: BP911540 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Result : TrEMBL tr_hit_id Q2VJ73 Definition tr|Q2VJ73|Q2VJ73_9ENTR Zeaxanthin glucosyl transferase OS=Enterobacteriaceae...r|Q2VJ73|Q2VJ73_9ENTR Zeaxanthin glucosyl transferase OS=Enterobacteriaceae bacterium DC416 GN=crtX PE=4 SV=

  1. AcEST: DK949530 [AcEST

    Lifescience Database Archive (English)

    Full Text Available L + R+ID G Sbjct: 451 PRTRFGAFARGAKVVLYTKKSGAHLRIIDGG 481 >sp|Q9NQ79|CRAC1_HUMAN Cartilage acidic protein 1 OS=Homo sapiens GN=CRTAC1...ovel protein similar to H.sapiens CRTAC1... 146 1e-33 tr|B6MKC0|B6MKC0_BRAFL Putative uncharacterized protei

  2. AcEST: DK959440 [AcEST

    Lifescience Database Archive (English)

    Full Text Available : Swiss-Prot sp_hit_id O13798 Definition sp|O13798|CID16_SCHPO Caffeine-induced p...uences producing significant alignments: (bits) Value sp|O13798|CID16_SCHPO Caffeine...nucleotidase surE OS=Janthinobacterium s... 29 8.2 >sp|O13798|CID16_SCHPO Caffeine-induced protein 16 OS=Sch

  3. Id1 represses osteoclast-dependent transcription and affects bone formation and hematopoiesis.

    Directory of Open Access Journals (Sweden)

    April S Chan

    2009-11-01

    Full Text Available The bone-bone marrow interface is an area of the bone marrow microenvironment in which both bone remodeling cells, osteoblasts and osteoclasts, and hematopoietic cells are anatomically juxtaposed. The close proximity of these cells naturally suggests that they interact with one another, but these interactions are just beginning to be characterized.An Id1(-/- mouse model was used to assess the role of Id1 in the bone marrow microenvironment. Micro-computed tomography and fracture tests showed that Id1(-/- mice have reduced bone mass and increased bone fragility, consistent with an osteoporotic phenotype. Osteoclastogenesis and pit formation assays revealed that loss of Id1 increased osteoclast differentiation and resorption activity, both in vivo and in vitro, suggesting a cell autonomous role for Id1 as a negative regulator of osteoclast differentiation. Examination by flow cytometry of the hematopoietic compartment of Id1(-/- mice showed an increase in myeloid differentiation. Additionally, we found increased expression of osteoclast genes, TRAP, Oscar, and CTSK in the Id1(-/- bone marrow microenvironment. Lastly, transplantation of wild-type bone marrow into Id1(-/- mice repressed TRAP, Oscar, and CTSK expression and activity and rescued the hematopoietic and bone phenotype in these mice.In conclusion, we demonstrate an osteoporotic phenotype in Id1(-/- mice and a mechanism for Id1 transcriptional control of osteoclast-associated genes. Our results identify Id1 as a principal player responsible for the dynamic cross-talk between bone and bone marrow hematopoietic cells.

  4. At the Fulcrum of Air Force Identity: Balancing the Internal and External Pressures of Image and Culture

    Science.gov (United States)

    2010-06-01

    and Commitment and Their Relationships to Turnover Intention: Does Organizational Heirarchy Matter?‖ Journal of Organizational Behaviour 27, no. 5...For the practical consumer , John Balmer, Guillaume Soenen, and Stephen Greyser acted on this premise to produce the trademarked AC2ID test, focused...television advertising, following the trail the Army so famously blazed with its ―Be All You Can Be‖ jingle in 1981.50 Use of the medium of television

  5. La certificazione professionale I&D in Europa

    OpenAIRE

    Franco, Augusta

    2003-01-01

    The statement points out the activity of I&D European associations in the field of competences' certification, in ECIA federation's area as well as in the national one. In the statement there are references on history and outcomes of DECIDoc project; objectives and operative stages of CERTIDoc project, promoted by ECIA; and enterprises of I&D associations in France, Spain, Germany and Italy. Secondly, it is illustrated the activity of Italian librarians and archivists associatio...

  6. Low Offset AC Correlator.

    Science.gov (United States)

    This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)

  7. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  8. AcEST: DK945374 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Link to BlastX Result : TrEMBL tr_hit_id Q8HXU8 Definition tr|Q8HXU8|Q8HXU8_CABUN Alpha adrenergic receptor 2B (Fragment) OS=Cabasso...Alpha adrenergic receptor 2B (Fragment) OS=Cabassous unicinctus GN=adra2B PE=3 SV=1 Length = 383 Score = 32.

  9. AcEST: DK961770 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Gamma-enolase OS=Gallus gallus GN=ENO2 PE=2... 55 2e-09 sp|Q9W7L0|ENOA_PYTRG Alpha-enolase OS=Python regius...FEFFMD 79 E+ID A Y + +I +DVAA EF+ D Sbjct: 229 EAIDKAGYTDKIVIGMDVAASEFYRD 254 >sp|Q9W7L0|ENOA_PYTRG Alpha-enolase OS=Python

  10. AcEST: BP919890 [AcEST

    Lifescience Database Archive (English)

    Full Text Available r_hit_id A3U3S0 Definition tr|A3U3S0|A3U3S0_9RHOB Peptidoglycan binding protein, putative OS=Oceanicola bats...0_9RHOB Peptidoglycan binding protein, putative OS=Oceanicola batsensis HTCC2597 GN=OB2597_03684 PE=4 SV=1 L

  11. Dicty_cDB: CFH668 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH668 (Link to dictyBase) - - - Contig-U13860-1 - (Link to Or...iginal site) - - CFH668Z 651 - - - - Show CFH668 Library CF (Link to library) Clone ID CFH668 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13860-1 Original site URL http://dictycdb.b...s) Value N AC116987 |AC116987.2 Dictyostelium discoideum chromosome 2 map 3527441-3568052 strain AX4, comple...te sequence. 58 1e-11 6 AC116305 |AC116305.2 Dictyostelium discoideum chromosome

  12. Dicty_cDB: CHD534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD534 (Link to dictyBase) - - - Contig-U15540-1 CHD534E (Link...) Clone ID CHD534 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Ori...nts: (bits) Value N AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 ma...p 215673-367476 strain AX4, complete sequence. 40 1e-05 6 AC117081 |AC117081.2 Dictyostelium discoideum chro...mosome 2 map 5862124-6045772 strain AX4, complete sequence. 40 2e-05 5 AJ277590 |AJ277590.1 Dictyostelium di

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB614 (Link to dictyBase) - - - Contig-U16382-1 VFB614Z (Link... to Original site) - - VFB614Z 219 - - - - Show VFB614 Library VF (Link to library) Clone ID VFB614 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...ments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...tin mRNA ITL-1, 3' end. 339 9e-90 1 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-2

  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB606 (Link to dictyBase) - - - Contig-U16382-1 VFB606E (Link...) Clone ID VFB606 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ucing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 22...28 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2...2028 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4, comple

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC222 (Link to dictyBase) - - - Contig-U16046-1 VFC222Z (Link... to Original site) - - VFC222Z 339 - - - - Show VFC222 Library VF (Link to library) Clone ID VFC222 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16046-1 Original site URL http://dict...pdate 2002.12.15 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116989 |AC116989.2 Dict...etical LO... 88 8e-17 AC115592_28( AC115592 |pid:none) Dictyostelium discoideum c

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB703 (Link to dictyBase) - - - Contig-U14188-1 VFB703Z (Link... to Original site) - - VFB703Z 680 - - - - Show VFB703 Library VF (Link to library) Clone ID VFB703 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14188-1 Original site URL http://dict...ENCE, 18 unordered pieces. 36 0.038 5 AC115680 |AC115680.2 Dictyostelium discoideum chromosome 2 map 4415041...4-226K1, *** SEQUENCING IN PROGRESS ***, 52 unordered pieces. 46 0.31 5 AC116977 |AC116977.2 Dict

  18. Agallamh Oisín agus Phádraig: léamha ón bparaitéacs

    Directory of Open Access Journals (Sweden)

    Síle Ní Mhurchú

    2016-10-01

    Full Text Available San aiste seo, baintear úsáid as coincheap an pharaitéacs le Gérard Genette chun anailís a dhéanamh ar na cóipeanna lámhscríbhinne d’Agallamh Oisín agus Phádraig. Léiríonn na paraitéacsanna seo go raibh níos mó i gceist le saothar an scríobhaí ná cóipeáil: rinne mórán acu machnamh dian ar an ábhar a bhí á scríobh acu agus thugadar freagra ar ghluaiseachtaí stairiúla agus intleachtúla a bhí ag dul i bhfeidhm orthu ina gcuid scríbhinní paraitéacsúla. Féachtar ar na hathruithe a rinneadh ar chur i láthair na dtéacsanna le himeacht na mblianta agus ar na scríbhinní paraitéacsúla éagsúla — teidil, réamhráite, gluaiseanna, aistriúcháin, agus téacsanna eile nach iad — a cuireadh leis an Agallamh. Thug an paraitéacs spás do scríobhaithe inar fhéad siad dul i gcion ar phátrúin agus ar léitheoirí eile agus is iad seo a leanas na príomhthéamaí a eascraíonn ó anailís ar pharaitéacsanna an Agallaimh: cuntais na scríobhaithe ar cheird na scríbhneoireachta; athruithe i leagan amach na dtéacsanna faoi thionchar an chlóphreasa; an Béarla sa pharaitéacs; tagairtí do shaothar James Macpherson; meath na Gaeilge. Ar deireadh, fiafraítear an dtugann na scríbhinní paraitéacsúla léargas dúinn ar na mothúcháin a mhúscail an tAgallamh ina léitheoirí agus ina éisteoirí.

  19. Journal de la Recherche Scientifique de l'Université de Lomé

    African Journals Online (AJOL)

    Journal de la Recherche Scientifique de l'Universite de Lome. ... B.A.K. Dossa, V.J. Mama, S Karimou, A.C. Mamam-Djibril, T Houetchegnon, I Toko .... des facteurs de risque cardiovasculaire et de cancer dans l'aire sanitaire de Zowla au Togo ...

  20. People with ID as interviewers and co-researchers: experiences and reflection.

    NARCIS (Netherlands)

    Lieshout, H. van

    2012-01-01

    Aim: To share the experience of working with people with intellectual disabilities (ID) as interviewers in a qualitative study about community participation of people with ID. We reflect on two perspectives: the interviewers and the researchers. Method: Eighteen people with ID were interviewed by

  1. An online ID identification system for liquefied-gas cylinder plant

    Science.gov (United States)

    He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao

    2017-11-01

    An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.

  2. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  3. AcEST: DK945560 [AcEST

    Lifescience Database Archive (English)

    Full Text Available lastX Result : TrEMBL tr_hit_id B8CPG2 Definition tr|B8CPG2|B8CPG2_9GAMM Exporter of the RND superfamily OS=Shewanella piezo...acterized protein OS=Trich... 34 4.2 >tr|B8CPG2|B8CPG2_9GAMM Exporter of the RND superfamily OS=Shewanella piezo

  4. AcEST: DK955410 [AcEST

    Lifescience Database Archive (English)

    Full Text Available e 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O24339 Definition sp|O24339|CATA_SOLAP... E Sequences producing significant alignments: (bits) Value sp|O24339|CATA_SOLAP ...na GN=CAT1... 79 5e-15 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 90

  5. AcEST: DK944467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sults ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O24339 Definition sp|O24339|CATA_SOLAP........................done Score E Sequences producing significant alignments: (bits) Value sp|O24339|CATA_SOLAP...TA_IPOBA Catalase OS=Ipomoea batatas PE=2 SV=1 248 2e-65 >sp|O24339|CATA_SOLAP Ca

  6. AcEST: CL1889Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1889Contig1 491 2 Adiantum capillus-veneris contig: CL1889contig1 sequence. Link ...apillus-veneris contig: CL1889contig1 sequence. Link to clone list Link to clone list Clone ID BP919609 BP91

  7. A novel approach for UI charge reduction using AMI based load prioritization in smart grid

    Directory of Open Access Journals (Sweden)

    Avani Pujara

    2017-09-01

    Full Text Available System frequency is vital part for power system balance. As per India Electricity Grid code frequency should be in the range of 49.5 Hz–50.5 Hz. Deviation from above mentioned range is charged as Unscheduled Interchange (UI charge. This paper proposes a new method for load and frequency control based on control of third parameter of three-part Availability Based Tariff (ABT i.e. Unscheduled Interchange charges. New circuit is designed considering prioritization of load and using Advanced Metering Infrastructure (AMI under Smart Grid environment.

  8. Family of the Sun-and-Stars Time-Determining Instruments (Ilseong-jeongsi-ui Invented During the Joseon Dynasty

    Directory of Open Access Journals (Sweden)

    Yong Sam Lee

    2016-09-01

    Full Text Available We analyze the design and specifications of the Sun-and-Stars Time-Determining group of instruments (Ilseong-jeongsi-ui, 日星定時儀 made during the Joseon dynasty. According to the records of the Sejong Sillok (Veritable Records of King Sejong, Sun-and-Stars Time-Determining Instruments measure the solar time of day and the sidereal time of night through three rings and an alidade. One such instrument, the Simplified Time-Determining Instrument (So-jeongsi-ui, 小定時儀, is made without the essential component for alignment with the celestial north pole. Among this group of instruments, only two bronze Hundred-Interval-Ring Sundials (Baekgak-hwan-Ilgu, 百刻環日晷 currently exist. A comparison of the functions of these two relics with two Time-Determining Instruments suggests that the Hundred-Interval-Ring Sundial is a Simplified Sundial (So-ilyeong, 小日影, as recorded in the Sejong Sillok and the Seongjong Sillok (Veritable Records of King Seongjong. Furthermore, the Simplified Sundial is a model derived from the Simplified Time-Determining Instrument. During the King Sejong reign, the Sun-and-Stars Time-Determining Instruments were used in military camps of the kingdom’s frontiers, in royal ancestral rituals, and in royal astronomical observatories.

  9. Family of the Sun-and-Stars Time-Determining Instruments (Ilseong-jeongsi-ui) Invented During the Joseon Dynasty

    Science.gov (United States)

    Lee, Yong Sam; Kim, Sang Hyuk; Mihn, Byeong-Hee

    2016-09-01

    We analyze the design and specifications of the Sun-and-Stars Time-Determining group of instruments (Ilseong-jeongsi-ui, 日星定時儀) made during the Joseon dynasty. According to the records of the Sejong Sillok (Veritable Records of King Sejong), Sun-and-Stars Time-Determining Instruments measure the solar time of day and the sidereal time of night through three rings and an alidade. One such instrument, the Simplified Time-Determining Instrument (So-jeongsi-ui, 小定時儀), is made without the essential component for alignment with the celestial north pole. Among this group of instruments, only two bronze Hundred-Interval-Ring Sundials (Baekgak-hwan-Ilgu, 百刻環日晷) currently exist. A comparison of the functions of these two relics with two Time-Determining Instruments suggests that the Hundred-Interval-Ring Sundial is a Simplified Sundial (So-ilyeong, 小日影), as recorded in the Sejong Sillok and the Seongjong Sillok (Veritable Records of King Seongjong). Furthermore, the Simplified Sundial is a model derived from the Simplified Time-Determining Instrument. During the King Sejong reign, the Sun-and-Stars Time-Determining Instruments were used in military camps of the kingdom’s frontiers, in royal ancestral rituals, and in royal astronomical observatories.

  10. Supporting co-creation with software, the idSpace platform

    NARCIS (Netherlands)

    Van Rosmalen, Peter; Boon, Jo; Bitter-Rijpkema, Marlies; Sie, Rory; Sloep, Peter

    2014-01-01

    Innovation, in general, requires teamwork among specialist of different disciplines. The idSpace project developed ideas on how teams of collaborating innovators could best be supported. These ideas were embodied in a platform that the project developed. This idSpace platform allows its users to

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB611 (Link to dictyBase) - - - Contig-U16239-1 VFB611P (Link... to Original site) VFB611F 650 VFB611Z 704 VFB611P 1354 - - Show VFB611 Library VF (Link to library) Clone ID VFB611 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16239-1 Original site URL http://dict...ant alignments: (bits) Value N AC116989 |AC116989.2 Dictyostelium discoideum chro...mosome 2 map complement(3527391-3470188) strain AX4, complete sequence. 42 5e-10 9 AC116987 |AC116987.2 Dict

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB489 (Link to dictyBase) - - - Contig-U16382-1 VFB489P (Link... to Original site) VFB489F 178 VFB489Z 501 VFB489P 679 - - Show VFB489 Library VF (Link to library) Clone ID VFB489 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...: (bits) Value N AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2...e cds. 783 0.0 3 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4,

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB770 (Link to dictyBase) - - - Contig-U16382-1 VFB770E (Link...) Clone ID VFB770 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyosteliu...m discoideum gene for actin A8. 2230 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 16...deum actin 15 gene, complete cds. 2030 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map

  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC187 (Link to dictyBase) - - - Contig-U12289-1 VFC187P (Link... to Original site) VFC187F 411 VFC187Z 678 VFC187P 1089 - - Show VFC187 Library VF (Link to library) Clone ID VFC187 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12289-1 Original site URL http://dict... N AC117176 |AC117176.2 Dictyostelium discoideum chromosome 2 map 5018074-5200947... strain AX4, complete sequence. 36 0.008 12 AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 map 2

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB837 (Link to dictyBase) - - - Contig-U14985-1 VFB837P (Link... to Original site) VFB837F 606 VFB837Z 689 VFB837P 1295 - - Show VFB837 Library VF (Link to library) Clone ID VFB837 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14985-1 Original site URL http://dict... 13 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-256737...0 strain AX4, complete sequence. 38 2e-05 15 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB574 (Link to dictyBase) - - - Contig-U16382-1 VFB574P (Link... to Original site) VFB574F 508 VFB574Z 686 VFB574P 1194 - - Show VFB574 Library VF (Link to library) Clone ID VFB574 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromo...some 2 map 1685067-2090751 strain AX4, complete sequence. 1352 0.0 4 AC116986 |AC116986.2 Dict

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB524 (Link to dictyBase) - - - Contig-U14169-1 VFB524Z (Link... to Original site) - - VFB524Z 233 - - - - Show VFB524 Library VF (Link to library) Clone ID VFB524 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14169-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116305 |AC116305.2 Dict... cds. 40 0.81 2 Z70204 |Z70204.1 Caenorhabditis elegans cosmid C11G6. 40 2.7 2 AC117176 |AC117176.2 Dictyost

  19. AcEST: BP918718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 06_9POAL NADH dehydrogenase subunit B OS=Danthonia... 118 2e-25 tr|O03150|O03150_OSMCL NdhB protein (Fragment) OS=Osmunda clay...n (Fragment) OS=Osmunda claytoniana GN=ndhB PE=2 SV=1 Length = 148 Score = 117 bits (294), Expect = 2e-25 Id...QMYNSPG--ISIALIFITVGLGFKLSLAPFHQWTPDVYEGS 242 >tr|O03150|O03150_OSMCL NdhB protei

  20. AcEST: DK944561 [AcEST

    Lifescience Database Archive (English)

    Full Text Available hit_id Q306W7 Definition sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine encephalitis virus (s...E Sequences producing significant alignments: (bits) Value sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine...domain-conta... 29 6.3 >sp|Q306W7|POLS_EEEV8 Structural polyprotein OS=Eastern equine encephalitis virus (st