Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH222 (Link to dictyBase) - - - Contig-U16475-1 SLH222Z (Link... to Original site) - - SLH222Z 433 - - - - Show SLH222 Library SL (Link to library) Clone ID SLH222 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH222Q.Seq.d/ Representative seq. ID SLH22...2Z (Link to Original site) Representative DNA sequence >SLH222 (SLH222Q) /CSM/SL/SLH2-A/SLH222Q.Seq.d/ XXXXX...603Q.Seq.d/ 728 0.0 SLI537 (SLI537Q) /CSM/SL/SLI5-B/SLI537Q.Seq.d/ 728 0.0 SLH222 (SLH222Q) /CSM/SL/SLH2
A proposed HTTP service based IDS
Directory of Open Access Journals (Sweden)
Mohamed M. Abd-Eldayem
2014-03-01
Full Text Available The tremendous growth of the web-based applications has increased information security vulnerabilities over the Internet. Security administrators use Intrusion-Detection System (IDS to monitor network traffic and host activities to detect attacks against hosts and network resources. In this paper IDS based on Naïve Bayes classifier is analyzed. The main objective is to enhance IDS performance through preparing the training data set allowing to detect malicious connections that exploit the http service. Results of application are demonstrated and discussed. In the training phase of the proposed IDS, at first a feature selection technique based on Naïve Bayes classifier is used, this technique identifies the most important HTTP traffic features that can be used to detect HTTP attacks. In the testing and running phases proposed IDS classifies the network traffic based on the requested service, then based on the selected features Naïve Bayes classifier is used to analyze the HTTP service based traffic and identifies the HTTP normal connections and attacks. The performance of the IDS is measured through experiments using NSL-KDD data set. The results show that the detection rate of the IDS is about 99%, the false-positive rate is about 1%, and the false-negative rate is about 0.25%; therefore, proposed IDS holds the highest detection rate and the lowest false alarm compared with other leading IDS. In addition, the proposed IDS based on Naïve Bayes is used to classify network connections as a normal or attack. And it holds a high detection rate and a low false alarm.
International Nuclear Information System (INIS)
Sharma, Pankaj; Patel, Divya; Chaudhary, Jaideep
2012-01-01
As transcriptional regulators of basic helix–oop–helix (bHLH) transcription and non-bHLH factors, the inhibitor of differentiation (Id1, Id2, Id3, and Id4) proteins play a critical role in coordinated regulation of cell growth, differentiation, tumorigenesis, and angiogenesis. Id1 regulates prostate cancer (PCa) cell proliferation, apoptosis, and androgen independence, but its clinical significance in PCa remains controversial. Moreover, there is lack of evidence on the expression of Id2 and Id3 in PCa progression. In this study we investigated the expression of Id2 and Id3 and reevaluated the expression of Id1 in PCa. We show that increased Id1 and Id3 protein expression is strongly associated with increasing grade of PCa. At the molecular level, we report that silencing either Id1 or Id3 attenuates cell cycle. Although structurally and mechanistically similar, our results show that both these proteins are noncompensatory at least in PCa progression. Moreover, through gene silencing approaches we show that Id1 and Id3 primarily attenuates CDKN1A (p21) and CDKN1B (p27), respectively. We also demonstrate that silencing Id3 alone significantly attenuates proliferation of PCa cells as compared with Id1. We propose that increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype
Now called RSA SecurID, SecurID is a mechanism developed by Security Dynamics that allows two-factor authentication for a user on a network resource. It works on the principle of the unique password mode, based on a shared secret. Every sixty seconds, the component generates a new six-digit token on the screen. The latter comes from the current time (internal clock) and the seed (SecurID private key that is available on the component, and is also from the SecurID server). During an authentication request, the SecurID server will check the entered token by performing exactly the same calculation as that performed by your component. The server knows the two information required for this calculation: the current time and the seed of your component. Access is allowed if the token calculated by the server matches the token you specified.
A long range transport model of Rn-222
International Nuclear Information System (INIS)
Ikebe, Y.; Kojima, S.; Shimo, M.
1993-01-01
In this report, we propose an analytical treatment about temporal variation of 222 Rn concentration in the atmosphere with an aim to clarify origin and transport of 222 Rn. Based on the results of numerical simulation of radon, we separate the 222 Re concentration measured at Nagoya into the following two components : (1) 222 Rn atom originated near from the measuring site, which is denoted by 'diurnal variation component'. From numerical simulation of radon, it has been shown that the measured diurnal variation can be explained by this component. (2) 222 Rn atoms originated far from the measuring site (including Chinese Continent), which is denoted by 'background component'. For this component, we propose here a one layer transport model using air mass trajectory technique. By this model we can explain the temporal variation of background component and seasonal variation of 222 Rn at Nagoya. (3 figs.)
Babakhanyan, Anna; Leke, Rose G. F.; Salanti, Ali; Bobbili, Naveen; Gwanmesia, Philomina; Leke, Robert J. I.; Quakyi, Isabella A.; Chen, John J.; Taylor, Diane Wallace
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8–9% of males had antibodies to full-length VAR2CSA, but 90–96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a. PMID:24505415
Directory of Open Access Journals (Sweden)
Anna Babakhanyan
Full Text Available In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women naturally acquire antibodies to ID1-ID2a and if antibodies to ID1-ID2a correlate with absence of placental malaria at delivery. Antibody levels to full-length VAR2CSA and ID1-ID2a were measured in plasma samples from 745 pregnant Cameroonian women, 144 Cameroonian men, and 66 US subjects. IgM levels and IgG avidity to ID1-ID2a were also determined. As expected, antibodies to ID1-ID2a were absent in US controls. Although pregnant Cameroonian women developed increasing levels of antibodies to full-length VAR2CSA during pregnancy, no increase in either IgM or IgG to ID1-ID2a was observed. Surprisingly, no differences in antibody levels to ID1-ID2a were detected between Cameroonian men and pregnant women. For example, in rural settings only 8-9% of males had antibodies to full-length VAR2CSA, but 90-96% had antibodies to ID1-ID2a. In addition, no significant difference in the avidity of IgG to ID1-ID2a was found between pregnant women and Cameroonian men, and no correlation between antibody levels at delivery and absence of placental malaria was found. Thus, the response to ID1-ID2a was not pregnancy specific, but predominantly against cross-reactivity epitopes, which may have been induced by other PfEMP1 antigens, malarial antigens, or microbes. Currently, ID1-ID2a is a leading vaccine candidate, since it binds to the CSA with the same affinity as the full-length molecule and elicits binding-inhibitory antibodies in animals. Further studies are needed to determine if the presence of naturally acquired cross-reactive antibodies in women living in malaria endemic countries will alter the response to ID1-ID2a following vaccination with ID1-ID2a.
20 CFR 222.55 - When a stepchild is dependent.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a stepchild is dependent. 222.55 Section 222.55 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.55 When a stepchild is dependent. An employee's...
Id-1 and Id-2 genes and products as markers of epithelial cancer
Desprez, Pierre-Yves [El Cerrito, CA; Campisi, Judith [Berkeley, CA
2008-09-30
A method for detection and prognosis of breast cancer and other types of cancer. The method comprises detecting expression, if any, for both an Id-1 and an Id-2 genes, or the ratio thereof, of gene products in samples of breast tissue obtained from a patient. When expressed, Id-1 gene is a prognostic indicator that breast cancer cells are invasive and metastatic, whereas Id-2 gene is a prognostic indicator that breast cancer cells are localized and noninvasive in the breast tissue.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Research. 93.222 Section 93.222 Public Health... STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT Definitions § 93.222 Research. Research means a systematic experiment, study, evaluation...
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 222.1 Section 222.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.1 Introduction. This part sets forth and describes the family relationships that may make a...
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Definitions. 22.2 Section 22.2 Labor Office of the Secretary of Labor PROGRAM FRAUD CIVIL REMEDIES ACT OF 1986 § 22.2 Definitions. (a) ALJ means an Administrative... accounting or bookkeeping entry made— (1) With respect to a claim or to obtain the approval or payment of a...
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Examples. 222.2 Section 222.2 Banks and Banking... (REGULATION V) General Provisions § 222.2 Examples. The examples in this part are not exclusive. Compliance with an example, to the extent applicable, constitutes compliance with this part. Examples in a...
Pengalaman Komunikasi Pelanggan Zalora.co.id (Studi Fenomenologi Pelanggan Zalora.co.id)
Aji, Widya Andhika; Pradekso, Tandiyo; Ulfa, Nurist Surayya
2013-01-01
1PENGALAMAN KOMUNIKASI PELANGGAN ZALORA.CO.ID(Studi Fenomenologi Pelanggan Zalora.co.id)Oleh:Widya Andhika AjiFakultas Ilmu Sosial dan Ilmu PolitikUniversitas Diponegoro SemarangABSTRAKPenelitian ini bertujuan untuk menganalisis pengalaman komunikasi danpemahaman penerimaan konsumen terkait pesan komunikasi pemasaran dalamberbelanja di Zalora.co.id. Dengan menggunakan sampel pada lima informandan metode wawancara, dapat ditarik kesimpulan: Pelanggan Zalora.co.idmemiliki pengalaman komunikasi ...
Kiss, István; Kiss, Zoltán; Kerkovits, Lóránt; Paksy, András; Ambrus, Csaba
2017-01-01
The relationship between smoking and mortality in patients on hemodialysis is controversial. Earlier studies showed that the insertion/deletion (I/D) polymorphism of the ACE gene might have an effect on mortality. The aim of this study was to test the impact of smoking on survival and whether this association was influenced by ACE gene I/D polymorphism in patients on maintenance hemodialysis. In this prospective, multicenter cohort study we analyzed 709 prevalent patients on maintenance hemodialysis. Patients were allocated into groups based on their smoking habit. Outcome data were collected during the 144-month follow-up period. Outcomes of current smokers and lifelong non-smokers were compared. In order to control for interactions between predictor variables, we also identified 160 matched pairs for further sub-analysis. The vast majority of patients (67%) were non-smokers, followed by current smokers (22.2%) and ex-smokers (9.8%). Smoking had no impact on survival in the matched pair analysis ( p = 0.99). After adjustment for ACE I/D polymorphism and other co-variates, smoking had no effect on survival. Our data suggest that smoking has no impact on survival; neither is it associated with ACE gene I/D polymorphism in hemodialysis patients.
20 CFR 222.56 - When a grandchild or stepgrandchild is dependent.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a grandchild or stepgrandchild is dependent. 222.56 Section 222.56 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.56 When a grandchild or...
39 CFR 222.3 - Other delegation.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Other delegation. 222.3 Section 222.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION DELEGATIONS OF AUTHORITY § 222.3 Other delegation. (a) Documentation. All delegations of authority must be officially documented. (b...
Quantification of Groundwater Discharge in a Subalpine Stream Using Radon-222
Directory of Open Access Journals (Sweden)
Elizabeth Avery
2018-01-01
Full Text Available During the dry months of the water year in Mediterranean climates, groundwater influx is essential to perennial streams for sustaining ecosystem health and regulating water temperature. Predicted earlier peak flow due to climate change may result in decreased baseflow and the transformation of perennial streams to intermittent streams. In this study, naturally occurring radon-222 (222Rn was used as a tracer of groundwater influx to Martis Creek, a subalpine stream near Lake Tahoe, CA. Groundwater 222Rn is estimated based on measurements of 222Rn activity in nearby deep wells and springs. To determine the degassing constant (needed for quantification of water and gas flux, an extrinsic tracer, xenon (Xe, was introduced to the stream and monitored at eight downstream locations. The degassing constant for 222Rn is based on the degassing constant for Xe, and was determined to be 1.9–9.0 m/day. Applying a simple model in which stream 222Rn activity is a balance between the main 222Rn source (groundwater and sink (volatilization, the influx in reaches of the upstream portion of Martis Creek was calculated to be <1 to 15 m3/day/m, which cumulatively constitutes a significant portion of the stream discharge. Experiments constraining 222Rn emanation from hyporheic zone sediments suggest that this should be considered a maximum rate of influx. Groundwater influx is typically difficult to identify and quantify, and the method employed here is useful for identifying locations for focused stream flow measurements, for formulating a water budget, and for quantifying streamwater–groundwater interaction.
Enatioselective[2+2+2] Cycloaddition as A Synthetic Tool
Institute of Scientific and Technical Information of China (English)
T.Shibata; S.Yoshida; M.Otsuka; Y.Arai; K.Endo
2007-01-01
1 Results Transition metal-catalyzed [2+2+2] cycloaddition is one of the most efficient protocols for the construction of six-membered ring system.Our group has comprehensively studied various types of highly enantioselective [2+2+2] cycloaddition for the synthesis of chiral cycloadducts; we already reported an iridium-catalyzed intermolecular [2+2+2] cycloaddition between α,ω-diynes,having various tethers and substituents on the alkyne termini,and monoalkynes,possessing oxygen or/and nitrogen functiona...
Beam transport radiation shielding for branch lines 2-ID-B and 2-ID-C
International Nuclear Information System (INIS)
Feng, Y.P.; Lai, B.; McNulty, I.; Dejus, R.J.; Randall, K.J.; Yun, W.
1995-01-01
The x-ray radiation shielding requirements beyond the first optics enclosure have been considered for the beam transport of the 2-ID-B and 2-ID-C branch lines of Sector 2 (SRI-CAT) of the APS. The first three optical components (mirrors) of the 2-ID-B branch are contained within the shielded first optics enclosure. Calculations indicate that scattering of the primary synchrotron beam by beamline components outside the enclosure, such as apertures and monochromators, or by gas particles in case of vacuum failure is within safe limits for this branch. A standard 2.5-inch-diameter stainless steel pipe with 1/16-inch-thick walls provides adequate shielding to reduce the radiation dose equivalent rate to human tissue to below the maximum permissible limit of 0.25 mrem/hr. The 2-ID-C branch requires, between the first optics enclosure where only two mirrors are used and the housing for the third mirror, additional lead shielding (0.75 mm) and a minimum approach distance of 2.6 cm. A direct beam stop consisting of at least 4.5 mm of lead is also required immediately downstream of the third mirror for 2-ID-C. Finally, to stop the direct beam from escaping the experimental station, a beam stop consisting of at least 4-mm or 2.5-mm steel is required for the 2-ID-B or 2-ID-C branches, respectively. This final requirement can be met by the vacuum chambers used to house the experiments for both branch lines
Inferring 222Rn soil fluxes from ambient 222Rn activity and eddy covariance measurements of CO2
Directory of Open Access Journals (Sweden)
S. van der Laan
2016-11-01
Full Text Available We present a new methodology, which we call Single Pair of Observations Technique with Eddy Covariance (SPOT-EC, to estimate regional-scale surface fluxes of 222Rn from tower-based observations of 222Rn activity concentration, CO2 mole fractions and direct CO2 flux measurements from eddy covariance. For specific events, the regional (222Rn surface flux is calculated from short-term changes in ambient (222Rn activity concentration scaled by the ratio of the mean CO2 surface flux for the specific event to the change in its observed mole fraction. The resulting 222Rn surface emissions are integrated in time (between the moment of observation and the last prior background levels and space (i.e. over the footprint of the observations. The measurement uncertainty obtained is about ±15 % for diurnal events and about ±10 % for longer-term (e.g. seasonal or annual means. The method does not provide continuous observations, but reliable daily averages can be obtained. We applied our method to in situ observations from two sites in the Netherlands: Cabauw station (CBW and Lutjewad station (LUT. For LUT, which is an intensive agricultural site, we estimated a mean 222Rn surface flux of (0.29 ± 0.02 atoms cm−2 s−1 with values > 0.5 atoms cm−2 s−1 to the south and south-east. For CBW we estimated a mean 222Rn surface flux of (0.63 ± 0.04 atoms cm−2 s−1. The highest values were observed to the south-west, where the soil type is mainly river clay. For both stations good agreement was found between our results and those from measurements with soil chambers and two recently published 222Rn soil flux maps for Europe. At both sites, large spatial and temporal variability of 222Rn surface fluxes were observed which would be impractical to measure with a soil chamber. SPOT-EC, therefore, offers an important new tool for estimating regional-scale 222Rn surface fluxes. Practical applications furthermore include
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC222 (Link to dictyBase) - - - Contig-U16046-1 VFC222Z (Link... to Original site) - - VFC222Z 339 - - - - Show VFC222 Library VF (Link to library) Clone ID VFC222 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16046-1 Original site URL http://dict...pdate 2002.12.15 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116989 |AC116989.2 Dict...etical LO... 88 8e-17 AC115592_28( AC115592 |pid:none) Dictyostelium discoideum c
A study of the physico-chemical characteristics of a solid radon 222 source
International Nuclear Information System (INIS)
Chuiton, G.
1990-01-01
A solid radon 222 source is described; it is made of a manganese oxide impregnated acrylic felt disc on which radium 226 is fixed. The disc is incorporated into a scanning device allowing the passage through the felt of a radon 222 free gas (air or nitrogen) previously led to a relative humidity of air near to saturation. At the device outlet, a stable activity of radon 222 is obtained. The preparation, characteristics and radiochemical stability conditions of the 226 radium source are presented. Following a description of the scanning device, the radon 222 emanation coefficient is studied as a function of the relative humidity of air. The reliability of the device is assessed by an uncertainty calculation for the utilisation conditions recommended. Finally, an approach to the physico-chemical processes governing radon 222 emanation rate in the device is set forth [fr
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Sleep time. 553.222 Section 553.222 Labor Regulations... Enforcement Employees of Public Agencies Tour of Duty and Compensable Hours of Work Rules § 553.222 Sleep time... enforcement personnel in accordance with section 7(a)(1) of the Act, the public agency may exclude sleep time...
A micromegas detector for {sup 222}Rn emanations measurements
Energy Technology Data Exchange (ETDEWEB)
García, J. A.; Garza, J. G.; Irastorza, I. G.; Mirallas, H. [Laboratorio de Física Nuclear y Altas Energías, Universidad de Zaragoza, Zaragoza (Spain)
2013-08-08
The {sup 222}Rn emanation has significant contribution in the overall background for rare event searches experiments. In order to measure this emanations a high sensitivity detector has been designed. The detection method is based on the electrostatic collection of the {sup 222}Rn daughters on a Micromegas detector. Using a chamber with a volume of 21.2 l for the collection of {sup 218}Po and {sup 214}Po progeny of {sup 222}Rn and a 12 × 12cm{sup 2} pixelized Micromegas for the α detection. The advantages of the Micromegas detectors are the low intrinsic radioactivity and the track reconstruction of the α’s, having excellent capabilities for event discrimination.
Contribution of 222Rn in domestic water supplies to 222Rn in indoor air in Colorado homes
International Nuclear Information System (INIS)
Lawrence, E.P.; Wanty, R.B.; Nyberg, P.
1992-01-01
The contribution of 222Rn from domestic water wells to indoor air was investigated in a study of 28 houses near Conifer, CO. Air concentrations determined by alpha-track detectors (ATDs) and continuous radon monitors were compared with the predictions of a single-cell model. In many of the houses, the water supply was shown to contribute significantly to levels of indoor 222Rn. The data from the ATD study were augmented with a continuous monitoring study of a house near Lyons, CO. The well water in that house has the highest known concentration of 222Rn in water yet reported (93 MBq m-3). The temporal pattern in the indoor 222Rn concentration corresponds to water-use records. In general, it is difficult to quantify the proportion of indoor radon attributable to water use. Several lines of evidence suggest that the single-cell model underestimates this proportion. Continuous-monitoring data, although useful, are impractical due to the cost of the equipment. We propose a protocol for 222Rn measurement based on three simultaneous integrating radon detectors that may help estimate the proportion of indoor 222Rn derived from the water supply
A brief review of revocable ID-based public key cryptosystem
Directory of Open Access Journals (Sweden)
Tsu-Yang Wu
2016-03-01
Full Text Available The design of ID-based cryptography has received much attention from researchers. However, how to revoke the misbehaviour/compromised user in ID-based public key cryptosystem becomes an important research issue. Recently, Tseng and Tsai proposed a novel public key cryptosystem called revocable ID-based public key cryptosystem (RIBE to solve the revocation problem. Later on, numerous research papers based on the Tseng-Tsai key RIBE were proposed. In this paper, we brief review Tseng and Tsai's RIBE. We hope this review can help the readers to understand the Tseng and Tsai's revocable ID-based public key cryptosystem.
20 CFR 222.52 - When a legally adopted child is dependent-general.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-general. 222.52 Section 222.52 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.52 When a legally adopted...
1 CFR 22.2 - Authority citation.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Authority citation. 22.2 Section 22.2 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS PREPARATION OF NOTICES AND PROPOSED RULES Notices § 22.2 Authority citation. The authority under...
20 CFR 222.58 - When a child is living with an employee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a child is living with an employee. 222.58 Section 222.58 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.58 When a child is living with an...
Absolute measurement of the activity of 222Rn using a proportional counter
International Nuclear Information System (INIS)
Busch, Ingo; Greupner, Heinz; Keyser, Uwe
2002-01-01
A measuring set-up comprising a proportional counter of calculable 222 Rn efficiency and quantifiable active volume (δ V 222 Rn efficiency is determined by computer simulation of the measured α-spectra. The procedures necessary for absolute measurements by means of the counter are described, and the suitability of the counter for absolute measurements of the 222 Rn activity is proved by experiments. Thus, a new method for the realization of the unit of activity of 222 Rn is obtained, which is independent of the unit of activity of 226 Ra
Thais, Savannah Jennifer; The ATLAS collaboration
2018-01-01
Efficient and accurate electron identification is of critical importance to measuring many physics processes with leptons in the final state, including H->4l, dark vector boson searches, and various SUSY searches. This poster will describe the current status of the Likelihood driven Electron ID, highlighting the recent move from a MC driven ID to a data-driven ID. It will include the most recent identification efficiency and scale-factor measurements. Additionally, it will describe continued improvements for Run 2 electron ID, highlighting improvements in the low pt region and potential Machine Learning improvements.
How to save distressed IDS-physician marriages: a case study.
Collins, H; Johnson, B A
1998-04-01
A hospital-driven IDS that encounters serious problems resulting from ownership of a physician practice should address those problems by focusing on three core areas: vision and leadership, effectiveness of operations, and physician compensation arrangements. If changes in these areas do not lead to improvements, the IDS may need to consider organizational restructuring. In one case study, a hospital-driven IDS faced the problem of owning a poorly performing MSO with a captive physician group. The IDS's governing board determined that the organization lacked effective communication with the physicians and that realization of the organization's vision would require greater physician involvement in organizational decision making. The organization is expected to undergo some corporate reorganization in which physicians will acquire an equity interest in the enterprise.
Tinjauan Desain Website Kemlu.Go.Id
Danu Widhyatmoko
2013-01-01
Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007). At the end of the article, several recommendations in developing kemlu.go.id website are...
50 CFR 222.404 - Observer program sampling.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Observer program sampling. 222.404 Section 222.404 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... Requirement § 222.404 Observer program sampling. (a) During the program design, NMFS would be guided by the...
Tinjauan Desain Website Kemlu.Go.Id
Directory of Open Access Journals (Sweden)
Danu Widhyatmoko
2013-04-01
Full Text Available Review of kemlu.go.id website design is a research report on Kemlu.go.id website design. Kemlu.go.id website aims to be the information gateway of Ministry of Foreign Affairs, and also as guidelines of foreign politic policies of Republic of Indonesia. The review had been accomplished by using analytical method based on the "Nine Essential Principles for Good Web Design" developed by Collis Ta'eed (2007. At the end of the article, several recommendations in developing kemlu.go.id website are presented to create better appearance.
International Nuclear Information System (INIS)
Ohkura, Takehisa; Yamazawa, Hiromi; Moriizumi, Jun; Hirao, Shigekazu; Iida, Takao
2010-01-01
222 Rn fluxes from the ground surface and 226 Ra contents in soil were measured on Hachijo-jima Island, which is a solitary island in the Pacific Ocean located about 200 km to the south of the main island of Japan, to evaluate fractional contributions of the locally exhaled 222 Rn and the long-range transported one to the surface air concentration measured on this island. Averages of 222 Rn flux and 226 Ra content in dry soil were evaluated to be 0.9±0.4 mBq m -2 s -1 and 6.8±0.2 Bq kg -1 , respectively. These are considerably smaller than the respective values of 9.7±0.8 mBq m -2 s -1 and 23.2±0.4 Bq kg -1 measured at Nagoya as a reference. The lower value of the 226 Ra content and the even lower 222 Rn flux on this island can be attributed to the basaltic geology and the soil's coarse texture moisture, respectively. A simple model calculation assuming a typical nocturnal condition showed that the measured 222 Rn flux would cause only a small increase in the surface air concentration by 0.035 to 0.072 Bq m -3 (relative contribution of 1 to 12%) in addition to the long-range transported 222 Rn under a typical nocturnal condition. The contribution of the local flux would be smaller than that under nocturnal condition. This local 222 Rn component is negligible as compared with the concentration of the long-range transported 222 Rn (0.6 to 3.6 Bq m -3 ). It is, therefore, concluded that Hachijo-jima Island is suitable for measuring the long-range transported atmospheric 222 Rn in East Asia region. (author)
A Good IDS Response Protocol of MANET Containment Strategies
Cheng, Bo-Chao; Chen, Huan; Tseng, Ryh-Yuh
Much recent research concentrates on designing an Intrusion Detection System (IDS) to detect the misbehaviors of the malicious node in MANET with ad-hoc and mobility natures. However, without rapid and appropriate IDS response mechanisms performing follow-up management services, even the best IDS cannot achieve the desired primary goal of the incident response. A competent containment strategy is needed to limit the extent of an attack in the Incident Response Life Cycle. Inspired by the T-cell mechanisms in the human immune system, we propose an efficient MANET IDS response protocol (T-SecAODV) that can rapidly and accurately disseminate alerts of the malicious node attacks to other nodes so as to modify their AODV routing tables to isolate the malicious nodes. Simulations are conducted by the network simulator (Qualnet), and the experiment results indicate that T-SecAODV is able to spread alerts steadily while greatly reduce faulty rumors under simultaneous multiple malicious node attacks.
20 CFR 222.51 - When a natural child is dependent.
2010-04-01
... FAMILY RELATIONSHIPS Child Support and Dependency § 222.51 When a natural child is dependent. The... employee's earnings record and the relationship of the child to the employee, the child will be considered... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a natural child is dependent. 222.51...
Variations of Rn-222 concentration in the Bratislava air
International Nuclear Information System (INIS)
Holy, K.; Bohm, R.; Polaskova, A.
1996-01-01
222 Rn is produced by alpha decay of 222 Ra in roil. A small fraction of totally produced 222 Rn escapes from coil particles into soil air. Then 222 Rn is transported predominantly by molecular diffusion into outdoor atmosphere. The radon concentration in the outdoor atmosphere is not stable. It varies irregularly depending on meteorological conditions. However there were found out regular daily and remand variations of 222 Rn concentration in outdoor atmosphere. These variations were measured in numerous works and results are summarized f.e. in work of Gesell. A simple model described the annual variations of 222 Rn concentration war published by Minato. A mathematical analysis of daily course of 222 Rn concentration in outdoor atmosphere was realized by Garzon et al. Some results of our study of 222 Rn variations in outdoor atmosphere of Bratislava are shown in this report. (author)
International Nuclear Information System (INIS)
Ohkura, Takehisa; Yamazawa, Hiromi; Moriizumi, Jun; Hirao, Shigekazu; Iida, Takao; Guo Qiuju; Tohjima, Yasunori
2009-01-01
A monitoring network of atmospheric 222 Rn concentration as a tracer for long-range transport in East Asia was established. Atmospheric 222 Rn concentration at Beijing, which is located on China Continent was 10-20 Bq m -3 , at Nagoya, which is located on edge of terrestrial area was 3-10 Bq m -3 and at Hachijo-jima and Hateruma-jima, which are solitary islands in Pacific Ocean was 0.5-3 Bq m -3 , respectively. The atmospheric 222 Rn concentration variations were different from sites. The 222 Rn concentration was the lowest in the summer and the highest in the winter except Nagoya where the highest was observed in the autumn and the lowest in the spring. Diurnal variations were measured at Beijing and Nagoya. In contrast, diurnal variations were not measured but several-day-cycle variations were measured at Hachijo-jima and Hateruma-jima. It was pointed out by this study that the several-day-cycle variations at Hachijo-jima were dependent on synoptic-scale atmospheric disturbance. 222 Rn concentration increased rapidly after a cold front passed through Hachijo-jima. Backward trajectory analysis of the relationship between atmospheric 222 Rn concentrations at Hachijo-jima and transport pathway of air mass indicates that air mass transported from China and Siberia has high concentration 222 Rn and air mass transported from Pacific Ocean has low concentration 222 Rn. In winter, atmospheric 222 Rn concentrations at Hachijo-jima is dependent on vertical transport pathway rather than horizontal transport pathway. (author)
RADON 222 AND TROPOSPHERIC VERTICAL TRANSPORT.
Liu, SC; McAfee, JR; Cicerone, RJ
1984-01-01
Radon 222 is an inert gas whose loss is due only to radioactive decay with a half life of 3. 83 days (5. 51-day 'exponential' lifetime). It is a very useful tracer of continental air because only ground level continental sources are significant. Previously published measured **2**2**2Rn profiles are analyzed here by averaging for the summer, winter, and spring-fall seasons. The analysis shows that in summer, about 55% of the **2**2**2Rn is transported above the planetary boundary layer, consi...
Radon-222 and beryllium-7 as natural tracer; Radon-222 und Beryllium-7 als natuerliche Tracer
Energy Technology Data Exchange (ETDEWEB)
Frank, G.; Steinkopff, T. [Deutscher Wetterdienst, Offenbach (Germany). Radioaktivitaetsueberwachung; Salvamoser, J. [Institut fuer Angewandte Isotopen-, Gas- und Umweltuntersuchungen (IGU), Woerthsee (Germany)
2016-07-01
The Global Atmosphere Watch Program (GAW) is intended to analyse worldwide the influence of anthropogenic emissions to the atmosphere. Data are continuously transferred to the ''World Data Centre for Green House Gases'' of the WMO. For the study of atmospheric transports the natural radionuclides Rn-222, Be-7, Pb-210, Pb- 214 and Bi-214 are continuously measured at the Umweltforschungsstation Schneefernerhaus (2650 m) and at the Zugspitze (2962 m) by the Deutscher Wetterdienst (DWD, German Weather Service). The measurements support the classification of atmospheric transport, atmospheric dilution and dispersion models of gaseous and aerosol bond micro pollutants. Results are carried out in combination with meteorological data. It is shown the optimization and effect of a new sampling site for the measurement of Rn-222 activity at the Zugspitze. Results of Rn-222 and Be-7 concentrations are shown in relation to horizontal and vertical dispersion of air masses. The origin of natural Rn-222 and Be-7 are known, therefore both nuclides are well suited for the research of atmospheric transport. Rn-222 is an ideal tracer, because there is no influence by atmospheric processes (chemical processes, wash out effects).
Desprez, Pierre-Yves; Campisi, Judith
2014-09-30
A method for treatment and amelioration of breast, cervical, ovarian, endometrial, squamous cells, prostate cancer and melanoma in a patient comprising targeting Id-1 or Id-2 gene expression with a delivery vehicle comprising a product which modulates Id-1 or Id-2 expression.
One ID Card for the Entire Campus.
Ridenour, David P.; Ferguson, Linda M.
1986-01-01
The implementation by Indiana State University of a machine-readable photo ID system for their food services prompted an investigation into the available alternatives and requirements for a more efficient all-University ID card system. The new ID system is described. (AUTHOR/MLW)
Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer
International Nuclear Information System (INIS)
Carey, Jason PW; Asirvatham, Ananthi J; Galm, Oliver; Ghogomu, Tandeih A; Chaudhary, Jaideep
2009-01-01
Inhibitor of differentiation 4 (Id4), a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH) transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP) analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS), expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR), p21, p27 and p53 expression in DU145 cells. The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously silenced tumor suppressors
20 CFR 222.12 - Ceremonial marriage relationship.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Ceremonial marriage relationship. 222.12 Section 222.12 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.12 Ceremonial marriage...
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.222 Section 284.222 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Blanket Certificates Authorizing Certain Transportation by Interstate Pipelines on Behalf of Others and...
microRNA-222 modulates liver fibrosis in a murine model of biliary atresia
Energy Technology Data Exchange (ETDEWEB)
Shen, Wen-jun; Dong, Rui; Chen, Gong, E-mail: chengongzlp@hotmail.com; Zheng, Shan
2014-03-28
Highlights: • The RRV infected group showed cholestasis, retardation and extrahepatic biliary atresia. • miR-222 was highly expressed, and PPP2R2A was inhibited in the murine biliary atresia model. • miR-222 profoundly modulated the process of fibrosis in the murine biliary atresia model. • miR-222 might represent a potential target for improving biliary atresia prognosis. - Abstract: microRNA-222 (miR-222) has been shown to initiate the activation of hepatic stellate cells, which plays an important role in the pathogenesis of liver fibrosis. The aim of our study was to evaluate the role of miR-22 in a mouse model of biliary atresia (BA) induced by Rhesus Rotavirus (RRV) infection. New-born Balb/c mice were randomized into control and RRV infected groups. The extrahepatic bile ducts were evaluated. The experimental group was divided into BA group and negative group based on histology. The expression of miR-222, protein phosphatase 2 regulatory subunit B alpha (PPP2R2A), proliferating cell nuclear antigen (PCNA) and phospho-Akt were detected. We found that the experimental group showed signs of cholestasis, retardation and extrahepatic biliary atresia. No abnormalities were found in the control group. In the BA group, miR-222, PCNA and Akt were highly expressed, and PPP2R2A expression was significantly inhibited. Our findings suggest that miR-222 profoundly modulated the process of fibrosis in the murine BA model, which might represent a potential target for improving BA prognosis.
microRNA-222 modulates liver fibrosis in a murine model of biliary atresia
International Nuclear Information System (INIS)
Shen, Wen-jun; Dong, Rui; Chen, Gong; Zheng, Shan
2014-01-01
Highlights: • The RRV infected group showed cholestasis, retardation and extrahepatic biliary atresia. • miR-222 was highly expressed, and PPP2R2A was inhibited in the murine biliary atresia model. • miR-222 profoundly modulated the process of fibrosis in the murine biliary atresia model. • miR-222 might represent a potential target for improving biliary atresia prognosis. - Abstract: microRNA-222 (miR-222) has been shown to initiate the activation of hepatic stellate cells, which plays an important role in the pathogenesis of liver fibrosis. The aim of our study was to evaluate the role of miR-22 in a mouse model of biliary atresia (BA) induced by Rhesus Rotavirus (RRV) infection. New-born Balb/c mice were randomized into control and RRV infected groups. The extrahepatic bile ducts were evaluated. The experimental group was divided into BA group and negative group based on histology. The expression of miR-222, protein phosphatase 2 regulatory subunit B alpha (PPP2R2A), proliferating cell nuclear antigen (PCNA) and phospho-Akt were detected. We found that the experimental group showed signs of cholestasis, retardation and extrahepatic biliary atresia. No abnormalities were found in the control group. In the BA group, miR-222, PCNA and Akt were highly expressed, and PPP2R2A expression was significantly inhibited. Our findings suggest that miR-222 profoundly modulated the process of fibrosis in the murine BA model, which might represent a potential target for improving BA prognosis
Inhibitor of differentiation 4 (Id4 is a potential tumor suppressor in prostate cancer
Directory of Open Access Journals (Sweden)
Carey Jason PW
2009-06-01
Full Text Available Abstract Background Inhibitor of differentiation 4 (Id4, a member of the Id gene family is also a dominant negative regulator of basic helix loop helix (bHLH transcription factors. Some of the functions of Id4 appear to be unique as compared to its other family members Id1, Id2 and Id3. Loss of Id4 gene expression in many cancers in association with promoter hypermethylation has led to the proposal that Id4 may act as a tumor suppressor. In this study we provide functional evidence that Id4 indeed acts as a tumor suppressor and is part of a cancer associated epigenetic re-programming. Methods Data mining was used to demonstrate Id4 expression in prostate cancer. Methylation specific polymerase chain reaction (MSP analysis was performed to understand molecular mechanisms associated with Id4 expression in prostate cancer cell lines. The effect of ectopic Id4 expression in DU145 cells was determined by cell cycle analysis (3H thymidine incorporation and FACS, expression of androgen receptor, p53 and cyclin dependent kinase inhibitors p27 and p21 by a combination of RT-PCR, real time-PCR, western blot and immuno-cytochemical analysis. Results Id4 expression was down-regulated in prostate cancer. Id4 expression was also down-regulated in prostate cancer line DU145 due to promoter hyper-methylation. Ectopic Id4 expression in DU145 prostate cancer cell line led to increased apoptosis and decreased cell proliferation due in part by an S-phase arrest. In addition to S-phase arrest, ectopic Id4 expression in PC3 cells also resulted in prolonged G2/M phase. At the molecular level these changes were associated with increased androgen receptor (AR, p21, p27 and p53 expression in DU145 cells. Conclusion The results suggest that Id4 acts directly as a tumor suppressor by influencing a hierarchy of cellular processes at multiple levels that leads to a decreased cell proliferation and change in morphology that is possibly mediated through induction of previously
A Contextual Model for Identity Management (IdM) Interfaces
Fuller, Nathaniel J.
2014-01-01
The usability of Identity Management (IdM) systems is highly dependent upon design that simplifies the processes of identification, authentication, and authorization. Recent findings reveal two critical problems that degrade IdM usability: (1) unfeasible techniques for managing various digital identifiers, and (2) ambiguous security interfaces.…
DEFF Research Database (Denmark)
Jensen, Tenna; Jespersen, Astrid Pernille; Grønnow, Liv Cæcilie
2015-01-01
Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune.......Idékataloget er en selvstændig publikation hørende til projekt Appetit på maden. Idékataloget er udviklet til brug i Københavns Kommune....
21 CFR 1305.17 - Preservation of DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Preservation of DEA Forms 222. 1305.17 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.17 Preservation of DEA Forms 222. (a) The purchaser must retain Copy 3 of each executed DEA Form 222 and all copies of unaccepted or defective forms with each...
222Rn in wine cellars in Hungary
International Nuclear Information System (INIS)
Csige, I.; Hunyadi, I.; Szerbin, P.; Juhasz, L.
2004-01-01
We measured seasonal average 222 Rn activity concentrations in the air of 60 wine cellars in the Tokajhegyalja and Villany wine regions of Hungary using Radamon type etched track radon detectors. The exposure period was 3 months, matching the seasons of 2003-2004. We also used an ionization chamber-type continuous 222 Rn-monitor (AlphaGUARD PQ222, Genitron Instruments, Germany) to study temporal variations of 222 Rn activity concentration in a selected wine cellar in the Tokajhegyalja wine region. This instruments also recorded temperature, atmospheric pressure and relative humidity data. The etched track detector data revealed that the 222 Rn activity concentrations in the air of wine cellars spread over a wide range, from the ambient outdoor concentration of 6 Bq.m -3 up to 6 kBq.m -3 characteristic of natural caves. The temporal variation of 222 Rn activity concentration in the air of the selected cellar varied inversely with the variation of the atmospheric pressure. Earlier we observed similar phenomena in natural karstic caves connected to the surface with vertical shafts only. This suggests that relatively large volume of pore space of the embedding rock communicates with the volume of the cellar induced by the variation of the atmospheric pressure
20 CFR 222.4 - Homicide of employee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Homicide of employee. 222.4 Section 222.4... RELATIONSHIPS General § 222.4 Homicide of employee. No person convicted of the felonious and intentional homicide of an employee can be entitled to an annuity or lump-sum payment based on the employee's earnings...
4 CFR 22.2 - Board Consideration [Rule 2].
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Board Consideration [Rule 2]. 22.2 Section 22.2 Accounts... OFFICE CONTRACT APPEALS BOARD § 22.2 Board Consideration [Rule 2]. (a) Offices. The office of the Board... consideration of a matter by all members of the Contract Appeals Board will not be granted in any appeal filed...
DEFF Research Database (Denmark)
Babakhanyan, Anna; Leke, Rose G F; Salanti, Ali
2014-01-01
In pregnant women, Plasmodium falciparum-infected erythrocytes expressing the VAR2CSA antigen bind to chondroitin sulfate A in the placenta causing placental malaria. The binding site of VAR2CSA is present in the ID1-ID2a region. This study sought to determine if pregnant Cameroonian women natura...
12 CFR 222.27 - Renewal of opt-out.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Renewal of opt-out. 222.27 Section 222.27 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.27 Renewal of opt-out. (a) Renewal notice and...
Evaluation of ID-PaGIA syphilis antibody test.
Naaber, Paul; Makoid, Ene; Aus, Anneli; Loivukene, Krista; Poder, Airi
2009-01-01
Laboratory diagnosis of syphilis is usually accomplished by serology. There are currently a large number of different commercial treponemal tests available that vary in format, sensitivity and specificity. To evaluate the ID-PaGIA Syphilis Antibody Test as an alternative to other specific treponemal tests for primary screening or confirmation of diagnosis. Serum samples from healthy adults (n = 100) were used for detection of specificity of ID-PaGIA. To evaluate sensitivity of ID-PaGIA serum samples (n = 101) from patients with confirmed or suspected syphilis were tested for syphilis antibodies with FTA-Abs IgM, ID-PaGIA, ELISA IgM and TPHA tests. No false-positive results were found with ID-PaGIA. Sensitivity of various treponemal tests was the following: FTA-Abs IgM: 95.5%, ID-PaGIA and ELISA IgM: 94%, and TPHA 75%. The positive and negative predictive values of ID-PaGIA were 100 and 89.5%, respectively. Compared with other treponemal tests ID-PaGIA has excellent sensitivity and specificity.
Realization of a reference system for the generation radon 222
International Nuclear Information System (INIS)
Guelin, M.
1990-11-01
After some general considerations on radon and its calibration techniques, the methods and technologies developed in order to realize a reference system for the generation of radon 222 are presented. Two original patented techniques have been developed. The former technique deals with the realization of radon 222 solid sources from radium 226 deposit on acrylic fibres. This new technology offers the advantage of very quickly obtaining a constant emission rate near to 100%. The latter technique deals with the standard measurement of radon 222 volumic activity via gamma spectrometry of its short-lived daughters. This new procedure is the only one allowing to relate this measure to gaseous standards. An aeraulic/ventilation circuit makes it possible to calibrate the radon measurement instrumentation within a wide volumic activity range from to 4 to 4 000 Bq/m 3
International Nuclear Information System (INIS)
Doerr, H.; Muennich, K.O.
1990-01-01
Measurements of the 222 Rn activity concentration profile in the soil and the 222 Rn flux in West-Germany are presented. The spatial pattern of the 222 Rn flux depends more on soil type than on the 226 Ra activity of the soil material. The average 222 Rn flux from sandy soils is 1000-2000 dpm m -2 h -1 and 4000-6000 dpm m -2 h -1 froam loamy and clayey soils. Weekly 222 Rn flux measurements during a period of 1 year at a sandy site show no significant temporal variations. At a clayey site, the 222 Rn flux tends to be higher in summer than in winter. The permeability coefficient P Rn , obtained from simultaneous 222 Rn flux and concentration profile measurements in various soils, can be expressed as a function of the soil parameters total porosity ε 0 , soil moisture F, tortuosity k and the molecular diffusion coefficient D 0 of 222 Rn in air: P = D 0 ((ε 0 -F)/k-const.). The flux of any other gas into or out of the soil can thus be calculated from its measured concentration profile in the soil and from the 222 Rn permeability coefficient, replacing the molecular diffusion coefficient of 222 Rn by that of the specific gas under consideration. As an example, this method of flux determination is demonstrated for the soil CO 2 flux to the atmosphere and for the flux of atmospheric CH 4 into the soil. (author) 14 refs
International Nuclear Information System (INIS)
Buchli, R.; Burkart, W.
1989-01-01
The external gamma radiation and the indoor air Rn (222Rn) concentration were measured in 55 houses of the South East Grisons, the Urseren valley, and the Upper Rhine valley (crystalline subsoils) and in 39 houses of the Molasse basin and the Helvetic nappes (sedimentary subsoils). In homes located on a crystalline subsoil, a mean cellar gamma level of 1.40 mGy y-1 was measured, which is twice the mean gamma level of 0.70 mGy y-1 found in homes built on a sedimentary subsoil. The cellar 222Rn gas concentration is about six times higher in houses with a crystalline subsoil (1232 Bq m-3) than in houses with a sedimentary subsoil (201 Bq m-3). Although a weak correlation is observed between the mean gamma radiation levels and mean cellar 222Rn gas concentrations for the five subregions investigated, the gamma levels and the 222Rn gas concentrations do not correlate for single homes. For the population living on the ground floor of a house with a crystalline subsoil, the gamma radiation and the indoor air 222Rn lead to estimated mean exposures of 1.16 mSv and 9.44 mSv effective dose equivalent per year, respectively. In houses with a sedimentary subsoil, these mean exposures lead to 0.68 mSv y-1 and 3.22 mSv y-1, respectively. A mean tap water 222Rn content of 38.3 Bq L-1 and 10.4 Bq L-1 was measured in 31 villages with a crystalline subsoil and 73 villages with a sedimentary subsoil, respectively. Radon-222 degasing from the tap water into the indoor air leads to an additional exposure of about 0.11 mSv y-1 and 0.03 mSv y-1 in homes with a crystalline subsoil and homes with a sedimentary subsoil, respectively
21 CFR 1305.12 - Procedure for executing DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for executing DEA Forms 222. 1305.12... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.12 Procedure for executing DEA Forms 222. (a) A purchaser must prepare and execute a DEA Form 222 simultaneously in triplicate by means of interleaved...
Facts about Infectious Diseases (ID)
... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...
21 CFR 1305.16 - Lost and stolen DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Lost and stolen DEA Forms 222. 1305.16 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.16 Lost and stolen DEA Forms 222. (a) If a purchaser ascertains that an unfilled DEA Form 222 has been lost, he or she must execute another in triplicate and...
21 CFR 1305.15 - Unaccepted and defective DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Unaccepted and defective DEA Forms 222. 1305.15... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.15 Unaccepted and defective DEA Forms 222. (a) A DEA Form 222 must not be filled if either of the following apply: (1) The order is not complete...
Use of Tricaine Methanesulfonate (MS222) for Euthanasia of Reptiles
Conroy, CJ; Papenfuss, T; Parker, J; Hahn, NE
2009-01-01
Tricaine methanesulfonate (MS222) injected into the intracoelomic cavity of reptiles was evaluated as a chemical euthanasia method. Three western fence lizards, 2 desert iguanas, 4 garter snakes, and 6 geckos were euthanized by intracoelomic injection of 250 to 500 mg/kg of 0.7% to 1% sodium-bicarbonate–buffered MS222 solution followed by intracoelomic injection of 0.1 to 1.0 ml unbuffered 50% (v/v) MS222 solution. A simple 2-stage protocol for euthanasia of reptiles by using MS222 is outlined. In addition, the conditions for safe use of MS222 are discussed. MS222 offers an alternative to sodium pentobarbital for euthanasia of reptiles. PMID:19245747
Extreme levels of 222Rn and U in a private water supply
International Nuclear Information System (INIS)
Lowry, J.D.; Hoxie, D.C.; Moreau, E.
1987-01-01
In 1985, the Maine Department of Human Services discovered a private water supply in Leeds, ME, that contains over 40,700 BqL -1 (1.1 x 10 +6 pCil -1 ) of 222 Rn on average, and ranges between 13,300 and 59,200 Bql -1 . The well water also contains a gross alpha concentration of approximately 10.0 BqL -1 (270 pCiL -1 ), of which more than 95 percent is U (403 ugL -1 ). The ratio of 234 U to 238 U averages 1.17, which compares closely to the sea water at 1.14. The Ra content comprises less than 2 percent of the gross alpha. The levels of 222 Rn and U are considered to be extremely high, with the 222 Rn being the highest known level the authors are aware of for a drinking water supply. This area of Maine has geologic features characteristic of those shown by others to have a high potential for elevated levels of 222 Rn and other radioisotopes. The purpose of this paper is to update the information presented previously about this site, in particular to the ramifications on treatment alternatives associated with the presence of both 222 Rn and U in a water supply
Kloos, W E; George, C G
1991-01-01
The accuracies of the MicroScan Pos ID and Rapid Pos ID panel systems (Baxter Diagnostic Inc., MicroScan Division, West Sacramento, Calif.) were compared with each other and with the accuracies of conventional methods for the identification of 25 Staphylococcus species and 4 subspecies. Conventional methods included those used in the original descriptions of species and subspecies and DNA-DNA hybridization. The Pos ID panel uses a battery of 18 tests, and the Rapid Pos ID panel uses a battery of 42 tests for the identification of Staphylococcus species. The Pos ID panel has modified conventional and chromogenic tests that can be read after 15 to 48 h of incubation; the Rapid Pos ID panel has tests that use fluorogenic substrates or fluorometric indicators, and test results can be read after 2 h of incubation in the autoSCAN-W/A. Results indicated that both MicroScan systems had a high degree of congruence (greater than or equal to 90%) with conventional methods for the species S. capitis, S. aureus, S. auricularis, S. saprophyticus, S. cohnii, S. arlettae, S. carnosus, S. lentus, and S. sciuri and, in particular, the subspecies S. capitis subsp. capitis and S. cohnii subsp. cohnii. The Rapid Pos ID panel system also had greater than or equal to 90% congruence with conventional methods for S. epidermidis, S. caprae, S. warneri subsp. 2, S. xylosus, S. kloosii, and S. caseolyticus. For both MicroScan systems, congruence with conventional methods was 80 to 90% for S. haemolyticus subsp. 1, S. equorum, S. intermedius, and S. hyicus; and in addition, with the Rapid Pos ID panel system congruence was 80 to 89% for S. capitis subsp. ureolyticus, S. warneri subsp. 1, S. hominis, S. cohnii subsp. urealyticum, and S. simulans. The MicroScan systems identified a lower percentage (50 to 75%) of strains of S. lugdunensis, S. gallinarum, S. schleiferi, and S. chromogenes, although the addition of specific tests to the systems might increase the accuracy of identification
222-S laboratory quality assurance plan
International Nuclear Information System (INIS)
Meznarich, H.K.
1995-01-01
This document provides quality assurance guidelines and quality control requirements for analytical services. This document is designed on the basis of Hanford Analytical Services Quality Assurance Plan (HASQAP) technical guidelines and is used for governing 222-S and 222-SA analytical and quality control activities. The 222-S Laboratory provides analytical services to various clients including, but not limited to, waste characterization for the Tank Waste Remediation Systems (TWRS), waste characterization for regulatory waste treatment, storage, and disposal (TSD), regulatory compliance samples, radiation screening, process samples, and TPA samples. A graded approach is applied on the level of sample custody, QC, data verification, and data reporting to meet the specific needs of the client
21 CFR 1305.13 - Procedure for filling DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for filling DEA Forms 222. 1305.13... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.13 Procedure for filling DEA Forms 222. (a) A purchaser must submit Copy 1 and Copy 2 of the DEA Form 222 to the supplier and retain Copy 3 in the...
21 CFR 1305.14 - Procedure for endorsing DEA Forms 222.
2010-04-01
... on the reverse sides of Copies 1 and 2 of the DEA Form 222) the name and address of the second... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for endorsing DEA Forms 222. 1305.14... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.14 Procedure for endorsing DEA Forms 222. (a) A...
20 CFR 222.13 - Common-law marriage relationship.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Common-law marriage relationship. 222.13 Section 222.13 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.13 Common-law marriage...
21 CFR 1305.11 - Procedure for obtaining DEA Forms 222.
2010-04-01
... the name, address, and registration number of the registrant and the number of books of DEA Forms 222... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for obtaining DEA Forms 222. 1305.11... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.11 Procedure for obtaining DEA Forms 222. (a) DEA...
33 CFR 222.4 - Reporting earthquake effects.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Reporting earthquake effects. 222..., DEPARTMENT OF DEFENSE ENGINEERING AND DESIGN § 222.4 Reporting earthquake effects. (a) Purpose. This... significant earthquakes. It primarily concerns damage surveys following the occurrences of earthquakes. (b...
Characterization of 222Rn entry into a basement structure surrounded by low permeability soil
International Nuclear Information System (INIS)
Ward, D.C.
1992-01-01
An experimental facility has been developed to monitor the entry rate and concentration of 222 Rn in two basement type structures surrounded by soil having a permeability on the order of 1- -12 m 2 . A data acquisition system recorded environmental conditions outside and inside the structures, including basement air exchange rates, every 15 min. Indoor 222 Rn concentrations ranged from 400 to 1400 Bq m -3 . The observed 222 Rn entry rate is highly variable and has two primary components; a constant input rate caused by diffusion of 222 Rn through the concrete walls and floor, and a variable rate that depends upon indoor-soil pressure differentials of only a few pascals. Pressure differentials are dependent upon wind speed and wind direction. Stack effect was not significant. During a two week period, with relatively calm winds, diffusion through the concrete walls and floor plus the floor-wall joint accounted for more than 80% of the total 222 Rn entry
27 CFR 26.222 - Still wines containing carbon dioxide.
2010-04-01
... carbon dioxide. 26.222 Section 26.222 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... ISLANDS Formulas for Products From the Virgin Islands § 26.222 Still wines containing carbon dioxide. (a) General. Still wines may contain not more than 0.392 gram of carbon dioxide per 100 milliliters of wine...
7 CFR 1280.222 - Books and Records of Board.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and Records of Board. 1280.222 Section 1280.222... INFORMATION ORDER Lamb Promotion, Research, and Information Order Reports, Books, and Records § 1280.222 Books and Records of Board. The Board shall: (a) Maintain such books and records, which shall be made...
A novel albumin gene mutation (R222I) in familial dysalbuminemic hyperthyroxinemia.
Schoenmakers, Nadia; Moran, Carla; Campi, Irene; Agostini, Maura; Bacon, Olivia; Rajanayagam, Odelia; Schwabe, John; Bradbury, Sonia; Barrett, Timothy; Geoghegan, Frank; Druce, Maralyn; Beck-Peccoz, Paolo; O'Toole, Angela; Clark, Penelope; Bignell, Michelle; Lyons, Greta; Halsall, David; Gurnell, Mark; Chatterjee, Krishna
2014-07-01
Familial dysalbuminemic hyperthyroxinemia, characterized by abnormal circulating albumin with increased T4 affinity, causes artefactual elevation of free T4 concentrations in euthyroid individuals. Four unrelated index cases with discordant thyroid function tests in different assay platforms were investigated. Laboratory biochemical assessment, radiolabeled T4 binding studies, and ALB sequencing were undertaken. (125)I-T4 binding to both serum and albumin in affected individuals was markedly increased, comparable with known familial dysalbuminemic hyperthyroxinemia cases. Sequencing showed heterozygosity for a novel ALB mutation (arginine to isoleucine at codon 222, R222I) in all four cases and segregation of the genetic defect with abnormal biochemical phenotype in one family. Molecular modeling indicates that arginine 222 is located within a high-affinity T4 binding site in albumin, with substitution by isoleucine, which has a smaller side chain predicted to reduce steric hindrance, thereby facilitating T4 and rT3 binding. When tested in current immunoassays, serum free T4 values from R222I heterozygotes were more measurably abnormal in one-step vs two-step assay architectures. Total rT3 measurements were also abnormally elevated. A novel mutation (R222I) in the ALB gene mediates dominantly inherited dysalbuminemic hyperthyroxinemia. Susceptibility of current free T4 immunoassays to interference by this mutant albumin suggests likely future identification of individuals with this variant binding protein.
20 CFR 222.14 - Deemed marriage relationship.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Deemed marriage relationship. 222.14 Section... FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.14 Deemed marriage relationship... may still be found to have the relationship as spouse of an employee based upon a deemed marriage. A...
20 CFR 222.53 - When a legally adopted child is dependent-child adopted after entitlement.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-child adopted after entitlement. 222.53 Section 222.53 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.53 When...
Design and construction of a system for determination of Radon-222 by a surface-barrier detector
International Nuclear Information System (INIS)
Bonifacio M, J.; Iturbe, J.L.
1993-01-01
In the present work the design and construction of a system for the determination of 222 Rn is described, which utilizes silicon surface-barrier detectors. The 222 Rn gas was obtained a source of 226 Ra electrodeposited on stainless-steel discs. The well separated energies with this system makes possible the measurement and identification of alpha particles of 222 Rn, and its daughters 210 Po, 218 Po and 214 Po. (Author) 3 figs, 19 refs
20 CFR 222.35 - Relationship as stepchild.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as stepchild. 222.35 Section 222.35 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY... the relationship of stepchild of an employee, and will be considered a child for annuity but not for...
48 CFR 252.222-7002 - Compliance with local labor laws (overseas).
2010-10-01
... labor laws (overseas). 252.222-7002 Section 252.222-7002 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7002 Compliance with local labor laws (overseas). As prescribed in 222.7201(a), use the following clause: Compliance with Local Labor Laws (Overseas) (JUN 1997...
Exposure of burrowing mammals to {sup 222}Rn
Energy Technology Data Exchange (ETDEWEB)
Beresford, N.A., E-mail: nab@ceh.ac.uk [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Barnett, C.L. [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Vives i Batlle, J. [Belgian Nuclear Research Centre (SCK-CEN), Boeretang 200, 2400 Mol (Belgium); Potter, E.D. [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Ibrahimi, Z.-F. [Health Protection Agency, Centre for Radiation, Chemical and Environmental Hazards, Chilton, Didcot OX11 0RQ (United Kingdom); Barlow, T.S.; Schieb, C.; Jones, D.G. [British Geological Survey, Environmental Science Centre, Keyworth, Nottingham NG12 5GG (United Kingdom); Copplestone, D. [School of Natural Sciences, University of Stirling, Stirling FK9 4LA (United Kingdom)
2012-08-01
Estimates of absorbed dose rates to wildlife from exposure to natural background radionuclides are required to put estimates of dose rates arising from regulated releases of radioactivity and proposed benchmarks into context. Recent review papers have estimated dose rates to wildlife from {sup 40}K, and {sup 238}U and {sup 232}Th series radionuclides. However, only one study previous has considered the potential dose rates to burrowing animals from inhaled {sup 222}Rn and its daughter products. In this paper we describe a study conducted at seven sites in northwest England. Passive track etch detectors were used to measure the {sup 222}Rn concentrations in artificial burrows over a period of approximately one year. Results suggest that absorbed dose rates to burrowing mammals as a consequence of exposure to {sup 222}Rn are likely to be at least an order of magnitude higher than those suggested in previous evaluations of natural background exposure rates which had omitted this radionuclide and exposure pathway. Dose rates in some areas of Great Britain will be considerably in excess of incremental no-effects benchmark dose rates suggested for use as screening levels. Such advised benchmark dose rates need to be better put into context with background dose rates, including exposure to {sup 222}Rn, to ensure credibility; although the context will be determined by the purpose of the benchmark and the assessment level. - Highlights: Black-Right-Pointing-Pointer Determined {sup 222}Rn concentrations in artificial burrows. Black-Right-Pointing-Pointer Estimated dose rates to burrowing mammals from inhaled {sup 222}Rn and daughter products. Black-Right-Pointing-Pointer {sup 222}Rn likely to dominate exposure of burrowing mammals due to natural radionuclides.
21 CFR 1305.19 - Cancellation and voiding of DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Cancellation and voiding of DEA Forms 222. 1305.19... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.19 Cancellation and voiding of DEA Forms 222. (a) A purchaser may cancel part or all of an order on a DEA Form 222 by notifying the supplier in...
36 CFR 222.10 - Range betterment fund.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Range betterment fund. 222.10... MANAGEMENT Grazing and Livestock Use on the National Forest System § 222.10 Range betterment fund. In... also be accomplished through use of the range betterment fund as follows: (a) On National Forest land...
20 CFR 222.34 - Relationship resulting from equitable adoption.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship resulting from equitable adoption. 222.34 Section 222.34 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.34 Relationship resulting from...
Dependence of indoor 222Rn level on building materials
International Nuclear Information System (INIS)
Tso, M.W.; Ng, C.; Leung, J.K.C.
1993-01-01
The radionuclide contents of typical building materials used in Hong Kong were studied by γ spectroscopic analysis. The physical properties of these building materials affecting the production and transportation of 222 Rn to the surrounding air were examined; these include the emanation coefficient of 2 '2 2 Rn of the material, the diffusion coefficient of 222 Rn in the material and the effect of surface coating and temperature on the rate of 222 Rn exhalation. Results obtained in this study explain the indoor 222 Rn concentration observed in our previous surveys and also suggest that the main source of indoor 222 Rn in Hong Kong is building material. (3 figs., 4 tabs.)
Theoretical study of the diffusion 222Rn gas on activated charcoal
International Nuclear Information System (INIS)
Lopez, Fabio O.; Canoba, Analia C.
2001-01-01
The 222 Rn adsorption coefficient is the fundamental parameter characterizing activated carbon's ability to adsorb 222 Rn . In this work, it has been determined the 222 Rn coefficient adsorption for 222 Rn activated carbon detectors. Scintillation vials were used as detectors. The measurement of the 222 Rn activity adsorbed in activated carbon was made by a liquid scintillation measurement of its alpha-beta progeny decay. On the other hand, in this work a diffusion and adsorption model has been developed for the transport of 222 Rn in an activated carbon porous bed. The equation that describes these processes is a partial differential equation, of the second order with respect to axial coordinate, and the first order with respect to time. The equation was numerically solved using a finites differences method. With this model the 222 Rn activity adsorbed in the detector, for several situations, was calculated. The results were tested with the data obtained from series of experiences made in our laboratories. (author)
20 CFR 222.33 - Relationship resulting from legal adoption.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship resulting from legal adoption. 222.33 Section 222.33 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.33 Relationship resulting from legal adoption...
A process-based 222radon flux map for Europe and its comparison to long-term observations
Karstens, U.; Schwingshackl, C.; Schmithüsen, D.; Levin, I.
2015-11-01
Detailed 222radon (222Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution 222Rn flux map for Europe, based on a parameterization of 222Rn production and transport in the soil. The 222Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based 222Rn soil profile measurements. Monthly 222Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083° × 0.083° and compared to long-term direct measurements of 222Rn exhalation rates in different areas of Europe. The two realizations of the 222Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean 222Rn flux from soils in Europe is estimated to be 10 mBq m-2 s-1 (ERA-Interim/Land soil moisture) or 15 mBq m-2 s-1 (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m-2 s-1 and from ca. 11 to ca. 20 mBq m-2 s-1, respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of 222Rn exhalation rates. Comparison with observations suggests that the flux estimates based on the GLDAS Noah soil moisture model on average better
A process-based 222radon flux map for Europe and its comparison to long-term observations
International Nuclear Information System (INIS)
Karstens, U.; Schwingshackl, C.; Schmithuesen, D.; Levin, I.
2015-01-01
Detailed 222 radon ( 222 Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution 222 Rn flux map for Europe, based on a parameterization of 222 Rn production and transport in the soil. The 222 Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based 222 Rn soil profile measurements. Monthly 222 Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083 x 0.083 and compared to long-term direct measurements of 222 Rn exhalation rates in different areas of Europe. The two realizations of the 222 Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean 222 Rn flux from soils in Europe is estimated to be 10 mBq m -2 s -1 (ERA-Interim/Land soil moisture) or 15 mBq m -2 s -1 (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m -2 s -1 and from ca. 11 to ca. 20 mBq m -2 s -1 , respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of 222 Rn exhalation rates. Comparison with observations suggests that the flux estimates based on the GLDAS Noah soil moisture model on
21 CFR 1305.18 - Return of unused DEA Forms 222.
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Return of unused DEA Forms 222. 1305.18 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.18 Return of unused DEA Forms 222. If the registration... substances for which the purchaser is registered, the purchaser must return all unused DEA Forms 222 to the...
Measurement of 222Rn in soil concentrations in interstitial air
International Nuclear Information System (INIS)
Duenas, C.; Fernandez, M.C.; Carretero, J.; Liger, E.
1996-01-01
Measurements of 222 Rn soil concentrations were made by inserting stainless-steel sampling tubes into the soil. The samples of the soil interstitial air were taken in to pre-evacuated 1 L glass flasks. The glass flasks are cylindrical and coated with a film of ZnS(Ag). 222 Rn was measured by counting the alpha particles emitted by 222 Rn and its daughter products, 218 Po and 214 Bi, when they reached radioactive equilibrium. Measurements of 222 Rn gas concentrations in the soil air interstices by the method at different depths were used to calculate the diffusion coefficient of the 222 Rn in the soil air. This study has been carried out for diverse soils. (Author)
Method for determination of radon-222 in water by liquid scintillation counting
International Nuclear Information System (INIS)
Suomela, J.
1993-06-01
The procedure for the determination of radon-222 by liquid scintillation counting is quite specific for this radionuclide. Radon-222 is extracted readily from the water sample by an organic scintillant. The decay products of radon-222 will remain in the water phase whilst radon-222 will be extracted into the organic phase. Before measurement the sample is stored for three hours until equilibrium is reached between radon-222 and its alpha emitting decay products. The alpha activity from radon-222 and its decay products is measured in a liquid scintillation counter
Increased Inhibitor of Differentiation 4 (Id4 Expression in Glioblastoma: A Tissue Microarray Study
Directory of Open Access Journals (Sweden)
Weifin Zeng, Elisabeth J. Rushing, Daniel P. Hartmann, Norio Azumi
2010-01-01
Full Text Available Background: The inhibitor of differentiation/DNA binding protein family (Id1-4 is involved in cell cycle control, tumorigenesis and angiogenesis through the negative regulation of helix-loop-helix transcription factors. Of these proteins, Id4 is known to play an important role in neural stem cell differentiation, and deregulation has been implicated in glial neoplasia. However, the expression and significance of Id4 in astrocytomas has not been fully addressed. Herein we report the differential expression of Id4 in astrocytomas of various grades using tissue microarrays (TMA and immunohistochemistry (IHC. Design: The GBM TMA was constructed from 53 archival cases at Georgetown University Hospital and a TMA with normal brain controls and grades II-III astrocytoma was obtained from Cybrdi (Rockville, MD. TMA sections were stained with Id4 antibody and the slides were scored according to the percentage of staining astrocytic nuclei (<9% -, 10-50% +, >51% ++. The Fisher Exact test was used to test for statistical significance. Results: Nuclear staining for Id4 was seen in 73.58% GBMs, 25% grade III, and 12.5% grade II astrocytomas; staining was absent in normal brain tissue. There was a statistically significant difference between GBM and grades II, III astrocytoma (p <0.01. Significant Id4 expression was not detected in normal brain. Conclusions: Our study confirms the frequent upregulation of Id4 expression in GBM, which lends support to its role in tumorigenesis, possibly in the transformation of low to high-grade astrocytoma (i.e. GBM. Further studies are warranted to determine the precise role of Id4 in glial neoplasia and its potential use in targeted therapy for GBM.
20 CFR 222.3 - Other regulations related to this part.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 222.3 Section 222.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.3 Other regulations related to this part. This part is related to a...
Commissioning of the IDS Neutron Detector and $\\beta$-decay fast-timing studies at IDS
Piersa, Monika
2016-01-01
The following report describes my scientific activities performed during the Summer Student Programme at ISOLDE. The main part of my project was focused on commissioning the neutron detector dedicated to nuclear decay studies at ISOLDE Decay Station (IDS). I have participated in all the steps needed to make it operational for the IS609 experiment. In the testing phase, we obtained expected detector response and calibrations confirmed its successful commissioning. The detector was mounted in the desired geometry at IDS and used in measurements of the beta-delayed neutron emission of $^8$He. After completing aforementioned part of my project, I became familiar with the fast-timing method. This technique was applied at IDS in the IS610 experiment performed in June 2016 to explore the structure of neutron-rich $^{130-134}$Sn nuclei. Since the main part of my PhD studies will be the analysis of data collected in this experiment, the second part of my project was dedicated to acquiring knowledge about technical de...
Excess bottom radon 222 distribution in deep ocean passages
International Nuclear Information System (INIS)
Sarmiento, J.L.; Broecker, W.S.; Biscaye, P.E.
1978-01-01
Radon 222 and STD profiles were obtained as part of the Geosecs program in the Vema Channel in the southwest Atlantic Ocean and in the Samoan, Clarion, and Wake Island passages in the Pacific Ocean. The standing crop of excess radon 222 is higher in the passages than at other nearby locations. The most likely explanation for this is that there is a high flux of radon 222 from the floor of the passages. Since much of the floor is covered with manganese nodules and encrustations, the high flux of radon 222 may be attributable to the high concentrations of radium 226 in the outer few millimeters of such deposits. Laboratory measurements of radon 222 emissivity from maganese encrustations obtained in Vema Channel support this hypothesis. The excess radon 222 in the Vema Channel and Wake Island Passage is found in substantial quantities at heights above bottom greatly exceeding the heights at which excess radon 222 is found in nonpassage areas. The horizontal diffusion of radon emanating from the walls of the passages is unlikely to be the cause of the observed concentrations because the ratio of wall surface area to water volume is very low. The profiles must therefore be a result of exceptionally high apparent vertical mixing in the passages. Further work is needed to determine the nature of this apparent vertical mixing. The excess radon 222 and STD data in all four passages have been fit with an empirical model in which it is assumed that the bouyancy flux is constant with distance above bottom. The fits are very good and yield apparent buoyancy fluxes that are between 1 and 3 orders of magnitude greater than those obtained at nearby stations outside the passages for three of the four passages
Potable water as a source of airborne 222Rn in US dwellings: a review and assessment
International Nuclear Information System (INIS)
Nazaroff, W.W.; Doyle, S.M.; Nero, A.V.; Sextro, R.G.
1987-01-01
Using a long-term-average, single-cell model and available data for U.S. housing, the concentration of 222 Rn in indoor air due to the use of potable water is assessed. The ratio of the airborne 222 Rn concentration to the concentration in water is represented by a lognormal distribution with geometric mean and geometric standard deviation of 0.65 X 10(-4) and 2.88, respectively, in fair agreement with the previously reported results of direct measurements of the ratio in 13 houses. By combining this result with data on 222 Rn concentrations in U.S. water supplies, potable water is estimated to contribute an average of 24, 1.3, and 0.1 Bq m-3 to the airborne 222 Rn concentration in residences served by private wells, public ground water, and surface water supplies, respectively
International Nuclear Information System (INIS)
Noetzel, Erik; Veeck, Jürgen; Niederacher, Dieter; Galm, Oliver; Horn, Felicitas; Hartmann, Arndt; Knüchel, Ruth; Dahl, Edgar
2008-01-01
Inhibitor of DNA binding/Inhibitor of differentiation 4 (ID4) is a critical factor for cell proliferation and differentiation in normal vertebrate development. ID4 has regulative functions for differentiation and growth of the developing brain. The role of ID1, ID2 and ID3 are expected to be oncogenic due to their overexpression in pancreatic cancer and colorectal adenocarcinomas, respectively. Aside from these findings, loss of ID3 expression was demonstrated in ovarian cancer. The aim of the present study was to reveal the factual role of ID4 in carcinogenesis in more detail, since its role for the pathogenesis of human breast cancer has been discussed controversially, assigning both oncogenic and tumour suppressive functions. ID4 promoter methylation, ID4 mRNA expression and ID4 protein expression were analysed in primary human breast cancer specimens using methylation-specific PCR (MSP) (n=170), semiquantitative realtime RT-PCR (n=46) and immunhistochemistry (n=3), respectively. In order to demonstrate a functional association of ID4 promoter methylation with its gene silencing, we performed DNA demethylation analysis with four human breast cell lines using MSP and semiquantitative realtime RT-PCR. In addition, we performed correlations of ID4 promoter methylation with ID4 mRNA and ID4 protein expression in matched samples of breast tumour and corresponding normal tissue. We carried out statistical analyses in order to find correlations between ID4 promoter methylation and clinicopathological parameters. Frequent ID4 promoter methylation was observed in primary breast cancer samples (69%, 117/170). We found a tight correlation (P<0.0001) between ID4 promoter methylation and loss of ID4 expression in primary breast cancer 3 specimens. Demethylating treatment with breast cancer cell lines was associated with clear ID4 mRNA re-expression. Tumours with ID4 promoter methylation showed distinct loss of ID4 expression on both transcription and protein level
Measurements of octupole collectivity in $^{220,222}$Rn and $^{222,224}$Ra using Coulomb excitation
Kruecken, R; Larsen, A; Hurst, A M; Voulot, D; Grahn, T; Clement, E; Wadsworth, R; Gernhaeuser, R A; Siem, S; Huyse, M L; Iwanicki, J S
2008-01-01
We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{220,222}$Rn and $^{222,224}$Ra ion beams from the REX facility to enable the Coulomb excitation of the first 3$^{-}$ states in these nuclei. By measuring the $\\gamma$-ray yields of the E1 decays from the 3$^{-}$ state using the MINIBALL array we can obtain the transition matrix elements. This will give quantitative information about octupole correlations in these nuclei. We require 22 shifts to fulfil the aims of the experiment.
Vibrations in the urban environment controlling 222Rn migration in soils
International Nuclear Information System (INIS)
Wiegand, J.
1998-01-01
Comparable to investigations looking for a connection of 222 Rn and earthquakes, this study shows the influence of subsurface vibrations on the 222 Rn concentration of the soil-gas in urban environments. Generally, the 222 Rn concentration increases through vibrations induced by trains, street-traffic and activities at project sites. The spatial radius of the 222 Rn increase due to vibrations reach highest values at project sites where piled foundations or metal panels are rammed into the ground (> 60 m). Along railway tracks the radius is wider (> 30 m) than along heavy traffic roads ( 222 Rn concentrations in soil-gas due to vibrations is the highest at project sites (53%). Along heavy traffic roads the increase of 222 Rn concentrations by motor vehicle traffic is higher (37%) than that by railway traffic (11.5%). The maximum increase of 400% was observed in a distance of 1 m from a railway track. In the vicinity of railway tracks a difference of the vibration influence according to unconsolidated rock (11.1%) or solid rock (11.8%) was not noticed. Beside this vibration effect, the overall 222 Rn level decreases with increasing distance to the vibration source, but only at locations laying above solid rocks. The observation of the increase of 222 Rn concentrations can be explained by a 'pump effect': the mechanical vibration of soil and mineral particles leads to an upward motion of the whole volume of soil-gas. Therefore, 222 Rn is pumped out of the soil to the atmosphere and as a result the upward transport is increased. (author)
Cyclin D1, Id1 and EMT in breast cancer
International Nuclear Information System (INIS)
Tobin, Nicholas P; Sims, Andrew H; Lundgren, Katja L; Lehn, Sophie; Landberg, Göran
2011-01-01
Cyclin D1 is a well-characterised cell cycle regulator with established oncogenic capabilities. Despite these properties, studies report contrasting links to tumour aggressiveness. It has previously been shown that silencing cyclin D1 increases the migratory capacity of MDA-MB-231 breast cancer cells with concomitant increase in 'inhibitor of differentiation 1' (ID1) gene expression. Id1 is known to be associated with more invasive features of cancer and with the epithelial-mesenchymal transition (EMT). Here, we sought to determine if the increase in cell motility following cyclin D1 silencing was mediated by Id1 and enhanced EMT-features. To further substantiate these findings we aimed to delineate the link between CCND1, ID1 and EMT, as well as clinical properties in primary breast cancer. Protein and gene expression of ID1, CCND1 and EMT markers were determined in MDA-MB-231 and ZR75 cells by western blot and qPCR. Cell migration and promoter occupancy were monitored by transwell and ChIP assays, respectively. Gene expression was analysed from publicly available datasets. The increase in cell migration following cyclin D1 silencing in MDA-MB-231 cells was abolished by Id1 siRNA treatment and we observed cyclin D1 occupancy of the Id1 promoter region. Moreover, ID1 and SNAI2 gene expression was increased following cyclin D1 knock-down, an effect reversed with Id1 siRNA treatment. Similar migratory and SNAI2 increases were noted for the ER-positive ZR75-1 cell line, but in an Id1-independent manner. In a meta-analysis of 1107 breast cancer samples, CCND1 low /ID1 high tumours displayed increased expression of EMT markers and were associated with reduced recurrence free survival. Finally, a greater percentage of CCND1 low /ID1 high tumours were found in the EMT-like 'claudin-low' subtype of breast cancer than in other subtypes. These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id
RPD: Reusable Pseudo-Id Distribution for a Secure and Privacy Preserving VANET
Directory of Open Access Journals (Sweden)
Sulaiman Ashraph
2013-08-01
Full Text Available In any VANET, security and privacy are the two fundamental issues. Obtaining efficient security in vehicular communication is essential without compromising privacy-preserving mechanisms. Designing a suitable protocol for VANET by having these two issues in mind is challenging because efficiency, unlinkablity and traceability are the three qualities having contradictions between them. In this paper, we introduce an efficient Reusable Pseudo-id Distribution (RPD scheme. The Trusted Authority (TA designating the Road Side Units (RSUs to generate n reusable pseudo ids and distribute them to the On Board Units (OBUs on request characterizes the proposed protocol. RSUs issue the aggregated hashes of all its valid pseudo-ids along with a symmetric shared key and a particular pseudo-id to each vehicle that enters into its coverage range. Through this the certificates attached to the messages can be eliminated and thus resulting in a significantly reduced packet size. The same anonymous keys can then be re-distributed by the RSUs episodically to other vehicles. We analyze the proposed protocol extensively to demonstrate its merits and efficiency.
Preliminary experiences with 222Rn gas in Arizona homes
International Nuclear Information System (INIS)
Kearfott, K.J.
1989-01-01
Results of a survey of 222Rn gas using four-day charcoal canister tests in 759 Arizona homes are reported. Although the study was not random with respect to population or land area, it was useful in identifying areas at risk and locating several homes having elevated indoor 222Rn air concentrations. Approximately 18% of the homes tested exceeded 150 Bq m-3 (4 pCi L-1), with 7% exceeding 300 Bq m-3 (8 pCi L-1). Several Arizona cities had larger fractions of homes exceeding 150 Bq m-3 (4 pCi L-1), such as Carefree and Cave Creek (23%), Paradise Valley (30%), Payson (33%), and Prescott (31%). The Granite Dells and Groom Creek areas of Prescott had in excess of 40-60% of the houses tested exceeding 150 Bq m-3 (4 pCi L-1). Elevated 222Rn concentrations were measured for a variety of home types having different construction materials. Private well water was identified as a potentially significant source of 222Rn gas in Prescott homes, with water from one well testing over 3.5 MBq m-3 (94,000 pCi L-1). A 222Rn concentration in air exceeding 410,000 Bq m-3 (11,000 pCi L-1) was measured using a four-day charcoal canister test in a house in Prescott which had a well opening into a living space. Additional measurements in this 150-m3 dwelling revealed a strikingly heterogeneous 222Rn concentration. The excessive 222Rn level in the dwelling was reduced to less than 190 Bq m-3 (5.2 pCi L-1) by sealing the well head with caulking and providing passive ventilation through a pipe
22 CFR 40.68 - Aliens subject to INA 222(g).
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Aliens subject to INA 222(g). 40.68 Section 40... § 40.68 Aliens subject to INA 222(g). An alien who, under the provisions of INA 222(g), has voided a... new nonimmigrant visa unless the alien complies with the requirements in 22 CFR 41.101 (b) or (c...
20 CFR 222.11 - Determination of marriage relationship.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Determination of marriage relationship. 222... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.11 Determination of marriage relationship. A claimant will be considered to be the husband, wife, or widow(er) of an employee...
12 CFR 222.83 - Disposal of consumer information.
2010-01-01
... RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Duties of Users of Consumer Reports Regarding Identity Theft § 222.83 Disposal of consumer information. (a) Definitions as used in this section. (1) You means... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Disposal of consumer information. 222.83...
HH 222: A GIANT HERBIG-HARO FLOW FROM THE QUADRUPLE SYSTEM V380 ORI
Energy Technology Data Exchange (ETDEWEB)
Reipurth, Bo; Aspin, Colin; Connelley, M. S. [Institute for Astronomy, University of Hawaii at Manoa, 640 North Aohoku Place, Hilo, HI 96720 (United States); Bally, John [Center for Astrophysics and Space Astronomy, University of Colorado, Boulder, CO 80309 (United States); Geballe, T. R. [Gemini Observatory, 670 North Aohoku Place, Hilo, HI 96720 (United States); Kraus, Stefan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-78, Cambridge, MA 02138 (United States); Appenzeller, Immo [Landessternwarte Heidelberg, Königstuhl 12, D-69117 Heidelberg (Germany); Burgasser, Adam, E-mail: reipurth@ifa.hawaii.edu, E-mail: caa@ifa.hawaii.edu, E-mail: msc@ifa.hawaii.edu, E-mail: John.Bally@colorado.edu, E-mail: tgeballe@gemini.edu, E-mail: stefan.kraus@cfa.harvard.edu, E-mail: iappenze@lsw.uni-heidelberg.de, E-mail: aburgasser@ucsd.edu [Center for Astrophysics and Space Science, University of California San Diego, La Jolla, CA 92093 (United States)
2013-11-01
HH 222 is a giant shocked region in the L1641 cloud, and is popularly known as the Orion Streamers or ''the waterfall'' on account of its unusual structure. At the center of these streamers are two infrared sources coincident with a nonthermal radio jet aligned along the principal streamer. The unique morphology of HH 222 has long been associated with this radio jet. However, new infrared images show that the two sources are distant elliptical galaxies, indicating that the radio jet is merely an improbable line-of-sight coincidence. Accurate proper motion measurements of HH 222 reveal that the shock structure is a giant bow shock moving directly away from the well-known, very young, Herbig Be star V380 Ori. The already known Herbig-Haro object HH 35 forms part of this flow. A new Herbig-Haro object, HH 1041, is found precisely in the opposite direction of HH 222 and is likely to form part of a counterflow. The total projected extent of this HH complex is 5.3 pc, making it among the largest HH flows known. A second outflow episode from V380 Ori is identified as a pair of HH objects, HH 1031 to the northwest and the already known HH 130 to the southeast, along an axis that deviates from that of HH 222/HH 1041 by only 3.°7. V380 Ori is a hierarchical quadruple system, including a faint companion of spectral type M5 or M6, which at an age of ∼1 Myr corresponds to an object straddling the stellar-to-brown dwarf boundary. We suggest that the HH 222 giant bow shock is a direct result of the dynamical interactions that led to the conversion from an initial non-hierarchical multiple system into a hierarchical configuration. This event occurred no more than 28,000 yr ago, as derived from the proper motions of the HH 222 giant bow shock.
Demonstrating idAnimate : a multi-touch system for sketching and rapidly manipulating animations
Quevedo Fernandez, Javier; Martens, J.B.O.S.
2012-01-01
This demonstration presents idAnimate, a multi-touch application for sketching animations. Thanks to the affordances provided by multitouch interfaces, idAnimate yields a novel, intuitive and easy to use animation technique named transformation-by-example, that allows users to author animations in
Expression of Id2 in the Second Heart Field and Cardiac Defects in Id2 Knock-Out Mice
Jongbloed, M. R. M.; Vicente-Steijn, R.; Douglas, Y. L.; Wisse, L. J.; Mori, K.; Yokota, Y.; Bartelings, M. M.; Schalij, M. J.; Mahtab, E. A.; Poelmann, R. E.; Gittenberger-De Groot, A. C.
2011-01-01
The inhibitor of differentiation Id2 is expressed in mesoderm of the second heart field, which contributes myocardial and mesenchymal cells to the primary heart tube. The role of Id2 in cardiac development is insufficiently known. Heart development was studied in sequential developmental stages in
ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma
International Nuclear Information System (INIS)
Phi, Ji Hoon; Choi, Seung Ah; Lim, Sang-Hee; Lee, Joongyub; Wang, Kyu-Chang; Park, Sung-Hye; Kim, Seung-Ki
2013-01-01
The inhibitor of differentiation (ID) genes have been implicated as promoters of tumor progression and metastasis in many human cancers. The current study investigated the expression and functional roles of ID genes in seeding and prognosis of medulloblastoma. ID gene expression was screened in human medulloblastoma tissues. Knockdown of ID3 gene was performed in medulloblastoma cells in vitro. The expression of metastasis-related genes after ID3 knockdown was assessed. The effect of ID3 knockdown on tumor seeding was observed in an animal model in vivo. The survival of medulloblastoma patients was plotted according to the ID3 expression levels. Significantly higher ID3 expression was observed in medulloblastoma with cerebrospinal fluid seeding than tumors without seeding. Knockdown of ID3 decreased proliferation, increased apoptosis, and suppressed the migration of D283 medulloblastoma cells in vitro. In a seeding model of medulloblastoma, ID3 knockdown in vivo with shRNA inhibited the growth of primary tumors, prevented the development of leptomeningeal seeding, and prolonged animal survival. High ID3 expression was associated with shorter survival of medulloblastoma patients, especially in Group 4 medulloblastomas. High ID3 expression is associated with medullolbastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors. ID3 may represent the metastatic/ aggressive phenotype of a subgroup of medulloblastoma
20 CFR 222.42 - When employee is contributing to support.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When employee is contributing to support. 222.42 Section 222.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.42 When...
36 CFR 222.3 - Issuance of grazing and livestock use permits.
2010-07-01
... livestock use permits. 222.3 Section 222.3 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE RANGE MANAGEMENT Grazing and Livestock Use on the National Forest System § 222.3 Issuance of grazing and livestock use permits. (a) Unless otherwise specified by the Chief, Forest Service, all...
Radon 222 and tropospheric vertical transport
International Nuclear Information System (INIS)
Liu, S.C.; McAfee, J.R.; Cicerone, R.J.
1984-01-01
Radon 222 is an inert gas whose loss is due only to radioactive decay with a half life of 3.83 days (5.51-day ''exponential'' lifetime). It is a very useful tracer of continental air because only ground level continental sources are significant. Thus it is similar in several ways to many air pollutants (e.g., NO/sub x/) (NO+NO 2 ), SO 2 , and certain hydrocarbons. Previously published measured 222 Rn profiles are analyzed here by averaging for the summer, winter, and spring-fall seasons. The analysis shows that in summer, about 55% of the 222 Rn is transported above the planetary boundary layer, considerably more than during the other seasons. Similarly, in summer, about 20% rises to over 5.5 km (500 mbar). The average profiles have been used to derive vertical eddy diffusion coefficients with maximum values of 5-7 x 10 5 cm 2 s -1 in the midtroposphere and 8 x 10 3 to 5 x 10 4 cm 2 s -1 near the surface
Id2 reinforces TH1 differentiation and inhibits E2A to repress TFH differentiation.
Shaw, Laura A; Bélanger, Simon; Omilusik, Kyla D; Cho, Sunglim; Scott-Browne, James P; Nance, J Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W
2016-07-01
The differentiation of helper T cells into effector subsets is critical to host protection. Transcription factors of the E-protein and Id families are important arbiters of T cell development, but their role in the differentiation of the TH1 and TFH subsets of helper T cells is not well understood. Here, TH1 cells showed more robust Id2 expression than that of TFH cells, and depletion of Id2 via RNA-mediated interference increased the frequency of TFH cells. Furthermore, TH1 differentiation was blocked by Id2 deficiency, which led to E-protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired the generation of TH1 cells following infection with Toxoplasma gondii. The TFH cell-defining transcriptional repressor Bcl6 bound the Id2 locus, which provides a mechanism for the bimodal Id2 expression and reciprocal development of TH1 cells and TFH cells.
48 CFR 52.222-20 - Walsh-Healey Public Contracts Act.
2010-10-01
... Contracts Act. 52.222-20 Section 52.222-20 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.222-20 Walsh-Healey Public Contracts Act. As prescribed in 22.610, insert the following clause in solicitations and contracts covered by the Act: Walsh-Healey Public Contracts Act (OCT 2010) If...
222 S Laboratory complex hazards assessment
International Nuclear Information System (INIS)
Sutton, L.N.
1998-01-01
This report documents the hazards assessment for the 222-S Analytical Laboratory located on the US Department of Energy (DOE) Hanford Site. Operation of the laboratory is the responsibility of Waste Management Federal Services, Inc. (WMFS). This hazards assessment was conducted to provide the emergency planning technical basis for the 222-S Facility. DOE Orders require an emergency planning hazards assessment for each facility that has the potential to reach or exceed the lowest level emergency classification
A sub-nationwide survey of outdoor and indoor 222Rn concentrations in China by passive method
International Nuclear Information System (INIS)
Jin Yihe; Ikebe, Y.; Iida, T.
1996-01-01
From Nov. 1988 to Mar. 1993, cooperated by China and Japan, a survey of outdoor and indoor 222 Rn concentrations in 10 cities which were highly populated in China was carried out by means of passive method. the annual mean of outdoor 222 Rn concentration in 10 cities was 8.8 Bq·m -3 . The highest of 13.5 Bq·m -3 was in Wuhan, the lowest of 3.3 Bq·m -3 was in Chongming Island of Shanghai; and there were no significant differences among the different years in the same areas. During the northwest wind seasons, about 50% of outdoor 222 Rn concentration in Taiwan was contributed by the airflow from the mainland. Typical apartment houses and offices built of brick and concrete were also surveyed for indoor 222 Rn concentration. The annual mean of indoor 222 Rn concentration in the 10 cities was 19.5 Bq·m - 3. The highest of 33.9 Bq·m -3 was observed in Guiyang, the lowest of 9.0 Bq·m -3 was observed in Chongming Island of Shanghai. The outdoor and indoor 222 Rn concentrations showed a clear seasonal pattern with the minimum in summer and the maximum in winter. And they also showed a clear geographic distribution tendency; they were higher in inland than in seashores, and higher in the south than in the north. The ratios of indoor to outdoor 222 Rn concentrations were from 1.1 to 4.6. The annual effective dose equivalents resulting from outdoor and indoor 222 Rn concentrations amounted to about 0.64 mSv·a -1 . The highest was in Guiyang, and the lowest was in Nantong, being 1.12 and 0.39 mSv·a -1 , respectively
Epigenetic inactivation of inhibitor of differentiation 4 (Id4) correlates with prostate cancer
International Nuclear Information System (INIS)
Sharma, Pankaj; Chinaranagari, Swathi; Patel, Divya; Carey, Jason; Chaudhary, Jaideep
2012-01-01
The inhibitor of DNA-binding (Id) proteins, Id1–4 are negative regulators of basic helix-loop-helix (bHLH) transcription factors. As key regulators of cell cycle and differentiation, expression of Id proteins are increasingly observed in many cancers and associated with aggressiveness of the disease. Of all the four Id proteins, the expression of Id1, Id2, and to a lesser extent, Id3 in prostate cancer and the underlying molecular mechanism is relatively well known. On the contrary, our previous results demonstrated that Id4 acts as a potential tumor suppressor in prostate cancer. In the present study, we extend these observations and demonstrate that Id4 is down-regulated in prostate cancer due to promoter hypermethylation. We used prostate cancer tissue microarrays to investigate Id4 expression. Methylation specific PCR on bisulfite treated DNA was used to determine methylation status of Id4 promoter in laser capture micro-dissected normal, stroma and prostate cancer regions. High Id4 expression was observed in the normal prostate epithelial cells. In prostate cancer, a stage-dependent decrease in Id4 expression was observed with majority of high grade cancers showing no Id4 expression. Furthermore, Id4 expression progressively decreased in prostate cancer cell line LNCaP and with no expression in androgen-insensitive LNCaP-C81 cell line. Conversely, Id4 promoter hypermethylation increased in LNCaP-C81 cells suggesting epigenetic silencing. In prostate cancer samples, loss of Id4 expression was also associated with promoter hypermethylation. Our results demonstrate loss of Id4 expression in prostate cancer due to promoter hypermethylation. The data strongly support the role of Id4 as a tumor suppressor
A process-based {sup 222}radon flux map for Europe and its comparison to long-term observations
Energy Technology Data Exchange (ETDEWEB)
Karstens, U. [Max-Planck-Instistut fuer Biogeochemie, Jena (Germany); Schwingshackl, C.; Schmithuesen, D.; Levin, I. [Heidelberg Univ. (Germany). Inst. fuer Umweltphysik
2015-07-01
Detailed {sup 222}radon ({sup 222}Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution {sup 222}Rn flux map for Europe, based on a parameterization of {sup 222}Rn production and transport in the soil. The {sup 222}Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based {sup 222}Rn soil profile measurements. Monthly {sup 222}Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083 x 0.083 and compared to long-term direct measurements of {sup 222}Rn exhalation rates in different areas of Europe. The two realizations of the {sup 222}Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean {sup 222}Rn flux from soils in Europe is estimated to be 10 mBq m{sup -2} s{sup -1} (ERA-Interim/Land soil moisture) or 15 mBq m{sup -2} s{sup -1} (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m{sup -2} s{sup -1} and from ca. 11 to ca. 20 mBq m{sup -2} s{sup -1}, respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of {sup 222}Rn exhalation rates. Comparison with
20 CFR 222.15 - When spouse is living with employee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When spouse is living with employee. 222.15 Section 222.15 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.15 When spouse is living with...
Achieving Payoffs from an Industry Cloud Ecosystem at BankID
DEFF Research Database (Denmark)
Eaton, Ben; Hallingby, Hanne Kristine; Nesse, Per-Jonny
2014-01-01
BankID is an industry cloud owned by Norwegian banks. It provides electronic identity, authentication and electronic signing capabilities for banking, merchant and government services. More than 60% of the population uses BankID services. As the broader ecosystem around BankID evolved, challenges......—arising from tensions between different parts of the ecosystem—had to be resolved. The four lessons learned from the BankID case will help others to build an industry cloud and establish a healthy ecosystem to service a broad user base....
5 CFR 9901.222 - Review of classification decisions.
2010-01-01
....222 Section 9901.222 Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT OF DEFENSE-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF DEFENSE...., pay system, career group, occupational series, official title, pay schedule, or pay band) of his or...
20 CFR 222.22 - Relationship as divorced spouse.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as divorced spouse. 222.22 Section 222.22 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...
48 CFR 252.222-7005 - Prohibition on use of nonimmigrant aliens-Guam.
2010-10-01
... nonimmigrant aliens-Guam. 252.222-7005 Section 252.222-7005 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7005 Prohibition on use of nonimmigrant aliens—Guam. As prescribed in 222.7302, use the following clause: Prohibition on Use of Nonimmigrant Aliens—Guam (SEP 1999...
A non-parametric peak calling algorithm for DamID-Seq.
Directory of Open Access Journals (Sweden)
Renhua Li
Full Text Available Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS of double sex (DSX-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq. One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only. After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1 reads resampling; 2 reads scaling (normalization and computing signal-to-noise fold changes; 3 filtering; 4 Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC. We also used irreproducible discovery rate (IDR analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
A non-parametric peak calling algorithm for DamID-Seq.
Li, Renhua; Hempel, Leonie U; Jiang, Tingbo
2015-01-01
Protein-DNA interactions play a significant role in gene regulation and expression. In order to identify transcription factor binding sites (TFBS) of double sex (DSX)-an important transcription factor in sex determination, we applied the DNA adenine methylation identification (DamID) technology to the fat body tissue of Drosophila, followed by deep sequencing (DamID-Seq). One feature of DamID-Seq data is that induced adenine methylation signals are not assured to be symmetrically distributed at TFBS, which renders the existing peak calling algorithms for ChIP-Seq, including SPP and MACS, inappropriate for DamID-Seq data. This challenged us to develop a new algorithm for peak calling. A challenge in peaking calling based on sequence data is estimating the averaged behavior of background signals. We applied a bootstrap resampling method to short sequence reads in the control (Dam only). After data quality check and mapping reads to a reference genome, the peaking calling procedure compromises the following steps: 1) reads resampling; 2) reads scaling (normalization) and computing signal-to-noise fold changes; 3) filtering; 4) Calling peaks based on a statistically significant threshold. This is a non-parametric method for peak calling (NPPC). We also used irreproducible discovery rate (IDR) analysis, as well as ChIP-Seq data to compare the peaks called by the NPPC. We identified approximately 6,000 peaks for DSX, which point to 1,225 genes related to the fat body tissue difference between female and male Drosophila. Statistical evidence from IDR analysis indicated that these peaks are reproducible across biological replicates. In addition, these peaks are comparable to those identified by use of ChIP-Seq on S2 cells, in terms of peak number, location, and peaks width.
International Nuclear Information System (INIS)
O'Connor, P.J.; Gallagher, V.; Van den Boom, G.
1992-01-01
Recent indoor radon reconnaissance surveys in Ireland have identified buildings with high radon concentrations (up to 1700 Bq.m -3 ) overlying Carboniferous karstic limestone sequences in the western part of the country. A detailed investigation of indoor 222 Rn and soil gas 222 Rn and 4 He concentrations has been carried out over a karstic limestone-uraniferous granite boundary in County Galway. High indoor 222 Rn concentrations occur in dwellings over both lithologies. Radon migratory routes in bedrock and overburden appear to be controlled by zones of enhanced permeability, e.g. fractures, faults, etc. which are defined by linear arrays of elevated 4 He soil gas values. While the ultimate source of radon remains conjectural, the greatly enhanced permeability of karstified limestone is thought to be of fundamental importance in providing a means of rapid radon transport into overlying soils and buildings. (author)
Natural and technologically enhanced sources of radon-222
International Nuclear Information System (INIS)
Travis, C.C.; Watson, A.P.; McDowell-Boyer, L.M.; Cotter, S.J.; Randolph, M.L.; Fields, D.E.
1979-01-01
An assessment of 222 Rn releases (curies/year) from major natural and technologically enhanced sources in the United States is presented. The resulting inhalation population dose commitments to the bronchial epithelium of the lung (lung-rem) are also estimated. The sources of radon considered are natural soil, evapotranspiration, potable water supplies, building materials, natural gas, uranium mining and milling, coal and phosphate mining, phosphate fertilizer, liquefied petroleum gas, geothermal power facilities, coal-fired power plants, and gas and oil wells. The most important natural source of 222 Rn is decay of 226 Ra in the soil and rocks of the earth's crust. This source results in approximately 40% of the total population dose from all sources of radon. The largest technoligcally enhanced contributor to population dose is airborne 222 Rn in building interiors, which is estimated to contribute 55% to the total population exposure to 222 Rn. Each of the other sources is estimated to contribute less than 3% to the total
36 CFR 222.29 - Relocation and disposal of animals.
2010-07-01
... animals. 222.29 Section 222.29 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... disposal of animals. (a) The Chief, Forest Service, shall, when he determines over-population of wild... animals from that particular territory. Such action shall be taken until all excess animals have been...
Surface-water radon-222 distribution along the west-central Florida shelf
Smith, C.G.; Robbins, L.L.
2012-01-01
In February 2009 and August 2009, the spatial distribution of radon-222 in surface water was mapped along the west-central Florida shelf as collaboration between the Response of Florida Shelf Ecosystems to Climate Change project and a U.S. Geological Survey Mendenhall Research Fellowship project. This report summarizes the surface distribution of radon-222 from two cruises and evaluates potential physical controls on radon-222 fluxes. Radon-222 is an inert gas produced overwhelmingly in sediment and has a short half-life of 3.8 days; activities in surface water ranged between 30 and 170 becquerels per cubic meter. Overall, radon-222 activities were enriched in nearshore surface waters relative to offshore waters. Dilution in offshore waters is expected to be the cause of the low offshore activities. While thermal stratification of the water column during the August survey may explain higher radon-222 activities relative to the February survey, radon-222 activity and integrated surface-water inventories decreased exponentially from the shoreline during both cruises. By estimating radon-222 evasion by wind from nearby buoy data and accounting for internal production from dissolved radium-226, its radiogenic long-lived parent, a simple one-dimensional model was implemented to determine the role that offshore mixing, benthic influx, and decay have on the distribution of excess radon-222 inventories along the west Florida shelf. For multiple statistically based boundary condition scenarios (first quartile, median, third quartile, and maximum radon-222 inshore of 5 kilometers), the cross-shelf mixing rates and average nearshore submarine groundwater discharge (SGD) rates varied from 100.38 to 10-3.4 square kilometers per day and 0.00 to 1.70 centimeters per day, respectively. This dataset and modeling provide the first attempt to assess cross-shelf mixing and SGD on such a large spatial scale. Such estimates help scale up SGD rates that are often made at 1- to 10-meter
COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison
International Nuclear Information System (INIS)
Skliarov, V.; Rottger, A.; Honig, A.; Korostin, S.; Kuznetsov, S.; Lapenas, A.; Milevsky, V.; Ivaniukovich, A.; Kharitonov, I.; Sepman, S.
2009-01-01
According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5. meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. (authors)
COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison
Energy Technology Data Exchange (ETDEWEB)
Skliarov, V. [National Scientific Centre, Institute of Metrology (NSC IM), Kharkiv (Ukraine); Rottger, A.; Honig, A. [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany); Korostin, S.; Kuznetsov, S. [All-Russian Scientific Research Institute of Physical, Technical and Radio Measurements (VNIIFTRI), Moscow Region, Mendeleyevo (Russian Federation); Lapenas, A. [Latvian National Metrology Centre Ltd, Radiation Metrology and Testing Centre (RMTC), Salaspils (Latvia); Milevsky, V.; Ivaniukovich, A. [Belarussian State Institute of Metrology (BelGIM), Minsk (Belarus); Kharitonov, I.; Sepman, S. [D I Mendeleyev Institute of metrology (VNIIM), Saint Petersburg (Russian Federation)
2009-06-15
According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5. meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. (authors)
Id1 represses osteoclast-dependent transcription and affects bone formation and hematopoiesis.
Directory of Open Access Journals (Sweden)
April S Chan
2009-11-01
Full Text Available The bone-bone marrow interface is an area of the bone marrow microenvironment in which both bone remodeling cells, osteoblasts and osteoclasts, and hematopoietic cells are anatomically juxtaposed. The close proximity of these cells naturally suggests that they interact with one another, but these interactions are just beginning to be characterized.An Id1(-/- mouse model was used to assess the role of Id1 in the bone marrow microenvironment. Micro-computed tomography and fracture tests showed that Id1(-/- mice have reduced bone mass and increased bone fragility, consistent with an osteoporotic phenotype. Osteoclastogenesis and pit formation assays revealed that loss of Id1 increased osteoclast differentiation and resorption activity, both in vivo and in vitro, suggesting a cell autonomous role for Id1 as a negative regulator of osteoclast differentiation. Examination by flow cytometry of the hematopoietic compartment of Id1(-/- mice showed an increase in myeloid differentiation. Additionally, we found increased expression of osteoclast genes, TRAP, Oscar, and CTSK in the Id1(-/- bone marrow microenvironment. Lastly, transplantation of wild-type bone marrow into Id1(-/- mice repressed TRAP, Oscar, and CTSK expression and activity and rescued the hematopoietic and bone phenotype in these mice.In conclusion, we demonstrate an osteoporotic phenotype in Id1(-/- mice and a mechanism for Id1 transcriptional control of osteoclast-associated genes. Our results identify Id1 as a principal player responsible for the dynamic cross-talk between bone and bone marrow hematopoietic cells.
Sabolčák, Peter
2006-01-01
FlowIDS is system which can detect some of the undesirable traffi c in computer networks (undesirable traffic could be also ie. virus activity or overloading of network) and mostly doing counteraction which are set by administrator. Information about data ows are provided by hardware of network infrastructure, eliminitaion of undesirable activity is done through changes in network hardware settings. Regarding the quantity of solution which are provided on market, I decided to focus on Cisco n...
RNA-ID, a Powerful Tool for Identifying and Characterizing Regulatory Sequences.
Brule, C E; Dean, K M; Grayhack, E J
2016-01-01
The identification and analysis of sequences that regulate gene expression is critical because regulated gene expression underlies biology. RNA-ID is an efficient and sensitive method to discover and investigate regulatory sequences in the yeast Saccharomyces cerevisiae, using fluorescence-based assays to detect green fluorescent protein (GFP) relative to a red fluorescent protein (RFP) control in individual cells. Putative regulatory sequences can be inserted either in-frame or upstream of a superfolder GFP fusion protein whose expression, like that of RFP, is driven by the bidirectional GAL1,10 promoter. In this chapter, we describe the methodology to identify and study cis-regulatory sequences in the RNA-ID system, explaining features and variations of the RNA-ID reporter, as well as some applications of this system. We describe in detail the methods to analyze a single regulatory sequence, from construction of a single GFP variant to assay of variants by flow cytometry, as well as modifications required to screen libraries of different strains simultaneously. We also describe subsequent analyses of regulatory sequences. © 2016 Elsevier Inc. All rights reserved.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false What action must an applicant take upon a change in its boundary, classification, control, governing authority, or identity? 222.8 Section 222.8 Education..., DEPARTMENT OF EDUCATION IMPACT AID PROGRAMS General § 222.8 What action must an applicant take upon a change...
36 CFR 222.2 - Management of the range environment.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Management of the range environment. 222.2 Section 222.2 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... environment. (a) Allotments will be designated on the National Forest System and on other lands under Forest...
A 'delayed' counting method to determine indoor Rn-222 levels indirectly
Iannopollo, V; Trimarchi, M; Tripepi, M G; Vermiglio, G
2001-01-01
A new indirect and 'delayed' way is presented to determine indoor concentration of Rn-222 by best-fitting methods. If a rapid knowledge of Rn-222 levels is required and if a detection system is not available in situ, it is possible to obtain concentration of radioactive gas by determining of 'delayed' counts of Po-214. The 'delay' time consists of two or three hours. The method is based on the use of cellulose filters for particulate collection and on the analysis of samples by alpha spectroscopy. It is also possible to obtain concentrations of short-lived radon daughters Po-218, Pb-214, Bi-214, which are very important quantities in a medical framework.
Radon-222 measurements at Chester
International Nuclear Information System (INIS)
Fisenne, I.M.
1982-01-01
The Environmental Measurements Laboratory has compiled a five year record of continuous hourly radon-222 measurements at Chester, New Jersey. The data for the 1977-1978, 1978-1979, 1979-1980, and 1980-1981 have been reported previously
Kanabus, Benoît; Popa, Délia
2017-01-01
Dès lors, on entend mieux la question sur laquelle se referment les mille pages du Marx : « La pensée de Marx nous place devant la question abyssale : qu’est-ce que la vie » ? Cette question peut être reposée à nouveaux frais à l’âge du capitalisme avancé, où, comme le notait Adorno, la vie est devenue « l’idéologie de sa propre absence ». La recherche d’un autre rapport à l’idéologie vient alors prendre le relais de la lutte anti-idéologique de la théorie critique. Cette recherche part du po...
Factors affecting radon removal from Rn-222 enriched water
International Nuclear Information System (INIS)
Abulfaraj, W.H.; Mamoon, A.
1994-01-01
Continued use of potable well water that has elevated levels of Rn-222 is harmful to human health. activated carbon, aeration and heating can remove radon from treated water. Water artificially enriched with Rn-222 using a pitchblende source was studied in a laboratory scale model under controlled conditions. (author), 3 figs., 3 refs
20 CFR 222.41 - Determination of relationship and support for parent.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Determination of relationship and support for parent. 222.41 Section 222.41 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.41...
Radon-222 and radium-226 in southeastern Bering Sea shelf waters and sediment
International Nuclear Information System (INIS)
Glover, D.M.; Reeburgh, W.S.
1987-01-01
Radon-222 and 226 Ra activities were measured in the waters and sediment of the southeastern Bering Sea shelf to evaluate the use of radon as a tracer of gas exchange, water column mixing and sediment-water exchange. Cross-shelf distributions of 222 Rn and 226 Ra are presented. Gas transfer coefficients were estimated using near-surface 222 Rn deficiency measurements. A statistically significant linear relationship between averaged wind speed and transfer coefficient was found. Vertical eddy diffusivities were evaluated by applying a one-dimensional model to near-bottom excess 222 Rn distributions; these diffusivities were compared to independently determined values. The one-dimensional model applied to the near-bottom 222 Rn data was found to be inadequate and a two-dimensional model was applied to improve the fit between model and data. Exchange across the sediment-water interface was computed from the deficiency of 222 Rn measured in sediment cores, standing crop estimates of excess 222 Rn in the water column and 222 Rn production rates of sediment surface grab samples. Biological irrigation of the sediments appeared to be the primary exchange mechanism between the sediment and water columns. Distributions in the water column showed finestructure reported previously and suggested biological removal of 226 Ra. (author)
20 CFR 222.57 - When an equitably adopted child is dependent.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When an equitably adopted child is dependent. 222.57 Section 222.57 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.57 When an equitably adopted child is...
Standards, calibration and quality assurance of 222Rn measurements in Sweden
International Nuclear Information System (INIS)
Falk, R.; Hagberg, N.; Mjoenes, L.; Moere, H.; Nyblom, L.; Swedjemark, G.A.
1994-01-01
Inhaled decay products of 222 Rn are the dominant components of the natural radiation exposure to the general population. Limits have been introduced in Sweden, and recommendations were made in 1980 for decreasing indoor 222 Rn concentration. The need for the coordinated calibration of measuring instruments as well as for quality assurance was obvious for both health and economic reasons. 222 Rn measurements in Sweden are based on standards traceable to the National Institute of Standard and Technology (NIST) through the use of standard reference material 226 Ra. Standards for both 222 Rn and short-lived 222 Rn progeny are described together with the reference instrument adopted for these studies. The calibration of field instruments was performed in a ''radon room'', a climate chamber in which it is possible to vary and monitor the concentration of 222 Rn as well as other characteristics of the indoor air such as temperature, humidity, ventilation rate and aerosol concentration. The rules and regulations for field measurements imply a calibration of the instruments yearly, as well as accreditation and training for the companies that carry out the measurements. Examples are given of the official measurement protocols used for the different types of instruments. (orig.)
ID-pilet teeb Tallinnas võidukäiku / Anneli Lepp
Lepp, Anneli
2006-01-01
Vt. ka Postimees : na russkom jazõke 12. jaan. lk 3. Tallinna transpordiameti peaökonomisti Mart Moosuse sõnul moodustas ID-pilet 60,7% ühistranspordi piletituludest, Tartus oli vastav näitaja aga alla 1%. Tartut teenindava bussifirma AS Connex Eesti finantsjuht Tiina Telling peab suure erinevuse põhjuseks asjaolu, et Tallinnas on ID-pilet paberpiletist 40-88% soodsam, Tartus hinnavahe aga puudub või on lausa negatiivne ID-pileti kahjuks. Lisa: ID-pilet
Directory of Open Access Journals (Sweden)
Hendro Agus Prakoso
2016-09-01
berita kedua media tersebut. Frekuensi berita berjumlah 107 di Republika.co.id dan 51 berita di Tempo.co.id Ragam berita Republika.co.id didominasi konsep Spesialisasi sebesar 22,4% dari 107 berita, sedangkan pada Tempo.co.id didominasi konsep Nama baik sebesar 23,5% dari 51 berita. Sumber berita pada Republika.co.id mayoritas berasal dari Liputan langsung sebesar 42,9% dari 107 berita sedangkan pada Tempo.co.id mayoritas berasal dari Intelektual sebesar 54,9% dari 51 berita.
Id2 reinforces TH1 cell differentiation and inhibits E2A to repress TFH cell differentiation
Shaw, Laura A.; Bélanger, Simon; Omilusik, Kyla D.; Cho, Sunglim; Scott-Browne, James P.; Nance, J. Philip; Goulding, John; Lasorella, Anna; Lu, Li-Fan; Crotty, Shane; Goldrath, Ananda W.
2016-01-01
Differentiation of T helper (TH) effector subsets is critical for host protection. E protein transcription factors and Id proteins are important arbiters of T cell development, but their role in differentiation of TH1 and TFH cells is not well understood. TH1 cells showed robust Id2 expression compared to TFH cells, and RNAi depletion of Id2 increased TFH cell frequencies. Further, TH1 cell differentiation was blocked by Id2 deficiency, leading to E protein-dependent accumulation of effector cells with mixed characteristics during viral infection and severely impaired generation of TH1 cells following Toxoplasma gondii infection. The TFH-defining transcriptional repressor Bcl6 bound the Id2 locus, providing a mechanism for the bimodal Id2 expression and reciprocal development of TH1 and TFH cell fates. PMID:27213691
People with ID as interviewers and co-researchers: experiences and reflection.
Lieshout, H. van
2012-01-01
Aim: To share the experience of working with people with intellectual disabilities (ID) as interviewers in a qualitative study about community participation of people with ID. We reflect on two perspectives: the interviewers and the researchers. Method: Eighteen people with ID were interviewed by
Rn 222 in the Black Sea waters
International Nuclear Information System (INIS)
Arbuzova, A.P.; Batrakov, G.F.; Eremeev, V.N.; Zemlyanoj, A.D.; Ivanova, T.M.
1988-01-01
Results of Rn 222 concentration measurements in the Black Sea waters obtained in the summer of 1986 during the expedition of the Akademik Vernadskij research ship are presented. It is ascertained that the intensity of vertical turbulent exchange produces the main effect on Rn 222 distribution in the sea surface waters. The vertical distribution in a 200 m layer is characterized by the growth of concentration with depth, which is caused by the presence of Ra 226 increased concentration region, that coincides with the boundary layer between oxygen and hydrogen sulfide
Relationship between major depressive disorder and ACE gene I/D polymorphism in a Turkish population
Directory of Open Access Journals (Sweden)
Sema Inanir
2016-04-01
Full Text Available Abstract Background Major depressive disorder (MDD is a complex disease and a significant health problem that is prevalent across the world. Angiotensin-converting enzyme (ACE has an important role in renin-angiotensin system (RAS and converts inactive angiotensin I to a potent vasopressor and aldosterone-stimulating peptide angiotensin II. Levels of ACE in plasma vary according to the insertion/deletion (I/D polymorphism of ACE gene. Objective The aim of the current study was to examine the influence ACE gene I/D variations on the risk of MDD. Methods In the present case-control study, we analyzed ACE I/D polymorphism in 346 MDD patients and 210 healthy subjects using polymerase chain reaction technique. Results Comparing the two groups, no significant difference was observed with regard to either genotype distributions or allele frequencies of the I/D polymorphism of ACE gene. Discussion Our findings suggest that the ACE I/D polymorphism is not associated with MDD in Turkish case-control study. Further studies are still needed.
An online ID identification system for liquefied-gas cylinder plant
He, Jin; Ding, Zhenwen; Han, Lei; Zhang, Hao
2017-11-01
An automatic ID identification system for gas cylinders' online production was developed based on the production conditions and requirements of the Technical Committee for Standardization of Gas Cylinders. A cylinder ID image acquisition system was designed to improve the image contrast of ID regions on gas cylinders against the background. Then the ID digits region was located by the CNN template matching algorithm. Following that, an adaptive threshold method based on the analysis of local average grey value and standard deviation was proposed to overcome defects of non-uniform background in the segmentation results. To improve the single digit identification accuracy, two BP neural networks were trained respectively for the identification of all digits and the easily confusable digits. If the single digit was classified as one of confusable digits by the former BP neural network, it was further tested by the later one, and the later result was taken as the final identification result of this single digit. At last, the majority voting was adopted to decide the final identification result for the 6-digit cylinder ID. The developed system was installed on a production line of a liquefied-petroleum-gas cylinder plant and worked in parallel with the existing weighing step on the line. Through the field test, the correct identification rate for single ID digit was 94.73%, and none of the tested 2000 cylinder ID was misclassified through the majority voting.
Weak lensing study of dark matter filaments and application to the binary cluster A 222 and A 223
Dietrich, JP; Schneider, P; Clowe, D; Romano-Diaz, E; Kerp, J
We present a weak lensing analysis of the double cluster system Abell 222 and Abell 223. The lensing reconstruction shows evidence for a possible dark matter filament connecting both clusters. The case for a filamentary connection between A 222/223 is supported by an analysis of the galaxy density
International Nuclear Information System (INIS)
Labidi, S; Essafi, F; Mahjoubi, H
2006-01-01
The 222 Rn concentration in air was measured in a thermal water spa used as a hydrotherapy centre in Tunisia. The associated health risk for employees and patients due to the inhalation of 222 Rn and its progeny was estimated. A protection scheme for the employees of the spas has been designed. Results show that the 222 Rn concentration varies in the range 33-589 Bq m -3 . The 222 Rn concentrations measured in the present study show lower values in comparison to those reported for thermal spas in other countries. The 222 Rn concentration in different rooms of the spa depends mainly on the ventilation rate. A model based on a dosimetric approach was adopted to estimate the radon risk considering the 222 Rn concentration, the time spent in the spa, and the radioactive equilibrium factor F. The annual effective dose was found to vary between 0.2 and 1.7 mSv for workers while the range for patients was from 2.8 x 10 -4 to 1.1 x 10 -4 mSv. These values are within the ICRP recommended values. (note)
Energy Technology Data Exchange (ETDEWEB)
Labidi, S [Institut Superieur des Technologies Medicales de Tunis (Tunisia); Essafi, F [Faculte de Medecine de Tunis, Section de Biophysique, Tunis (Tunisia); Mahjoubi, H [Institut Superieur des Technologies Medicales de Tunis (Tunisia)
2006-09-15
The {sup 222}Rn concentration in air was measured in a thermal water spa used as a hydrotherapy centre in Tunisia. The associated health risk for employees and patients due to the inhalation of {sup 222}Rn and its progeny was estimated. A protection scheme for the employees of the spas has been designed. Results show that the {sup 222}Rn concentration varies in the range 33-589 Bq m{sup -3}. The {sup 222}Rn concentrations measured in the present study show lower values in comparison to those reported for thermal spas in other countries. The {sup 222}Rn concentration in different rooms of the spa depends mainly on the ventilation rate. A model based on a dosimetric approach was adopted to estimate the radon risk considering the {sup 222}Rn concentration, the time spent in the spa, and the radioactive equilibrium factor F. The annual effective dose was found to vary between 0.2 and 1.7 mSv for workers while the range for patients was from 2.8 x 10{sup -4} to 1.1 x 10{sup -4} mSv. These values are within the ICRP recommended values. (note)
A functionally significant polymorphism in ID3 is associated with human coronary pathology.
Directory of Open Access Journals (Sweden)
Ani Manichaikul
Full Text Available We previously identified association between the ID3 SNP rs11574 and carotid intima-media thickness in the Diabetes Heart Study, a predominantly White diabetic population. The nonsynonymous SNP rs11574 results in an amino acid substitution in the C-terminal region of ID3, attenuating the dominant negative function of ID3 as an inhibitor of basic HLH factor E12-mediated transcription. In the current investigation, we characterize the association between the functionally significant polymorphism in ID3, rs11574, with human coronary pathology.The Multi-Ethnic Study of Atherosclerosis (MESA is a longitudinal study of subclinical cardiovascular disease, including non-Hispanic White (n = 2,588, African American (n = 2,560 and Hispanic (n = 2,130 participants with data on coronary artery calcium (CAC. The Coronary Assessment in Virginia cohort (CAVA included 71 patients aged 30-80 years, undergoing a medically necessary cardiac catheterization and intravascular ultrasound (IVUS at the University of Virginia. ID3 SNP rs11574 risk allele was associated with the presence of CAC in MESA Whites (P = 0.017. In addition, the risk allele was associated with greater atheroma burden and stenosis in the CAVA cohort (P = 0.003, P = 0.04 respectively. The risk allele remained predictive of atheroma burden in multivariate analysis (Model 1: covariates age, gender, and LDL, regression coefficient = 9.578, SE = 3.657, p = 0.0110; Model 2: covariates Model 1, presence of hypertension, presence of diabetes, regression coefficient = 8.389, SE = 4.788, p = 0.0163.We present additional cohorts that demonstrate association of ID3 SNP rs11574 directly with human coronary artery pathology as measured by CAC and IVUS: one a multiethnic, relatively healthy population with low levels of diabetes and the second a predominantly White population with a higher incidence of T2DM referred for cardiac catheterization.
20 CFR 222.23 - Relationship as surviving divorced spouse.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as surviving divorced spouse. 222.23 Section 222.23 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried...
Intercomparison of Rn-222 determination from groundwater
DEFF Research Database (Denmark)
Vesterbacka, P.; Pettersson, H.; Hanste, U.-M.
2010-01-01
An intercomparison exercise on Rn-222 determination in groundwater was organized between eight Nordic laboratories. The individual laboratory results were in most cases within 20% of the median value and within reported uncertainties. Considering the particular difficulties in preparing, transpor......An intercomparison exercise on Rn-222 determination in groundwater was organized between eight Nordic laboratories. The individual laboratory results were in most cases within 20% of the median value and within reported uncertainties. Considering the particular difficulties in preparing...
Use of 222Rn for estimation of greenhouse gases emissions at Russian territory
Berezina, E. V.; Elansky, N. F.
2009-04-01
It is well known that 222Rn is widely used as a tracer for studying different atmospheric processes including estimations of greenhouse gases emissions. Calculation of 222Rn fluxes from the soil into the atmosphere allows quantitative estimation of greenhouse gases emissions having the soil origin or sources of which are located near the surface. For accurate estimation of 222Rn fluxes detailed investigations of spatial and temporal variations of its concentrations are necessary. 222Rn concentrations data in the atmospheric surface layer over continental Russia from Moscow to Vladivostok obtained during the six TROICA (Transcontinental Observations Into the Chemistry of the Atmosphere) expeditions of the mobile laboratory along the Trans-Siberian railroad are analyzed. Spatial distribution, diurnal and seasonal variations of surface 222Rn concentrations along the Trans-Siberian railroad are investigated. According to the obtained data surface 222Rn concentration values above continental Russia vary from 0.5 to 75 Bq/m3 depending on meteorological conditions and geological features of the territory with the average value being 8.42 ± 0.10 Bq/m3. The average 222Rn concentration is maximum in the autumn expedition and minimum in the spring one. The factors mostly influencing 222Rn concentration variations are studied: surface temperature inversions, geological features of the territory, precipitations. 222Rn accumulation features in the atmospheric surface layer during night temperature inversions are analyzed. It was noted that during night temperature inversions the surface 222Rn concentration is 7 - 8 times more than the one during the nights without temperature inversions. Since atmospheric stratification determines accumulation and diurnal variations of many atmospheric pollutants as well as greenhouse gases its features are analyzed in detail. Surface temperature inversions were mainly observed from 18:00-19:00 to 06:00-07:00 in the warm season and from 16
Schieve, Laura A.; Clayton, Heather B.; Durkin, Maureen S.; Wingate, Martha S.; Drews-Botsch, Carolyn
2015-01-01
While studies report associations between perinatal outcomes and both autism spectrum disorder (ASD) and intellectual disability (ID), there has been little study of ASD with versus without co-occurring ID. We compared perinatal risk factors among 7547 children in the 2006-2010 Autism and Developmental Disability Monitoring Network classified as…
48 CFR 222.7301 - Prohibition on use of nonimmigrant aliens.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Prohibition on use of nonimmigrant aliens. 222.7301 Section 222.7301 Federal Acquisition Regulations System DEFENSE ACQUISITION... aliens. (a) Any alien who is issued a visa or otherwise provided nonimmigrant status under Section 101(a...
20 CFR 222.24 - Relationship as remarried widow(er).
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as remarried widow(er). 222.24 Section 222.24 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...
Supporting co-creation with software, the idSpace platform
Van Rosmalen, Peter; Boon, Jo; Bitter-Rijpkema, Marlies; Sie, Rory; Sloep, Peter
2014-01-01
Innovation, in general, requires teamwork among specialist of different disciplines. The idSpace project developed ideas on how teams of collaborating innovators could best be supported. These ideas were embodied in a platform that the project developed. This idSpace platform allows its users to
49 CFR Appendix B to Part 222 - Alternative Safety Measures
2010-10-01
.... 222, App. B Appendix B to Part 222—Alternative Safety Measures Introduction A public authority seeking... requirements associated with an SSM as listed in appendix A is revised or deleted, data or analysis supporting...); d. Photographic or video equipment deployed to capture images sufficient to document the violation...
Picture This: How to Establish an Effective School ID Card Program
Finkelstein, David
2013-01-01
Most school districts do not have an ID card policy that everyone knows and follows, yet. many school districts are implementing ID card programs to address concerns about safety, efficiency, and convenience. A well-thought-out ID card program leads to greater security and smoother operations throughout the school and should thus be a priority.…
Calibration of a degassing-emanation line for 222Rn determination in seawater samples
International Nuclear Information System (INIS)
Farias, Luciana Aparecida
2002-01-01
The purpose of this study is to calibrate a degassing-emanation line and to determine 222 Rn and 226 Ra activity concentrations in seawater samples. This methodology, also called Lucas method, consists in the extraction of radon (originally dissolved in seawater), collection of the gas in a liquid nitrogen cold trap and transfer from the trap to an alpha scintillation cell. Total extraction efficiencies of the 4 degassing-emanation systems were determined by measuring 226 Ra reference solutions. The efficiencies obtained for these 4 systems varied from 21 % to 62%. This work also presents preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil: Flamengo Bay, Fortaleza Bay, Mar Virado Bay and Ubatuba Bay. Concentration of Rn in excess varied from 0,011 to 0,317 Bq/L for Flamengo Bay, from 0,009 to 0,130 Bq/L for Fortaleza Bay, from 0,018 to 0,050 Bq/L for Mar Virado Bay and from 0,004 to 0,120 Bq/L for Ubatuba Bay. The results obtained for the concentration of 222 Rn in excess in a transect at Flamengo Bay varied from 0,002 to 0,036 Bq/L. Higher concentrations of 222 Rn in excess were obtained in Flamengo Bay, Fortaleza Bay and Ubatuba bay. It was also observed that the concentration of 222 Rn in excess increases with depth, as expected. (author)
IMI's CANCER-ID: Status of liquid biopsy standardization
Pantel, Klaus; Terstappen, Leon W. M. M.; Baggiani, Barbara; Krahn, Thomas; Schlange, Thomas
The CANCER-ID (www.cancer-id.eu) consortium was established in early 2015 with more than 30 partners as part of the Innovative Medicines Initiative (IMI), Europe's largest public-private partnership funded in equal parts by the European Union and the European Federation of Pharmaceutical Industries
Security analysis for biometric data in ID documents
Schimke, S.; Kiltz, S.; Vielhauer, C.; Kalker, A.A.C.M.
2005-01-01
In this paper we analyze chances and challenges with respect to the security of using biometrics in ID documents. We identify goals for ID documents, set by national and international authorities, and discuss the degree of security, which is obtainable with the inclusion of biometric into documents
International Nuclear Information System (INIS)
Picolo, Jean-Louis
1995-06-01
Radon 222 metrology is required to obtain higher accuracy in assessing human health risks from exposure to natural radiation. This paper describes the development of a cryogenic facility that allows absolute measurements of radon 222 in order to obtain a primary standard. The method selected is the condensation of a radon 222 sample on a geometrically defined cold surface with a constant, well known and adjustable temperature and facing an alpha particles detector. Counting of the alpha particles reaching the detector and the precisely known detection geometry provide an absolute measurement of the source activity. After describing the cryogenic facility, the measurement accuracy and precision are discussed and a comparison made with other measurement systems. The relative uncertainty is below 1 pc (1 σ). The facility can also be used to improve our knowledge of the nuclear properties of radon 222 and to produce secondary standards. (author) [fr
Knoto-ID: a tool to study the entanglement of open protein chains using the concept of knotoids.
Dorier, Julien; Goundaroulis, Dimos; Benedetti, Fabrizio; Stasiak, Andrzej
2018-05-02
The backbone of most proteins forms an open curve. To study their entanglement, a common strategy consists in searching for the presence of knots in their backbones using topological invariants. However, this approach requires to close the curve into a loop, which alters the geometry of curve. Knoto-ID allows evaluating the entanglement of open curves without the need to close them, using the recent concept of knotoids which is a generalization of the classical knot theory to open curves. Knoto-ID can analyse the global topology of the full chain as well as the local topology by exhaustively studying all subchains or only determining the knotted core. Knoto-ID permits to localize topologically non-trivial protein folds that are not detected by informatics tools detecting knotted protein folds. Knoto-ID is written in C ++ and includes R (www.R-project.org) scripts to generate plots of projections maps, fingerprint matrices and disk matrices. Knoto-ID is distributed under the GNU General Public License (GPL), version 2 or any later version and is available at https://github.com/sib-swiss/Knoto-ID. A binary distribution for Mac OS X, Linux and Windows with detailed user guide and examples can be obtained from https://www.vital-it.ch/software/Knoto-ID. julien.dorier@sib.swiss.
12 CFR 222.21 - Affiliate marketing opt-out and exceptions.
2010-01-01
... solicitation for marketing purposes to a consumer with whom you have a pre-existing business relationship; (2... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Affiliate marketing opt-out and exceptions. 222... FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.21 Affiliate...
A Neighborhood Condition for Fractional ID-[A, B]-Factor-Critical Graphs
Directory of Open Access Journals (Sweden)
Zhou Sizhong
2016-05-01
Full Text Available Let G be a graph of order n, and let a and b be two integers with 1 ≤ a ≤ b. Let h : E(G → [0, 1] be a function. If a ≤ ∑e∋x h(e ≤ b holds for any x ∈ V (G, then we call G[Fh] a fractional [a, b]-factor of G with indicator function h, where Fh = {e ∈ E(G : h(e > 0}. A graph G is fractional independent-set-deletable [a, b]-factor-critical (in short, fractional ID-[a, b]- factor-critical if G − I has a fractional [a, b]-factor for every independent set I of G. In this paper, it is proved that if for any two nonadjacent vertices x, y ∈ V (G, then G is fractional ID-[a, b]-factor-critical. Furthermore, it is shown that this result is best possible in some sense.
Design and construction of a system to analyze Radon 222 by means of alpha spectroscopy
International Nuclear Information System (INIS)
Martinez, J.B.
1991-01-01
Design and construction of a system to measure gaseous Radon 222 which arise from a source of Radium 226 electrodeposited in a stainless disc is described. Such a system allows to differentiate the energies of radium where they come from, as well as energies of daughter products. In this way it is possible to have a more precise measure of the alpha activity of this isotope. The system was constructed in a stainless steel hermetic container made of the camera, a cape and a valve, the used sample was a standards of Radium 226 attained from carnotite ore. The Radon 222 alpha particles, as well as the alpha particles of its decay products namely Polonium 210. Polonium 218 and Polonium 214 were identified by a surface barrier detector. The results in this manner obtained shows clearly well definite peaks of Radon 222 and also peaks of the Radon 222 daughter products with energies of 5.43, 5.31, 6.0 and 7.69 Mev respectively. The system allows to separate and to indentify the energies of Radon and its daughter products coming directly from a standard solid sample of Radium 226 (Author)
Applications of environmental radon-222 to some cases of water circulation
International Nuclear Information System (INIS)
Kimura, S.; Komae, T.
1980-01-01
We have proposed three methods to analyze water circulation and the changes caused by human activities by studying the changing distribution patterns of 222 Rn concentrations in water. We investigated the results by applying the methods to some water circulation problems of Japan. The first method was a detailed analysis of the hydrogeological structure of an area, using the fact that the 222 Rn concentration of water takes a value characteristic of the aquifer. In the second method we analyzed the state of mixing of surface water and groundwater by taking advantage of the fact that the 222 Rn concentrations of the two are quite different. In the third method, we used the differing 222 Rn concentrations in vadose water and in retention water to analyze the pressure acting on the aquifer or the groundwater
Relationship between 222Rn concentration in soil water and degree of saturation
International Nuclear Information System (INIS)
Hamada, Hiromasa; Komae, Takami
1996-01-01
The object of the researches an analyzing downward flow to groundwater using 222 Rn concentration in water as an indicator has been saturated flow. However, when groundwater table is low, downward flow from surface is unsaturated flow. In this paper, the authors represented the relationship between 222 Rn concentration in soil water and degree of saturation, and measured the vertical distributions of 222 Rn concentrations in groundwater and 222 Rn concentration in water table in the fields. As the results, it was found that 222 Rn concentrations in the vicinity of groundwater table decreased by unsaturated downward flow. Moreover, from the variation of 222 Rn concentrations in groundwater table, it was possible to show the occurrence of the unsaturated downward flow by paddy fields irrigation, i.e., the downward flow of the soil water pushed out by irrigation water, the unsaturated percolation in the irrigation period, and the redistribution of the soil water after the release of ponding water. The degree of saturation in downward flow was calculated to be about 50% from 222 Rn concentrations in the irrigation period and in the non-irrigation period. It was deduced that the value was within reasonable range considering the difference of the hydraulic conductivities between of the upper layer and of the lower layer. These results proved that the relationship between 222 Rn concentrations in soil water and degree of saturation represented by the authors was reasonable and that the analytical method using 222 Rn concentrations in groundwater table as an indicator was useful 10 analyze the actual stale of unsaturated downward flow. (author)
A multi-detector continuous monitor for assessment of 222Rn in the coastal ocean
International Nuclear Information System (INIS)
Dulaiova, H.; Peterson, R.; Burnett, W.C.
2005-01-01
Radon-222 is a good natural tracer of groundwater discharge and other physical processes in the coastal ocean. Unfortunately, its usefulness is limited by the time consuming nature of collecting individual samples and traditional analysis schemes. An automated multi-detector system is demonstrated that can be used in a continuous survey basis to assess radon activities in coastal ocean waters. The system analyses 222 Rn from a constant stream of water delivered by a submersible pump to an air-water exchanger where radon in the water phase equilibrates with radon in a closed air loop. The air stream is fed to 3 commercial radon-in-air monitors connected in parallel to determine the activity of 222 Rn. By running the detectors out of phase, it is possible to obtain as many as 6 readings per hour with a precision of approximately ±5-15% for typical coastal seawater concentrations. (author)
49 CFR 222.51 - Under what conditions will quiet zone status be terminated?
2010-10-01
...-Quiet Zones § 222.51 Under what conditions will quiet zone status be terminated? (a) New Quiet Zones... 49 Transportation 4 2010-10-01 2010-10-01 false Under what conditions will quiet zone status be terminated? 222.51 Section 222.51 Transportation Other Regulations Relating to Transportation (Continued...
Rn-222 release to the environment: comparison between different granite sources
International Nuclear Information System (INIS)
Mamoon, M.; Kamal, S.M.
2005-01-01
In this work three different types of granites were studied, namely: pure granite, alkali granite and altered (hydrated) alkali granite. General radioactivity of the granites was studied along with the potential for 222 Rn emanation. The study indicated that altered alkali granite releases, relatively, the highest 222 Rn emanation to the surrounding air while alkali granite emits the more intense gamma radiation of the three granites. Hence, altered alkali granite can be used as a laboratory source for 222 Rn.
24 CFR 92.222 - Reduction of matching contribution requirement.
2010-04-01
... major disaster pursuant to the Robert T. Stafford Disaster Relief and Emergency Assistance Act is made... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reduction of matching contribution requirement. 92.222 Section 92.222 Housing and Urban Development Office of the Secretary, Department of...
Zimnoch, M.; Wach, P.; Chmura, L.; Gorczyca, Z.; Rozanski, K.; Godlowska, J.; Mazur, J.; Kozak, K.; Jeričević, A.
2014-09-01
Concentration of radon (222Rn) in the near-ground atmosphere has been measured quasi-continuously from January 2005 to December 2009 at two continental sites in Europe: Heidelberg (south-west Germany) and Krakow (southern Poland). The atmosphere was sampled at ca. 30 and 20 m above the local ground. Both stations were equipped with identical instruments. Regular observations of 222Rn were supplemented by measurements of surface fluxes of this gas in the Krakow urban area, using two different approaches. The measured concentrations of 222Rn varied at both sites in a wide range, from less than 2.0 Bq m-3 to approximately 40 Bq m-3 in Krakow and 35 Bq m-3 in Heidelberg. The mean 222Rn content in Krakow, when averaged over the entire observation period, was 30% higher than in Heidelberg (5.86 ± 0.09 and 4.50 ± 0.07 Bq m-3, respectively). Distinct seasonality of 222Rn signal is visible in the obtained time series of 222Rn concentration, with higher values recorded generally during late summer and autumn. The surface 222Rn fluxes measured in Krakow also revealed a distinct seasonality, with broad maximum observed during summer and early autumn and minimum during the winter. When averaged over a 5-year observation period, the night-time surface 222Rn flux was equal to 46.8 ± 2.4 Bq m-2 h-1. Although the atmospheric 222Rn levels at Heidelberg and Krakow appeared to be controlled primarily by local factors, it was possible to evaluate the "continental effect" in atmospheric 222Rn content between both sites, related to gradual build-up of 222Rn concentration in the air masses travelling between Heidelberg and Krakow. The mean value of this build-up was equal to 0.78 ± 0.12 Bq m-3. The measured minimum 222Rn concentrations at both sites and the difference between them was interpreted in the framework of a simple box model coupled with HYSPLIT (Hybrid Single Particle Lagrangian Integrated Trajectory) analysis of air mass trajectories. The best fit of experimental data was
20 CFR 222.43 - How the one-half support determination is made.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How the one-half support determination is made. 222.43 Section 222.43 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.43...
39 CFR 222.2 - Authority to administer oaths or function as notaries public.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Authority to administer oaths or function as notaries public. 222.2 Section 222.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION DELEGATIONS OF AUTHORITY § 222.2 Authority to administer oaths or function as notaries public. (a...
Guinea pig ID-like families of SINEs.
Kass, David H; Schaetz, Brian A; Beitler, Lindsey; Bonney, Kevin M; Jamison, Nicole; Wiesner, Cathy
2009-05-01
Previous studies have indicated a paucity of SINEs within the genomes of the guinea pig and nutria, representatives of the Hystricognathi suborder of rodents. More recent work has shown that the guinea pig genome contains a large number of B1 elements, expanding to various levels among different rodents. In this work we utilized A-B PCR and screened GenBank with sequences from isolated clones to identify potentially uncharacterized SINEs within the guinea pig genome, and identified numerous sequences with a high degree of similarity (>92%) specific to the guinea pig. The presence of A-tails and flanking direct repeats associated with these sequences supported the identification of a full-length SINE, with a consensus sequence notably distinct from other rodent SINEs. Although most similar to the ID SINE, it clearly was not derived from the known ID master gene (BC1), hence we refer to this element as guinea pig ID-like (GPIDL). Using the consensus to screen the guinea pig genomic database (Assembly CavPor2) with Ensembl BlastView, we estimated at least 100,000 copies, which contrasts markedly to just over 100 copies of ID elements. Additionally we provided evidence of recent integrations of GPIDL as two of seven analyzed conserved GPIDL-containing loci demonstrated presence/absence variants in Cavia porcellus and C. aperea. Using intra-IDL PCR and sequence analyses we also provide evidence that GPIDL is derived from a hystricognath-specific SINE family. These results demonstrate that this SINE family continues to contribute to the dynamics of genomes of hystricognath rodents.
Observation and modeling of 222Rn daughters in liquid nitrogen
International Nuclear Information System (INIS)
Frodyma, N.; Pelczar, K.; Wójcik, M.
2014-01-01
The results of alpha spectrometric measurements of the activity of 222 Rn daughters dissolved in liquefied nitrogen are presented. A direct detection method of ionized alpha-emitters from the 222 Rn decay chain ( 214 Po and 218 Po) in a cryogenic liquid in the presence of an external electric field is shown. Properties of the radioactive ions are derived from a proposed model of ion production and transport in the cryogenic liquid. Ionic life-time of the ions was found to be on the order of 10 s in liquid nitrogen (4.0 purity class). The presence of positive and negative ions was observed. - Highlights: • A direct detection method of the alpha-emitters in a cryogenic liquid is shown. • We examine electrostatic drifting of the radioactive ions in liquid nitrogen. • The ions belong to the Radon-222 decay chain; Radon-222 is dissolved in the liquid. • The model of the ions production and behaviour in the liquid is proposed. • The ion production significantly depends on the nuclear decay type (alpha or beta)
MicroRNA-221 and -222 Regulate Radiation Sensitivity by Targeting the PTEN Pathway
International Nuclear Information System (INIS)
Zhang Chunzhi; Kang Chunsheng; Wang Ping; Cao Yongzhen; Lv Zhonghong; Yu Shizhu; Wang Guangxiu; Zhang Anling; Jia Zhifan; Han Lei; Yang Chunying; Ishiyama, Hiromichi; Teh, Bin S.; Xu Bo; Pu Peiyu
2011-01-01
Purpose: MicroRNAs (miRNAs) are noncoding RNAs inhibiting expression of numerous target genes by posttranscriptional regulation. miRNA-221 and miRNA-222 (miRNA-221/-222) expression is elevated in radioresistant tumor cell lines; however, it is not known whether and how miRNAs control cellular responses to ionizing irradiation. Methods and Materials: We used bioinformatic analyses, luciferase reporter assay, and genetic knockdown and biochemical assays to characterize the regulation pathways of miRNA-221/-222 in response to radiation treatment. Results: We identified the PTEN gene as a target of miRNA-221/-222. Furthermore, we found that knocking down miRNA-221/-222 by antisense oligonucleotides upregulated PTEN expression. Upregulated PTEN expression suppressed AKT activity and increased radiation-induced apoptosis, resulting in enhancement of radiosensitivity in tumor cells. Conclusions: miRNA-221/-222 control radiation sensitivity by regulating the PTEN/AKT pathway and can be explored as novel targets for radiosensitization.
La certificazione professionale I&D in Europa
Franco, Augusta
2003-01-01
The statement points out the activity of I&D European associations in the field of competences' certification, in ECIA federation's area as well as in the national one. In the statement there are references on history and outcomes of DECIDoc project; objectives and operative stages of CERTIDoc project, promoted by ECIA; and enterprises of I&D associations in France, Spain, Germany and Italy. Secondly, it is illustrated the activity of Italian librarians and archivists associatio...
A preliminary investigation of 222Rn and 220Rn levels in non-uranium mines in China
International Nuclear Information System (INIS)
Shang Bing; Cui Hongxing; Wu Yunyun; Zhang Qingzhao; Su Xu
2008-01-01
Objective: To measure levels of 222 Rn and 220 Rn in typical non-uranium mines, China, and to estimate dose from the occupational radon exposure in the miners. Methods: Using typical sampling scheme, 44 mines were selected in 12 provinces, which can be classified into 4 categories and 17 types of mines. The radon-thoron discriminative detectors were used to measure 222 Rn and 220 Rn concentrations in mines. Result: The concentration of 222 Rn or 220 Rn was log-normally distributed. The arithmetic mean (AM) concentration and geometric mean (GM) concentration of 222 Rn and 220 Rn in 25 metal mines (n=147) were estimated to be (1211 ±2359) Bq/m 3 (AM) and (311 ± 5.5) Bq/m 3 (GM), and (269 ±700) Bq/m 3 (AM) and (71 ± 4.4)Bq/m 3 (GM), respectively. The mean concentrations of 222 Rn and 220 Rn in 18 non-metal mines (n=118) were (98 ± 207) Bq/m 3 (AM) and(55 ± 2.5) Bq/m 3 (GM), and (60 ± 76) Bq/m 3 (AM) and (38 ± 2.4) Bq/m 3 (GM) respectively. In total, we measured 222 Rn concentration in 44 underground mines, 6 of them, accounted for 15%, with the mean radon concentration exceeding 1000 Bqm -3 (limit of workplace in China). Approximately 7% of radon concentration in mines measured were higher than 3700 Bq/m 3 (current limit in uranium mine in China), some points even exceeded 10 000 Bq/m 3 . Based on this typical measurements, the equilibrium factor for 222 Rn was estimated to be 0.33 ± 0.15 in underground mines and 0.47 ±0.18 in nearby houses. Equilibrium factor for 220 Rn ranged from 0.001 to 0.032. Using the data obtained in this typical survey, the average annual effective dose of underground miners exposed to radon and thoron was estimated to be 8.15 mSv/a. Conclusions: High levels of 222 Rn exists in metal mines, such as copper, tin, lead and zinc, gold, and aluminum mines among others. More study and administrative measures are needed to address the radiation protection of workers occupationally exposed to high radon in mines. (authors)
Scintillation detectors for radon-222 in air and water
International Nuclear Information System (INIS)
Mastinu, G.G.
1980-01-01
A scintillation detector and an emanation circuit that enable sensitive measurements of 222 Rn in water, in field practice, and in laboratory routine have been developed. Activities as low as 0.1 pCi per sample can be measured with a very simple procedure. The detector is also well suited to measure 222 Rn in air at concentrations down to 0.001 pCi/liter if a large-size detector is used
The Ongoing Evolution of the K2-22 System
Colon, Knicole D.; Zhou, George; Shporer, Avi; Collins, Karen A.; Bieryla, Allyson; Latham, David W.; Espinoza, Nestor; Murgas, Felipe; Pattarakijwanich, Petchara; Awiphan, Supachai; TECH Collaboration
2018-06-01
Of the thousands of exoplanets known, only three disintegrating planets have been identified. These disintegrating planets appear to have tails of dusty material that produce asymmetric transit shapes. K2-22b is one of these few disintegrating planets discovered to date, and its light curve not only displays highly variable transit depths but also uniquely displays evidence of a leading dust tail. Here, we present results from a large ground-based photometric observing campaign of the K2-22 system that took place between December 2016 and May 2017, which we use to investigate the evolution of the transit of K2-22b. Last observed in early 2015, in these new observations we recover the transit around the expected time and measure a typical depth of K2-22b, although the overall shallowness of the transit makes a detailed analysis of the transit shape and timing difficult. In addition, we find no strong evidence of wavelength-dependent transit depths for epochs where we have simultaneous coverage at multiple wavelengths. Given the observed decrease in the transit depth between 2015 and 2017, we encourage continued high-precision photometric monitoring of this system in order to further constrain the evolution timescale and to aid comparative studies with the other few disintegrating planets known.
The Self-Identity Protein IdsD Is Communicated between Cells in Swarming Proteus mirabilis Colonies.
Saak, Christina C; Gibbs, Karine A
2016-12-15
Proteus mirabilis is a social bacterium that is capable of self (kin) versus nonself recognition. Swarming colonies of this bacterium expand outward on surfaces to centimeter-scale distances due to the collective motility of individual cells. Colonies of genetically distinct populations remain separate, while those of identical populations merge. Ids proteins are essential for this recognition behavior. Two of these proteins, IdsD and IdsE, encode identity information for each strain. These two proteins bind in vitro in an allele-restrictive manner. IdsD-IdsE binding is correlated with the merging of populations, whereas a lack of binding is correlated with the separation of populations. Key questions remained about the in vivo interactions of IdsD and IdsE, specifically, whether IdsD and IdsE bind within single cells or whether IdsD-IdsE interactions occur across neighboring cells and, if so, which of the two proteins is exchanged. Here we demonstrate that IdsD must originate from another cell to communicate identity and that this nonresident IdsD interacts with IdsE resident in the recipient cell. Furthermore, we show that unbound IdsD in recipient cells does not cause cell death and instead appears to contribute to a restriction in the expansion radius of the swarming colony. We conclude that P. mirabilis communicates IdsD between neighboring cells for nonlethal kin recognition, which suggests that the Ids proteins constitute a type of cell-cell communication. We demonstrate that self (kin) versus nonself recognition in P. mirabilis entails the cell-cell communication of an identity-encoding protein that is exported from one cell and received by another. We further show that this intercellular exchange affects swarm colony expansion in a nonlethal manner, which adds social communication to the list of potential swarm-related regulatory factors. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Application of Sharī‘ah contracts in contemporary Islamic finance: A maqāṣid perspective
Directory of Open Access Journals (Sweden)
Younes Soualhi
2015-12-01
Full Text Available This research exposes the underlying maqāṣid embedded in Sharī‘ah contracts as applied in Islamic banking and finance. It addresses the problem of not observing maqāṣid in nominated and combined Sharī‘ah contracts as well as the problem of not sufficiently imbuing maqāṣid in products developed by Islamic financial institutions. As a benchmark of the maqāṣid of wealth, the research adopts Ibn ‘Āshūr’s classification of maqāṣid to evaluate the conformity of Sharī‘ah contracts to Maqāṣid al-Sharī‘ah namely, justice, circulation, transparency, and firmness. The study focuses on three markets related to the application of Sharī‘ah contracts, namely, banking, Islamic capital market, and takāful. The study concludes that, by and large, the application of Sharī‘ah contracts has observed Maqāṣid al-Sharī‘ah during its development and initial application stages of Islamic finance products; however, offering such products in the market has raised economic questions as to their viability and economic values. In addition, the malpractice of some Sharī‘ah contracts has long raised concerns as to the maqāṣid compliance of such products. The research recommends a de-sophistication of Islamic financial engineering to minimise the possibility of convergence with conventional finance. The research also emphasises product differentiation based on less complicated combined Sharī‘ah contracts.
Waste analysis plan for 222-S dangerous and mixed waste storage area
International Nuclear Information System (INIS)
Warwick, G.J.
1994-01-01
The 222-S Laboratory Complex, in the southeast corner of the 200 West Area, consists of the 222-S Laboratory, the 222-SA Standards Laboratory, and several ancillary facilities. Currently, 222-S Laboratory activities are in supporting efforts to characterize the waste stored in the 200 Areas single shell and double shell tanks. Besides this work, the laboratory also provides analytical services for waste-management processing plants, Tank Farms, B Plant, 242-A Evaporator Facility, Plutonium-Uranium Extraction Plant, Plutonium Finishing Plant, Uranium-Oxide Plant, Waste Encapsulation Storage Facility, environmental monitoring and surveillance programs, and activities involving essential materials and research and development. One part of the 222-SA Laboratory prepares nonradioactive standards for the 200 Area laboratories. The other section of the laboratory is used for cold (nonradioactive) process development work and standards preparation. The 219-S Waste Handling Facility has three storage tanks in which liquid acid waste from 222-S can be received, stored temporarily, and neutralized. From this facility, neutralized waste, containing radionuclides, is transferred to the Tank Farms. A 700-gallon sodium-hydroxide supply tank is also located in this facility. This plan provides the methods used to meet the acceptance criteria required by the 204-AR Waste Receiving Facility
International Nuclear Information System (INIS)
Homma, Y.; Murase, Y.; Handa, K.; Murakami, I.
1997-01-01
222 Rn in 2L-water samples was extracted with 30 mL toluene, and 21 mL of the toluene solution was transferred into a liquid scintillation vial, in which PPO - 2,5-diphenyloxazole was placed in advance. The total activity of 222 Rn in the water sample was calculated based on the Ostwald's coefficient of solubilities of 222 Rn in toluene and water at the temperature of the sample water and the volume of water and toluene. About 40% of 222 Rn dissolved in 2L-water sample can be collected. After allowing to stand for 3.5 h, the equilibrium mixture of 222 Rn and its daughters was measured with an Aloka liquid scintillation spectrometer using a modified integral counting method which extrapolates the integral counting curve not to the zero pulse-height, but to the zero detection threshold, an average energy required to produce a measurable pulse, of the liquid scintillation spectrometer. The general method which agitates water sample (usually about 10 mL) with a liquid scintillation cocktail is practical when the activity of 222 Rn is high. By adding 10 mL of water sample, however, it is possible also to add variable amounts of quencher. In some cases water sample is preserved with nitric acid. The slope of the integral counting rate curve increases as quench level of the sample increases. Therefore, it is clear that the modified integral counting method gives more accurate 222 Rn concentrations for water samples of strong quench than the conventional integral counting method. 222 Rn sample of 0.2 Bq/L can be determined within an overall uncertainty of 3.1%
Best practices for the implementation of the REAL ID Act.
2015-10-01
The REAL ID Act specifies the minimum standards that must be used to produce and issue drivers license and : identification cards that are REAL ID compliant. Beginning in 2020, if a person does not possess a form of : identification that meets REA...
222Rn alpha dose to organs other than lung
International Nuclear Information System (INIS)
Harley, N.H.; Robbins, E.S.
1991-01-01
The alpha dose to cells in tissues or organs other theft the lung has been calculated using the solubility coefficients for 222 Rn measured in human tissue. The annual alpha dose equivalent f rom 222 Rn and decay products in most tissues is a maximum of 30% of the annual average natural background dose equivalent (1 mSv) for external and internally deposited nuclides. The dose to the small population of lymphocytes located in or under the bronchial epithelium is a special case and their annual dose equivalent is essentially the same as that to basal cells in bronchial epithelium (200 mSv) for continuous exposure to 200 Bq M -3 . The significance of this dose is uncertain because the only excess cancer observed in follow up studies of underground miners with high 222 Rn exposure is bronchogenic carcinoma
OpenID Connect as a security service in cloud-based medical imaging systems.
Ma, Weina; Sartipi, Kamran; Sharghigoorabi, Hassan; Koff, David; Bak, Peter
2016-04-01
The evolution of cloud computing is driving the next generation of medical imaging systems. However, privacy and security concerns have been consistently regarded as the major obstacles for adoption of cloud computing by healthcare domains. OpenID Connect, combining OpenID and OAuth together, is an emerging representational state transfer-based federated identity solution. It is one of the most adopted open standards to potentially become the de facto standard for securing cloud computing and mobile applications, which is also regarded as "Kerberos of cloud." We introduce OpenID Connect as an authentication and authorization service in cloud-based diagnostic imaging (DI) systems, and propose enhancements that allow for incorporating this technology within distributed enterprise environments. The objective of this study is to offer solutions for secure sharing of medical images among diagnostic imaging repository (DI-r) and heterogeneous picture archiving and communication systems (PACS) as well as Web-based and mobile clients in the cloud ecosystem. The main objective is to use OpenID Connect open-source single sign-on and authorization service and in a user-centric manner, while deploying DI-r and PACS to private or community clouds should provide equivalent security levels to traditional computing model.
Directory of Open Access Journals (Sweden)
Nora Seidel
Full Text Available The amino acid substitution of aspartic acid to glycine in hemagglutinin (HA in position 222 (HA-D222G as well as HA-222D/G polymorphism of pandemic (H1N1 2009 influenza viruses (A(H1N1pdm09 were frequently reported in severe influenza in humans and mice. Their impact on viral pathogenicity and the course of influenza has been discussed controversially and the underlying mechanism remained unclarified. In the present study, BALB/c mice, infected with the once mouse lung- and cell-passaged A(H1N1pdm09 isolate A/Jena/5258/09 (mpJena/5258, developed severe pneumonia. From day 2 to 3 or 4 post infection (p.i. symptoms (body weight loss and clinical score continuously worsened. After a short disease stagnation or even recovery phase in most mice, severity of disease further increased on days 6 and 7 p.i. Thereafter, surviving mice recovered. A 45 times higher virus titer maximum in the lung than in the trachea on day 2 p.i. and significantly higher tracheal virus titers compared to lung on day 6 p.i. indicated changes in the organ tropism during infection. Sequence analysis revealed an HA-222D/G polymorphism. HA-D222 and HA-G222 variants co-circulated in lung and trachea. Whereas, HA-D222 variant predominated in the lung, HA-G222 became the major variant in the trachea after day 4 p.i. This was accompanied by lower neutralizing antibody titers and broader receptor recognition including terminal sialic acid α-2,3-linked galactose, which is abundant on mouse trachea epithelial cells. Plaque-purified HA-G222-mpJena/5258 virus induced severe influenza with maximum symptom on day 6 p.i. These results demonstrated for the first time that HA-222D/G quasispecies of A(H1N1pdm09 caused severe biphasic influenza because of fast viral intra-host evolution, which enabled partial antibody escape and minor changes in receptor binding.
Interoperability for electronic ID
Zygadlo, Zuzanna
2009-01-01
Electronic Business, including eBanking, eCommerce and eGovernmental services, is today based on a large variety of security solutions, comprising electronic IDs provided by a broad community of Public Key Infrastructure (PKI) vendors. Significant differences in implementations of those solutions introduce a problem of lack of interoperability in electronic business, which have not yet been resolved by standardization and interoperability initiatives based on existing PKI trust models. It i...
St 2-22 - Another Symbiotic Star with High-Velocity Bipolar Jets
Tomov, T.; Zamanov, R.; Gałan, C.; Pietrukowicz, P.
2017-09-01
We report the detection of high-velocity components in the wings of Hα emission line in spectra of symbiotic binary star St 2-22 obtained in 2005. This finding encouraged us to start the present investigation in order to show that this poorly-studied object is a jet-producing system. We have used high-resolution optical and low-resolution near-infrared spectra, as well as available optical and infrared photometry, to evaluate some physical parameters of the St 2-22 components and characteristics of the jets. We confirm that St 2-22 is a S-type symbiotic star. Our results demonstrate that an unnoticed outburst, similar to those in classical symbiotic systems, occurred in the first half of 2005. During the outburst, collimated bipolar jets were ejected by the hot component of St 2-22 with an average velocity of about 1700 km/s.
34 CFR 222.30 - What is “free public education”?
2010-07-01
... Section 8003(b) and (e) of the Act § 222.30 What is “free public education”? In addition to the terms defined in § 222.2, the following definition applies to this part: Free public education. (1) The term... provide a free public education to the children claimed under section 8003. (5) For the purpose of...
40 CFR 22.2 - Use of number and gender.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Use of number and gender. 22.2 Section... PERMITS General § 22.2 Use of number and gender. As used in these Consolidated Rules of Practice, words in the singular also include the plural and words in the masculine gender also include the feminine, and...
Lifescience Database Archive (English)
Full Text Available 222.png Shinobu Okamoto (Kazusa DNA Research Institute ) licensed under CC Attribution2.1 Japan シアノバクテリア 光学顕微鏡写真 撮影:岡本忍(かずさDNA研究所) bando 2010/02/15 15:28:38 2010/02/16 10:25:09 ...
Maintenance Implementation Plan for the 222-S Laboratory
International Nuclear Information System (INIS)
Stark, T.E.
1992-10-01
This Maintenance Implementation Plan (MIP) has been developed for the 222-S Laboratory at Hanford. It is based on assessments of the existing maintenance program to the requirements specified by US Department of Energy (DOE) Order 4330.4A, Maintenance Management Program (DOE 1990), Chapter II, Change 3. The results of these assessments were evaluated to determine corrective actions required. The 222-S Laboratory is currently supporting the waste management, chemical processing, and environmental monitoring programs presently under Westinghouse Hanford Company (Westinghouse Hanford) responsibility. This is done through quality analytical and process chemistry services
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
International Nuclear Information System (INIS)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep
2016-01-01
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
ID4 promotes AR expression and blocks tumorigenicity of PC3 prostate cancer cells
Energy Technology Data Exchange (ETDEWEB)
Komaragiri, Shravan Kumar; Bostanthirige, Dhanushka H.; Morton, Derrick J.; Patel, Divya; Joshi, Jugal; Upadhyay, Sunil; Chaudhary, Jaideep, E-mail: jchaudhary@cau.edu
2016-09-09
Deregulation of tumor suppressor genes is associated with tumorigenesis and the development of cancer. In prostate cancer, ID4 is epigenetically silenced and acts as a tumor suppressor. In normal prostate epithelial cells, ID4 collaborates with androgen receptor (AR) and p53 to exert its tumor suppressor activity. Previous studies have shown that ID4 promotes tumor suppressive function of AR whereas loss of ID4 results in tumor promoter activity of AR. Previous study from our lab showed that ectopic ID4 expression in DU145 attenuates proliferation and promotes AR expression suggesting that ID4 dependent AR activity is tumor suppressive. In this study, we examined the effect of ectopic expression of ID4 on highly malignant prostate cancer cell, PC3. Here we show that stable overexpression of ID4 in PC3 cells leads to increased apoptosis and decreased cell proliferation and migration. In addition, in vivo studies showed a decrease in tumor size and volume of ID4 overexpressing PC3 cells, in nude mice. At the molecular level, these changes were associated with increased androgen receptor (AR), p21, and AR dependent FKBP51 expression. At the mechanistic level, ID4 may regulate the expression or function of AR through specific but yet unknown AR co-regulators that may determine the final outcome of AR function. - Highlights: • ID4 expression induces AR expression in PC3 cells, which generally lack AR. • ID4 expression increased apoptosis and decreased cell proliferation and invasion. • Overexpression of ID4 reduces tumor growth of subcutaneous xenografts in vivo. • ID4 induces p21 and FKBP51 expression- co-factors of AR tumor suppressor activity.
Événement, idéologie et utopie
Directory of Open Access Journals (Sweden)
Jean-Luc AMALRIC
2014-12-01
Full Text Available RESUMEL’hypothèse que tente d’esquisser cet article est que l’idée ricœurienne d’une médiatisation dynamique des contradictions de l’imaginaire social présuppose une corrélation originaire de l’idéologie et de l’utopie qui ne peut elle-même être comprise qu’à partir de l’événement de l’institution d’un imaginaire social constituant. Dans un premier temps, l’article s’efforce de cerner ce qui fait la spécificité de la théorie ricœurienne de l’idéologie et de l’utopie comme « pratiques imaginatives », en soulignant à ce titre l’influence déterminante des thèses de Jacques Ellul sur l’idéologie. Puis, dans un second temps, il s’engage dans une analyse régressive qui conduit de la réappropriation ricœurienne de la conception dialectique de l’idéologie et de l’utopie exposée par Mannheim à l’idée d’un fondement événementiel de ces deux formes opposées de l’imaginaire social.Mots-Clés : Evénement, idéologie, utopie, Ellul, Mannheim. ABSTRACTThis paper attempts to sketch out the hypothesis that the Ricœurian conception of a dynamic mediatization of the contradictions of the social imaginary presupposes an original correlation between ideology and utopia, which can itself be understood only from the event that institutes a constitutive social imaginary. The first part of the paper marks out the specificity of the Ricœurian theory of ideology and utopia in terms of “imaginative practices”, underlining the determining influence of Jacques Ellul’s theses on ideology. The second part tries to develop a regressive argument, starting from the Ricœurian re-appropriation of Mannheim’s dialectical conception of ideology and utopia, and leading back to the idea of an event foundation for these two opposed forms of the social imaginary.Keywords : Event, Ideology, Utopia, Ellul, Mannheim
Radon-222 as an indicator of geothermal reservoirs behaviour
International Nuclear Information System (INIS)
Segovia, N.; De La Cruz-Reyna, S.; Mena, M.; Seidel, J.L.; Monnin, M.
1991-01-01
Radon-222 concentration in soils at shallow depth was measured at the ''Los Azufres'' geothermal field, Michoacan State, Mexico, in order to observe possible temporal variations in relation to the peculiar conditions of the area. A four years' survey is reported using the SSNTD technique. The data obtained indicate the feasibility of the technique for this type of investigation and illustrate the role of Radon-222 as a tracer of pore fluids motion in the substratum. (author)
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-grandchild or stepgrandchild adopted after entitlement. 222.54 Section 222.54 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and...
CASK inhibits ECV304 cell growth and interacts with Id1
International Nuclear Information System (INIS)
Qi Jie; Su Yongyue; Sun Rongju; Zhang Fang; Luo Xiaofeng; Yang Zongcheng; Luo Xiangdong
2005-01-01
Calcium/calmodulin-dependent serine protein kinase (CASK) is generally known as a scaffold protein. Here we show that overexpression of CASK resulted in a reduced rate of cell growth, while inhibition of expression of endogenous CASK via RNA-mediated interference resulted in an increased rate of cell growth in ECV304 cells. To explore the molecular mechanism, we identified a novel CASK-interacting protein, inhibitor of differentiation 1 (Id1) with a yeast two-hybrid screening. Furthermore, endogenous CASK and Id1 proteins were co-precipitated from the lysates of ECV304 cells by immunoprecipitation. Mammalian two-hybrid protein-protein interaction assays indicated that CASK possessed a different binding activity for Id1 and its alternative splicing variant. It is known that Id proteins play important roles in regulation of cell proliferation and differentiation. Thus, we speculate that the regulation of cell growth mediated by CASK may be involved in Id1. Our findings indicate a novel function of CASK, the mechanism that remains to be further investigated
Relation between 222Rn concentration in outdoor air and lower atmosphere
International Nuclear Information System (INIS)
Kataoka, Toshio; Mori, Tadashige; Yunoki, Eiji; Michihiro, Kenshuh; Sugiyama, Hirokazu; Shimizu, Mitsuo; Tsukamoto, Osamu; Sahashi, Ken.
1991-01-01
Using the height of the surface-based inversion layer obtained by the acoustic sounder returns and the variation of the 222 Rn concentration in the outdoor air during the presence of the surface-based inversion layer, the exhalation rate of 222 Rn is estimated to be 0.020 Bq·m -2 ·s -1 , which is observed elsewhere on land. Furthermore, the exposure rate at 1 m above the air-ground interface due to the short-lived 222 Rn daughters in the outdoor air during the presence of the surface-based inversion layer can be estimated using the height of the surface-based inversion layer and the 222 Rn concentrations in the outdoor air at the ground level before and after the onset of the surface-based inversion layer. From these treatment, it is clearly demonstrated that the monostatic acoustic sounder is useful as a supplementary method for a weather survey which forms a part of monitoring around the nuclear facilities. (author)
ID card number detection algorithm based on convolutional neural network
Zhu, Jian; Ma, Hanjie; Feng, Jie; Dai, Leiyan
2018-04-01
In this paper, a new detection algorithm based on Convolutional Neural Network is presented in order to realize the fast and convenient ID information extraction in multiple scenarios. The algorithm uses the mobile device equipped with Android operating system to locate and extract the ID number; Use the special color distribution of the ID card, select the appropriate channel component; Use the image threshold segmentation, noise processing and morphological processing to take the binary processing for image; At the same time, the image rotation and projection method are used for horizontal correction when image was tilting; Finally, the single character is extracted by the projection method, and recognized by using Convolutional Neural Network. Through test shows that, A single ID number image from the extraction to the identification time is about 80ms, the accuracy rate is about 99%, It can be applied to the actual production and living environment.
Primary measuring of equipment factor of 222Rn/220Rn indoor
International Nuclear Information System (INIS)
Liu Yanyang; Liu Fudong; Wang Chunhong; Sheng Mingwei
2010-01-01
The activity concentration of 222 Rn, 220 Rn and their progenies of certain working places and dwellings in Baotou city were measured simultaneously. Based on these results, the equipment factor of 222 Rn is 0.35 for working places and 0.43 for dwellings, while equipment factor of 220 Rn measured at 20 cm distance from wall is 0.030 for both working places and dwellings. Preliminary results show that the temporal change of 220 Rn equilibrium equivalent concentration is same as 222 Rn which is high in midnight and low in afternoon,and significant difference between instant and accumulated measure result of 222 Rn, 220 Rn activity concentration is found, with the factor of 2.1 and 1.7. (authors)
Regulation of Id2 expression in EL4 T lymphoma cells overexpressing growth hormone.
Weigent, Douglas A
2009-01-01
In previous studies, we have shown that overexpression of growth hormone (GH) in cells of the immune system upregulates proteins involved in cell growth and protects from apoptosis. Here, we report that overexpression of GH in EL4 T lymphoma cells (GHo) also significantly increased levels of the inhibitor of differentiation-2 (Id2). The increase in Id2 was suggested in both Id2 promoter luciferase assays and by Western analysis for Id2 protein. To identify the regulatory elements that mediate transcriptional activation by GH in the Id2 promoter, promoter deletion analysis was performed. Deletion analysis revealed that transactivation involved a 301-132bp region upstream to the Id2 transcriptional start site. The pattern in the human GHo Jurkat T lymphoma cell line paralleled that found in the mouse GHo EL4 T lymphoma cell line. Significantly less Id2 was detected in the nucleus of GHo EL4 T lymphoma cells compared to vector alone controls. Although serum increased the levels of Id2 in control vector alone cells, no difference was found in the total levels of Id2 in GHo EL4 T lymphoma cells treated with or without serum. The increase in Id2 expression in GHo EL4 T lymphoma cells measured by Id2 promoter luciferase expression and Western blot analysis was blocked by the overexpression of a dominant-negative mutant of STAT5. The results suggest that in EL4 T lymphoma cells overexpressing GH, there is an upregulation of Id2 protein that appears to involve STAT protein activity.
25 CFR 1000.222 - How does a Tribe/Consortium obtain a waiver?
2010-04-01
... ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.222 How does a Tribe/Consortium obtain a waiver? To...; (b) Identify the regulation to be waived and the reasons for the request; (c) Identify the programs...
Radon 222 levels in deep well waters of Toluca municipality (county)
International Nuclear Information System (INIS)
Olguin Gutierrez, Maria Teresa.
1990-01-01
The levels of Radon 222 were determined in 46 deep (50-180m) wells in the city and county of Toluca, as well as the annual radiation dose that the stomach admits when ingesting such water. The method used for the quantification of Radon 222 was liquid scintillation counting. The result revealed that levels of Radon 222 in the studied area in the range of 0 to 320 pCi l -1 . In the case of the equivalent annual dose that the stomach (empty) admits due to ingestion of water from the wells, values are in an interval between 0 to 95 mrem a -1 . This values are well below the level established by the International Commission of Radiological Protection (ICRP). The wells that had the higher concentration of Radon 222 were found in the regions of Lodo Prieto, Seminario; San Antonio Buenavista and La Trinidad Huichochitlan. (Author)
International Nuclear Information System (INIS)
Barreto, Rafael C.; Perna, Allan F.N.; Narloch, Danielle C.; Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.
2017-01-01
It was developed an improved theoretical model capable to estimate the radium concentration in building materials solely measuring the radon-222 concentration in a con ned atmosphere. This non-destructive technique is not limited by the size of the samples, and it intrinsically includes back diffusion. The resulting equation provides the exact solution for the concentration of radon-222 as a function of time and distance in one dimension. The effective concentration of radium-226 is a fit parameter of this equation. In order to reduce its complexity, this equation was simplified considering two cases: low diffusion in the building material compared to the air, and a building material initially saturated with radon-222. These simplified versions of the exact one dimension solution were used to t experimental data. Radon-222 concentration was continuously measured for twelve days with an AlphaGUARD TM detector, located at the Laboratory of Applied Nuclear Physics at Universidade Tecnologica Federal do Parana (UTFPR). This model was applied to two different materials: cement mortar and concrete, which results were respectively (15:7 ±8:3) Bq=kg and (10:5±2:4) Bq=kg for the radium-226 effective concentration. This estimation was confronted with the direct measurements of radium in the same materials (same sources) using gamma-ray spectrometry, fulfilled at Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), which results were respectively (13:81±0:23) Bq=kg and (12:61±0:22) Bq=kg. (author)
Energy Technology Data Exchange (ETDEWEB)
Barreto, Rafael C.; Perna, Allan F.N.; Narloch, Danielle C.; Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A., E-mail: baarreth@gmail.com, E-mail: allan_perna@hotmail.com, E-mail: daninarloch@hotmail.com, E-mail: aviadelclaro@gmail.com, E-mail: janine_nicolosi@hotmail.com, E-mail: spaschuk@gmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil). Departamento Academico de Fisica e Departamento Academico de Construcao Civil
2017-07-01
It was developed an improved theoretical model capable to estimate the radium concentration in building materials solely measuring the radon-222 concentration in a con ned atmosphere. This non-destructive technique is not limited by the size of the samples, and it intrinsically includes back diffusion. The resulting equation provides the exact solution for the concentration of radon-222 as a function of time and distance in one dimension. The effective concentration of radium-226 is a fit parameter of this equation. In order to reduce its complexity, this equation was simplified considering two cases: low diffusion in the building material compared to the air, and a building material initially saturated with radon-222. These simplified versions of the exact one dimension solution were used to t experimental data. Radon-222 concentration was continuously measured for twelve days with an AlphaGUARD{sup TM} detector, located at the Laboratory of Applied Nuclear Physics at Universidade Tecnologica Federal do Parana (UTFPR). This model was applied to two different materials: cement mortar and concrete, which results were respectively (15:7 ±8:3) Bq=kg and (10:5±2:4) Bq=kg for the radium-226 effective concentration. This estimation was confronted with the direct measurements of radium in the same materials (same sources) using gamma-ray spectrometry, fulfilled at Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), which results were respectively (13:81±0:23) Bq=kg and (12:61±0:22) Bq=kg. (author)
Lidocaine Hydrochloride Compared with MS222 for the Euthanasia of Zebrafish (Danio rerio)
Collymore, Chereen; Banks, E Kate; Turner, Patricia V
2016-01-01
Despite several shortcomings, MS222 is the most commonly used chemical agent for euthanasia of zebrafish. Although lidocaine hydrochloride has some advantages over MS222, its effectiveness as a euthanasia agent for zebrafish is unknown. Larvae at 9 to 16 d postfertilization were exposed to 250 mg/L MS222 or 400, 500, 600, 700, 800, 900, or 1000 mg/L lidocaine and observed for cessation of heartbeat. Adult zebrafish were exposed to 250 mg/L MS222 or 400, 500, or 600 mg/L lidocaine; times to loss of righting reflex, cessation of opercular movement, and complete recovery; body length; aversive behavior; and gross and microscopic evidence of acute toxicity were evaluated. The heartbeat was not lost from any larvae in any group, regardless of drug or dosage. For adults, time to loss of righting reflex was greatest in the 500-mg/L lidocaine group. Opercular movement ceased earlier in all lidocaine groups compared with the MS222 group. Fish in the 500-mg/L lidocaine group were smaller than those in other groups. Fewer fish in the lidocaine groups displayed aversive behavior (erratic swimming and piping) compared with the MS222 group. No fish in the lidocaine hydrochloride groups (n = 30) recovered from euthanasia, whereas one fish in the MS222 group did (n = 10). Neither the MS222 nor lidocaine groups showed any gross or histologic changes suggestive of acute toxicity. Our results suggest that lidocaine hydrochloride may be an effective alternative chemical euthanasia agent for adult zebrafish but should not be used in larval fish. PMID:27931323
Psychometrics and latent structure of the IDS and QIDS with young adult students.
González, David Andrés; Boals, Adriel; Jenkins, Sharon Rae; Schuler, Eric R; Taylor, Daniel
2013-07-01
Students and young adults have high rates of suicide and depression, thus are a population of interest. To date, there is no normative psychometric information on the IDS and QIDS in these populations. Furthermore, there is equivocal evidence on the factor structure and subscales of the IDS. Two samples of young adult students (ns=475 and 1681) were given multiple measures to test the psychometrics and dimensionality of the IDS and QIDS. The IDS, its subscales, and QIDS had acceptable internal consistencies (αs=.79-90) and favorable convergent and divergent validity correlations. A three-factor structure and two Rasch-derived subscales best fit the IDS. The samples were collected from one university, which may influence generalizability. The IDS and QIDS are desirable measures of depressive symptoms when studying young adult students. Copyright © 2013 Elsevier B.V. All rights reserved.
A Cross-Layer, Anomaly-Based IDS for WSN and MANET.
Amouri, Amar; Morgera, Salvatore D; Bencherif, Mohamed A; Manthena, Raju
2018-02-22
Intrusion detection system (IDS) design for mobile adhoc networks (MANET) is a crucial component for maintaining the integrity of the network. The need for rapid deployment of IDS capability with minimal data availability for training and testing is an important requirement of such systems, especially for MANETs deployed in highly dynamic scenarios, such as battlefields. This work proposes a two-level detection scheme for detecting malicious nodes in MANETs. The first level deploys dedicated sniffers working in promiscuous mode. Each sniffer utilizes a decision-tree-based classifier that generates quantities which we refer to as correctly classified instances (CCIs) every reporting time. In the second level, the CCIs are sent to an algorithmically run supernode that calculates quantities, which we refer to as the accumulated measure of fluctuation (AMoF) of the received CCIs for each node under test (NUT). A key concept that is used in this work is that the variability of the smaller size population which represents the number of malicious nodes in the network is greater than the variance of the larger size population which represents the number of normal nodes in the network. A linear regression process is then performed in parallel with the calculation of the AMoF for fitting purposes and to set a proper threshold based on the slope of the fitted lines. As a result, the malicious nodes are efficiently and effectively separated from the normal nodes. The proposed scheme is tested for various node velocities and power levels and shows promising detection performance even at low-power levels. The results presented also apply to wireless sensor networks (WSN) and represent a novel IDS scheme for such networks.
2010-07-01
... is obtained for purposes directly related to enforcement of the criminal laws. (d) Research or... Administration DEPARTMENT OF JUSTICE CONFIDENTIALITY OF IDENTIFIABLE RESEARCH AND STATISTICAL INFORMATION § 22.2... capacity. (c) Research or statistical project means any program, project, or component thereof which is...
DEFF Research Database (Denmark)
Schøsler, Jørn
2013-01-01
Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer.......Der gives en analyse af begreberne 'evidens' og 'medfødte idéer' hos Descartes og Locke samt hos de franske oplysningsfilosoffer....
REFORMASI PEMAHAMAN TEORI MAQᾹṢID SYARIAH Analisis Pendekatan Sistem Jasser Auda
Directory of Open Access Journals (Sweden)
Muhammad Iqbal Fasa
2016-12-01
Full Text Available This paper attempts to offer reform ideas Jasser Auda thought related reforms theoretical understanding of maqᾱṣid sharia. The systems approach is done by Auda critize the theory of classical maqᾱṣid more likely to hierarchical and narrow mindset. The classical maqᾱṣid pressure a point more on protection and preservation. Whereas the new maqᾱṣid theory emphasizes development (construction, development and rights (rights. Thus, Auda developed the concept of human development as the main target of maslahah (public interest. Auda offers the systems approach, namely: cognitive nature; interrelated; wholeness; openness; multi dimentionality and purposefulness. At the end of the discussion in this paper, the authors develop the idea of Jasser Auda by offering Sharia Maqᾱṣid concept in the context of Islamic Economics
Ekspert : mobiil-ID kasutamine valimistel turvariske ei tekita / Holger Roonemaa
Roonemaa, Holger
2008-01-01
E-valimiste projektijuhi Taavi Martensi väitel pole põhjust kahelda mobiil-ID turvalisuses. Valimiskomisjoni esimehe Heiki Sibula meelest peaks m-ID kaarte välja andma kodakondsus- ja migratsiooniamet
Evaluation of radon-222 concentration in air of workplaces at Curitiba/PR, Brazil
Energy Technology Data Exchange (ETDEWEB)
Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson, E-mail: flaviadelclaro@gmail.com, E-mail: spaschuk@gmail.com, E-mail: janine_nicolosi@hotmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy, E-mail: denyak@gmail.com [Instituto de Pesquisa Pele Pequeno Principe (IPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita O., E-mail: rocha@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2013-07-01
The isotope Rn-222 is a noble gas that is responsible for approximately half of the effective annual dose received by the world population, and has very high probability to induce the lung cancer. The goal of present research is to evaluate the activity concentration of Rn-222 in the air of workplaces at Curitiba, Parana State. Simultaneously there were performed the measurements of Rn-222 emanation from soil and building materials occurred at evaluated workplaces. Indoor measurements of Rn-222 activity were performed using CR-39 detectors. The instant radon detector AlphaGUARD (Saphymo GmbH) was used in the measurements of the average concentrations of Rn-222 in soil gas and building materials. The average concentration of indoor Rn-222 obtained in the measurements of workplaces vary between 36+/-49 Bq/m³ and 164+/-51 Bq/m³. These values are considered within the reference limit of 200 Bq/m³ established by international agencies such as the United Nations Scientific Committee on the Effects of Atomic Radiation and the International Commission on Radiological Protection, but slightly above the limit of 148 Bq/m³ established by the United States Environmental Protection Agency. The measurements involving building materials presented the concentration values of Rn-222 in a range from 427+/-310 Bq/m³ to 2053+/-700 Bq/m³. The Rn-222 concentrations in soil ranged from 31+/-2 kBq/m³ to 35+/-4 kBq/m³ and the average values of Rn-220 are found in a range of 41+/-6 kBq/m³ and 25+/-11 kBq/m³, thus the concentrations of radon gas soil are below the swedish criterion of 50 kBq/m³ that represent the minimum value for high-risk situation. (author)
Evaluation of radon-222 concentration in air of workplaces at Curitiba/PR, Brazil
International Nuclear Information System (INIS)
Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson; Denyak, Valeriy; Rocha, Zildete; Santos, Talita O.
2013-01-01
The isotope Rn-222 is a noble gas that is responsible for approximately half of the effective annual dose received by the world population, and has very high probability to induce the lung cancer. The goal of present research is to evaluate the activity concentration of Rn-222 in the air of workplaces at Curitiba, Parana State. Simultaneously there were performed the measurements of Rn-222 emanation from soil and building materials occurred at evaluated workplaces. Indoor measurements of Rn-222 activity were performed using CR-39 detectors. The instant radon detector AlphaGUARD (Saphymo GmbH) was used in the measurements of the average concentrations of Rn-222 in soil gas and building materials. The average concentration of indoor Rn-222 obtained in the measurements of workplaces vary between 36+/-49 Bq/m³ and 164+/-51 Bq/m³. These values are considered within the reference limit of 200 Bq/m³ established by international agencies such as the United Nations Scientific Committee on the Effects of Atomic Radiation and the International Commission on Radiological Protection, but slightly above the limit of 148 Bq/m³ established by the United States Environmental Protection Agency. The measurements involving building materials presented the concentration values of Rn-222 in a range from 427+/-310 Bq/m³ to 2053+/-700 Bq/m³. The Rn-222 concentrations in soil ranged from 31+/-2 kBq/m³ to 35+/-4 kBq/m³ and the average values of Rn-220 are found in a range of 41+/-6 kBq/m³ and 25+/-11 kBq/m³, thus the concentrations of radon gas soil are below the swedish criterion of 50 kBq/m³ that represent the minimum value for high-risk situation. (author)
Tracey, Monica W.; Unger, Kelly L.
2012-01-01
As the need for instructing a globalized workforce increases, instructional designers must embrace the constraints and the opportunities these projects provide in order to move the field of cross-cultural instructional design (ID) forward. Cross-cultural projects offer multiple avenues for growth in ID practice, overcoming cultural barriers, and a…
Id-1 is not expressed in the luminal epithelial cells of mammary glands
International Nuclear Information System (INIS)
Uehara, Norihisa; Chou, Yu-Chien; Galvez, Jose J; Candia, Paola de; Cardiff, Robert D; Benezra, Robert; Shyamala, Gopalan
2003-01-01
The family of inhibitor of differentiation/DNA binding (Id) proteins is known to regulate development in several tissues. One member of this gene family, Id-1, has been implicated in mammary development and carcinogenesis. Mammary glands contain various cell types, among which the luminal epithelial cells are primarily targeted for proliferation, differentiation and carcinogenesis. Therefore, to assess the precise significance of Id-1 in mammary biology and carcinogenesis, we examined its cellular localization in vivo using immunohistochemistry. Extracts of whole mammary glands from wild type and Id-1 null mutant mice, and tissue sections from paraffin-embedded mouse mammary glands from various developmental stages and normal human breast were subjected to immunoblot and immunohistochemical analyses, respectively. In both these procedures, an anti-Id-1 rabbit polyclonal antibody was used for detection of Id-1. In immunoblot analyses, using whole mammary gland extracts, Id-1 was detected. In immunohistochemical analyses, however, Id-1 was not detected in the luminal epithelial cells of mammary glands during any stage of development, but it was detected in vascular endothelial cells. Id-1 is not expressed in the luminal epithelial cells of mammary glands
ID Barrel installed in cryostat
Apsimon, R.; Romaniouk, A.
Wednesday 23rd August was a memorable day for the Inner Detector community as they witnessed the transport and installation of the central part of the inner detector (ID-barrel) into the ATLAS detector. Many members of the collaboration gathered to witness this moment at Point 1. After years of design, construction and commissioning, the outer two detectors (TRT and SCT) of the ID barrel were moved from the SR1 cleanroom to the ATLAS cavern. The barrel was moved across the car park from building 2175 to SX1. Although only a journey of about 100 metres, this required weeks of planning and some degree of luck as far as the weather was concerned. Accelerometers were fitted to the barrel to provide real-time monitoring and no values greater than 0.1 g were recorded, fully satisfying the transport specification for this extremely precise and fragile detector. Muriel, despite her fear of heights, bravely volunteered to keep a close eye on the detector. Swapping cranes to cross the entire parking lot, while Mur...
A survey of 222Rn in drinking water in mexico city
International Nuclear Information System (INIS)
Vasquez-Lopez, C.; Zendejas-Leal, B. E.; Golzarri, J. I.; Espinosa, G.
2011-01-01
In Mexico City there are more than 22 millions of inhabitants (10 in the metropolitan area and 12 in the suburban zone) exposed to drinking water. The local epidemiological authorities recognised that exposure to radon contaminated drinking water is a potential health hazard, as has been considered worldwide. The United States Environmental Protection Agency has proposed a limit of 11.1 Bq l -1 for the radon level in drinking water. In Mexico a maximum contamination level of radon in drinking water has not yet even considered. In this work, a 222 Rn study of drinking water in Mexico City has revealed a range of concentrations from background level to 3.8 Bq l -1 . 222 Rn was calculated using a portable degassing system (AquaKIT) associated with an AlphaGUARD measuring system. Samples from 70 wells of the water system of the south of the Valley Basin of Mexico City and from houses of some other political administrative divisions of Mexico City were taken. (authors)
idRHa+ProMod - Rail Hardening Control System
International Nuclear Information System (INIS)
Ferro, L
2016-01-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl (paper)
idRHa+ProMod - Rail Hardening Control System
Ferro, L.
2016-03-01
idRHa+ProMod is the process control system developed by Primetals Technologies to foresee the thermo-mechanical evolution and micro-structural composition of rail steels subjected to slack quenching into idRHa+ Rail Hardening equipments in a simulation environment. This tool can be used both off-line or in-line, giving the user the chance to test and study the best cooling strategies or letting the automatic control system free to adjust the proper cooling recipe. Optimization criteria have been tailored in order to determine the best cooling conditions according to the metallurgical requirements imposed by the main rail standards and also taking into account the elastoplastic bending phenomena occurring during all stages of the head hardening process. The computational core of idRHa+ProMod is a thermal finite element procedure coupled with special algorithms developed to work out the main thermo-physical properties of steel, to predict the non-isothermal austenite decomposition into all the relevant phases and subsequently to evaluate the amount of latent heat of transformation released, the compound thermal expansion coefficient and the amount of plastic deformation in the material. Air mist and air blades boundary conditions have been carefully investigated by means of pilot plant tests aimed to study the jet impingement on rail surfaces and the cooling efficiency at all working conditions. Heat transfer coefficients have been further checked and adjusted directly on field during commissioning. idRHa+ is a trademark of Primetals Technologies Italy Srl
Internal validation of the RapidHIT® ID system.
Wiley, Rachel; Sage, Kelly; LaRue, Bobby; Budowle, Bruce
2017-11-01
Traditionally, forensic DNA analysis has required highly skilled forensic geneticists in a dedicated laboratory to generate short tandem repeat (STR) profiles. STR profiles are routinely used either to associate or exclude potential donors of forensic biological evidence. The typing of forensic reference samples has become more demanding, especially with the requirement in some jurisdictions to DNA profile arrestees. The Rapid DNA (RDNA) platform, the RapidHIT ® ID (IntegenX ® , Pleasanton, CA), is a fully automated system capable of processing reference samples in approximately 90min with minimal human intervention. Thus, the RapidHIT ID instrument can be deployed to non-laboratory environments (e.g., booking stations) and run by trained atypical personnel such as law enforcement. In order to implement the RapidHIT ID platform, validation studies are needed to define the performance and limitations of the system. Internal validation studies were undertaken with four early-production RapidHIT ID units. Reliable and concordant STR profiles were obtained from reference buccal swabs. Throughout the study, no contamination was observed. The overall first-pass success rate with an "expert-like system" was 72%, which is comparable to another current RDNA platform commercially available. The system's second-pass success rate (involving manual interpretation on first-pass inconclusive results) increased to 90%. Inhibitors (i.e., coffee, smoking tobacco, and chewing tobacco) did not appear to affect typing by the instrument system; however, substrate (i.e., swab type) did impact typing success. Additionally, one desirable feature not available with other Rapid systems is that in the event of a system failed run, a swab can be recovered and subsequently re-analyzed in a new sample cartridge. Therefore, rarely should additional sampling or swab consumption be necessary. The RapidHIT ID system is a robust and reliable tool capable of generating complete STR profiles within
Results of Long-term Measurement of 222Rn Volume Activity in Soil Air
International Nuclear Information System (INIS)
Holy, K.; Matos, M.; Boem, R.; Stanys, T.; Hola, O.; Polaskova, A.
1999-01-01
Radon in the soil air was continuously monitored for four years. The measured volume activities differ one from another even three times. On the basis of the measured data the annual and average daily courses of the 222 Rn volume activity were studied for individual months. In annual courses the winter and also summer maxima of the 222 Rn volume activity were found out. The study of the average daily courses revealed that the oscillation of the 222 Rn volume activity about its average value during a day is only a few percent. For dry summer months a linear relation was found out between the changes of the 222 Rn volume activity and the changes of the atmospheric pressure in their average daily courses (Authors)
Assessing urban air quality and its relation with radon (222Rn)
International Nuclear Information System (INIS)
Zoran, Maria; Savastru, Dan; Dida, Adrian
2016-01-01
This paper focuses on the assessment of air quality and its relation with radon ( 222 Rn) for Bucharest metropolitan area in Romania. Specifically, daily mean concentrations of particle matter (PM2.5, PM10), ozone (O 3 ), nitrogen dioxide (NO 2 ), sulphur dioxide (SO 2 ) and global air quality indices have been analyzed in relation with radon ( 222 Rn) concentrations measured in the air near the ground with AlphaGUARD Radon Monitoring System and CR-39 SSNTDs during 2012 year. Such new information is required by atmospheric sciences to prove suitability of 222 Rn as a tracer for atmospheric dynamics analysis as well as by epidemiological and radiological protection studies. (author)
Dry soil diurnal quasi-periodic oscillations in soil 222Rn concentrations
International Nuclear Information System (INIS)
Tommasone Pascale, F.; De Francesco, S.; Carbone, P.; Cuoco, E.; Tedesco, D.
2014-01-01
222 Rn concentrations have been monitored during the dry season in August 2009 and August 2010, in a reworked alluvial-pyroclastic soil of the Pietramelara Plain, in Southern Italy, with the aim of determining the role of atmospheric factors in producing the quasi-periodic oscillations in soil 222 Rn concentrations reported in the literature. In this study we present the results of a detailed analysis and matching of soil 222 Rn concentrations, meteorological and solar parameters where the observed oscillations feature a characteristic behavior with second order build-up and depletion limbs, separated by a daily maximum and minimum. All these features are clearly shown to be tied to sunrise and sunset timings and environmental radiative flux regimes. Furthermore, a significant, and previously unreported, second order correlation (r 2 = 0.73) between daily maximum hourly global radiation and the daily range of soil 222 Rn concentrations has been detected, allowing estimates of the amplitude of these oscillations to be made from estimated or measured solar radiation data. The correlation has been found to be valid even in the presence of persistent patchy daytime cloudiness. In this case a daytime prolongation of the night-time build up stage and an attenuation or even suppression of daytime depletion is observed (a previously unreported effect). Neither soil cracking, nor precipitation, both suggested in some studies as causative factors for these oscillations, during the dry season appear to be necessary in explaining their occurrence. We also report the results of an artificial shading experiment, conducted in August 2009, that further support this conclusion. As soil 222 Rn concentrations during the dry season show a characteristic daily cycle, radon monitoring in soils under these conditions necessarily has to be gauged to the timings of the daily maximum and minimum, as well as to the eventual occurrence of cloudiness and to its related effects, in order to
Id3 induces an Elk-1–caspase-8-dependent apoptotic pathway in squamous carcinoma cells
International Nuclear Information System (INIS)
Chen, You-Shin; Aubee, Joseph; DiVito, Kyle A; Zhou, Hengbo; Zhang, Weiyi; Chou, Fen-Pi; Simbulan-Rosenthal, Cynthia M; Rosenthal, Dean S
2015-01-01
Inhibitor of differentiation/DNA-binding (Id) proteins are helix–loop–helix (HLH) transcription factors. The Id protein family (Id1–Id4) mediates tissue homeostasis by regulating cellular processes including differentiation, proliferation, and apoptosis. Ids typically function as dominant negative HLH proteins, which bind other HLH proteins and sequester them away from DNA promoter regions. Previously, we have found that Id3 induced apoptosis in immortalized human keratinocytes upon UVB exposure, consistent with its role as a tumor suppressor. To investigate the role of Id3 in malignant squamous cell carcinoma (SCC) cells (A431), a tetracycline-regulated inducible system was used to induce Id3 in cell culture and mouse xenograft models. We found that upon Id3 induction, there was a decrease in cell number under low serum conditions, as well as in soft agar. Microarray, RT-PCR, immunoblot, siRNA, and inhibitor studies revealed that Id3 induced expression of Elk-1, an E-twenty-six (ETS)-domain transcription factor, inducing procaspase-8 expression and activation. Id3 deletion mutants revealed that 80 C-terminal amino acids, including the HLH, are important for Id3-induced apoptosis. In a mouse xenograft model, Id3 induction decreased tumor size by 30%. Using immunofluorescent analysis, we determined that the tumor size decrease was also mediated through apoptosis. Furthermore, we show that Id3 synergizes with 5-FU and cisplatin therapies for nonmelanoma skin cancer cells. Our studies have shown a molecular mechanism by which Id3 induces apoptosis in SCC, and this information can potentially be used to develop new treatments for SCC patients
Identifying Groundwater Discharge in the Merced River Basin, California Using Radon-222
Shaw, G. D.; Hudson, G. B.; Moran, J.; Conklin, M.
2004-12-01
Groundwater flow in fractured granite of the Sierra Nevada is poorly characterized, in particular, contributions of mountain block recharge are not known. Using a combination of water quality and isotopic analyses, groundwater inputs to the Upper Merced River were characterized. Between November 2003 and July 2004, monthly water quality samples were taken from Happy Isles to the inlet of Lake McClure, a 75 km reach. These samples demonstrated the expected dilution due to snowmelt in the spring. In the fall, the spatial profile matched the geology with anion concentrations increasing downstream of the transition from the Sierra Nevada batholith to the country rock, suggesting significant groundwater inputs. From July 19 to 21, 2004, radon-222 and other noble gases (He, Ne, Ar, Kr and Xe abundances and 3He/4He ratio) were measured along a 37 km reach of the Merced River, extending from the top of Yosemite Valley to the confluence of the South Fork of the Merced River. All radon samples were extracted into mineral oil immediately in the field and counted using liquid scintillation; noble gas samples were collected in copper tubes. Radon-222 activity varied from about 1 to 100 pCi/L (at collection time) indicating significant, spatially variable groundwater discharge into the Merced River. Two one-mile reaches of the Merced River were sampled for 222Rn on a fine scale. Large fracture sets in these two locations and previous temperature measurements suggested that groundwater discharge was higher relative to other locations along the river. Radon-222 activity was low upstream and downstream of large fractures observed in the bedrock; whereas, 222Rn activity was high at large fracture zones. Degassing is rapid downstream of fractures where no groundwater discharge is observed. For a representative groundwater end-member, radon-222 activity measured in Fern Spring, Yosemite Valley was about 1200 pCi/L. Excess 4He from U and Th decay is observed in samples with elevated
30 CFR 285.222 - What does MMS do with my bid?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What does MMS do with my bid? 285.222 Section... Energy Leases Competitive Lease Award Process § 285.222 What does MMS do with my bid? (a) If sealed... any proposal submitted will be made by a panel composed of members selected by MMS. The details of the...
Bio-fortification and shelf-life extension of idli batter using curry leaves (Murraya koenigii).
Chelliah, R; Ramakrishnan, S R; Premkumar, D; Antony, U
2016-06-01
Among several traditional foods of India, idli is one of the most popular and commonly consumed steamed products. A new method of adding Murraya koenigii (curry leaves) to idli batter as a vehicle for fortification and extension of shelf-life has been developed. Dried curry leaves powder was incorporated with other ingredients like rice and dehusked black gram in different proportions to optimize the most palatable formulation. Rate of fermentation and microbial changes in the batter; nutritional qualities, texture and sensory properties of the prepared product were assessed. Incorporation of curry leaves powder (5 %) in idli batter increased the shelf-life and also increased the flavour, texture and appearance of the idli. The calcium content of the prepared idli was 10 times more than that of the control idli, while dietary fiber content increased by 18.6 %. Anti-microbial activity of the curry leaves in idli batter extended the shelf-life from 2 to 5 days when stored at 30 °C.
To ID or Not to ID? Changes in Classification Rates of Intellectual Disability Using "DSM-5"
Papazoglou, Aimilia; Jacobson, Lisa A.; McCabe, Marie; Kaufmann, Walter; Zabel, T. Andrew
2014-01-01
The "Diagnostic and Statistical Manual of Mental Disorders-Fifth Edition" ("DSM-5") diagnostic criteria for intellectual disability (ID) include a change to the definition of adaptive impairment. New criteria require impairment in one adaptive domain rather than two or more skill areas. The authors examined the diagnostic…
Tang, Yi-Wei; Lowery, Kristin S; Valsamakis, Alexandra; Schaefer, Virginia C; Chappell, James D; White-Abell, Jill; Quinn, Criziel D; Li, Haijing; Washington, Cicely A; Cromwell, Jenna; Giamanco, Chantel M; Forman, Michael; Holden, Jeffery; Rothman, Richard E; Parker, Michelle L; Ortenberg, Elaine V; Zhang, Lei; Lin, Yea-Lin; Gaydos, Charlotte A
2013-01-01
Respiratory tract infections caused by influenza A and B viruses often present nonspecifically, and a rapid, high-throughput laboratory technique that can identify influenza viruses is clinically and epidemiologically desirable. The PLEX-ID Flu assay (Abbott Molecular Inc., Des Plaines, IL) incorporates multilocus PCR and electrospray ionization-mass spectrometry to detect and differentiate influenza A 2009 H1N1 (H1N1-p), seasonal H1N1 (H1N1-s), influenza A H3N2, and influenza B viruses in nasopharyngeal swab (NPS) specimens. The clinical performance characteristics of the PLEX-ID Flu assay in symptomatic patients were determined in this multicenter trial. A total of 2,617 prospectively and retrospectively collected NPS specimens from patients with influenza-like illness between February 2008 and 28 May 2010 were eligible for inclusion in the study. Each specimen was tested in parallel by the PLEX-ID Flu assay and by the Prodesse ProFLU+ assay (Prodesse Inc., Madison, WI), to detect influenza A and B viruses. Specimens testing positive for influenza A virus by ProFLU+ were subtyped as H1N1-p, H1N1-s, or H3N2 by using the ProFAST+ assay (Gen-Probe Prodesse Inc.). The reproducibility of the PLEX-ID Flu assay ranged from 98.3 to 100.0%, as determined by testing a nine-specimen panel at three clinical sites on each of 5 days. Positive percent agreements (PPAs) and negative percent agreements (NPAs) of the PLEX-ID Flu assay were 94.5% and 99.0% for influenza A virus and 96.0% and 99.9% for influenza B virus, respectively. For the influenza A virus subtyping characterization, the PLEX-ID Flu assay had PPAs and NPAs of 98.3% and 97.5% for H1N1-p, 88.6% and 100.0% for H1N1-s, and 98.0% and 99.9% for H3N2, respectively. The overall agreements between the PLEX-ID and Prodesse ProFLU+/ProFAST+ assays were 97.1 to 100.0%. Bidirectional Sanger sequencing analysis revealed that 87.5% of 96 discrepant results between the PLEX-ID Flu and ProFLU+/ProFAST+ assays were found upon
36 CFR 222.23 - Removal of other horses and burros.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Removal of other horses and... AGRICULTURE RANGE MANAGEMENT Management of Wild Free-Roaming Horses and Burros § 222.23 Removal of other horses and burros. Horses and burros not within the definition in § 222.20(b)(13) which are introduced...
A Plan to Optimize the Management of Weld ID SSN Numbering System for Nuclear Power Plants in Korea
International Nuclear Information System (INIS)
Yoo, Hyun Ju; Cho, Chan Hee; Kim, Jin Hoi; Park, Dong Min
2016-01-01
Summary Sheet Number(SSN) in the current LTP is an ID which means a weldment in a nuclear power plant. However, the SSN ID, which is unique on in a nuclear power plant, is not unique one if the weldments of entire nuclear power plant in Korea are treated in one system. Therefore, it is hard to manage the data during life time using the existing SSN ID system. It is also hard to configure the characteristics of weldment in mind because IDs implying Alloy600 and overlay weld do not exist in the existing SSN ID System. An optimized SSN numbering system managing weldments for the life time is introduced in this paper. Moreover, it is explained how to manage the SSN numbering system in the computer program system, too. The problem, which the weld is not harmoniously managed, would be solved provided adapting the new SSN ID introduced in this paper. A weld is managed during its life time from creation to extinction. The inquiry of inspection history of a concerned weld and the reference of statistics would be performed easily and rightly because the concerned weld can be accessed from anywhere connected to KHNP network such as KHNP headquater, plants and CRI
Radon-222 exhalation from Danish building materials: H + H Industri A/S results
International Nuclear Information System (INIS)
Andersen, C.E.
1999-08-01
This report describes a closed-chamber method for laboratory measurements of the rate at which radon-222 degasses (exhales) from small building material samples. The chamber is 55 L in volume and the main sample geometry is a slab of dimensions 5x30x30 cm 3 . Numerical modelling is used to assess (and partly remove) the bias of the method relative to an ideal measurement of the free exhalation rate. Experimental results obtained with the method are found to be in agreement with the results of an open-chamber method (which is subject to different sources of error). Results of radon-222 exhalation rate measurements for 10 samples of Danish building materials are reported. Samples include ordinary concrete, lightweight aggregate concrete, autoclaved aerated concrete, bricks, and gypsum board. The maximum mass-specific exhalation rate is about 20 mBq h -1 kg -1 . Under consideration of the specific applications of the investigated building materials, the contribution to the indoor radon-222 concentration in a single-family reference house is calculated. Numerical modelling is used to help extrapolate the laboratory measurements on small samples to full scale walls. Application of typical materials will increase the indoor concentration by less than 10 Bq m -3 . (au)
Detection of 222Rn and 226Ra in environmental samples by scintillation method
International Nuclear Information System (INIS)
Zafimanjato, J.L.R.; Raoelina Andriambololona; Mobius, S.
2009-01-01
222 Rn is considered as the major source of radiological exposure of natural radiations to the population. It represents about the half of exposures of natural radiation sources in the world (UNSCEAR, 1993). 222 Rn gets into human body with inhaled air and sometimes with drinking water. Then, the objective of this work is to know the 222 Rn concentrations in water and in indoor atmosphere, and the risk in order to set up a method of monitoring and to identify high radon level areas. A specific method of detection using liquid scintillation with special emphasis on α/β discrimination, the use of solvent extractive and enrichment of radionuclides have been developed for the determination of both 222 Rn and 226 Ra in water. The method is simple, rapid and sensitive. It was shown that the proposed method was suitable for a large scale monitoring and routine analysis. Considerable concentrations of 222 Rn were found in water and air samples from Vinaninkarena - Antsirabe. 222 Rn concentrations obtained by in situ and in laboratory measurements have been compared to the results of an international intercomparison campaigns organised by the German Society for Liquid Scintillation Spectrometry in 2001. An assesment model of the dose due to ingestion and liberation of radon from water is presented and compared with other models especially to the Crawford Brown's model.
Utilization of MS 222 in Transport of Catfish (Pangasius sutchi Seed
Directory of Open Access Journals (Sweden)
Harton Arfah
2007-12-01
Full Text Available ABSTRACTProblems faced in supplying seed out of Java especially Bogor to Sumatera, for instance, are it only contains few seed (100 seeds/l and it has a high mortality rate because of stress during transport. This experiment was conducted to know the effect of MS 222 in keeping fish metabolism activity down while taking note of its survival rate and change of water quality. The experimental design used here was factorial design 3x5 with 3 repetitions. Dosages of MS–222 were 0, 25 and 50 ppm and the fish densities were 100, 300, 400, 500 and 600 per liter. As container was plastic bag (volume 10 l. After putting the fish into the plastic bag, it was filled up with oxygen, which the volume was 3 times than water volume, than the plastic bag was closed by tying it. After 18 hours of treatment the survival rate and water quality were checked. Based on evaluation of survival rate, it was concluded that the combination between 25 ppm of MS 222 and fish density, which was 500 per liter, gave an optimum result.Keywords: Catfish, Pangasius sutchi, live transport, stress, MS–222, survival rate ABSTRAKKendala yang dihadapi dalam pemasokan benih ikan patin dari pulau Jawa terutama Bogor, keluar pulau Jawa terutama Sumatera adalah jumlah ikan yang terangkut masih sedikit (± 100 ekor/l dan tingkat kematian yang cukup tinggi, karena stres selama perjalanan. Penelitian ini dilakukan untuk mengetahui pengaruh penggunaan MS–222 dalam menekan aktivitas metabolisme ikan dengan memperhatikan tingkat kelangsungan ikan dan perubahan kualitas air. Penelitian ini menggunakan rancangan faktorial 3x5 dengan 3 ulangan. Dosis MS–222 yang digunakan: 0,25 dan 50 ppm dan kepadatan ikan: 100, 300, 400, 500 dan 600 ekor/l. Wadah pengangkutan berupa kantong plastik (volume 10 l. Ikan yang diangkut dimasukkan ke dalam kantong plastik, kemudian dipompakan oksigen sebanyak 3 kali volume air, selanjutnya dilakukan pengikatan. Setelah 18 jam perlakuan dilakukan
222Rn levels in Kingsville, Texas, and vicinity near an in situ uranium mine
International Nuclear Information System (INIS)
McGehee, T.L.; Martino, M.R.; Harr, T.L.; Samudio, A.
1994-01-01
An investigation of the 222 Rn levels in ground water, soils, and indoor air has disclosed two 222 Rn ground-water anomalies in the Kingsville, Texas, area from uranium-enriched sandstones of the Evangeline aquifer. Indoor air 222 Rn levels were measured in summer 1991 (from undetectable to 3.2 pCi/l) and winter 1991-1992 (0.01 to 3.98 pCi/l) to determine seasonal extremes and risk to the public. Soil 222 Rn concentration maps ranging from undetectable to 75.4 pCi/l correlate to the low levels found in homes. Results of this study are based on analyses of 218 water samples, 52 in situ soil samples, and 104 indoor air samples. Water samples were injected into a scintillation mix (EPA/EERF-Manual-78-1) and analyzed by liquid scintillation techniques. Indoor air and soil samples were collected using passive charcoal canisters and analyzed by gamma-ray detection techniques (EPA 520/5-87-005). One ground-water 222 Rn anomaly lies near the permitted boundary of a large uranium deposit that is being mined. Private wells near the ore body yielded, 1,023 to 23,256 pCi/l at the well head. A second anomaly is located 2.5 mi (4 km) north of the uranium ore body near Naval Air Station, Kingsville. Private water wells in this area yielded 442 to 1,950 pCi/l 222 Rn at the well head. The radon anomalies are related to subsurface mineralization, which is one of the known natural geologic hazards of this area. Indoor air 222 Rn levels are well below the U.S. Environmental Protection Agency (US/EPA) action limit of 4 pCi/l. However, the high levels of 222 RN in ground water should be mitigated before entry into the home environment. High 222 Rn levels in ground water were reduced to background levels in household waters by use of a pre-introduction large-capacity holding tank
48 CFR 52.222-44 - Fair Labor Standards Act and Service Contract Act-Price Adjustment.
2010-10-01
... and Service Contract Act-Price Adjustment. 52.222-44 Section 52.222-44 Federal Acquisition Regulations... CLAUSES Text of Provisions and Clauses 52.222-44 Fair Labor Standards Act and Service Contract Act—Price... Contract Act—Price Adjustment (SEP 2009) (a) This clause applies to both contracts subject to area...
Energy Technology Data Exchange (ETDEWEB)
Farias, Luciana Aparecida
2002-07-01
The purpose of this study is to calibrate a degassing-emanation line and to determine {sup 222}Rn and {sup 226}Ra activity concentrations in seawater samples. This methodology, also called Lucas method, consists in the extraction of radon (originally dissolved in seawater), collection of the gas in a liquid nitrogen cold trap and transfer from the trap to an alpha scintillation cell. Total extraction efficiencies of the 4 degassing-emanation systems were determined by measuring {sup 226}Ra reference solutions. The efficiencies obtained for these 4 systems varied from 21 % to 62%. This work also presents preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil: Flamengo Bay, Fortaleza Bay, Mar Virado Bay and Ubatuba Bay. Concentration of Rn in excess varied from 0,011 to 0,317 Bq/L for Flamengo Bay, from 0,009 to 0,130 Bq/L for Fortaleza Bay, from 0,018 to 0,050 Bq/L for Mar Virado Bay and from 0,004 to 0,120 Bq/L for Ubatuba Bay. The results obtained for the concentration of {sup 222}Rn in excess in a transect at Flamengo Bay varied from 0,002 to 0,036 Bq/L. Higher concentrations of {sup 222}Rn in excess were obtained in Flamengo Bay, Fortaleza Bay and Ubatuba bay. It was also observed that the concentration of {sup 222}Rn in excess increases with depth, as expected. (author)
Keramati, Hassan; Ghorbani, Raheb; Fakhri, Yadolah; Mousavi Khaneghah, Amin; Conti, Gea Oliveri; Ferrante, Margherita; Ghaderpoori, Mansour; Taghavi, Mahmoud; Baninameh, Zahra; Bay, Abotaleb; Golaki, Mohammad; Moradi, Bigard
2018-03-30
The current study was performed to review the conducted studies regarding the concentration of radon 222 in the tap drinking water; furthermore, by estimation of ingestion and inhalation effective dose, the health risk assessment in the adults and children using MCS technique was assessed. All related studies published among January 1990 to October 2016; were screened in the available databases such as Web of Science, PubMed, Science Direct, Scopus, SID, and Irandoc. The total effective dose was estimated by calculating E ing (Effective dose of ingestion) and E inh (Effective dose of inhalation) by Monte Carlo simulation (MCS) method. The range of ND ─ 40.9 Bq/L for radon 222 in water resources was proposed after evaluation of data collected from 13 studies with 1079 samples. The overall concentration of radon 222 in drinking water in Iran was 3.98: 95%CI (3.79 ─ 4.17 Bq/L). Also, the effective ingestion dose of radon 222 in adults age groups was 1.35 times higher than children. The rank order of drinking water resources based on the concentration of radon 222 was Spring > Spring and Well > Well > Spring and Qanat > Tap water. The overall concentration of radon 222 in drinking water in Iran was lower than WHO and EPA standard limits. Also, the rank order regarding area studied based on the concentration of radon 222 was Gillan > Mashhad > Mazandaran > Kerman > Yazd > Tehran > Kermanshah > Golestan > Hormozgan. The effective ingestion dose of radon 222 to consumers in the Gillan, Mashhad, Mazandaran, and Kerman were higher than WHO guidance (0.1 mSv/y). Also except consumers in the Hormozgan, inhalation effective dose radon 222, in the other investigated areas were higher than WHO guidance (0.1 mSv/y). Therefore, it is recommended to conduct the required programs regarding control and elimination of radon 222 concentration in Iranian drinking water supply. Copyright © 2018 Elsevier Ltd. All rights reserved.
2010-07-01
... adding together the assessed values determined pursuant to paragraph (a)(4) of this section for all... Uses for Determining Base Values Tax classifications of adjacent properties based on highest and best... aggregate assessed value of its eligible Federal property for its section 8002 payment? 222.23 Section 222...
Energy Technology Data Exchange (ETDEWEB)
Jared Verba; Michael Milvich
2008-05-01
Current Intrusion Detection System (IDS) technology is not suited to be widely deployed inside a Supervisory, Control and Data Acquisition (SCADA) environment. Anomaly- and signature-based IDS technologies have developed methods to cover information technology-based networks activity and protocols effectively. However, these IDS technologies do not include the fine protocol granularity required to ensure network security inside an environment with weak protocols lacking authentication and encryption. By implementing a more specific and more intelligent packet inspection mechanism, tailored traffic flow analysis, and unique packet tampering detection, IDS technology developed specifically for SCADA environments can be deployed with confidence in detecting malicious activity.
36 CFR 222.21 - Administration of wild free-roaming horses and burros and their environment.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Administration of wild free-roaming horses and burros and their environment. 222.21 Section 222.21 Parks, Forests, and Public Property... Burros § 222.21 Administration of wild free-roaming horses and burros and their environment. (a) The...
222Rn Determination In Drinking Waters - RAD7 And LSC Technique Comparison
International Nuclear Information System (INIS)
Todorovic, N.; Stojkovic, I.; Nikolov, J.; Tenjovic, B.
2015-01-01
A procedure for the determination of 222Rn in environmental water samples using liquid scintillation counting (LSC) was applied and optimized. For radon determination in drinking water from groundwater and surface water sources by LSC, the EPA Method 913.0 was used. A minimum detectable activity of 0.029 Bq L-1 in a 20 mL glass vial (10 mL water sample mixed with 10 mL of liquid scintillation cocktail) has been achieved during 300 minutes of measurement time. The procedure was compared with RAD7 radon detector measurements. Factors that affect the measurement accuracy and precision of RAD7 radon detector are the sampling technique, sample concentration, sample size, counting time, temperature, relative humidity and background effects. The minimal detectable activity (MDA) for RAD7 technique was found to be 0.1 Bq/L. From obtained results of 222Rn measurements in 15 water samples with different 222Rn activities, correlation between the two techniques applied for measurements of 222Rn in water samples (A less than 400 Bq/L) was determined. There is reasonable agreement (within statistical uncertainties) between the various techniques in most cases, while disagreements most likely come from systematic uncertainties associated with sampling procedures. Discrepancy in determined activities between the two techniques becomes more evident with increased 222Rn activities in water. LSC technique gives in general higher activity concentrations for about 30 percent than RAD7 spectrometer. The interpretation of shown results could be that RAD7 is not properly calibrated for higher activities, since USA reference level of 222Rn concentrations in water is only 11.1 Bq/L (US EPA, Proposed Radon in Drinking Water Regulation). (author).
Energy Technology Data Exchange (ETDEWEB)
Bonifacio M, J [Universidad Autonoma del Estado de Mexico. Facultad de Quimica. Toluca (Mexico)
1992-12-31
The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)
Energy Technology Data Exchange (ETDEWEB)
Bonifacio M, J. [Universidad Autonoma del Estado de Mexico. Facultad de Quimica. Toluca (Mexico)
1991-12-31
The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)
20 CFR 222.16 - When spouse is living in the same household with employee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When spouse is living in the same household with employee. 222.16 Section 222.16 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.16...
2010-02-23
... Airworthiness Directives; Airbus Model A310-203, -221, -222 Airplanes; and Model A300 F4-605R and -622R...-222 airplanes, all serial numbers. (2) Airbus Model A300 F4-605R and A300 F4-622R airplanes, all...
Knock-down of miR-221 and miR-222 in the radiosensitization of breast cancer cells
International Nuclear Information System (INIS)
Zhang Chunzhi; Kang Chunsheng; Cao Yongzhen; Pu Peiyu; Lu Zhonghong; Du Yue
2009-01-01
Objective: To investigate the radiosensitizing effect of knock-down of miR-221 miR-222 on MCF-7 human breast cancer cells and explore the possible mechanism. Methods: Antisense oligonucleotides of miR-221 and miR-222 (AS-miR-221 and AS-miR-222), mediated by lipofectamine, were transfected to MCF-7 cells to knock down miR-221 and miR-222, Northern blotting was conducted to detect the expression of miR-221 and miR-222 in transfected cells. The cell apoptosis was detected by flow cytometry and Caspase-3 and Caspase-7 activity assay. Clonogenic assay was used to measure the sensitizing enhancement ratio. Target genes of miR-221 and miR-222 relevant to radio-sensitivity were searched using bioinformatics analysis. The targeted protein expression was determined by Western blot analysis. Results: The expression of miR-221 and miR-222 in the AS-miR-221/222 cells determined by Northern blotting was significantly reduced. Compared with the control group, the cell apoptosis and mitotic cell death after the radiation were significantly higher in AS-miR-221/222 cells. The sensitizing enhancement ratio was 1.87. Based on bioinformatics analysis, PTEN was a target gene of miR-221 and miR-222 which could enhance the radiosensitivity of MCF-7 cells. In AS-miR-221/222 cells, the expression of PTEN was up-regulated while pAkt down-regulated. Conclusions: AS-miR-221 and AS-miR-222 may enhance the radiosensitivity of MCF-7 breast cancer cells by up-regulating the expression of PTEN. (authors)
Directory of Open Access Journals (Sweden)
Finn Hedefalk
2014-09-01
Full Text Available The Intermediate Data Structure (IDS is a standardised database structure for longitudinal historical databases. Such a common structure facilitates data sharing and comparative research. In this study, we propose an extended version of IDS, named IDS-Geo, that also includes geographic data. The geographic data that will be stored in IDS-Geo are primarily buildings and/or property units, and the purpose of these geographic data is mainly to link individuals to places in space. When we want to assign such detailed spatial locations to individuals (in times before there were any detailed house addresses available, we often have to create tailored geographic datasets. In those cases, there are benefits of storing geographic data in the same structure as the demographic data. Moreover, we propose the export of data from IDS-Geo using an eXtensible Markup Language (XML Schema. IDS-Geo is implemented in a case study using historical property units, for the period 1804 to 1913, stored in a geographically extended version of the Scanian Economic Demographic Database (SEDD. To fit into the IDS-Geo data structure, we included an object lifeline representation of all of the property units (based on the snapshot time representation of single historical maps and poll-tax registers. The case study verifies that the IDS-Geo model is capable of handling geographic data that can be linked to demographic data.
Investigations into the long-distance atmospheric transport in Central Europe using Rn-222
International Nuclear Information System (INIS)
Volpp, H.J.
1984-01-01
An measuring network was used to determine the atmospheric Rn-222 content in Central Europe (Northern and Southern Germany, Poland). Rn-222 is to serve as tracer for the long-distance atmospheric transport in central Europe. For several areas, an average Rn-222 flux density was found. The radon source 'continent' and the soil as radon source have been taken into account. (DG) [de
ACE I/D genotype, adiposity, and blood pressure in children
Directory of Open Access Journals (Sweden)
Rothschild Max
2009-03-01
Full Text Available Abstract Background Angiotensin converting enzyme (ACE is a possible candidate gene that may influence both body fatness and blood pressure. Although several genetic studies have been conducted in adults, relatively few studies have examined the contribution of potential candidate genes, and specifically ACE I/D, on adiposity and BP phenotypes in childhood. Such studies may prove insightful for the development of the obesity-hypertension phenotype early in life. The purpose of this study was to examine differences in body fatness and resting blood pressure (BP by ACE I/D genotype, and determine if the association between adiposity and BP varies by ACE I/D genotype in children. Methods 152 children (75 girls, 77 boys were assessed for body composition (% body fat using dual energy x-ray absorbtiometry and resting BP according to American Heart Association recommendations. Buccal cell samples were genotyped using newly developed PCR-RFLP tests for two SNPs (rs4341 and rs4343 in complete linkage disequilibrium with the ACE I/D polymorphism. Partial correlations were computed to assess the ociations between % body fat and BP in the total sample and by genotype. ANCOVA was used to examine differences in resting BP by ACE I/D genotype and fatness groups. Results Approximately 39% of youth were overfat based on % body fat (>30% fat in girls, 25% fat in boys. Body mass, body mass index, and fat-free mass were significantly higher in the ACE D-carriers compared to the II group (p Conclusion ACE D-carriers are heavier than ACE II children; however, BP did not differ by ACE I/D genotype but was adversely influenced in the overfat D-carriers. Further studies are warranted to investigate the genetics of fatness and BP phenotypes in children.
Health effects assessment in population exposed to 222Rn in drinking water
International Nuclear Information System (INIS)
Burkhardt, R.; Mocsy, I.; Muntean, N.
1996-01-01
The carcinogenetic effect produce by ionizing radiation upon human health, mainly by drinking water consumption with an elevated 222 Rn content is well documented. The objective of the paper was to demonstrated the possible relationship between the incidence of pulmonary and gastric cancer and 222 Rn presence in water and indoor air. The 222 Rn content was assessed by the standard method in drinking water sampled in two sources in Transylvania area from located in Tirgu Mures and Miercurea Ciuc towns. The 222 Rn concentration in indoor air was indirectly determined. On the basis of the registered values the pulmonary and gastric internal dose received by the residents of the towns was calculated. In parallel was performed a retrospective epidemiological study (1980-1992) regarding the incidence of gastric and pulmonary cancer in two towns in terms of morbidity, mortality and lethality indices. By comparing the estimated carcinogenic risk for this type of cancer with the specific mortality rate registered in our study, we estimate the contribution of 222 R to the cancer mortality percentage in the two towns, as follows: 0.47% for Tirgu Mures and 0.01% for Miercurea Ciuc town for pulmonary cancer and 0.23% and 0.015% for gastric cancer. (author)
Muon Identification performance: hadron mis-Id measurements and RPC Muon selections
CMS Collaboration
2014-01-01
Pion, kaon, proton mis-identification probabilities as muons have been measured for different Muon ID algorithms. Results from two independent analyses are presented. The performance of a new muon ID algorithm based on matching of inner tracks with hits in muon RPC chambers is also presented.
International Nuclear Information System (INIS)
Sudeep Kumara, K.; Karunakara, N.; Sahoo, B.K.; Gaware, J.J.; Sapra, B.K.; Mayya, Y.S.
2018-01-01
222 Rn, produced due to the decay of 226 Ra, can accumulate to high concentrations, and if adequate ventilation is not provided the workers may inhale the 222 Rn laden air, which would result in elevated inhalation dose in Uranium mining and milling operations. Similarly, in thorium mining and processing plants, the 220 Rn generated during monazite processing and thorium handling facility is of concern. In a previous publication it has been shown that adsorption in a flow-through charcoal bed offers an excellent method of alleviating the release of 220 Rn into occupational and public domain. In this paper we examine the utility of TMS as a 222 Rn hold up/delay system by evaluating its performance parameters such as breakthrough time (τ) and adsorption coefficient (K) at different flow rates
DEFF Research Database (Denmark)
Johansen, P; Andersen, J D; Børsting, Claus
2013-01-01
on the peak height and the signal to noise data exported from the TYPER 4.0 software. With the forensic analysis parameters, all inconsistencies were eliminated in reactions with ≥10ng DNA. However, the average call rate decreased to 69.9%. The iPLEX(®) Sample ID Plus Panel was tested on 10 degraded samples......Sequenom launched the first commercial SNP typing kit for human identification, named the iPLEX(®) Sample ID Plus Panel. The kit amplifies 47 of the 52 SNPs in the SNPforID panel, amelogenin and two Y-chromosome SNPs in one multiplex PCR. The SNPs were analyzed by single base extension (SBE......) and Matrix Assisted Laser Desorption/Ionization-Time of Flight Mass Spectrometry (MALDI-TOF MS). In this study, we evaluated the accuracy and sensitivity of the iPLEX(®) Sample ID Plus Panel by comparing the typing results of the iPLEX(®) Sample ID Plus Panel with those obtained with our ISO 17025 accredited...
78 FR 65555 - Establishment of Class E Airspace; Salmon, ID
2013-11-01
...-0531; Airspace Docket No. 13-ANM-20] Establishment of Class E Airspace; Salmon, ID AGENCY: Federal... at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Salt Lake...
222-S Laboratory complex hazards assessment
International Nuclear Information System (INIS)
Sutton, L.N.
1996-01-01
This document establishes the technical basis in support of Emergency Planning activities for the 222-S Laboratory Complex on the Hanford Site. Through this document, the technical basis for the development of facility specific Emergency Action Levels and Emergency Planning Zone is demonstrated
OpenID connect as a security service in Cloud-based diagnostic imaging systems
Ma, Weina; Sartipi, Kamran; Sharghi, Hassan; Koff, David; Bak, Peter
2015-03-01
The evolution of cloud computing is driving the next generation of diagnostic imaging (DI) systems. Cloud-based DI systems are able to deliver better services to patients without constraining to their own physical facilities. However, privacy and security concerns have been consistently regarded as the major obstacle for adoption of cloud computing by healthcare domains. Furthermore, traditional computing models and interfaces employed by DI systems are not ready for accessing diagnostic images through mobile devices. RESTful is an ideal technology for provisioning both mobile services and cloud computing. OpenID Connect, combining OpenID and OAuth together, is an emerging REST-based federated identity solution. It is one of the most perspective open standards to potentially become the de-facto standard for securing cloud computing and mobile applications, which has ever been regarded as "Kerberos of Cloud". We introduce OpenID Connect as an identity and authentication service in cloud-based DI systems and propose enhancements that allow for incorporating this technology within distributed enterprise environment. The objective of this study is to offer solutions for secure radiology image sharing among DI-r (Diagnostic Imaging Repository) and heterogeneous PACS (Picture Archiving and Communication Systems) as well as mobile clients in the cloud ecosystem. Through using OpenID Connect as an open-source identity and authentication service, deploying DI-r and PACS to private or community clouds should obtain equivalent security level to traditional computing model.
Directory of Open Access Journals (Sweden)
Marianne Wedde
Full Text Available Influenza A(H1N1pdm09 viruses cause sporadically very severe disease including fatal clinical outcomes associated with pneumonia, viremia and myocarditis. A mutation characterized by the substitution of aspartic acid (wild-type to glycine at position 222 within the haemagglutinin gene (HA-D222G was recorded during the 2009 H1N1 pandemic in Germany and other countries with significant frequency in fatal and severe cases. Additionally, A(H1N1pdm09 viruses exhibiting the polymorphism HA-222D/G/N were detected both in the respiratory tract and in blood. Specimens from mild, fatal and severe cases were collected to study the heterogeneity of HA-222 in A(H1N1pdm09 viruses circulating in Germany between 2009 and 2011. In order to enable rapid and large scale analysis we designed a pyrosequencing (PSQ assay. In 2009/2010, the 222D wild-type of A(H1N1pdm09 viruses predominated in fatal and severe outcomes. Moreover, co-circulating virus mutants exhibiting a D222G or D222E substitution (8/6% as well as HA-222 quasispecies were identified (10%. Both the 222D/G and the 222D/G/N/V/Y polymorphisms were confirmed by TA cloning. PSQ analyses of viruses associated with mild outcomes revealed mainly the wild-type 222D and no D222G change in both seasons. However, an increase of variants with 222D/G polymorphism (60% was characteristic for A(H1N1pdm09 viruses causing fatal and severe cases in the season 2010/2011. Pure 222G viruses were not observed. Our results support the hypothesis that the D222G change may result from adaptation of viral receptor specificity to the lower respiratory tract. This could explain why transmission of the 222G variant is less frequent among humans. Thus, amino acid changes at HA position 222 may be the result of viral intra-host evolution leading to the generation of variants with an altered viral tropism.
Estimation of groundwater flow rate using the decay of 222Rn in a well
International Nuclear Information System (INIS)
Hamada, Hiromasa
1999-01-01
A method of estimating groundwater flow rate using the decay of 222 Rn in a well was investigated. Field application revealed that infiltrated water (i.e., precipitation, pond water and irrigation water) accelerated groundwater flow. In addition, the depth at which groundwater was influenced by surface water was determined. The velocity of groundwater in a test well was estimated to be of the order of 10 -6 cm s -1 , based on the ratio of 222 Rn concentration in groundwater before and after it flowed into the well. This method is applicable for monitoring of groundwater flow rate where the velocity in a well is from 10 -5 to 10 -6 cm s -1
Directory of Open Access Journals (Sweden)
Cǎtǎlin NAE
2010-03-01
Full Text Available This paper is dedicated to a very specific type of analysis tool (VLM - Vortex Lattice Method to be integrated in a IDS - Integrated Design System, tailored for the usage of small aircraft industry. The major interest is to have the possibility to simulate at very low computational costs a preliminary set of aerodynamic characteristics for basic aerodynamic global characteristics (Lift, Drag, Pitching Moment and aerodynamic derivatives for longitudinal and lateral-directional stability analysis. This work enables fast investigations of the influence of configuration changes in a very efficient computational environment. Using experimental data and/or CFD information for a specific calibration of VLM method, reliability of the analysis may me increased so that a first type (iteration zero aerodynamic evaluation of the preliminary 3D configuration is possible. The output of this tool is basic state aerodynamic and associated stability and control derivatives, as well as a complete set of information on specific loads on major airframe components.The major interest in using and validating this type of methods is coming from the possibility to integrate it as a tool in an IDS system for conceptual design phase, as considered for development for CESAR project (IP, UE FP6.
12 CFR 222.20 - Coverage and definitions.
2010-01-01
... FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.20 Coverage and definitions. (a...-existing business relationship—(i) In general. The term “pre-existing business relationship” means a relationship between a person, or a person's licensed agent, and a consumer based on— (A) A financial contract...
Upregulation of miR-222 in both Helicobacter pylori-infected and ...
Indian Academy of Sciences (India)
MINA NOORMOHAMMAD
of this study was to analyse the expression level of miR-222 in gastric cancer tissues, evaluating the relationship between. miR-222 ... using RT-qPCR and compared with 88 healthy samples. ... observed in some diseases; for instance, hepatocellular carci- noma .... cellular matrix proteins in stomach cells (Chun-Zhi et al.
Measurement of Rn-222 concentration in underground water in Osaka stratum group in Sennan area
International Nuclear Information System (INIS)
Fukui, Masami; Katsurayama, Kosuke
1977-01-01
The Rn-222 concentration in underground water is reported as follows, which is the result obtained when the ground inspection was carried out in the Research Reactor Institute of Kyoto University located at Kumatori area in Osaka stratum group. Underground water, at different depth, well water and rain water were taken, and the contained Rn-222 was extracted with toluene to measure by liquid scintillation technique. Rn-222 concentration in rain water was 3.5 - 8.0 pCi/l, while the concentration in well water was 130 - 250 pCi/l, and that in underground water was 240 - 313 pCi/l. The seasonal change, geographical difference and variation according to depth of Rn-222 concentration were examined. Rn-222 behavior in soil should be investigated more in detail in reference to Rn-222 dispersion, transport and equilibrium problems in soil-water system in the future. (Kobatake, H.)
Efficient coding and detection of ultra-long IDs for visible light positioning systems.
Zhang, Hualong; Yang, Chuanchuan
2018-05-14
Visible light positioning (VLP) is a promising technique to complement Global Navigation Satellite System (GNSS) such as Global positioning system (GPS) and BeiDou Navigation Satellite System (BDS) which features the advantage of low-cost and high accuracy. The situation becomes even more crucial for indoor environments, where satellite signals are weak or even unavailable. For large-scale application of VLP, there would be a considerable number of Light emitting diode (LED) IDs, which bring forward the demand of long LED ID detection. In particular, to provision indoor localization globally, a convenient way is to program a unique ID into each LED during manufacture. This poses a big challenge for image sensors, such as the CMOS camera in everybody's hands since the long ID covers the span of multiple frames. In this paper, we investigate the detection of ultra-long ID using rolling shutter cameras. By analyzing the pattern of data loss in each frame, we proposed a novel coding technique to improve the efficiency of LED ID detection. We studied the performance of Reed-Solomon (RS) code in this system and designed a new coding method which considered the trade-off between performance and decoding complexity. Coding technique decreases the number of frames needed in data processing, significantly reduces the detection time, and improves the accuracy of detection. Numerical and experimental results show that the detected LED ID can be much longer with the coding technique. Besides, our proposed coding method is proved to achieve a performance close to that of RS code while the decoding complexity is much lower.
Online {sup 222}Rn removal by cryogenic distillation in the XENON100 experiment
Energy Technology Data Exchange (ETDEWEB)
Aprile, E.; Anthony, M.; De Perio, P.; Gao, F.; Goetzke, L.W.; Greene, Z.; Lin, Q.; Messina, M.; Plante, G.; Rizzo, A.; Zhang, Y. [Columbia University, Physics Department, New York, NY (United States); Aalbers, J.; Breur, P.A.; Brown, A.; Colijn, A.P.; Decowski, M.P.; Hogenbirk, E.; Tiseni, A. [Nikhef and the University of Amsterdam, Science Park, Amsterdam (Netherlands); Agostini, F. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); University of Bologna, Department of Physics and Astrophysics, Bologna (Italy); INFN-Bologna (Italy); Alfonsi, M.; Geis, C.; Grignon, C.; Oberlack, U.; Scheibelhut, M.; Schindler, S. [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik and Exzellenzcluster PRISMA, Mainz (Germany); Amaro, F.D.; Cardoso, J.M.R.; Lopes, J.A.M.; Orrigo, S.E.A.; Santos, J.M.F. dos; Silva, M. [University of Coimbra, Department of Physics, Coimbra (Portugal); Arneodo, F.; Benabderrahmane, M.L.; Di Giovanni, A.; Maris, I. [New York University Abu Dhabi, Abu Dhabi (United Arab Emirates); Barrow, P.; Baudis, L.; Franco, D.; Galloway, M.; Kessler, G.; Kish, A.; Mayani, D.; Pakarha, P.; Piastra, F.; Wei, Y.; Wulf, J. [University of Zurich, Physik-Institut, Zurich (Switzerland); Bauermeister, B. [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik and Exzellenzcluster PRISMA, Mainz (Germany); Stockholm University, AlbaNova, Department of Physics, Oskar Klein Centre, Stockholm (Sweden); Berger, T.; Brown, E.; Piro, M.C. [Rensselaer Polytechnic Institute, Department of Physics, Applied Physics and Astronomy, Troy, NY (United States); Bruenner, S.; Cichon, D.; Eurin, G.; Hasterok, C.; Lindner, M.; Undagoitia, T.M.; Pizzella, V.; Rauch, L.; Rupp, N.; Schreiner, J.; Simgen, H. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Bruno, G.; Gallo Rosso, A.; Molinario, A. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); Budnik, R.; Duchovni, E.; Itay, R.; Landsman, H.; Lellouch, D.; Levinson, L.; Manfredini, A.; Priel, N. [Weizmann Institute of Science, Department of Particle Physics and Astrophysics, Rehovot (Israel); Buetikofer, L.; Coderre, D.; Kaminsky, B.; Schumann, M.; Sivers, M. v. [Universitaet Freiburg, Physikalisches Institut, Freiburg (Germany); Calven, J.; Conrad, J.; Ferella, A.D.; Pelssers, B. [Stockholm University, AlbaNova, Department of Physics, Oskar Klein Centre, Stockholm (Sweden); Cervantes, M.; Lang, R.F.; Masson, D.; Pienaar, J.; Reichard, S.; Reuter, C. [Purdue University, Department of Physics and Astronomy, West Lafayette, IN (United States); Cussonneau, J.P.; Diglio, S.; Le Calloch, M.; Masbou, J.; Micheneau, K.; Persiani, R.; Thers, D. [Universite de Nantes, SUBATECH, Ecole des Mines de Nantes, CNRS/In2p3, Nantes (France); Di Gangi, P.; Garbini, M.; Massoli, F.V.; Sartorelli, G.; Selvi, M. [University of Bologna, Department of Physics and Astrophysics, Bologna (Italy); INFN, Bologna (Italy); Fei, J.; Ni, K.; Ye, J. [University of California, Department of Physics, San Diego, CA (United States); Fieguth, A.; Murra, M.; Rosendahl, S.; Weinheimer, C. [Westfaelische Wilhelms-Universitaet Muenster, Institut fuer Kernphysik, Muenster (Germany); Fulgione, W. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); INFN-Torino (Italy); Osservatorio Astrofisico di Torino, Turin (Italy); Grandi, L.; Saldanha, R.; Shockley, E.; Upole, N. [University of Chicago, Department of Physics and Kavli Institute of Cosmological Physics, Chicago, IL (United States); Lindemann, S. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Universitaet Freiburg, Physikalisches Institut, Freiburg (Germany); Meng, Y.; Stein, A.; Wang, H. [University of California, Physics and Astronomy Department, Los Angeles, CA (United States); Miguez, B.; Trinchero, G. [INFN-Torino (Italy); Osservatorio Astrofisico di Torino, Turin (Italy); Naganoma, J.; Shagin, P. [Rice University, Department of Physics and Astronomy, Houston, TX (United States); Lavina, L.S. [LPNHE, Universite Pierre et Marie Curie, Universite Paris Diderot, CNRS/IN2P3, Paris (France); Tunnell, C. [Nikhef and the University of Amsterdam, Science Park, Amsterdam (Netherlands); University of Chicago, Department of Physics and Kavli Institute of Cosmological Physics, Chicago, IL (United States); Cristescu, I. [Karlsruhe Institute of Technology, Tritium Laboratory Karlsruhe, Eggenstein-Leopoldshafen (Germany); Collaboration: XENON Collaboration
2017-06-15
We describe the purification of xenon from traces of the radioactive noble gas radon using a cryogenic distillation column. The distillation column was integrated into the gas purification loop of the XENON100 detector for online radon removal. This enabled us to significantly reduce the constant {sup 222}Rn background originating from radon emanation. After inserting an auxiliary {sup 222}Rn emanation source in the gas loop, we determined a radon reduction factor of R > 27 (95% C.L.) for the distillation column by monitoring the {sup 222}Rn activity concentration inside the XENON100 detector. (orig.)
ACE insertion/deletion (I/D) polymorphism and diabetic nephropathy.
Rahimi, Zohreh
2012-10-01
Angiotensin converting enzyme (ACE) gene encodes ACE, a key component of renin angiotensin system (RAS), plays an important role in blood pressure homeostasis by generating the vasoconstrictor peptide angiotensin II. Directory of Open Access Journals (DOAJ), Google Scholar, Pubmed (NLM), LISTA (EBSCO) and Web of Science have been searched. The presence of ACE insertion/deletion (I/D) polymorphism affects the plasma level of ACE. ACE DD genotype is associated with the highest systemic and renal ACE levels compared with the lowest ACE activity in carriers of II genotype. In this review focus has been performed on the study of ACE I/D polymorphism in various populations and its influence on the risk of onset and progression of diabetic nephropathy. Also, association between ACE I/D polymorphism and response to ACE inhibitor and angiotensin II receptor antagonists will be reviewed. Further, synergistic effect of this polymorphism and variants of some genes on the risk of development of diabetic nephropathy will be discussed.
ID.alistic: identificatie met een touch voor de patiënt
M. Wilschut; M. Zijlmans; Dr. L.S.G.L Wauben
2017-01-01
ID.alistic is een conceptuele patiëntidentificatie methode (middels een vingerafdrukscanner), ter vervanging van het polsbandjessysteem van het Albert Schweitzer ziekenhuis (ASz) dialysecentrum. Dit onderzoek bepaalt de implementeerbaarheid van ID.alistic binnen het dialysecentrum door
Energy Technology Data Exchange (ETDEWEB)
Pereyra, P.; Lopez, M. E.; Perez, B., E-mail: ppereyr@pucp.edu.pe [Pontificia Universidad Catolica del Peru, Seccion Fisica, Av. Universitaria 1801, Lima (Peru)
2014-08-15
The measurement of the Radon-222 levels was realized in the first semester of 2013 in residences corresponding to 16 districts of the metropolitan area of Lima, including to the zones North, Center and South of the city, during one period of 3 to 6 months in continuous form, with measurement periods of 1 to 2 months. The houses where the measurements were made were selected considering diverse variables as antiquity, construction materials, coatings, soil type, occupational use of the monitored rooms, etc. The measurements were realized in basements, first and second floor of the residences. For the Radon-222 measurements passive detectors of cellulose nitrate (Lr-115) were used. The procedure of data collection, dosimeters reading and the measurement results are shown in this work; this monitoring is the first one that is carried out in this city. The results are only indicators of the present radon rate, by the detectors type not is possible to discriminate the presence of the Radon-222 descendants. (Author)
Toprak Radon (222Rn Gazı Anomalilerinin ARIMA Analizi
Directory of Open Access Journals (Sweden)
Miraç KAMIŞLIOĞLU
2014-12-01
Full Text Available Özet: Zaman serileri analizi, istatistik, ekonomi, fizik ve mühendislik gibi bilim dallarında geniş uygulama alanına sahiptir. Zaman serisi analizi, değişkenlerin gelecekteki değerlerinin doğru bir şekilde tahmin edilmesi için kullanılan bir yöntemdir. Bu çalışmada, bir deprem öncüsü olarak bilinen toprak radon gazı (222Rn ölçümleri ile bir zaman serisi oluşturulmuştur. Bu veriler kullanılarak, otoregresif süreçler (ARIMA yardımıyla dinamik sistem modellemesi yapılmıştır. ARIMA; zaman serileri analizinde, zaman içerisinde rastgele gerçekleşen bir stokastik (olasılıksal sürecin veya hatalarının modellenmesidir. ARIMA modeli, temelde Box-Jenkins modeline dayanmaktadır. Box-Jenkins modeli, tek değişkenli zaman serilerinin ileriye dönük tahmin ve kontrolünde kullanılan istatistiksel tabanlı bir yöntemdir. Elde edilen sonuçlar, ARIMA modellerinin tahmin konusundaki başarısını göstermektedir. Anahtar kelimeler: Zaman Serileri Analizi, Radon Gazı (222Rn, ARIMA ARIMA Analysis of Soil Radon (222Rn Gas Anomalies Abstract: Time series analysis, has wide applications in statistics, economics, physics and engineering such disciplines. This method used for estimate correctly future values of the variables. In this study, is formed a time series with soil radon gas (222Rn measurements known as a pioneer of an earthquake. Dynamic system modelling was performed with autoregressive (ARIMA modelling process by used these measurements. ARIMA; time series analysis is modelled of the recoverable over time a random stochastic (probabilistic process or its errors. ARIMA model is based on Box-Jenkins model. Box-Jenkins model is a statistically based method which is used forward-looking forecasting and control of univariate time series. The obtained results, ARIMA model is indicating success in predict subject. Key words: Time Series Analysis, Radon Gas (222Rn, ARIMA
International Nuclear Information System (INIS)
Wei Suxia
1992-01-01
A method concerning selection of design parameters of diffusion barrier in a passive 222 Rn sampler based on activated charcoal adsorption. The proper parameter value of diffusion barrier is obtained by means of linearization of 222 Rn adsorption versus the exposure time. Thus, the influence of temperature on measured results may be greatly decreased, and higher sensitivity of the detector may be maintained
Ra-226 and Rn-222 in saline water compartments of the Aral Sea region
International Nuclear Information System (INIS)
Schettler, Georg; Oberhänsli, Hedi; Hahne, Knut
2015-01-01
Highlights: • 222 Rn and 226 Ra concentrations in different water compartments of the Aral Sea region. • 226 Ra-analysis based on 222 Rn-ingrowth versus MS-analysis after solid-phase extraction. • 226 Ra in different groundwater types of the Aral Sea Basin. • 222 Rn distribution in the Aral Sea, western basin. - Abstract: The Aral Sea has been shrinking since 1963 due to extensive irrigation and the corresponding decline in the river water inflow. Understanding of the current hydrological situation demands an improved understanding of the surface water/groundwater dynamics in the region. 222 Rn and 226 Ra measurements can be used to trace groundwater discharge into surface waters. Data of these radiometric parameters were not previously available for the study region. We determined 222 Rn activities after liquid phase extraction using Liquid Scintillation Counting (LSC) with peak-length discrimination and analyzed 226 Ra concentrations in different water compartments of the Amu Darya Delta (surface waters, unconfined groundwater, artesian water, and water profiles from the closed Large Aral Sea (western basin). The water samples comprise a salinity range between 1 and 263 g/l. The seasonal dynamics of solid/water interaction under an arid climate regime force the hydrochemical evolution of the unconfined groundwater in the Amu Darya Delta to high-salinity Na(Mg)Cl(SO 4 ) water types. The dissolved radium concentrations in the waters were mostly very low due to mineral over-saturation, extensive co-precipitation of radium and adsorption of radium on coexisting solid substrates. The analysis of very low 226 Ra concentrations (<10 ppq) at remote study sites is a challenge. We used the water samples to test and improve different analytical methods. In particular, we modified a procedure developed for the α-spectrometric determination of 226 Ra after solid phase extraction of radium using 3M Empore™ High Performance Extraction Disks (Purkl, 2002) for the
International Nuclear Information System (INIS)
Maw, Min Khine; Fujimoto, Jiro; Tamaya, Teruhiko
2009-01-01
The inhibitor of DNA-binding (ID) has been involved in cell cycle regulation, apoptosis and angiogenesis. This prompted us to study ID functions in tumor advancement of ovarian cancers. Sixty patients underwent surgery for ovarian cancers. In ovarian cancers, the levels of ID-1, ID-2 and ID-3 mRNAs were determined by real-time reverse transcription-polymerase chain reaction. The histoscore with the localization of ID-1 was determined by immunohistochemistry. Patient prognosis was analyzed with a 36-month survival rate. Microvessel counts were determined by immunohistochemistry for CD34 and factor VIII-related antigen. ID-1 histoscores and mRNA levels both significantly (p < 0.001) increased in ovarian cancers according to clinical stage, regardless of histopathological type. Furthermore, 30 patients with high ID-1 expression had a lower survival rate (53%) compared to patients with low ID-1 expression (80%). ID-1 histoscores and mRNA levels significantly (p < 0.0001) correlated with microvessel counts in ovarian cancers. ID-1 increased in ovarian cancer cells during tumor progression. Moreover, ID-1 expression levels correlated with microvessel counts. Therefore, ID-1 might work on tumor advancement via angiogenesis and is considered to be a candidate for a prognostic indicator in ovarian cancers
Design and construction of a system to determine Radon-222 through alpha spectroscopy
International Nuclear Information System (INIS)
Bonifacio M, J.
1991-01-01
The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)
Toward operation of series IDs at BL43LXU of SPring-8
Energy Technology Data Exchange (ETDEWEB)
Baron, A. Q. R.; Tanaka, T.; Soutome, K.; Takao, M.; Nakamura, T.; Kobayashi, K.; Fujita, T.; Takahashi, S.; Aoyagi, H.; Shimosaki, Y.; Seike, T.; Uchiyama, H.; Ishikawa, D.; Chuang, T.-H.; Kimura, H.; Tanaka, H.; Kitamura, H.; Ishikawa, T. [SPring-8, 1-1-1 Kouto, Sayo, Hyogo, 679 (Japan)
2016-07-27
This paper discusses two issues relating to using 3 small gap insertion devices in series at BL43LXU of SPring-8 to make a uniquely powerful source in the 15-26 keV region of the x-ray spectrum. The issues discussed are (1) damage to the covers of the downstream IDs by radiation from the upstream IDs and (2) proper steering of the electron beam to get the best photon beam properties. After tests in several configurations, including one where an ID was run without an impedance-reducing cover, the damage issue was solved by installing a distributed absorber in the most downstream ID. The steering issues were mostly resolved by the introduction of appropriate corrector magnets and feedback. The paper is written from the viewpoint of an interested beamline scientist impressed with the cooperation of different groups to make a source for new science possible.
Directory of Open Access Journals (Sweden)
Ying Xu
2017-08-01
Full Text Available Background/Aims: Aberrant vascular smooth muscle cell (VSMC proliferation plays an important role in the development of pulmonary artery hypertension (PAH. Dysregulated microRNAs (miRNAs, miRs have been implicated in the progression of PAH. miR-222 has a pro-proliferation effect on VSMCs while it has an anti-proliferation effect on vascular endothelial cells (ECs. As the biological function of a single miRNA could be cell-type specific, the role of miR-222 in pulmonary artery smooth muscle cell (PASMC proliferation is not clear and deserves to be explored. Methods: PASMCs were transfected with miR-222 mimic or inhibitor and PASMC proliferation was determined by Western blot for PCNA, Ki-67 and EdU staining, and cell number counting. The target genes of miR-222 including P27 and TIMP3 were determined by luciferase assay and Western blot. In addition, the functional rescue experiments were performed based on miR-222 inhibitor and siRNAs to target genes. Results: miR-222 mimic promoted PASMC proliferation while miR-222 inhibitor decreased that. TIMP3 was identified to be a direct target gene of miR-222 based on luciferase assay. Meanwhile, P27 and TIMP3 were up-regulated by miR-222 inhibitor and down-regulated by miR-222 mimic. Moreover, P27 siRNA and TIMP3 siRNA could both attenuate the anti-proliferation effect of miR-222 inhibitor in PASMCs, supporting that P27 and TIMP3 are at least partially responsible for the regulatory effect of miR-222 in PASMCs. Conclusion: miR-222 promotes PASMC proliferation at least partially through targeting P27 and TIMP3.
Mapping of Id locus for dermal shank melanin in a Chinese ...
Indian Academy of Sciences (India)
JIGUO XU
2017-12-08
Dec 8, 2017 ... Information on the SNPs used for the association analysis. ID. Position (galGal3) .... using Bio-Rad Manager software, and the data were nor- malized to the ..... This work was supported by the High Technology Research.
Zhang, B.; Liu, H.; Crawford, J. H.; Fairlie, T. D.; Chen, G.; Chambers, S. D.; Kang, C. H.; Williams, A. G.; Zhang, K.; Considine, D. B.; Payer Sulprizio, M.; Yantosca, R.
2015-12-01
Convective and synoptic processes play a major role in determining the transport and distribution of trace gases and aerosols in the troposphere. The representation of these processes in global models (at ~100-1000 km horizontal resolution) is challenging, because convection is a sub-grid process and needs to be parameterized, while synoptic processes are close to the grid scale. Depending on the parameterization schemes used in climate models, the role of convection in transporting trace gases and aerosols may vary from model to model. 222Rn is a chemically inert and radioactive gas constantly emitted from soil and has a half-life (3.8 days) comparable to synoptic timescale, which makes it an effective tracer for convective and synoptic transport. In this study, we evaluate the convective and synoptic transport in two chemical transport models (GMI and GEOS-Chem), both driven by the NASA's MERRA reanalysis. Considering the uncertainties in 222Rn emissions, we incorporate two more recent scenarios with regionally varying 222Rn emissions into GEOS-Chem/MERRA and compare the simulation results with those using the relatively uniform 222Rn emissions in the standard model. We evaluate the global distribution and seasonality of 222Rn concentrations simulated by the two models against an extended collection of 222Rn observations from 1970s to 2010s. The intercomparison will improve our understanding of the spatial variability in global 222Rn emissions, including the suspected excessive 222Rn emissions in East Asia, and provide useful feedbacks on 222Rn emission models. We will assess 222Rn vertical distributions at different latitudes in the models using observations at surface sites and in the upper troposphere and lower stratosphere. Results will be compared with previous models driven by other meteorological fields (e.g., fvGCM and GEOS4). Since the decay of 222Rn is the source of 210Pb, a useful radionuclide tracer attached to submicron aerosols, improved
Vibrational measurements in 3-ID-B
International Nuclear Information System (INIS)
Sutter, J.; Alp, E.; Barraza, J.; Shu, D.
1998-04-01
The authors have undertaken a series of vibrational measurements in hutch 3-ID-B. Their motivation was to compare two different methods of mounting an interferometer for effectiveness in vibrational isolation and stability. In addition they were able to compare the stability of the optical table with and without its eight large bolts inserted
FDIC Institution Directory (ID) -- Insured Insitution Download File
Federal Deposit Insurance Corporation — The FDIC's Institution Directory (ID) download file provides a list of all FDIC-insured institutions. The file includes demographic information related to the...
2013-02-06
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... workers and former workers of Hartford Financial Services Group, Inc., Commercial/Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford, Connecticut (The Hartford-IDS...
Goldmann, W; Marier, E; Stewart, P; Konold, T; Street, S; Langeveld, J; Windl, O; Ortiz-Pelaez, A
2016-02-13
Scrapie in goats is a transmissible, fatal prion disease, which is endemic in the British goat population. The recent success in defining caprine PRNP gene variants that provide resistance to experimental and natural classical scrapie has prompted the authors to conduct a survey of PRNP genotypes in 10 goat breeds and 52 herds to find goats with the resistant K222 allele. They report here the frequencies in 1236 tested animals of the resistance-associated K222 and several other alleles by breed and herd. Eight animals were found to be heterozygous QK222 goats (0.64 per cent genotype frequency, 95 per cent CI 0.28 to 1.27 per cent) but no homozygous KK222 goats were detected. The K222 allele was found in Saanen, Toggenburg and Anglo-Nubian goats. The fact that only a few goats with the K222 allele have been identified does not preclude the possibility to design and implement successful breeding programmes at national level. British Veterinary Association.
Wicked ID: Conceptual Framework for Considering Instructional Design as a Wicked Problem
Directory of Open Access Journals (Sweden)
Katrin Becker
2007-02-01
Full Text Available The process of instructional design has parallels in other design disciplines. Software design is one that has experienced intense attention in the last 30 or so years, and many lessons learned there can be applied to ID. Using software design as a springboard, this concept paper seeks to propose a new approach to ID. It suggests that instructional design is almost always a Wicked Problem. The connection is formed between Wicked Problems as first described by Rittel and Webber in 1973, and the models in and processes of instructional design. The areas of social planning, organizational management and software design all posses some accepted and tested approaches to the solution of Wicked Problems. These will be described, and how they can be applied to ID will be explained. Finally, this paper will propose a meta-model for ID and explain how it can be used in the current context. Résumé : Le processus de conception pédagogique a des similitudes avec d’autres disciplines. La conception de logiciels a fait l’objet d’une grande attention dans les trente dernières années et de nombreuses leçons tirées peuvent s’appliquer à la conception pédagogique. En se basant sur la conception de logiciels, cet article cherche à proposer une nouvelle méthode à la conception pédagogique. Il laisse entendre que la conception pédagogique constitue presque toujours un problème épineux. Le lien est formé entre les problèmes épineux tels que décrits par Rittel et Webber en 1973 et les modèles et processus de la conception pédagogique. Les secteurs de l’organisation sociale, de la gestion des organisations et de la conception de logiciels comptent des méthodes acceptées et validées à la résolution de problèmes épineux. Nous les décrirons et expliquerons comment ils peuvent servir à la conception pédagogique. Enfin, l’article proposera un meta-modèle de la conception pédagogique et expliquera comment il peut servir dans le
International Nuclear Information System (INIS)
Zhang, Long; Shi, Songting; Zhang, Juan; Zhou, Fangfang; Dijke, Peter ten
2012-01-01
Highlights: ► Expression of Id3 but not Id1 is induced by Wnt3a stimulation in C2C12 cells. ► Wnt3a induces Id3 expression via canonical Wnt/β-catenin pathway. ► Wnt3a-induced Id3 expression does not depend on BMP signaling activation. ► Induction of Id3 expression is critical determinant in Wnt3a-induced cell proliferation and differentiation. -- Abstract: Canonical Wnt signaling plays important roles in regulating cell proliferation and differentiation. In this study, we report that inhibitor of differentiation (Id)3 is a Wnt-inducible gene in mouse C2C12 myoblasts. Wnt3a induced Id3 expression in a β-catenin-dependent manner. Bone morphogenetic protein (BMP) also potently induced Id3 expression. However, Wnt-induced Id3 expression occurred independent of the BMP/Smad pathway. Functional studies showed that Id3 depletion in C2C12 cells impaired Wnt3a-induced cell proliferation and alkaline phosphatase activity, an early marker of osteoblast cells. Id3 depletion elevated myogenin induction during myogenic differentiation and partially impaired Wnt3a suppressed myogenin expression in C2C12 cells. These results suggest that Id3 is an important Wnt/β-catenin induced gene in myoblast cell fate determination.
ID'ing innate and innate-like lymphoid cells.
Verykokakis, Mihalis; Zook, Erin C; Kee, Barbara L
2014-09-01
The immune system can be divided into innate and adaptive components that differ in their rate and mode of cellular activation, with innate immune cells being the first responders to invading pathogens. Recent advances in the identification and characterization of innate lymphoid cells have revealed reiterative developmental programs that result in cells with effector fates that parallel those of adaptive lymphoid cells and are tailored to effectively eliminate a broad spectrum of pathogenic challenges. However, activation of these cells can also be associated with pathologies such as autoimmune disease. One major distinction between innate and adaptive immune system cells is the constitutive expression of ID proteins in the former and inducible expression in the latter. ID proteins function as antagonists of the E protein transcription factors that play critical roles in lymphoid specification as well as B- and T-lymphocyte development. In this review, we examine the transcriptional mechanisms controlling the development of innate lymphocytes, including natural killer cells and the recently identified innate lymphoid cells (ILC1, ILC2, and ILC3), and innate-like lymphocytes, including natural killer T cells, with an emphasis on the known requirements for the ID proteins. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Identity Management ToolKit (IdM TK)
Department of Veterans Affairs — With the IdM TK, authorized users can search and view identity and exception information from the Administrative Data Repository (ADR). Specifically, users can view...
Exosome-mediated transfer of miR-222 is sufficient to increase tumor malignancy in melanoma.
Felicetti, Federica; De Feo, Alessandra; Coscia, Carolina; Puglisi, Rossella; Pedini, Francesca; Pasquini, Luca; Bellenghi, Maria; Errico, Maria Cristina; Pagani, Elena; Carè, Alessandra
2016-02-24
, besides generally confirming the role of miR-222 in melanoma tumorigenesis, supported its responsibility in the exosome-associated melanoma properties, thus further indicating this miR as potential diagnostic and prognostic biomarker and its abrogation as a future therapeutic option.
Determination of local chromatin composition by CasID.
Schmidtmann, Elisabeth; Anton, Tobias; Rombaut, Pascaline; Herzog, Franz; Leonhardt, Heinrich
2016-09-02
Chromatin structure and function are determined by a plethora of proteins whose genome-wide distribution is typically assessed by immunoprecipitation (ChIP). Here, we developed a novel tool to investigate the local chromatin environment at specific DNA sequences. We combined the programmable DNA binding of dCas9 with the promiscuous biotin ligase BirA* (CasID) to biotinylate proteins in the direct vicinity of specific loci. Subsequent streptavidin-mediated precipitation and mass spectrometry identified both known and previously unknown chromatin factors associated with repetitive telomeric, major satellite and minor satellite DNA. With super-resolution microscopy, we confirmed the localization of the putative transcription factor ZNF512 at chromocenters. The versatility of CasID facilitates the systematic elucidation of functional protein complexes and locus-specific chromatin composition.
A decade of user operation on the macromolecular crystallography MAD beamline ID14-4 at the ESRF
International Nuclear Information System (INIS)
McCarthy, Andrew A.; Brockhauser, Sandor; Nurizzo, Didier; Theveneau, Pascal; Mairs, Trevor; Spruce, Darren; Guijarro, Matias; Lesourd, Marc; Ravelli, Raimond B. G.; McSweeney, Sean
2009-01-01
The improvement of the X-ray beam quality achieved on ID14-4 by the installation of new X-ray optical elements is described. ID14-4 at the ESRF is the first tunable undulator-based macromolecular crystallography beamline that can celebrate a decade of user service. During this time ID14-4 has not only been instrumental in the determination of the structures of biologically important molecules but has also contributed significantly to the development of various instruments, novel data collection schemes and pioneering radiation damage studies on biological samples. Here, the evolution of ID14-4 over the last decade is presented, and some of the major improvements that were carried out in order to maintain its status as one of the most productive macromolecular crystallography beamlines are highlighted. The experimental hutch has been upgraded to accommodate a high-precision diffractometer, a sample changer and a large CCD detector. More recently, the optical hutch has been refurbished in order to improve the X-ray beam quality on ID14-4 and to incorporate the most modern and robust optical elements used at other ESRF beamlines. These new optical elements will be described and their effect on beam stability discussed. These studies may be useful in the design, construction and maintenance of future X-ray beamlines for macromolecular crystallography and indeed other applications, such as those planned for the ESRF upgrade
Overestimation of the 25(OH)D serum concentration with the automated IDS EIA kit.
Cavalier, Etienne; Huberty, Véronique; Cormier, Catherine; Souberbielle, Jean-Claude
2011-02-01
We have recently observed an increasing number of patients presenting very high serum levels of 25-hydroxyvitamin D [25(OH)D] (> 150 ng/mL), which, in all cases, had been measured with the IDS EIA kit adapted on different "open" automated platforms. We performed a comparison between the IDS EIA kit adapted on two different "open"automated platforms and the DiaSorin RIA. We found a systematic bias (higher levels with the IDS EIA kit) for concentrations more than 50-60 ng/mL that was less obvious when the IDS EIA was used in its manual procedure. We thus suggest to use the IDS EIA kit in its manual procedure rather than to adapt it on an automated platform, and to interpret cautiously a 25(OH)D greater than 100 ng/mL with this kit. Copyright © 2011 American Society for Bone and Mineral Research.
Young, Vicky J; Ahmad, Syed F; Brown, Jeremy K; Duncan, W Colin; Horne, Andrew W
2015-11-18
VEGF-A, an angiogenic factor, is increased in the peritoneal fluid of women with endometriosis. The cytokine TGF-β1 is thought to play a role in the establishment of endometriosis lesions. Inhibitor of DNA binding (ID) proteins are transcriptional targets of TGF-β1 and ID1 has been implicated in VEGF-A regulation during tumor angiogenesis. Herein, we determined whether peritoneal expression of VEGF-A is regulated by TGF-β1 through the ID1 pathway in women with endometriosis. VEGF-A was measured in peritoneal fluid by ELISA (n = 16). VEGF-A and ID1 expression was examined in peritoneal biopsies (n = 13), and primary peritoneal and immortalized mesothelial cells (MeT5A) by immunohistochemistry, qRT-PCR and ELISA. VEGF-A was increased in peritoneal fluid from women with endometriosis and levels correlated with TGF-β1 concentrations (P peritoneal mesothelium and TGF-β1 increased VEGFA mRNA (P endometriosis and TGF-β1 increased concentrations of ID1 mRNA (P endometriosis, as an effector of TGFβ1 dependent upregulation of VEGF-A, and highlights a novel potential therapeutic target.
222Rn in private well water in the vicinity of uranium mines over ten years
International Nuclear Information System (INIS)
Yunoki, Eiji; Kataoka, Toshio; Michihiro, Kenshu; Sugiyama, Hirokazu; Shimizu, Mitsuo; Mori, Tadashige
1994-01-01
There are many small uranium mines of the sedimentary type in Kamisaibara, Okayama Prefecture, Japan. As inhabitants in Kamisaibara consume water from privately-dug wells, it is important to investigate distributions of 222 Rn in privately-dug well water in the vicinity of the mines. The determination of 222 Rn in well water was carried out from April 1980 to October 1990. Though small in area (16 km 2 ), each well water has its own characteristic activity concentrations of 222 Rn. The activity concentrations of 222 Rn are almost constant for each specific well over a long period (about 10 years). In general, the correlation coefficients for several sampling points are small. As Akawase and Tennoh are situated in the same rock type, the correlation coefficient is the highest value in this area. The estimated dose equivalent for the human stomach is approximately 0.4-54 μSv/year. The type of distribution of 222 Rn in privately-dug well water is log normal. (author)
48 CFR 52.222-3 - Convict Labor.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Convict Labor. 52.222-3... Labor. As prescribed in 22.202, insert the following clause: Convict Labor (JUN 2003) (a) Except as... union central bodies or similar labor union organizations have been consulted; (iii) Such paid...
A estabilização heterodoxa no brasil: idéias e redes políticas
Directory of Open Access Journals (Sweden)
Pio Carlos
2001-01-01
Full Text Available O artigo discute o papel das idéias e das "redes políticas" na explicação do conteúdo de políticas de estabilização no Brasil. As idéias heterodoxas dos economistas da Pontifícia Universidade Católica do Rio de Janeiro (PUC-RJ são apresentadas e comparadas ao conteúdo de dois programas de estabilização implementados no país: o Plano Cruzado (1986 e o Plano Real (desde 1993. Variáveis políticas são apontadas para explicar por que o segundo programa apresenta maior semelhança com as idéias originais dos economistas do que o primeiro, o que, segundo o autor, explica, em grande medida, seu maior êxito em reduzir a inflação.
Security and Privacy Improvements for the Belgian eID Technology
Verhaeghe, Pieter; Lapon, Jorn; de Decker, Bart; Naessens, Vincent; Verslype, Kristof
The Belgian Electronic Identity Card enables Belgian citizens to prove their identity digitally and to sign electronic documents. At the end of 2009, every Belgian citizen older than 12 years will have such an eID card. In the future, usage of the eID card may be mandatory. However, irresponsible use of the card may cause harm to individuals.
34 CFR 222.192 - What local funds may be considered as available for this project?
2010-07-01
... § 222.192 What local funds may be considered as available for this project? To determine the amount of... 34 Education 1 2010-07-01 2010-07-01 false What local funds may be considered as available for this project? 222.192 Section 222.192 Education Regulations of the Offices of the Department of...
78 FR 25406 - Proposed Modification of Class E Airspace; Twin Falls, ID
2013-05-01
...) Global Positioning System (GPS) and the Instrument Landing System (ILS) or Localizer (LOC) standard... the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls Joslin Field-Magic Valley Regional...
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Joselene de; Farias, Luciana A.; Mazzilli, Barbara P. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Dept. de Radiometria Ambiental]. E-mail: jolivei@net.ipen.br; Burnett, William C. [Florida State Univ., Tallahassee, FL (United States); Saraiva, Elisabete de S.B. e; Furtado, Valdenir V. [Sao Paulo Univ., SP (Brazil). Inst. Oceanografico. Dept. de Oceanografia Quimica e Geologica
2002-07-01
Submarine groundwater discharge (SGD) and recycled seawater can provide chemical constituents to coastal zone, representing an important material flux pathway from land to sea in some areas. Geochemical tracers, like {sup 222} Rn and {sup 226} Ra, are advantageous for regional-scale assessment of SGD, because their signals represent values integrated through the water column that removes small-scale variations. These radionuclides are usually enriched in groundwater compared to seawater, can be measured at very low concentrations and are conservative. This work reports preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil, covering latitudes between 23 deg 26{sup '}S and 23 deg 46{sup '}S and longitudes between 45 deg02{sup '}W and 45 deg 11{sup '}W. The main aims of this research were to set up an analytical method to assess {sup 222} Rn and {sup 226} Ra activities in seawater samples and to apply the excess {sup 222} Rn inventories obtained to estimate the submarine groundwater discharge. Measurements made during 2001/2002 included {sup 222} Rn and {sup 226} Ra in seawater, {sup 222} Rn in sediment, seawater and sediment physical properties. (author)
SUPPLEMENTARY COMPARISON: COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison
Skliarov, V.; Röttger, A.; Honig, A.; Korostin, S.; Kuznetsov, S.; Lapenas, A.; Milevsky, V.; Ivaniukovich, A.; Kharitonov, I.; Sepman, S.
2009-01-01
According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5th meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by COOMET, according to the provisions of the CIPM Mutual Recognition Arrangement (MRA).
78 FR 45478 - Proposed Establishment of Class E Airspace; Salmon, ID
2013-07-29
...-0531; Airspace Docket No. 13-ANM-20] Proposed Establishment of Class E Airspace; Salmon, ID AGENCY... action proposes to establish Class E airspace at the Salmon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Salmon, ID, to facilitate vectoring of Instrument Flight Rules...
Directory of Open Access Journals (Sweden)
Matteo Brioschi
2010-11-01
Full Text Available Core-binding factor leukemia (CBFL is a subgroup of acutemyeloid leukemia (AML characterized by genetic mutations involving the subunits of the core-binding factor (CBF. The leukemogenesis model for CBFL posits that one, or more, gene mutations inducing increased cell proliferation and/or inhibition of apoptosis cooperate with CBF mutations for leukemia development. One of the most commonmutations associated with CBF mutations involves the KIT receptor. A high expression of KIT is a hallmark of a high proportion of CBFL. Previous studies indicate that microRNA (MIR 222/221 targets the 3′ untranslated region of the KIT messenger RNA and our observation that AML1 can bind the MIR-222/221 promoter, we hypothesized that MIR-222/221 represents the link between CBF and KIT. Here, we show that MIR-222/221 expression is upregulated after myeloid differentiation of normal bone marrow AC133+ stem progenitor cells. CBFL blasts with either t(8;21 or inv(16 CBF rearrangements with high expression levels of KIT (CD117 display a significantly lower level of MIR-222/221 expression than non-CBFL blasts. Consistently, we found that the t(8;21 AML1-MTG8 fusion protein binds the MIR-222/221 promoter and induces transcriptional repression of a MIR-222/221-LUC reporter. Because of the highly conserved sequence homology, we demonstrated concomitant MIR-222/221 down-regulation and KIT up-regulation in the 32D/WT1 mouse cell model carrying the AML1-MTG16 fusion protein. This study provides the first hint that CBFL-associated fusion proteins may lead to up-regulation of the KIT receptor by down-regulating MIR-222/221, thus explaining the concomitant occurrence of CBF genetic rearrangements and overexpression of wild type or mutant KIT in AML.
International Nuclear Information System (INIS)
Yoneda, Minoru; Inoue, Yoriteru; Yoshimoto, Keizo
1994-01-01
The activated charcoal passive collector method can be applied to measure the concentration of 222 Rn in river water. The 222 Rn collector is composed of dry activated charcoal sealed in a polyethylene bag. However, we found it very difficult to keep activated charcoal in a collector dry during the period the collector was left in a river. The degree of dampness and the time lapsed when activated charcoal became wet were thought to affect the quantity of 222 Rn collected. First, we studied the effect of some parameters in the activated charcoal passive collector method qualitatively in three experiments. We found that the quantity of 222 Rn collected in a collector was not so sensitive to the quantity of activated charcoal in the collector or the thickness of polyethylene film under the condition of wet activated charcoal, and that wet activated charcoal accumulated less 222 Rn than dry activated charcoal. We present some equations which could explain how much 222 Rn was collected in a collector when activated charcoal was submerged directly in water and when activated charcoal was packed in a polyethylene bag but completely wet. These equations were proved effective by being compared with the results of the other experiments. Finally, we recommended some conditions which proved useful when measuring at an actual river
International Nuclear Information System (INIS)
Kurooka, Hisanori; Sugai, Manabu; Mori, Kentaro; Yokota, Yoshifumi
2013-01-01
Highlights: •Sodium arsenite induces cytoplasmic accumulation of Id3. •Arsenite binds to closely spaced N-terminal cysteine residues of Id3. •N-terminal cysteines are essential for arsenite-induced nuclear export of Id3. •Nuclear export of Id3 counteracts its transcriptional repression activity. -- Abstract: Ids are versatile transcriptional repressors that regulate cell proliferation and differentiation, and appropriate subcellular localization of the Id proteins is important for their functions. We previously identified distinct functional nuclear export signals (NESs) in Id1 and Id2, but no active NES has been reported in Id3. In this study, we found that treatment with the stress-inducing metalloid arsenite led to the accumulation of GFP-tagged Id3 in the cytoplasm. Cytoplasmic accumulation was impaired by a mutation in the Id3 NES-like sequence resembling the Id1 NES, located at the end of the HLH domain. It was also blocked by co-treatment with the CRM1-specific nuclear export inhibitor leptomycin B (LMB), but not with the inhibitors for mitogen-activated protein kinases (MAPKs). Importantly, we showed that the closely spaced N-terminal cysteine residues of Id3 interacted with the arsenic derivative phenylarsine oxide (PAO) and were essential for the arsenite-induced cytoplasmic accumulation, suggesting that arsenite induces the CRM1-dependent nuclear export of Id3 via binding to the N-terminal cysteines. Finally, we demonstrated that Id3 significantly repressed arsenite-stimulated transcription of the immediate-early gene Egr-1 and that this repression activity was inversely correlated with the arsenite-induced nuclear export. Our results imply that Id3 may be involved in the biological action of arsenite
Using 222Rn as a tracer of geodynamical processes in underground environments
International Nuclear Information System (INIS)
Valladares, D.L.; Silva, A.A.R. da; o, Gragoatá, 24210-340, Niterói, RJ (Brazil))" data-affiliation=" (Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/no, Gragoatá, 24210-340, Niterói, RJ (Brazil))" >Lacerda, T.; o, Gragoatá, 24210-340, Niterói, RJ (Brazil))" data-affiliation=" (Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/no, Gragoatá, 24210-340, Niterói, RJ (Brazil))" >Anjos, R.M.; Rizzotto, M.; Velasco, H.; Rosas, J.P. de; Tognelli, G.
2014-01-01
Radon levels in two old mines in San Luis, Argentina, were measured and analyzed, with the aim to assess the potential use of this radioactive noble gas as a tracer of geological processes in underground environments. La Carolina gold mine and Los Cóndores tungsten mine are today used as tourism mines. CR-39 nuclear track detectors were used for this purpose. Measurements were performed during both winter and summer seasons. The findings show that in these environments, significant radon concentrations are subject to large seasonal fluctuations, due to the strong dependence on natural ventilation with the outside temperature variations. For both mines, higher concentration values of 222 Rn were observed in summer than in winter; with an extreme ratio of 2.5 times between summer and winter seasons for Los Cóndores mine. The pattern of radon transport inside La Carolina mine revealed, contrary to what was believed, that this mine behaves as a system with two entrances located at different levels. However, this feature can only be observed in the winter season, when there is a marked difference between the inside and outside temperatures of the mine. In the case of Los Cóndores mine, the radon concentration pattern distribution is principally established by air current due to chimney-effect in summer and winter seasons. In both cases, the analyses of radon pattern distribution appear as a good method to trace air currents, and then localize unknown ducts, fissures or secondary tunnels in subterranean environments. - Highlights: • 222 Rn levels in two old mines in San Luis, Argentina • CR-39 nuclear track detectors were used for this purpose • higher concentration values of 222 Rn were observed in summer than in winter • radon pattern distribution appear as a good method to trace air currents • it localizes unknown ducts, fissures or secondary tunnels in subterranean environments
DNA origami-based shape IDs for single-molecule nanomechanical genotyping
Zhang, Honglu; Chao, Jie; Pan, Dun; Liu, Huajie; Qiang, Yu; Liu, Ke; Cui, Chengjun; Chen, Jianhua; Huang, Qing; Hu, Jun; Wang, Lianhui; Huang, Wei; Shi, Yongyong; Fan, Chunhai
2017-04-01
Variations on DNA sequences profoundly affect how we develop diseases and respond to pathogens and drugs. Atomic force microscopy (AFM) provides a nanomechanical imaging approach for genetic analysis with nanometre resolution. However, unlike fluorescence imaging that has wavelength-specific fluorophores, the lack of shape-specific labels largely hampers widespread applications of AFM imaging. Here we report the development of a set of differentially shaped, highly hybridizable self-assembled DNA origami nanostructures serving as shape IDs for magnified nanomechanical imaging of single-nucleotide polymorphisms. Using these origami shape IDs, we directly genotype single molecules of human genomic DNA with an ultrahigh resolution of ~10 nm and the multiplexing ability. Further, we determine three types of disease-associated, long-range haplotypes in samples from the Han Chinese population. Single-molecule analysis allows robust haplotyping even for samples with low labelling efficiency. We expect this generic shape ID-based nanomechanical approach to hold great potential in genetic analysis at the single-molecule level.
An application of 222Rn alpha particle's tracks to uranium exploration
International Nuclear Information System (INIS)
Aguilar H, F.
1981-01-01
The uranium exploration method is based on the register of 222 Rn alpha particles; 222 Rn gas is generated in the chain 238 U desintegration. The detection of alpha particles was performed with cellulose nitrate films (NTC), located in a grid at the region in study. The alpha particles produce latent tracks in the NTC films; these tracks may be enlarged by chemical etching and are observed with an ordinary optic microscope, ninety seven NTC films were used, these were distributed in an area of approximately seventeen square kilometers, located in the municipalities of Granados and Huasabas in Sonora Mexico, the detectors remain in the ground for a thirty days mean period. The results obtained show an area with high 222 Rn concentration, this can be related with an underground uranium ore deposit. The more important conclusion is that the results obtained in this work can be used as preliminary results for other prospection methods in this particular area. (author)
Directory of Open Access Journals (Sweden)
Acutis Pier Luigi
2012-02-01
Full Text Available Abstract Susceptibility of sheep to scrapie, a transmissible spongiform encephalopathy of small ruminants, is strongly influenced by polymorphisms of the prion protein gene (PRNP. Breeding programs have been implemented to increase scrapie resistance in sheep populations; though desirable, a similar approach has not yet been applied in goats. European studies have now suggested that several polymorphisms can modulate scrapie susceptibility in goats: in particular, PRNP variant K222 has been associated with resistance in case-control studies in Italy, France and Greece. In this study we investigated the resistance conferred by this variant using a natural Italian goat scrapie isolate to intracerebrally challenge five goats carrying genotype Q/Q 222 (wild type and five goats carrying genotype Q/K 222. By the end of the study, all five Q/Q 222 goats had died of scrapie after a mean incubation period of 19 months; one of the five Q/K 222 goats died after 24 months, while the other four were alive and apparently healthy up to the end of the study at 4.5 years post-challenge. All five of these animals were found to be scrapie negative. Statistical analysis showed that the probability of survival of the Q/K 222 goats versus the Q/Q 222 goats was significantly higher (p = 0.002. Our study shows that PRNP gene mutation K222 is strongly associated with resistance to classical scrapie also in experimental conditions, making it a potentially positive target for selection in the frame of breeding programs for resistance to classical scrapie in goats.
Independence Day 2004 (ID04) / Raul Hindov
Hindov, Raul
2004-01-01
Ülevaade 20.-22. veebruarini 2004 toimunud kaugluurepatrullide rännaku ja sõdurioskuste kompleksõppusest ID04 (Independence Day 2004 - Iseseisvuspäev 2004), millel osales 25 patrullvõistlusteks valmistuvat meest ja naist
International Nuclear Information System (INIS)
Bollhöfer, Andreas; Doering, Che
2016-01-01
Radon-222 exhalation flux densities from two different substrates of several metres thickness, waste rock and waste rock mixed with approximately 30% lateritic material, were measured over a period of five years in the wet-dry tropics of Northern Australia. Fourteen measurement campaigns using activated charcoal canisters (n > 1000) covered both dry and wet seasons and showed differences in seasonal and long term trends of the "2"2"2Rn exhalation flux densities normalised to the "2"2"6Ra activity concentrations of the substrate. Dry season "2"2"2Rn exhalation was generally higher for the mixed substrate, due to the larger fraction of fines. Seasonality established within the first year of landform construction on the mixed substrate, due to the higher water holding capacity of the lateritic material. In contrast, waste rock only shows no seasonality until years four and five after construction, when average normalised dry season "2"2"2Rn exhalation flux densities from waste rock increase to values (0.47 ± 0.06 mBq m"−"2 s"−"1 per Bq kg"−"1) similar to the mixed substrate (0.64 ± 0.08 mBq m"−"2 s"−"1 per Bq kg"−"1), likely due to an increase in fines from rapid weathering of the schistose waste rock. Volumetric water content has been used to parametrize relative "2"2"2Rn exhalation and we determined that wet season "2"2"2Rn exhalation is about 40% of the dry season exhalation. - Highlights: • We determined "2"2"2Rn exhalation flux densities normalised to "2"2"6Ra activity concentrations (R_E_-_R) for two substrates. • R_E_-_R was lower for waste rock only compared to waste rock blended with 30% fine grained lateritic material. • Seasonality in waste rock "2"2"2Rn exhalation flux densities established 4 years after construction. • Wet season R_E_-_R was about 40% of the dry season R_E_-_R.
Yu, Dan-Dan; Wu, Ying; Zhang, Xiao-Hui; Lv, Meng-Meng; Chen, Wei-Xian; Chen, Xiu; Yang, Su-Jin; Shen, Hongyu; Zhong, Shan-Liang; Tang, Jin-Hai; Zhao, Jian-Hua
2016-03-01
Breast cancer (BCa) is one of the major deadly cancers in women. However, treatment of BCa is still hindered by the acquired-drug resistance. It is increasingly reported that exosomes take part in the development, metastasis, and drug resistance of BCa. However, the specific role of exosomes in drug resistance of BCa is poorly understood. In this study, we investigate whether exosomes transmit drug resistance through delivering miR-222. We established an adriamycin-resistant variant of Michigan Cancer Foundation-7 (MCF-7) breast cancer cell line (MCF-7/Adr) from a drug-sensitive variant (MCF-7/S). Exosomes were isolated from cell supernatant by ultracentrifugation. Cell viability was assessed by MTT assay and apoptosis assay. Individual miR-222 molecules in BCa cells were detected by fluorescence in situ hybridization (FISH). Then, FISH was combined with locked nucleic acid probes and enzyme-labeled fluorescence (LNA-ELF-FISH). Individual miR-222 could be detected as bright photostable fluorescent spots and then the quantity of miR-222 per cell could be counted. Stained exosomes were taken in by the receipt cells. MCF-7/S acquired drug resistance after co-culture with exosomes from MCF-7/Adr (A/exo) but did not after co-culture with exosomes from MCF-7/S (S/exo). The quantity of miR-222 in A/exo-treated MCF-7/S was significantly greater than in S/exo-treated MCF-7/S. MCF-7/S transfected with miR-222 mimics acquired adriamycin resistance while MCF-7/S transfected with miR-222 inhibitors lost resistance. In conclusion, exosomes are effective in transmitting drug resistance and the delivery of miR-222 via exosomes may be a mechanism.
On the validity of Ksub(Id)-measurements in instrumented impact tests
International Nuclear Information System (INIS)
Kalthoff, J.F.; Winkler, S.; Klemm, W.; Beinert, J.
1979-01-01
The influence of inertia effects in determining the dynamic fracture toughness Ksub(Id) by instrumented impact testing is investigated. Model experiments in the brittle fracture regime are carried out with precracked bend specimens machined from the epoxy resin Araldite B. As is usual in these tests, the loads at the tup of the impinging striker are recorded as a function of time during the impact process. For reference purposes, the dynamic fracture toughness value Ksub(Id)sup(m1) is derived from the measured maximum load utilizing static stress intensity factor formulas. In addition to this conventional procedure, the actual stress intensity factors are measured directly at the tip of the crack by means of the shadow optical method of caustics applied in combination with high speed photography. The critical value of these optically measured stress intensity factors (for onset of crack propagation), Ksub(Id)sup(opt), is the true dynamic fracture toughness. In the experiments, the specimen size and the impact velocity were varied. In accordance with expectations, it is found that the hammer load signal is not correlated with the actual crack tip stress intensity factor values by a simple proportionality. The conventionally determined Ksub(Id)sup(m1)-value overestimates the true dynamic fracture toughness Ksub(Id)sup(opt). This overestimation becomes larger for larger specimen sizes and larger impact velocities. The results demonstrate the dominating influence inertia effects can have on hammer load measurements and emphasize the importance of eliminating these effects in order to determine non-erroneous dynamic fracture toughness values. (orig.)
Identification of an active ID-like group of SINEs in the mouse.
Kass, David H; Jamison, Nicole
2007-09-01
The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.
Mineral water 222 Rn activity decrease due to consumption habits
International Nuclear Information System (INIS)
Cipriani, Moacir; Taddei, Maria Helena Tirollo; Silva, Nivaldo Carlos da
2001-01-01
Mineral waters from the Pocos de Caldas Plateau springs, an elevated region with high natural radioactivity, in the State of Minas Gerais, Brazil, have significant 222 Rn concentration on site. The highest concentration in the waters are from: Fonte Villela - Aguas da Prata (∼ 1000 Bql -1 ); Fonte Grande Hotel - Pocinhos do Rio Verde (∼ 400 Brq -1 ) and Fonte CNEN Lab - Pocos de Caldas (∼ 290 Bql -1 ). These waters are used by the population as drinking water and due to consumption habits, can lead to internal doses above accepted limits for the public. This work deals with the decrease of 222 Rn activity in mineral waters fro two different popular consumption habits, and with the adult effective dose equivalent reduction due to water consumption habits. It has been found that the estimated dose based on the biokinetic Crawford-Brown model, can be one fourth of dose based on 222 Rn activity on site. (author)
Some remarks on exact methods for WL and 222Rn-daughter determination
International Nuclear Information System (INIS)
Groer, P.G.
1977-01-01
For an exact determination of the three 222 Rn-daughter concentrations (RaA, B and C) which properly weighted yield the Working Level, three equations relating observed counts (α or β) to these unknown concentrations have to be solved. The half-lives in the 222 Rn decay series, the type of decay and the counting errors, limit the suitable set of equations. Some aspects of two such exact methods are discussed
78 FR 31627 - Thirteenth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S.
2013-05-24
... Committee 222, Inmarsat AMS(R)S. AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S DATES: The meeting will be held June 10-11 from 9:00 a.m.-5:00 p.m. ADDRESSES: The meeting...
78 FR 61446 - Fourteenth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S
2013-10-03
... Committee 222, Inmarsat AMS(R)S AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S DATES: The meeting will be held November 19, 2013 from 9:00 a.m.-5:00 p.m. ADDRESSES: The...
Cloning and shake flask expression of hrIDS- Like in Pichia pastoris ...
African Journals Online (AJOL)
The human Iduronate-2-sulfate sulfatase (hIDS-Like) was cloned into the methylotrophic yeast Pichia pastoris under the control of alcohol oxidase promoter (AOX1) and the -mating factor signal peptide (a-factor). Six clones were identified by PCR. Using clone IDS28, the enzyme was secreted into the culture medium, ...
Energy Technology Data Exchange (ETDEWEB)
Michotte, C.; Ratel, G. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Cassette, P. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Laboratoire national de metrologie et d' essais -Laboratoire national Henri Becquerel, 91191 Gif-sur-Yvette cedex (France)
2012-02-15
In 2007, the Laboratoire national de metrologie et d'essais - Laboratoire national Henri Becquerel (LNE-LNHB), France submitted a sample of known activity of {sup 222}Rn to the International Reference System (SIR) for comparison. The value of the activity submitted was about 90 kBq. This key comparison result joins that of Switzerland and Germany in the key comparison database that now contains three results, identifier BIPM.RI(II)-K1.Rn-222. Consequently, the KCRV has been updated and the degrees of equivalence with the KCRV have been evaluated. (authors)
Alía, P; Mañá, J; Capdevila, O; Alvarez, A; Navarro, M A
2005-01-01
Serum angiotensin converting enzyme (SACE) concentration is considered a marker of sarcoidosis activity. This concentration is influenced by an insertion/deletion (I/D) polymorphism of the ACE gene, such that SACE levels follow the pattern DD>ID>II. The aim of our work was to study the relationship between I/D polymorphism and susceptibility to sarcoidosis, as well as the relation between this polymorphism and the clinical presentation and evolution of the disease in 177 sarcoidosis patients. A group of 104 individuals without sarcoidosis was included as control. Genotyping was done by a polymerase chain reaction (PCR) method, and SACE concentration at diagnosis was determined by a kinetic method. No differences were observed in genotype or allele distributions between patients and controls, nor between patients considering the type of presentation (Löfgren versus non-Löfgren) and evolution of the disease (acute versus chronic). As reported for healthy populations, SACE concentrations followed the pattern DD>ID>II in sarcoidosis patients, but significant differences between genotypes existed only in the Löfgren group (p = 0.003) and in acute patients (p = 0.02). SACE concentrations at diagnosis were lower in acute patients (p = 0.05) and in Löfgren's syndrome (p = 0.04), but this seemed to occur only in ID individuals (p = 0.02 and p = 0.01, respectively). No relation was thus found between I/D polymorphism and susceptibility to sarcoidosis, but ACE I/D genotyping may improve the assessment of disease activity, both at diagnosis and during the follow-up of treated and untreated patients.
An enhanced dynamic ID-based authentication scheme for telecare medical information systems
Directory of Open Access Journals (Sweden)
Ankita Chaturvedi
2017-01-01
Full Text Available The authentication schemes for telecare medical information systems (TMIS try to ensure secure and authorized access. ID-based authentication schemes address secure communication, but privacy is not properly addressed. In recent times, dynamic ID-based remote user authentication schemes for TMIS have been presented to protect user’s privacy. The dynamic ID-based authentication schemes efficiently protect the user’s privacy. Unfortunately, most of the existing dynamic ID-based authentication schemes for TMIS ignore the input verifying condition. This makes login and password change phases inefficient. Inefficiency of the password change phase may lead to denial of service attack in the case of incorrect input in the password change phase. To overcome these weaknesses, we proposed a new dynamic ID-based authentication scheme using a smart card. The proposed scheme can quickly detect incorrect inputs which makes the login and password change phase efficient. We adopt the approach with the aim to protect privacy, and efficient login and password change phases. The proposed scheme also resists off-line password guessing attack and denial of service attack. We also demonstrate the validity of the proposed scheme by utilizing the widely-accepted BAN (Burrows, Abadi, and Needham logic. In addition, our scheme is comparable in terms of the communication and computational overheads with relevant schemes for TMIS.
Zircaloy cladding ID/OD oxidation studies. Final report
International Nuclear Information System (INIS)
Westerman, R.E.; Hesson, G.M.
1977-11-01
The ID/OD oxide ratio that forms on Zircaloy tubing at temperatures relevant to postulated LOCA conditions was measured as a function of time, temperature, and distance from the rupture. The average ratio at the rupture position was less than unity, and decreased with decreasing test time and increasing distance from the point of rupture. The maximum observed ID/OD oxide ratio was 1.4. Ratios in excess of unity were typically found to be a consequence of the OD oxide being thinner than would have been anticipated from the nominal test conditions. Confirmatory data were also obtained on the isothermal oxidation kinetics of Zircaloy. These data are in good agreement with those obtained by other investigators and confirm the conservative nature of the Baker-Just equation that is required for use in licensing calculations
Indoor 222Rn measurements in the region of Beijing, People's Republic of China
International Nuclear Information System (INIS)
Ren, T.S.; Lin, L.Q.; Chen, Z.P.; Li, G.Y.; Chen, A.M.
1987-01-01
Passive integrating activated C detectors were used to study the regional distribution and temporal variation of 222 Rn in indoor air in dwellings in the Beijing region. Measurements were made in 537 dwellings, which were either detached houses or multi-family apartments. The city-wide study was completed in 1985. The distributions are approximately log-normal with 90% of the dwellings having 222 Rn levels less than 60 Bq m-3. The weighted average 222 Rn concentration has been found to be 22.4 Bq m-3. Averages for detached houses and multi-family dwellings are 25.9 and 15.2 Bq m-3, respectively. Assuming an equilibrium factor of 0.5 and an occupancy factor of 0.8, the average equilibrium equivalent concentration of 222 Rn progeny is 11.2 Bq m-3 and the annual average effective dose equivalent is 1.1 mSv
Directory of Open Access Journals (Sweden)
García-Carpintero, Esther
2014-06-01
Full Text Available The development and improvement of cooperation between the industrial sector and the public R&D system can produce competitive advantages for the companies. The present work describes experiences and perceptions of Spanish biotechnology companies in their collaboration with the public R&D system. Results show that almost all the biotechnological companies with R&D activities (93.6% have cooperated with the public R&D system. The main barriers found by the companies are the excess of bureaucracy and the slow response of public researchers. Results obtained also suggest the need to establish public policies and programmes to promote knowledge and technology transfer from public research centres to companies, with a special focus on encouraging researchers from the public R&D system and on improving how Technology Transfer Offices work.El desarrollo y la mejora de la cooperación entre el sector productivo y el sistema público de I+D puede generar un conjunto de ventajas competitivas para estas empresas. El presente trabajo describe las experiencias y percepciones de las empresas biotecnológicas españolas en su colaboración con el sistema público de I+D. Los resultados muestran que prácticamente la totalidad de empresas biotecnológicas españolas con actividades de I+D (un 93,6% han mantenido algún tipo de colaboración con el sistema público de I+D. Los principales obstáculos percibidos por estas empresas en su colaboración con el sistema público de I+D son el exceso de burocracia y la respuesta lenta de los investigadores. Los resultados obtenidos sugieren la conveniencia de establecer políticas y programas públicos para fomentar la transferencia de conocimiento y tecnología desde el sistema público de I+D a las empresas, fundamentalmente centrados en la necesidad de incentivar a los investigadores del sistema público de I+D y mejorar el funcionamiento de las Oficinas de Transferencia de Tecnología.
Anesthesia of juvenile Pacific Lampreys with MS-222, BENZOAK, AQUI-S 20E, and Aquacalm
Christiansen, Helena E.; Gee, Lisa P.; Mesa, Matthew G.
2013-01-01
Effective anesthetics are a critical component of safe and humane fish handling procedures. We tested three concentrations each of four anesthetics—Finquel (tricaine methanesulfonate, herein referred to as MS-222), BENZOAK (20% benzocaine), AQUI-S 20E (10% eugenol), and Aquacalm (metomidate hydrochloride)—for efficacy and safety in metamorphosed, outmigrating juvenile Pacific Lampreys Entosphenus tridentatus. The anesthetics MS-222 (100 mg/L) and BENZOAK (60 mg/L) were the most effective for anesthetizing juvenile Pacific Lampreys to a handleable state with minimal irritation to the fish. Fish anesthetized with BENZOAK also had lower rates of fungal infection than those exposed to MS-222, AQUI-S 20E, or no anesthetic. Exposure to AQUI-S 20E irritated juvenile Pacific Lampreys, causing them to leap or climb out of the anesthetic solution, and Aquacalm anesthetized fish to a handleable state too slowly and incompletely for effective use with routine handling procedures. Our results indicate that MS-222 and BENZOAK are effective anesthetics for juvenile Pacific Lampreys, but field studies are needed to determine whether exposure to MS-222 increases risk of fungal infection in juvenile Pacific Lampreys released to the wild.
miR-342 regulates BRCA1 expression through modulation of ID4 in breast cancer.
Directory of Open Access Journals (Sweden)
Elisabetta Crippa
Full Text Available A miRNAs profiling on a group of familial and sporadic breast cancers showed that miRNA-342 was significantly associated with estrogen receptor (ER levels. To investigate at functional level the role of miR-342 in the pathogenesis of breast cancer, we focused our attention on its "in silico" predicted putative target gene ID4, a transcription factor of the helix-loop-helix protein family whose expression is inversely correlated with that of ER. ID4 is expressed in breast cancer and can negatively regulate BRCA1 expression. Our results showed an inverse correlation between ID4 and miR-342 as well as between ID4 and BRCA1 expression. We functionally validated the interaction between ID4 and miR-342 in a reporter Luciferase system. Based on these findings, we hypothesized that regulation of ID4 mediated by miR-342 could be involved in the pathogenesis of breast cancer by downregulating BRCA1 expression. We functionally demonstrated the interactions between miR-342, ID4 and BRCA1 in a model provided by ER-negative MDA-MB-231 breast cancer cell line that presented high levels of ID4. Overexpression of miR-342 in these cells reduced ID4 and increased BRCA1 expression, supporting a possible role of this mechanism in breast cancer. In the ER-positive MCF7 and in the BRCA1-mutant HCC1937 cell lines miR-342 over-expression only reduced ID4. In the cohort of patients we studied, a correlation between miR-342 and BRCA1 expression was found in the ER-negative cases. As ER-negative cases were mainly BRCA1-mutant, we speculate that the mechanism we demonstrated could be involved in the decreased expression of BRCA1 frequently observed in non BRCA1-mutant breast cancers and could be implicated as a causal factor in part of the familial cases grouped in the heterogeneous class of non BRCA1 or BRCA2-mutant cases (BRCAx. To validate this hypothesis, the study should be extended to a larger cohort of ER-negative cases, including those belonging to the BRCAx class.
Growth inhibitory effects of miR-221 and miR-222 in non-small cell lung cancer cells
International Nuclear Information System (INIS)
Yamashita, Ryo; Sato, Mitsuo; Kakumu, Tomohiko; Hase, Tetsunari; Yogo, Naoyuki; Maruyama, Eiichi; Sekido, Yoshitaka; Kondo, Masashi; Hasegawa, Yoshinori
2015-01-01
Both pro- and anti-oncogenic roles of miR-221 and miR-222 microRNAs are reported in several types of human cancers. A previous study suggested their oncogenic role in invasiveness in lung cancer, albeit only one cell line (H460) was used. To further evaluate involvement of miR-221 and miR-222 in lung cancer, we investigated the effects of miR-221 and miR-222 overexpression on six lung cancer cell lines, including H460, as well as one immortalized normal human bronchial epithelial cell line, HBEC4. miR-221 and miR-222 induced epithelial-to-mesenchymal transition (EMT)-like changes in a minority of HBEC4 cells but, unexpectedly, both the microRNAs rather suppressed their invasiveness. Consistent with the prior report, miR-221 and miR-222 promoted growth in H460; however, miR-221 suppressed growth in four other cell lines with no effects in one, and miR-222 suppressed growth in three cell lines but promoted growth in two. These are the first results to show tumor-suppressive effects of miR-221 and miR-222 in lung cancer cells, and we focused on clarifying the mechanisms. Cell cycle and apoptosis analyses revealed that growth suppression by miR-221 and miR-222 occurred through intra-S-phase arrest and/or apoptosis. Finally, lung cancer cell lines transfected with miR-221 or miR-222 became more sensitive to the S-phase targeting drugs, possibly due to an increased S-phase population. In conclusion, our data are the first to show tumor-suppressive effects of miR-221 and miR-222 on lung cancer, warranting testing their potential as therapeutics for the disease
Monetizing a Meme: YouTube, Content ID, and the Harlem Shake
Directory of Open Access Journals (Sweden)
Michael Soha
2016-01-01
Full Text Available This article analyzes the creation, evolution, and monetization of the Harlem Shake meme on YouTube to explore contemporary implementation of copyright and understanding of authorship in regard to monetization of works with distributed authorship. This article has three main findings: first, we highlight the collection of digital labor that comprises the “Harlem Shake” meme, its rise in popularity, and the subsequent rise in popularity of Baauer, the composer of the song which forms the backbone of the meme; second, we examine how YouTube’s “new bargain” of Content ID, as a departure from the site’s origins creates coercive control mechanisms, shedding new light on the concept of and debate over “digital sharecropping.” Finally, we argue for a “Fair(er use” system by exploring how memes might be understood outside of the contemporary copyright system, rethinking the rights of users engaged in collective production. The article is significant in that it challenges the current distribution of Content ID payments solely to copyright holders in an attempt to rethink a system that acknowledges the creative labor of memetic phenomena and collective authorship.
Directory of Open Access Journals (Sweden)
Abolfazl Semnani
2006-12-01
Full Text Available Spectrophotometric and electrochemical studies concerning the interaction of cryptand 222 with DDQ and I2 have been performed in ethanol solution. In the case of DDQ, the results are indicative of the formation of C222¬+ and DDQ- through an equilibrium reaction. The results of I2 indicate the formation of I2-ethanol complex and I3- in the absence of C222. In the presence of C222, the formation of C222I¬+ and I3- through a non-equilibrium reaction is confirmed. The equilibrium constant of the redox reaction between DDQ and C222 has been calculated from the absorbance mole ratio data, using the nonlinear least square program “KINFIT”. The electrochemical reversibility of I-/I2 couple and irreversibility of DDQ/DDQ- is indicated by amperometry. The behavior of DDQ and I2 has been compared. A comparison with aprotic solvents has also been made.
Transfer of radon-222 from rocks of the Pocos de Caldas plateau to the waters
International Nuclear Information System (INIS)
Bonotto, Daniel Marcos; Lima, Jorge Luis Nepomuceno de
1997-01-01
The analytical procedures developed at the Sector of Unstable Isotopes of the Laboratory of Geochemistry, which belongs to the Department of Petrology and Metallogeny located at the Institute of Geosciences and Exact Sciences - Universidade Estadual Paulista Julio de Mesquita Filho (UNESP) to measure the release of 222 Rn from rocks to the waters is described. The methodology established was used to evaluate the emanation coefficient of 222 Rn from experiments of water-rock interaction under controlled conditions in the laboratory, which is an important parameter necessary to interpret the radioactivity related to dissolved 222 Rn content in waters. Four typical rocks from Pocos de Caldas Plateau were sampled for the experiments: phonolite, nepheline syenite, pseudoleucite tinguaite and silicified sandstone. The 226 Ra content of these rocks was evaluated by gamma-ray spectrometry using a Nal(TI) scintillation detector, a method that has been currently utilized in nuclear geophysics or isotope geochemistry to measure the equivalent uranium (e U). The 226 Ra content in the studied rocks and the 222 Rn transferred to the waters due to its generation by its 226 Ra progenitor allowed an estimation of the emanation coefficient of 222 Rn. A preliminary investigation on the influence of the mass of the rock in contact with water, of the surface area of the rock in contact with water and of the 226 Ra content in rocks on the amount of 222 Rn released to the water was also performed. (Author)
Exposure to radon Rn-222 of inhabitants of buildings in Olsztyn
International Nuclear Information System (INIS)
Gorzkowski, B.; Pachocki, K.; Rozycki, Z.; Majle, T.; Pensko, J.; Krzeslak, A.
1998-01-01
The concentrations of radon-222 in the air of some buildings in Olsztyn were measured. The main source of radon in buildings is in general the ground under building and the materials used for building structure. In this work the results of radon-222 concentration measurements in the air of some buildings constructed before the 1939 year, in the buildings constructed after 1945 year with the traditional use of the bricks and in the buildings constructed with the use of great prefabricated plates are presented. The relations between radon-222 concentrations in the basements and in the first floor flats situated above the basement were evaluated. Based on the mean radon concentrations in the air of the various types of buildings investigated the effective doses for the inhabitants of each type of buildings were estimated. (author)
Hussain, Misbah; Awan, Fazli Rabbi; Gujjar, Amna; Hafeez, Shakir; Islam, Mehboob
2018-01-01
Angiotensin converting enzyme (ACE) is a key component of renin angiotensin aldosterone system. It converts angiotensin I to angiotensin II. Insertion/deletion (I/D) polymorphism of ACE gene is found associated with several complications. However, its association with hypertension and related metabolic diseases is still controversial. So, the aim of the present study was to check this association for Punjabi population from Faisalabad, Pakistan. For this purpose, blood samples (patients = 100, controls = 48) were collected and several biochemical parameters were measured. Genotyping for ACE (I/D) polymorphism was performed by polymerase chain reaction (PCR) assay. ID genotype is found prevalent in the studied population as 41% in control subjects and 61% in patients. Furthermore, chi-square analysis showed significant (p = 0.005) difference for genotypic frequencies between both groups. One-way ANOVA for association of II, ID, and DD genotypes with anthropometric, clinical, and biochemical parameters showed that in patient group, DD genotype is significantly (p = 0.041) associated with systolic blood pressure (SBP). Moreover, ID genotype is found associated with the presence of cardiovascular diseases. This study concludes that DD genotype is strongly associated with higher SBP in hypertensive patients.
International Nuclear Information System (INIS)
Moustafa, A.S.
2004-01-01
The advantageous of liquid scintillation counting technique for 6 Ra determination compared with other methods are the high counting efficiency and the easier sample preparation, with no need for sample pre-concentration. In this work, liquid scintillation counting system was used to measure 222 Rn and 226 Ra levels in environmental samples. The liquid scintillation cocktail was prepared in the laboratory and was found efficient for measuring 222 Rn. Soil, sediment and TENORM samples were dried, grind, sieved and added to hydrochloric acid, in a standard scintillation vial, preloaded with the liquid scintillation cocktail. By measuring 222 Rn levels in the prepared vials, at different intervals of time after preparation, 222 Rn and 226 Ra levels were determined
The paradox of IDs: an account of an ethnographic experience in the US
Directory of Open Access Journals (Sweden)
Mariza Peirano
2008-01-01
Full Text Available In the modern world, IDs are indispensable objects, without which we cannot prove that we are who we say we are. We need material substantiation that attests to the authenticity of our self-identification. This paper is an account of an ethnographic experience about IDs and identification processes in the US, based on the examination of two events in which Eliot Spitzer, the New York State governor from January 2007 to March 2008, was a central figure. A comparison with the Brazilian scenario is present throughout the paper, and it ends by focusing on the ID theft phenomenon.
Implementasi Cell ID dan GPS dalam Pencarian Lokasi Fasilitas Kesehatan Terdekat
Directory of Open Access Journals (Sweden)
Fahmi Candra Permana
2017-07-01
Full Text Available Cell ID dan GPS merupakan layanan berbasis lokasi dan teknologi yang banyak membantu manusia dalam hal navigasi dan penemuan tempat-tempat yang bermanfaat di sekitarnya. Salah satu komponen utama dari teknologi ini dapat diterapkan pada telepon seluler. Dalam penelitian ini, dirancang sebuah aplikasi dengan memanfaatkan teknologi berdasar implementasi dari Cell ID dan GPS untuk mengetahui posisi user dan lokasi fasilitas kesehatan terdekat di sekitar user dan penggunaan JSON sebagai sarana untuk menyimpan database pada web. Aplikasi ini diimplementasikan pada telepon seluler dengan sistem operasi Android. Hasil dari penelitian ini menunjukkan bahwa Cell ID dan GPS dapat diimplementasikan dengan baik dengan memanfaatkan akses Internet dan Google Maps untuk mencari fasilitas kesehatan terdekat dan menggambarkan daerah sekitar user.
International Nuclear Information System (INIS)
Sexsmith, K.S.
1996-01-01
This study examines hydrological, geological and geochemical controls on 222 Rn variability in groundwater in the Front Range of Colorado. Specific objectives of the study are: (1) to determine if there are any correlations or spatial relationships between 222 Rn and the geological, geochemical and hydrogeological data; and (2) to determine whether it is geochemically reasonable for observed 222 Rn levels to be the result of U and 226 Ra accumulation by fracture filling minerals. Domestic-water wells were sampled and tested to determine the local aquifer characteristics and aqueous geochemistry. A multivariate and staged approach was used in the data analyses. Analysis of variance tests were used to test for relationships between 222 Rn and the lithology of the study wells. The effects of rock-type were then removed from the chemical and hydrological variables by subtracting the mean value for each rock-type from each of the measured values within that rock-type (a residual transformation). Linear and linear multiple regression techniques were used to test for expected relationships between residual 222 Rn levels and these variables, and stepwise linear regressions were used to test for any unforeseen multivariate relationships in the data. Correlograms, distance-weighted average and inverse-distance-weighted average predictions were used to look for spatial relationships in the data
Aguilar, Patricia V; Adams, A Paige; Suárez, Victor; Beingolea, Luis; Vargas, Jorge; Manock, Stephen; Freire, Juan; Espinoza, Willan R; Felices, Vidal; Diaz, Ana; Liang, Xiaodong; Roca, Yelin; Weaver, Scott C; Kochel, Tadeusz J
2009-09-15
Venezuelan equine encephalitis virus (VEEV) has been responsible for hundreds of thousands of human and equine cases of severe disease in the Americas. A passive surveillance study was conducted in Peru, Bolivia and Ecuador to determine the arboviral etiology of febrile illness. Patients with suspected viral-associated, acute, undifferentiated febrile illness of Peru, and more recently (2005), in Madre de Dios, Peru. We performed phylogenetic analyses with VEEV from Bolivia, Ecuador and Peru and compared their relationships to strains from other parts of South America. We found that VEEV subtype ID Panama/Peru genotype is the predominant one circulating in Peru. We also demonstrated that VEEV subtype ID strains circulating in Ecuador belong to the Colombia/Venezuela genotype and VEEV from Madre de Dios, Peru and Cochabamba, Bolivia belong to a new ID genotype. In summary, we identified a new major lineage of enzootic VEEV subtype ID, information that could aid in the understanding of the emergence and evolution of VEEV in South America.
Energy Technology Data Exchange (ETDEWEB)
Arevalo B, C. A.; Lopez del R, H.; Davila R, J. I.; Mireles G, F.; Pinedo V, J. L.; Rios M, C.; Saucedo A, S. A., E-mail: cesar_arevalob@outlook.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico)
2017-09-15
A study was carried out to determine the concentration of {sup 222}Rn in samples of drinking water collected from different homes in the Zacatecas city, Mexico, whose main source of supply is groundwater. The {sup 222}Rn radioactive gas is a product of the decay series of {sup 238}U and is considered one of the main sources of natural radiation, since it contributes almost half of the radiation dose that a person will receive throughout his life. The {sup 222}Rn originates in the rocks of the aquifers and dissolves in the water, which is later integrated into the distribution network of the public supply that supplies the entire population. Exposure to ionizing radiation that {sup 222}Rn and its offspring emit can damage the DNA molecule, inducing the possible appearance of cancer. Has been demonstrated by various epidemiological studies carried out in uranium mines workers in different parts of the world, that this exposure increases the incidence of lung cancer, placing {sup 222}Rn and their offspring as the second main cause of this type of cancer, after smoking habit. Using the technique of solvent extraction of {sup 222}Rn in water and liquid scintillation spectrometry, water collected from 14 different households was sampled and analyzed. The average of the measured activity of {sup 222}Rn was 2.09 Bq/L and the annual effective dose per water intake attributable to that concentration of 6.07 mSv/a. The concentration of {sup 222}Rn in water and the annual effective dose are below 11 Bq/L and 50 mSv/a, such concentrations are the maximum limits established by the Unites States Environmental Protection Agency (US EPA) and the ICRP, respectively. The concentration of {sup 222}Rn that is transferred from the water to the air inside a house was also calculated and the radiation dose that this concentration causes by inhalation, being 0.209 Bq/m{sup 3} and 1,463 μ Sv a, respectively. (Author)
Role of ID Proteins in BMP4 Inhibition of Profibrotic Effects of TGF-β2 in Human TM Cells.
Mody, Avani A; Wordinger, Robert J; Clark, Abbot F
2017-02-01
Increased expression of TGF-β2 in primary open-angle glaucoma (POAG) aqueous humor (AH) and trabecular meshwork (TM) causes deposition of extracellular matrix (ECM) in the TM and elevated IOP. Bone morphogenetic proteins (BMPs) regulate TGF-β2-induced ECM production. The underlying mechanism for BMP4 inhibition of TGF-β2-induced fibrosis remains undetermined. Bone morphogenic protein 4 induces inhibitor of DNA binding proteins (ID1, ID3), which suppress transcription factor activities to regulate gene expression. Our study will determine whether ID1and ID3 proteins are downstream targets of BMP4, which attenuates TGF-β2 induction of ECM proteins in TM cells. Primary human TM cells were treated with BMP4, and ID1 and ID3 mRNA, and protein expression was determined by quantitative PCR (Q-PCR) and Western immunoblotting. Intracellular ID1 and ID3 protein localization was studied by immunocytochemistry. Transformed human TM cells (GTM3 cells) were transfected with ID1 or ID3 expression vectors to determine their potential inhibitory effects on TGF-β2-induced fibronectin and plasminogen activator inhibitor-I (PAI-1) protein expression. Basal expression of ID1-3 was detected in primary human TM cells. Bone morphogenic protein 4 significantly induced early expression of ID1 and ID3 mRNA (P protein in primary TM cells, and a BMP receptor inhibitor blocked this induction. Overexpression of ID1 and ID3 significantly inhibited TGF-β2-induced expression of fibronectin and PAI-1 in TM cells (P protein 4 induced ID1 and ID3 expression suppresses TGF-β2 profibrotic activity in human TM cells. In the future, targeting specific regulators may control the TGF-β2 profibrotic effects on the TM, leading to disease modifying IOP lowering therapies.
Diurnal radon-222 concentrations in the outflow of a complex basin
International Nuclear Information System (INIS)
Clements, W.E.; Wilkening, M.
1981-01-01
Radon 222 concentrations were monitored continuously in the outflow from the Anderson and Putah Creek air drainage basin as part of the Department of Energy's Atmospheric Studies in Complex Terrain September 1980 field studies. Radon 222, an inert gas having a half-life of 3.8 days, can be considered to be exhaled uniformly at a constant rate from the earth's surface throughout the basin. The contribution to the total radon budget from vented steam from geothermal wells in the Geysers area is neglected. Hence, radon in this application is used as an extended-source atmospheric tracer in contrast with point-source release of tracer materials. One of the purposes of this study is to help classify drainage flow nights in terms of the diurnal patterns of radon concentration. As cool slope winds move along the terrain and into the valley, the air masses involved accumulate radon through the night until morning instabilities mix it to greater depths. Hence, the measured diurnal trend of radon in the outflow of the basin reflects the integrated behavior of nocturnal flows in the basin and subsequent breakup in the morning. The use of this technique to classify drainage flows has been used by Wilkening and Rust
Papaspyridonos, Marianna; Matei, Irina; Huang, Yujie; do Rosario Andre, Maria; Brazier-Mitouart, Helene; Waite, Janelle C; Chan, April S; Kalter, Julie; Ramos, Ilyssa; Wu, Qi; Williams, Caitlin; Wolchok, Jedd D; Chapman, Paul B; Peinado, Hector; Anandasabapathy, Niroshana; Ocean, Allyson J; Kaplan, Rosandra N; Greenfield, Jeffrey P; Bromberg, Jacqueline; Skokos, Dimitris; Lyden, David
2015-04-29
A central mechanism of tumour progression and metastasis involves the generation of an immunosuppressive 'macroenvironment' mediated in part through tumour-secreted factors. Here we demonstrate that upregulation of the Inhibitor of Differentiation 1 (Id1), in response to tumour-derived factors, such as TGFβ, is responsible for the switch from dendritic cell (DC) differentiation to myeloid-derived suppressor cell expansion during tumour progression. Genetic inactivation of Id1 largely corrects the myeloid imbalance, whereas Id1 overexpression in the absence of tumour-derived factors re-creates it. Id1 overexpression leads to systemic immunosuppression by downregulation of key molecules involved in DC differentiation and suppression of CD8 T-cell proliferation, thus promoting primary tumour growth and metastatic progression. Furthermore, advanced melanoma patients have increased plasma TGFβ levels and express higher levels of ID1 in myeloid peripheral blood cells. This study reveals a critical role for Id1 in suppressing the anti-tumour immune response during tumour progression and metastasis.
International Nuclear Information System (INIS)
Morris, R.C.; Fraley, L. Jr.
1989-01-01
We measured 222 Rn fluence rate and several environmental variables on two plots with U mill tailings buried beneath 30 cm of overburden and 20 cm of topsoil. An additional 30 cm of clay covered the tailings on one plot and each plot was subdivided into bare soil and vegetated subplots. We used linear correlation, two-way ANOVA and stepwise multiple regression to analyze the effects of the plot characteristics and the environmental variables on 222 Rn fluence rate. The most important effect on 222 Rn fluence rates from these plots was the combination of a clay cap and a vegetated surface. The mean annual fluence rate from the plot having both of these characteristics (520 +/- 370 mBq m-2 s-1) was over three times that of the vegetated plot without a clay cap (170 +/- 130 mBq m-2 s-1) and 18 times that of the bare plot with a clay cap (29 +/- 13 mBq m-2 s-1). The interaction effect may have been due to the growth of roots in the moist clay and active transport of dissolved 222 Rn to the surface in water. This speculation is supported by the observation that on vegetated plots with a clay cap, moisture in the clay enhanced the fluence rate
Kang, Hui-Yuan; Wang, Xin-Rong; Gao, Li; Wang, Wei; Li, Mian-Yang; Wang, Li-Li; Wang, Cheng-Bin; Yu, Li
2015-04-01
To evaluate significance of ID4 gene mehtylation in demethylating myelodysplastic syndrome(MDS) cell Line MUTZ1 and 2 patients with MDS. The methylation-specific PCR (MS-PCR) and reverse transcription-PCR (RT-PCR) were applied to identify the methylation status and gene expression of ID4 gene in MDS cell line MUTZ1, a patient with aplastic anemia(AA) and a donor with normal bone marrow (NBM). RT-PCR was applied to detect the ID4 gene expression status in MUTZ1 cell line treated with decitabine at 3 different concentrations. Then bisulfite sequencing PCR (BSP) was applied to detect ID4 gene methylation status in 2 MDS parients treated with decitabine. The MDS cell line MUTZ-1 displayed a complete methylation of ID4 gene promoter with little mRNA expression. Inversely, bone marrow of an AA patient and NBM showed complete unmethylation of this gene with intensity mRNA expression. With the increase of decitabine concentration, ID4 gene mRNA expression was more and more increased. After decitabine treatment, ID4 gene methylation-positive frequencies of both the 2 MDS patients were much more decreased than that of the first treatment. So, ID4 gene mRNA expression inhibited by promoter hypemethylation could be recovered by using demethylation medicine. ID4 as a new potential anti-oncogene suggests that its methylation may become a marker for selection and assessment of therapeutic schedules in patients with MDS.
Direct determination of 222Rn gas using the electret to remove daughters at formation
International Nuclear Information System (INIS)
Harley, N.H.
1981-01-01
Five compact, portable, continuous 222 Rn monitors have been constructed inhouse. Printed data can be obtained from intervals ranging from 10 minutes to 990 minutes. One hour count interval provides a lower limit of detection of 0.03 pCi 222 Rn/l -1 which is sufficient for measurement of any environmental level encountered. Calibration of the units was accomplished in the EML radon calibration room and the typical calibration factor is 165 counts per hour per pCi 222 Rn/l. The units are now being field tested. Two indoor/outdoor pairs are located in a single family dwelling and in a high rise apartment. One unit is being used for special studies
222Rn determination in some thermal baths of a central eastern Italian area
International Nuclear Information System (INIS)
Desideri, D.; Bruno, M.R.; Roselli, C.
2004-01-01
Some recent Italian laws, based on the Euratom Directive 26/96, introduce the obligation of monitoring the exposition to natural radioactivity in particular worksites (thermal baths, mines, basements, etc.). Results of 222 Rn measurements in some thermal baths of Rimini and Pesaro-Urbino provinces (Central Eastern Italy), by Radosys-2000, a complete set suitable to radon concentration measurements with CR-39 plastic alpha-track detectors are reported. Some areas where radon could accumulate (bathing, reaction, muddy, inhalation, insufflation rooms and swimming pools) were selected for the investigation. The dosimeters have been exposed for 98 days. The results show that 222 Rn concentrations are very low in the considered thermal baths (7-71 Bq x m -3 ). Moreover, no difference was observed between the concentrations measured in the therapy rooms (bathing, muddy, inhalation and insufflation rooms, swimming pools) and in the normal areas (passages, reaction rooms, dressing rooms, etc.). The calculated dose contribution to workers was about one tenth of the legally suggested value. (author)
Distribution Log Normal of 222 Rn in the state of Zacatecas, Mexico
International Nuclear Information System (INIS)
Garcia, M.L.; Mireles, F.; Quirino, L.; Davila, I.; Rios, C.; Pinedo, J.L.
2006-01-01
In this work the evaluation of the concentration of 222 Rn in air for Zacatecas is shown. The Solid State Nuclear Track Detectors were used as the technique for the realization of the measurements in large scale with cellulose nitrate LR-115, type 2, in open chambers of 222 Rn. The measurements were carried out during three months in different times of the year. In the results it is presented the log normal distribution, arithmetic mean and geometric media for the concentration at indoor and outdoor of residence constructions, the concentration at indoor of occupational constructions and in the 57 municipal heads of the state of Zacatecas. The statistics of the values in the concentration showed variation according to the time of the year, obtaining high quantities in winter seasons for both cases. The distribution of the concentration of 222 Rn is presented in the state map for each one of the municipalities, representing the measurement places in the entire state of Zacatecas. Finally the places where the values in the concentration of 222 Rn in air are near to the one limit settled down by the EPA of 148 Bq/m 3 are presented. (Author)
International Nuclear Information System (INIS)
Cao Jianping; Lu Zhizhao; Li Yuanshan
1993-03-01
The results of concentration measuring of 222 Ru and its daughters and estimation of internal doses to workers in the underground buildings at Nanjing city are presented. The double filtering membrane method and Thomas method were used in the monitoring of 222 Rn and its daughters, and the dose conversion factor was taken from the latest UNSCEAR report. Concentration distributions of 222 Rn and its daughters were approximately log-normal. The geometric means for 222 Rn was 40.5 Bq · m -3 and for its daughters was 1.4 x 10 -7 J · m -3 . The equilibrium factor was 0.63. The radioactive equilibrium ratio between short-lived 222 Rn daughters was 1:0.57:0.49. The estimation value of annual effective dose equivalent from 222 Rn daughters to workers working at underground sites was 1.3 mSv, which was 86% higher than that of those working on ground sites
77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID
2012-11-15
... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...
Suurnimed jäid müümata / Maria-Kristiina Soomre
Soomre, Maria-Kristiina, 1978-
2001-01-01
9. mai Christie' oksjonist, müümata jäänud Picasso, Degas', Cezanne'i tööd. 8. mai Sotheby oksjonist, kus edukalt müüdi töid S. J. Seegeri kogust, 3,85 miljoni dollari eest M. Beckmanni "Perseuse viimane katsumus". Sotheby kaasaegse kunsti oksjonil New Yorgis müüdi 5,6 miljoni dollari eest J. Koonsi skulptuur M. Jacksonist. Müümata jäid A. Warholi "Viis supipurki", A. Calderi 3 skulptuuri
222Rn concentration in the outdoor atmosphere and its relation to the atmospheric stability
International Nuclear Information System (INIS)
Holy, K.; Boehm, R.; Bosa, I.; Polaskova, A.; Hola, O.
1998-01-01
The radon in the outdoor atmosphere has been monitored continuously since 1991. On the basis of the measured data mainly the average daily and the average annual courses of the 222 Rn concentrations have been studied. The annual courses of 222 Rn concentration are similar for all years. They present the annual variations. The average course of the 222 Rn concentration calculated on the basis of all continual measurements in the years 1991-1997 reaches the maximum value in October and the minimum value in April. The average daily courses of the 222 Rn concentration for the individual months of the year. The average daily courses have a form of waves with a maximum in the morning hours and with a minimum in the afternoon. The maximal amplitudes of daily waves have been reached in the summer months, from June till August. The amplitudes of daily waves are very small at the end of an autumn and during the winter months. The analysis of the daily waves and annual courses of 222 Rn showed that the amplitudes of the daily waves are in proportion to the global solar radiation irradiating the Earth's surface. The day duration influence on the phase of the daily wave and the wind velocity influence mainly on the level of the radon concentration. For the study of the relation of the radon concentration in the outdoor atmosphere to the stability the data of the atmosphere were obtained and they were correlated with the radon concentration. The results indicate that the 222 Rn concentrations int he outdoor atmosphere could be used for determination of the vertical atmospheric stability and these ones could reflect the atmospheric stability more completely than the different classifications based on the knowledge pertinent to the meteorological parameters. (authors)
78 FR 40382 - Modification of Class D and E Airspace; Twin Falls, ID
2013-07-05
... using the Navigation (RNAV) Global Positioning System (GPS) and the Instrument Landing System (ILS) or... or more above the surface of the earth. * * * * * ANM ID E5 Twin Falls, ID [Modified] Twin Falls...
Padilla, G.; Hernández, P. A.; Padrón, E.; Barrancos, J.; Melián, G.; Dionis, S.; Rodríguez, F.; Nolasco, D.; Calvo, D.; Hernández, I.; Pereza, M. D.; Pérez, N. M.
2012-04-01
El Hierro (278 km2) is the southwesternmost island of the Canarian archipelago. From June 19, 2011 to January 2012, more than 11,950 seismic events have been detected by the seismic network of IGN. On 10 October 2011 the earthquake swarm changed its behaviour and produced a harmonic tremor due to magma movement, indicating that a submarine eruption located at 2 km south of La Restinga had started which is still in progress. Since 2003, the ITER Environmental Research Division now integrated in the Instituto Volcanológico de Canarias, INVOLCAN, has regularly performed soil gas surveys at El Hierro as a geochemical tool for volcanic surveillance. Among the investigated gases, soil gas radon (222Rn) and thoron (220Rn) have played a special attention. Both gases are characterized to ascend towards the surface mainly through cracks or faults via diffusion or advection, mechanisms dependent of both soil porosity and permeability, which in turn vary as a function of the stress/strain changes at depth. Years before the starts of the volcanic-seismic crisis on July 17, 2011, a volcanic multidisciplinary surveillance program was implemented at El Hierro including discrete and continuous measurements of 222Rn and 220Rn. Two soil gas 222Rn surveys had been carried out at El Hierro in 2003 and 2011, and four continuous geochemical monitoring stations for 222Rn and 220Rn measurements had been installed (HIE02, HIE03, HIE04 and HIE08). Soil gas 222Rn surveys were carried out at the surface environment of El Hierro after selecting 600 sampling observation sites (about 40 cm depth). Geochemical stations measure 222Rn and 220Rn activities by pumping the gas from a PVC pipe inserted 1m in the ground and thermally isolated. The results of the 2003 and 2011 soil gas 222Rn surveys show clearly a relatively higher observed 222Rn activities in the surface environment on 2011 than those observed on 2003 when no anomalous seismicity were taking place beneath El Hierro. The observed
Evaluation of the anesthetic effects of MS222 in the adult Mexican axolotl (Ambystoma mexicanum
Directory of Open Access Journals (Sweden)
Zullian C
2016-01-01
Full Text Available Chiara Zullian,1 Aurore Dodelet-Devillers,1 Stéphane Roy,2 Pascal Vachon1 1Département de Biomédecine Vétérinaire, Faculté de Médecine Vétérinaire, Université de Montréal, Saint-Hyacinthe, 2Département de Stomatologie, Faculté de Médecine Dentaire, Montréal, Québec, Canada Abstract: The Mexican axolotl (Ambystoma mexicanum is a unique research model in several fields of medicine, where surgical and invasive procedures may be required. As yet, little is known about the efficacy of MS222 (tricaine methanesulfonate, which is the most commonly used anesthetic agent in amphibians. The main objectives of this study were to evaluate the anesthetic effects and physiological changes in adult axolotls following a 20-minute immersion bath, containing progressive MS222 concentrations starting at 0.1%. Depth of anesthesia and physiological changes were evaluated every 15 minutes post-MS222 exposure with the following parameters: righting behavior, withdrawal reflex, acetic acid test response, heart rate, and blood oxygen saturation, as well as cloacal and body surface temperatures. A 20-minute exposure in a 0.1% MS222 immersion bath (n=6 animals had no anesthetic effects on adult axolotls after 20 minutes of exposure. With a 0.2% MS222 solution, all axolotls (n=9 were deeply anesthetized at 15 minutes, and 80% were still unresponsive at 30 minutes postexposure. Blood oxygen saturation and heart rate were slightly, but significantly, increased when compared with the baseline value and remained stable up to recovery. There was no significant increase in surface and cloaca temperatures, compared with baseline. With the 0.4% MS222 solution, the duration of anesthesia lasted for 90 minutes to at least 120 minutes (n=3 animals and this concentration was deemed too high. In conclusion, a 20-minute immersion bath with 0.2% MS222 may be used for short procedures (15–30 minutes requiring anesthesia of adult axolotls. Keywords: Ambystoma mexicanum
Calibration factor determination for solid nuclear track detectors CR-39 type exposed to Rn-222
International Nuclear Information System (INIS)
Cazula, Camila Dias; Campos, Marcia Pires de; Mazzilli, Barbara Paci
2014-01-01
In the detection method with solid nuclear track detector, when a heavy particle rests on the detector surface, causes a breakdown in their molecular structure forming a trace. One of the typical applications of these detectors is the measurement of the concentration of Rn -222 in air, a noble radioactive gas, part of the U-238 series, emitting alpha particles and important in epidemiological studies to protect individuals from natural radiation. To determine the concentration of Rn -222 in the air in a room is necessary to know the density of lines (traces / cm 2 ) on the detector surface, the exposure time and the calibration factor. The determination of the calibration factor for CR-39 detectors was taken from the exposure of these to a known concentration of Rn-222. Therefore, the detectors were placed inside a cell of Lucas adapted and subsequently exposed to a concentration of Rn-222 15 kBq / m 3 , by means of the apparatus RN-150 Pylon Electronics Incorporation, which has a source of Ra-226 and releases known concentrations of Rn-222. Six calibration factor determinations were performed, the average value obtained was 0.0534 ±0.0021 (traces / cm 2 per Bq / m 3 day). The results are consistent with literature values for the same type of detector and showed good reproducibility
The Implementation of C-ID, R2D2 Model on Learning Reading Comprehension
Rayanto, Yudi Hari; Rusmawan, Putu Ngurah
2016-01-01
The purposes of this research are to find out, (1) whether C-ID, R2D2 model is effective to be implemented on learning Reading comprehension, (2) college students' activity during the implementation of C-ID, R2D2 model on learning Reading comprehension, and 3) college students' learning achievement during the implementation of C-ID, R2D2 model on…
48 CFR 52.222-18 - Certification Regarding Knowledge of Child Labor for Listed End Products.
2010-10-01
... for Listed End Products. As prescribed in 22.1505(a), insert the following provision: Certification... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Certification Regarding Knowledge of Child Labor for Listed End Products. 52.222-18 Section 52.222-18 Federal Acquisition...
Anmeldung in ILIAS ohne Uni-Login-ID
Schanz, Nadja
2016-01-01
Gewusst wie...! Online-Tutorial der Universitätsbibliothek Tübingen. Erklärt die Anmeldung in Ilias zu Führungen ohne Uni-Login-ID Online Tutorial from university library tuebingen. teaches how to register in Ilias for courses and guided tours without university login
Radon-222 signatures of natural ventilation regimes in an underground quarry.
Perrier, Frédéric; Richon, Patrick; Crouzeix, Catherine; Morat, Pierre; Le Mouël, Jean Louis
2004-01-01
Radon-222 activity concentration has been monitored since 1999 in an underground limestone quarry located in Vincennes, near Paris, France. It is homogeneous in summer, with an average value of 1700 Bq m(-3), and varies from 730 to 1450 Bq m(-3) in winter, indicating natural ventilation with a rate ranging from 0.5 to 2.4 x 10(-6) s(-1) (0.04-0.22 day(-1)). This hypothesis is supported by measurements in the vertical access pit where, in winter, a turbulent air current produces a stable radon profile, smoothly decreasing from 700 Bq m(-3) at 20 m depth to 300 Bq m(-3) at surface. In summer, a thermal stratification is maintained in the pit, but the radon-222 concentration jumps repeatedly between 100 and 2000 Bq m(-3). These jumps are due to atmospheric pressure pumping, which induces ventilation in the quarry at a rate of about 0.1 x 10(-6) s(-1) (0.009 day(-1)). Radon-222 monitoring thus provides a dynamical characterisation of ventilation regimes, which is important for the assessment of the long-term evolution of underground systems.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false What disparity standard must a State meet in order to be certified and how are disparities in current expenditures or revenues per pupil measured? 222.162... of the Act § 222.162 What disparity standard must a State meet in order to be certified and how are...
Directory of Open Access Journals (Sweden)
van Karnebeek Clara D M
2012-07-01
Full Text Available Abstract Background Intellectual disability (ID is a devastating and frequent condition, affecting 2-3% of the population worldwide. Early recognition of treatable underlying conditions drastically improves health outcomes and decreases burdens to patients, families and society. Our systematic literature review identified 81 such inborn errors of metabolism, which present with ID as a prominent feature and are amenable to causal therapy. The WebAPP translates this knowledge of rare diseases into a diagnostic tool and information portal. Methods & results Freely available as a WebAPP via http://www.treatable-id.org and end 2012 via the APP store, this diagnostic tool is designed for all specialists evaluating children with global delay / ID and laboratory scientists. Information on the 81 diseases is presented in different ways with search functions: 15 biochemical categories, neurologic and non-neurologic signs & symptoms, diagnostic investigations (metabolic screening tests in blood and urine identify 65% of all IEM, therapies & effects on primary (IQ/developmental quotient and secondary outcomes, and available evidence For each rare condition a ‘disease page’ serves as an information portal with online access to specific genetics, biochemistry, phenotype, diagnostic tests and therapeutic options. As new knowledge and evidence is gained from expert input and PubMed searches this tool will be continually updated. The WebAPP is an integral part of a protocol prioritizing treatability in the work-up of every child with global delay / ID. A 3-year funded study will enable an evaluation of its effectiveness. Conclusions For rare diseases, a field for which financial and scientific resources are particularly scarce, knowledge translation challenges are abundant. With this WebAPP technology is capitalized to raise awareness for rare treatable diseases and their common presenting clinical feature of ID, with the potential to improve health outcomes
2012-01-01
Background Intellectual disability (ID) is a devastating and frequent condition, affecting 2-3% of the population worldwide. Early recognition of treatable underlying conditions drastically improves health outcomes and decreases burdens to patients, families and society. Our systematic literature review identified 81 such inborn errors of metabolism, which present with ID as a prominent feature and are amenable to causal therapy. The WebAPP translates this knowledge of rare diseases into a diagnostic tool and information portal. Methods & results Freely available as a WebAPP via http://www.treatable-id.org and end 2012 via the APP store, this diagnostic tool is designed for all specialists evaluating children with global delay / ID and laboratory scientists. Information on the 81 diseases is presented in different ways with search functions: 15 biochemical categories, neurologic and non-neurologic signs & symptoms, diagnostic investigations (metabolic screening tests in blood and urine identify 65% of all IEM), therapies & effects on primary (IQ/developmental quotient) and secondary outcomes, and available evidence For each rare condition a ‘disease page’ serves as an information portal with online access to specific genetics, biochemistry, phenotype, diagnostic tests and therapeutic options. As new knowledge and evidence is gained from expert input and PubMed searches this tool will be continually updated. The WebAPP is an integral part of a protocol prioritizing treatability in the work-up of every child with global delay / ID. A 3-year funded study will enable an evaluation of its effectiveness. Conclusions For rare diseases, a field for which financial and scientific resources are particularly scarce, knowledge translation challenges are abundant. With this WebAPP technology is capitalized to raise awareness for rare treatable diseases and their common presenting clinical feature of ID, with the potential to improve health outcomes. This innovative digital
Energy Technology Data Exchange (ETDEWEB)
Gouvea, Vandir de Azevedo; Cardoso, Domingos d' Oliveira; Pedro, Carlos Roberto [Instituto de Engenharia Nuclear (IEN), Rio de Janeiro, RJ (Brazil). Div. de Seguranca e Radioprotecao]. E-mail: vandir@cnen.gov.br; Castro, Carlos Alberto Carvalho [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil). Dept. de Engenharia Nuclear
2001-07-01
The radioecological concentrations of Radon-222 indoor and outdoor nuclear facility of IEN, have been determined.The present study has established a radon investigation methodology in occupational areas, besides to suggest solutions for gas concentration minimization, in others work environment like to IEN.
International Nuclear Information System (INIS)
Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K.P.; Sarma, K.S.S.
2017-01-01
Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli. - Highlights: • Idli (traditional Indian fermented food) was prepared in ready-to-eat (RTE) form. • Ready-to-eat Idli was then subjected to combination processing comprised of lowest irradiation dosage of 2.5 kGy with mild heat treatment to extend its shelf life. • Increase in hardness and decrease in brightness of combination processed Idli was observed. • Combination processed Idli was microbiologically safe and
Measurements of the radon-222 concentration in residences of Lima - Peru
International Nuclear Information System (INIS)
Pereyra, P.; Lopez, M. E.; Perez, B.
2014-08-01
The measurement of the Radon-222 levels was realized in the first semester of 2013 in residences corresponding to 16 districts of the metropolitan area of Lima, including to the zones North, Center and South of the city, during one period of 3 to 6 months in continuous form, with measurement periods of 1 to 2 months. The houses where the measurements were made were selected considering diverse variables as antiquity, construction materials, coatings, soil type, occupational use of the monitored rooms, etc. The measurements were realized in basements, first and second floor of the residences. For the Radon-222 measurements passive detectors of cellulose nitrate (Lr-115) were used. The procedure of data collection, dosimeters reading and the measurement results are shown in this work; this monitoring is the first one that is carried out in this city. The results are only indicators of the present radon rate, by the detectors type not is possible to discriminate the presence of the Radon-222 descendants. (Author)
International Nuclear Information System (INIS)
Arevalo B, C. A.; Lopez del R, H.; Davila R, J. I.; Mireles G, F.; Pinedo V, J. L.; Rios M, C.; Saucedo A, S. A.
2017-09-01
A study was carried out to determine the concentration of 222 Rn in samples of drinking water collected from different homes in the Zacatecas city, Mexico, whose main source of supply is groundwater. The 222 Rn radioactive gas is a product of the decay series of 238 U and is considered one of the main sources of natural radiation, since it contributes almost half of the radiation dose that a person will receive throughout his life. The 222 Rn originates in the rocks of the aquifers and dissolves in the water, which is later integrated into the distribution network of the public supply that supplies the entire population. Exposure to ionizing radiation that 222 Rn and its offspring emit can damage the DNA molecule, inducing the possible appearance of cancer. Has been demonstrated by various epidemiological studies carried out in uranium mines workers in different parts of the world, that this exposure increases the incidence of lung cancer, placing 222 Rn and their offspring as the second main cause of this type of cancer, after smoking habit. Using the technique of solvent extraction of 222 Rn in water and liquid scintillation spectrometry, water collected from 14 different households was sampled and analyzed. The average of the measured activity of 222 Rn was 2.09 Bq/L and the annual effective dose per water intake attributable to that concentration of 6.07 mSv/a. The concentration of 222 Rn in water and the annual effective dose are below 11 Bq/L and 50 mSv/a, such concentrations are the maximum limits established by the Unites States Environmental Protection Agency (US EPA) and the ICRP, respectively. The concentration of 222 Rn that is transferred from the water to the air inside a house was also calculated and the radiation dose that this concentration causes by inhalation, being 0.209 Bq/m 3 and 1,463 μ Sv a, respectively. (Author)
International Nuclear Information System (INIS)
Lee, Thomas K.C.; Yu, K.N.
2000-01-01
A bedroom was selected for detailed measurements on 220 Rn and 222 Rn concentrations and environmental parameters including CO 2 concentration, temperature and relative humidity. To simulate different sealing conditions, five conditions were artificially created in the sampling period of 25 consecutive days. It was concluded that natural ventilation is the most efficient way to lower the 222 Rn levels, while air conditioning is the next. Dehumidification provides only a marginal reduction of 222 Rn levels. The 220 Rn concentrations are not affected by natural ventilation, air conditioner or dehumidification, and were all around 10 Bq m -3 . There are no significant correlations between the 220 Rn and 222 Rn concentrations and environmental conditions such as CO 2 concentrations, temperature, relative humidity and pressure
Evaluation of groundwater discharge into small lakes based on the temporal distribution of radon-222
Dimova, N.T.; Burnett, W.C.
2011-01-01
In order to evaluate groundwater discharge into small lakes we constructed a model that is based on the budget of 222Rn (radon t1/2 5 3.8 d) as a tracer. The main assumptions in our model are that the lake's waters are wellmixed horizontally and vertically; the only significant 222Rn source is via groundwater discharge; and the only losses are due to decay and atmospheric evasion. In order to evaluate the groundwater-derived 222Rn flux, we monitored the 222Rn concentration in lake water over periods long enough (usually 1-3 d) to observe changes likely caused by variations in atmospheric exchange (primarily a function of wind speed and temperature). We then attempt to reproduce the observed record by accounting for decay and atmospheric losses and by estimating the total 222Rn input flux using an iterative approach. Our methodology was tested in two lakes in central Florida: one of which is thought to have significant groundwater inputs (Lake Haines) and another that is known not to have any groundwater inflows but requires daily groundwater augmentation from a deep aquifer (Round Lake). Model results were consistent with independent seepage meter data at both Lake Haines (positive seepage of ??? 1.6 ?? 104 m3 d-1 in Mar 2008) and at Round Lake (no net groundwater seepage). ?? 2011, by the American Society of Limnology and Oceanography, Inc.
78 FR 8684 - Twelfth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S
2013-02-06
... Committee 222, Inmarsat AMS(R)S AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S. DATES: The meeting will be held February 20, 2013, from 1:00 p.m.--4:00 p.m. ADDRESSES...
Fraudulent ID using face morphs: Experiments on human and automatic recognition.
Robertson, David J; Kramer, Robin S S; Burton, A Mike
2017-01-01
Matching unfamiliar faces is known to be difficult, and this can give an opportunity to those engaged in identity fraud. Here we examine a relatively new form of fraud, the use of photo-ID containing a graphical morph between two faces. Such a document may look sufficiently like two people to serve as ID for both. We present two experiments with human viewers, and a third with a smartphone face recognition system. In Experiment 1, viewers were asked to match pairs of faces, without being warned that one of the pair could be a morph. They very commonly accepted a morphed face as a match. However, in Experiment 2, following very short training on morph detection, their acceptance rate fell considerably. Nevertheless, there remained large individual differences in people's ability to detect a morph. In Experiment 3 we show that a smartphone makes errors at a similar rate to 'trained' human viewers-i.e. accepting a small number of morphs as genuine ID. We discuss these results in reference to the use of face photos for security.
VIPP-LD: A promising Video Feedback intervention program for parents with ID
Hodes, M.W.; Kef, S.; Meppelder, H.M.; Schuengel, C.
2012-01-01
Aim: Parenting support has been shown to be of benefit to parents with intellectual disabilities (ID) on several outcomes; however, effects on parent-child interaction in the form of sensitive responsiveness and positive inductive discipline are still under debate. This study tested the effects of an
International Nuclear Information System (INIS)
Meng, Qingzhen; Jia, Zhuqing; Wang, Weiping; Li, Binhong; Ma, Kangtao; Zhou, Chunyan
2011-01-01
Highlights: → Id1 was upregulated during the cardiac differentiation process of P19CL6 cells. → Id1 upregulated expression of cardiac specific genes Gata4, α-MHC and ISL1. → Id1 promoted proliferation of P19CL6 cells. → Overexpression of Id1 increased activity of TOP flash. → Wnt3a or LiCl treatment promoted Id1 expression in P19CL6 cells. -- Abstract: The inhibitor of DNA binding (Id) family of genes encodes negative regulators of basic helix-loop-helix transcription factors and has been implicated in such diverse cellular processes as differentiation, proliferation, apoptosis and migration. Id knockout mouse embryos display multiple cardiac defects but the specific role of Id1 in cardiac differentiation is unclear. In the present study, we investigated the function of Id1 in DMSO-induced P19CL6 cells, a widely-accepted cell model of cardiac differentiation. We found that Id1 was upregulated during the cardiac differentiation of P19CL6 cells. The expression of cardiac specific marker genes, Gata4, α-MHC and ISL1, was upregulated in P19CL6 cells stably transfected with Id1 (P19CL6-Id1) during cardiac differentiation. The overexpression of Id1 reduced the number of cells in G1 phase and increased the cell population in G2, M and S phases, while knockdown of Id1 increased the number of cells in G1 phase from 48.6 ± 2.51% to 62.2 ± 1.52% at day 0 of cardiac induction, and from 52.5 ± 3.41% to 63.7 ± 1.02% at day 3 after cardiac induction, indicating that Id1 promoted proliferation of P19CL6 cells. Luciferase assays showed that the activity of TOP flash was higher in P19CL6-Id1 cells than wildtype P19CL6 cells, while Id1 expression was also upregulated in P19CL6 cells treated with Wnt3a or LiCl. This indicates that there may be positive feedback between Id1 and Wnt signaling which plays an important role in cardiac differentiation.
Automatic spent fuel ID number reader (I)
International Nuclear Information System (INIS)
Tanabe, S.; Kawamoto, H.; Fujimaki, K.; Kobe, A.
1991-01-01
An effective and efficient technique has been developed for facilitating identification works of LWR spent fuel stored in large scale spent fuel storage pools of such as processing plants. Experience shows that there are often difficulties in the implementation of operator's nuclear material accountancy and control works as well as safeguards inspections conducted on spent fuel assemblies stored in deep water pool. This paper reports that the technique is realized as an automatic spent fuel ID number reader system installed on fuel handling machine. The ID number reader system consists of an optical sub-system and an image processing sub-system. Thousands of spent fuel assemblies stored in under water open racks in each storage pool could be identified within relatively short time (e.g. within several hours) by using this combination. Various performance tests were carried out on image processing sub-system in 1990 using TV images obtained from different types of spent fuel assemblies stored in various storage pools of PWR and BWR power stations
Continuous 222Rn measurements in water to perform a hydrograph separation
International Nuclear Information System (INIS)
Hofmann, H.; Kies, A.; Tosheva, Z.
2004-01-01
To get information about the different components of runoff before, during and after heavy rain events, micro catchments were selected to perform hydrograph separations using the radioactive noble gas 222 Rn and the stable isotope 18 O as natural occurring, conservative tracers. These tracers help to separate 'pre event', 'event', and 'post event' water in the total runoff. The selected micro basins are situated in the western part of Luxembourg and belong to the Attert River catchment area. Our investigations are a part of the project 'Cycleau' which is studying risk assessments in the Attert River area. By combining the databases great opportunities for comparison were realized. So far the catchment areas have been studied for two years. Continuous monitoring radon detectors were installed at selected measuring points, which were important for the different flow regimes. Along with the detectors precision thermometers, conductivity instruments, CO 2 -detectors, flow meter, v-notches, and automatic sampler for chemical analysis were set up. Besides the continuous measurements for 222 Rn, point samples were taken for liquid scintillation analysis (LCS). Single rain events will have been sampled and measured intensively for 222 Rn (LCS) and 18 O in two to three days field campaigns, for a comparison of the continuous method with the 18 O results and to strengthen our data by the end of march 2004. During the first year of this study instrument testing and evaluation was performed. Different radon monitor units were examined to find instruments that work best under field conditions. Additionally, separate units had to be constructed for a degassing of the solved gases out of the water, because the instruments for radon measuring were constructed for radon in air not for radon in water. A 'bubbler' had be developed that performs the degassing process. The techniques will be presented. Through stable results from our instrument developments, we observed different radon
Role of miR-222-3p in c-Src-Mediated Regulation of Osteoclastogenesis
Directory of Open Access Journals (Sweden)
Shinya Takigawa
2016-02-01
Full Text Available MicroRNAs (miRNAs are small non-coding RNAs that play a mostly post-transcriptional regulatory role in gene expression. Using RAW264.7 pre-osteoclast cells and genome-wide expression analysis, we identified a set of miRNAs that are involved in osteoclastogenesis. Based on in silico analysis, we specifically focused on miR-222-3p and evaluated its role in osteoclastogenesis. The results show that the inhibitor of miR-222-3p upregulated the mRNA levels of nuclear factor of activated T-cells, cytoplasmic 1 (NFATc1 and tartrate-resistant acid phosphatase (TRAP, while its mimicking agent downregulated their mRNA levels. Western blot analysis showed that its inhibitor increased the protein levels of TRAP and cathepsin K, while its mimicking agent decreased their levels. Genome-wide mRNA expression analysis in the presence and absence of receptor activator of nuclear factor κ-B ligand (RANKL predicted c-Src as a potential regulatory target of miR-222-3p. Live cell imaging using a fluorescence resonance energy transfer (FRET technique revealed that miR-222-3p acted as an inhibitor of c-Src activity, and a partial silencing of c-Src suppressed RANKL-induced expression of TRAP and cathepsin K, as well as the number of multi-nucleated osteoclasts and their pit formation. Collectively, the study herein demonstrates that miR-222-3p serves as an inhibitor of osteoclastogenesis and c-Src mediates its inhibition of cathepsin K and TRAP.
ACE Gene I/D Polymorphism and Obesity in 1,574 Patients with Type 2 Diabetes Mellitus.
Pan, Yan-Hong; Wang, Min; Huang, Yan-Mei; Wang, Ying-Hui; Chen, Yin-Ling; Geng, Li-Jun; Zhang, Xiao-Xi; Zhao, Hai-Lu
2016-01-01
Association between ACE gene I/D polymorphism and the risk of overweight/obesity remains controversial. We investigated the possible relationship between ACE gene I/D polymorphism and obesity in Chinese type 2 diabetes mellitus (T2DM) patients. In this study, obesity was defined as a body mass index (BMI) value ≥ 25 kg/m 2 and subjects were classified into 4 groups (lean, normal, overweight, and obese). PCR (polymerase chain reaction) was used to detect the ACE gene I/D polymorphism in T2DM patients. Metabolic measurements including blood glucose, lipid profile, and blood pressure were obtained. Frequencies of the ACE genotypes (DD, ID, and II) were not significant among the 4 groups of BMI-defined patients ( P = 0.679) while ACE II carriers showed higher systolic blood pressure (SBP) and pulse pressure (PP) (all P ACE gene I/D polymorphism with obesity is insignificant in Chinese patients with T2DM. SBP and PP might be higher in the ACE II carriers than in the DD and ID carriers.
DeID – A Data Sharing Tool for Neuroimaging Studies
Directory of Open Access Journals (Sweden)
Xuebo eSong
2015-09-01
Full Text Available Funding institutions and researchers increasingly expect that data will be shared to increase scientific integrity and provide other scientists with the opportunity to use the data with novel methods that may advance understanding in a particular field of study. In practice, sharing human subject data can be complicated because data must be de-identified prior to sharing. Moreover, integrating varied data types collected in a study can be challenging and time consuming. For example, sharing data from structural imaging studies of a complex disorder requires the integration of imaging, demographic and/or behavioral data in a way that no subject identifiers are included in the de-identified dataset and with new subject labels or identification values that cannot be tracked back to the original ones. We have developed a Java program that users can use to remove identifying information in neuroimaging datasets, while still maintaining the association among different data types from the same subject for further studies. This software provides a series of user interaction wizards to allow users to select data variables to be de-identified, implements functions for auditing and validation of de-identified data, and enables the user to share the de-identified data in a single compressed package through various communication protocols, such as FTPS and SFTP. DeID runs with Windows, Linux, and Mac operating systems and its open architecture allows it to be easily adapted to support a broader array of data types, with the goal of facilitating data sharing. DeID can be obtained at http://www.nitrc.org/projects/deid.
Directory of Open Access Journals (Sweden)
Batiot-Guilhe Christelle
2007-01-01
Full Text Available Carbon dioxide and 222Rn monitoring of the atmosphere of a Mediterranean sink hole - spring (SE France during two hydrological cycles (from September 2004 to September 2006 showed seasonal variations with very high concentrations during summer (greater than 6% and 20 000 Bq/m3, respectively. Gas dynamics in caves often show seasonal variations.Meteorological parameters (barometric pressure and temperature mainly, cave geometry and fracture networks control exchanges between the cavity and outside atmosphere. Carbon dioxide and 222Rn may have different sources (atmosphere, soil, bedrock, deep gas diffusion, in situ oxidation of organic matter and, in some caves, the key role of swift underground streams.For a CO2 origin, 13C measurements on water and gas samples taken into the cavity suggest a superficial origin. Radon-222 appears to be locally produced and transported by biogenic CO2. Further investigations will be carried out in order to study the relationship of gas-level variations with barometric pressure variations and piezometric level fluctuations within the aquifer.
Use of 222Rn-resistant techniques in new home construction
International Nuclear Information System (INIS)
Watson, J.E. Jr.; Cote, R.A.
1999-01-01
The objective of this project was to assess the status of the use of 222 Rn-resistant construction techniques in new home construction in the eight Zone 1 counties of North Carolina. Zone 1 counties have an average predicted indoor 222 Rn screening potential greater than 148 Bq m -3 (4 pCi L -1 ). To facilitate a response from builders, a brief survey form was designed and printed on the back of a self-addressed, postage-paid postcard. This survey form was mailed to 460 home builders in the Zone 1 counties. The response rate was 17%, which can be compared to the 4.9% response rate obtained in a national survey conducted by the National Association of Home Builders Research Center. In their survey, 62% of the responding builders reported that they had built some or many homes in 1996 using construction techniques to reduce the entry of radon into homes, but only 10% of the builders reported using these techniques for many homes. The National Association of Home Builders survey determined that, nationally, 30% of homes built in Zone 1 counties had 222 Rn venting features. There is the potential for bias in the results of their survey (as well as in the results of the National Association of Home Builders survey) since the response rates were low
Practical difficulties in determining 222Rn flux density in underground uranium mines
International Nuclear Information System (INIS)
Bigu, J.
1991-01-01
Radon-222 flux density, J, has been determined in a number of locations in an underground U mine. Measurements were conducted using the Two-Point Measurement (2PM) method, consisting of measuring the 222Rn concentration at two different points a distance apart within a given section of the mine. Several mine models were used for determining J by the above method. The 2PM method is sensitive to sources and sinks of 222Rn other than mine walls, as well as mining operations and mining activities of a diverse nature, and to local variations in airflow conditions. Because of this, J obtained by the 2PM method represents an 'apparent' flux density. Significant differences were found in the flux density calculated according to different mine models. In addition, J measurements using the flux 'can' method were also carried out in mine walls and compared with the values obtained by the 2PM method. Wide discrepancies between the two methods were found. The practical and theoretical difficulties in determining J are discussed
Average daily and annual courses of 222Rn concentration in some natural medium
International Nuclear Information System (INIS)
Holy, K.; Bohm, R.; Polaskova, A.; Stelina, J.; Sykora, I.; Hola, O.
1996-01-01
Simultaneous measurements of the 222 Rn concentration in the outdoor atmosphere of Bratislava and in the soil air over one year period have been made. Daily and seasonal variations of the 222 Rn concentration in both media were found. Some attributes of these variations as well as methods of measurements are presented in this work. (author). 17 refs., 6 figs
Sun, Feifei; He, Ning; Zhang, Keyong; Wu, Nan; Zhao, Jingbo; Qiu, Changchun
2018-01-01
Angiotensin converting enzyme (ACE) gene, as a strong candidate gene for essential hypertension(EH), has been extensively studied. In this study, we carried out a population-based case-control study to explore whether ACE gene I/D and A2350G polymorphisms could consider to be risk factors for EH. A total of 2040 subjeces were recruited from Chinese Han in this study, out of which 1010 were cases and 1030 were normotensive individuals. ACE gene A2350G and I/D polymorphisms were amplified by polymerase chain reaction (PCR) and A2350G polymorphism was detected after restriction enzyme digestion with BstuI. Besides, we choosed 10% samples randomly sequencing to verify the accuracy of results. Genotype and allele frequencies distribution of I/D and A2350G in EH and control groups were significantly different. After grouped by sex or age, there were still statistical significances for two polymorphisms. In dominant and recessive model of A2350G, we found significant differences between two groups, respectively. For ACE I/D polymorphism, we observed that the existence of dramatical difference in dominant model between two groups, while in recessive model, marginally significant difference was found. Among the four haplotypes composed by ACE gene A2350G and I/D, haplotype G-D reached the statistical significance in two groups, and exhibited to be a risk factor for the development of EH, whose P ACE gene A2350G and I/D polymorphisms were associated with increasing the risk of suffering from EH in the northernmost province of China individuals, with D allele and G allele individuals had a higher risk of EH(OR = 1.443, 95%CI = 1.273-1.636 and OR = 1.481, 95%CI = 1.303-1.684).
ID-1 mass storage system for mainframe by using FDDI network
International Nuclear Information System (INIS)
Morita, Y.; Fujii, H.; Inoue, E.; Kodama, H. Manabe, A.; Miyamoto, A.; Nomachi, M.; Watase, Y.; Yasu, Y.
1994-01-01
The authors have developed an ID-1 mass storage system as a distributed data server for Fujitsu mainframe computers. The system consists of a SONY ID-1 recorder DIR-1000, a tape robot system DMS-24 and a SCSI-II interface DFC-1500, which are connected to Spar Station 10 with an FDDI interface. The maximum speed of 7.5 Mbytes/sec is achieved for data transfer between Sparc Station 10 memory and DIR-1000 with a buffer size of 1 Mbytes. The system has been used successfully since last October to migrate more than 1 Tbytes data
Mulmule, Manoj D.; Shimmy, Shankar M.; Bambole, Vaishali; Jamdar, Sahayog N.; Rawat, K. P.; Sarma, K. S. S.
2017-02-01
Idli, a steam-cooked breakfast food item consumed in India, is famous as a staple food for its spongy texture and unique fermented taste. Idli preparation is a time consuming process; although instant Idli pre-mixes as powder or batter are available in the market, they do not have the distinctive taste and aroma similar to the Idli prepared at home. Hence ready-to-eat (RTE) form of this food is in demand. Therefore, an attempt was made to prepare RTE Idli bearing similar taste as home-cooked Idli with an extended shelf-life of up to two months at an ambient temperature using Electron Beam Irradiation (EBI) at dosages 2.5 kGy, 5 kGy and 7.5 kGy and combination processing comprised of EBI dosage at 2.5 kGy and thermal treatment (80 °C for 20 min). The treated Idli's were microbiologically and sensorially evaluated at storage periods of zero day, 14 days, 30 days and 60 days. Idli's irradiated at 7.5 kGy and subjected to combination processing at 2.5 kGy and thermal treatment were shelf-stable for 60 days. 2.5 kGy and 5 kGy radiation dosages alone were not sufficient to preserve Idli samples for more than 14 days. Undesirable change in sensory properties of Idli was observed at an EBI dosage of 7.5 kGy. Sensory properties of combination processed Idli's were found to undergo minor change over the storage period. The present work suggests that lowest radiation dosage in combination with thermal treatment could be useful to achieve the extended shelf-life without considerably impairing the organoleptic quality of Ready-to-Eat Idli.
International Nuclear Information System (INIS)
Hess, C.T.; Casparius, R.E.; Norton, S.A.; Brutsaert, W.F.
1980-01-01
We have used an inexpensive radon ( 222 Rn) measurement method using liquid scintillation counting to remeasure potable water from 10 sites near Raymond, Maine, to determine the accuracy and reproducibility of earlier measurements. Duplication or triplication of samples shows a high degree of reproducibility for the liquid scintillation method. A hypothesis emerged from analysis of the measured values of 222 Rn near Raymond, Maine, that high values (50,000 to 200,000 pCi/liter) are associated with granite. This was shown to be correct for several large areas of granite such as the Sebago, Lucern, Waldo, and Waldoboro granites. The presence of high 222 Rn concentrations in granite areas hundreds of kilometers from the Raymond area shows that the high 222 Rn levels in water are a statewide and perhaps a regional problem rather than a western Maine problem
Directory of Open Access Journals (Sweden)
Retha Arjadi
Full Text Available Depression screening and examination in Indonesia are highly challenging due to the disproportionately low number of mental health professionals in comparison to the Indonesian population. Self-report questionnaires on depression are cost-effective and time-efficient. The current study investigates the psychometric properties of the Indonesian Inventory of Depressive Symptomatology Self Report (IDS-SR.The participants were 904 Indonesians (aged 16-61; 50.2% female, recruited via an online survey using Qualtrics. Confirmatory factor analysis of the one-factor, three-factor, and four-factor model were explored. Convergent and divergent validity of the total score of the Indonesian IDS-SR and each factor were examined, as well as the Cronbach's Alpha reliability. In addition, an optimal cut-off score for the Indonesian IDS-SR was established using ROC curve analysis.The three-factor model of "cognitive/mood", "anxiety/arousal", and "sleep disturbance" was the best fit with the Indonesian IDS-SR data. Convergent and divergent validity were good. Cronbach's Alpha reliability was excellent for the total score, good for the factors "cognitive/mood" and "anxiety/arousal", but insufficient for the factor "sleep disturbance". The optimal cut-off score of the Indonesian IDS-SR was 14, with 87% sensitivity and 86% specificity.As a multifactorial instrument to measure depression that has good validity and reliability, the Indonesian IDS-SR can be used to assess depressive symptoms for the purpose of research and clinical practice. The optimal cut-off score of the Indonesian IDS-SR is in accordance with the internationally used cut-off score.
Screening of Lactobacillus plantarum isolated from fermented idli ...
African Journals Online (AJOL)
Probiotics are defined as live microorganisms which when administered in adequate amounts confer a health benefit on the host. The objective of this study was to screen eight potential probiotic Lactobacillus plantarum strains from fermented idli batter using in vitro assays such as bile tolerance, acid tolerance, transit ...
Directory of Open Access Journals (Sweden)
Daniela Annibali
Full Text Available The transcription factor ID2 is an important repressor of neural differentiation strongly implicated in nervous system cancers. MicroRNAs (miRNAs are increasingly involved in differentiation control and cancer development. Here we show that two miRNAs upregulated on differentiation of neuroblastoma cells--miR-9 and miR-103--restrain ID2 expression by directly targeting the coding sequence and 3' untranslated region of the ID2 encoding messenger RNA, respectively. Notably, the two miRNAs show an inverse correlation with ID2 during neuroblastoma cell differentiation induced by retinoic acid. Overexpression of miR-9 and miR-103 in neuroblastoma cells reduces proliferation and promotes differentiation, as it was shown to occur upon ID2 inhibition. Conversely, an ID2 mutant that cannot be targeted by either miRNA prevents retinoic acid-induced differentiation more efficient than wild-type ID2. These findings reveal a new regulatory module involving two microRNAs upregulated during neural differentiation that directly target expression of the key differentiation inhibitor ID2, suggesting that its alteration may be involved in neural cancer development.
222Rn and 14CO2 concentrations in the surface layer of the atmosphere
International Nuclear Information System (INIS)
Holy, K.; Chudy, M.; Sivo, A.; Richtarikova, M.; Boehm, R.; Polaskova, A.; Vojtyla, P.; Bosa, I.; Hola, O.
2002-01-01
Long-term monitoring of the Δ 14 C in the atmospheric near-ground CO 2 has been realized in Bratislava and Zlkovce, situated near the nuclear power plant Jaslovske Bohunice. Until 1993, the monthly mean Δ 14 C values showed a high variability. The annual means of Δ 14 C were about 30 per mille higher at Zlkovce than in highly industrialised Bratislava. An important change in the behaviour of the 14 C data has occurred since 1993. The records from both stations show the similar course, mainly due to the fact that there do not occur deep winter minima in Bratislava. This behaviour corresponds to the lower values of the total fossil fuel CO 2 emissions in the years after 1993 when compared to the previous years. At present, both sets of data show that the 14 C concentration is about 10% above the natural level. Since 1987 also the 222 Rn concentration in the surface layer of the atmosphere has been measured in Bratislava. These measurements provided an extensive set of the 222 Rn data characteristic for the inland environment with high level of atmospheric pollution. The seasonal and daily variations of the 222 Rn concentration were observed. The investigation of the relation between the monthly mean diurnal courses of the 222 Rn concentration and the atmospheric stability proved a high correlation between them. The 222 Rn data were used to interpret the anomalous Δ 14 C values in the surface layer of the atmosphere. (author)
Energy Technology Data Exchange (ETDEWEB)
Sexsmith, K.S.
1996-12-31
This study examines hydrological, geological and geochemical controls on {sup 222}Rn variability in groundwater in the Front Range of Colorado. Specific objectives of the study are: (1) to determine if there are any correlations or spatial relationships between {sup 222}Rn and the geological, geochemical and hydrogeological data; and (2) to determine whether it is geochemically reasonable for observed {sup 222}Rn levels to be the result of U and {sup 226}Ra accumulation by fracture filling minerals. Domestic-water wells were sampled and tested to determine the local aquifer characteristics and aqueous geochemistry. A multivariate and staged approach was used in the data analyses. Analysis of variance tests were used to test for relationships between {sup 222}Rn and the lithology of the study wells. The effects of rock-type were then removed from the chemical and hydrological variables by subtracting the mean value for each rock-type from each of the measured values within that rock-type (a residual transformation). Linear and linear multiple regression techniques were used to test for expected relationships between residual {sup 222}Rn levels and these variables, and stepwise linear regressions were used to test for any unforeseen multivariate relationships in the data. Correlograms, distance-weighted average and inverse-distance-weighted average predictions were used to look for spatial relationships in the data.
Desprez, Pierre-Yves; Campisi, Judith
2014-08-19
A method for treatment of breast cancer and other types of cancer. The method comprises targeting and modulating Id-1 gene expression, if any, for the Id-1 gene, or gene products in breast or other epithelial cancers in a patient by delivering products that modulate Id-1 gene expression. When expressed, Id-1 gene is a prognostic indicator that cancer cells are invasive and metastatic.
Energy Technology Data Exchange (ETDEWEB)
Santos, M.L.O.; Farias, E.E.G.; Amaral, D.S.; Hazin, C.A.; França, E.J., E-mail: emersonemiliano@yahoo.com.br [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Souza Neto, J.A. [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil)
2017-07-01
Liquid Scintillation Spectrometry (LSC) is one of the most used techniques for quantification of alpha and beta particles in aqueous medium, being used to determine the concentration of Radon-222 in water. The counting efficiency of this methodology depends on the good extraction of the radionuclide and the definition of the most appropriate scintillator cocktail. The study aimed to construct a growth curve of Rn-222 activity in aqueous medium and to test the counting efficiency of this method. For this, samples containing 12 mL Ra-226 standard solution and 12 mL scintillator cocktail were prepared in triplicate. The cocktail was prepared using 1 L of p-xylene, 7 g of 2,5-diphenyloxazole (PPO) and 0.75 g of 1,4-bis- [2- (5-diphenyloxazol)] benzene (POPOP). Subsequently, the containers were sealed and agitated for five minutes, seeking an efficient transfer of the radon to the organic phase. Analytical white was prepared using deionized water and the scintillation cocktail. After 3 hours, the concentrations of this radionuclide were determined by the LSC technique, using QUANTULUS 1220 equipment, Perkin Elmer. Analyzes were performed on nine different days, making a total of 21 days between the first and last analysis. The results obtained allowed to make an analytical curve with good fit (r{sup 2} = 0.98), which could be used as a calibration factor for this method. The method used showed a counting efficiency of 78%. A suitable analytical protocol for determination of Rn-222 in water samples was established.
Directory of Open Access Journals (Sweden)
Chmaisse Hania
2009-01-01
Full Text Available Type-2 diabetes mellitus (T2DM is a chronic disorder characterized by a varying range of predominant insulin resistance with relative insulin deficiency, to predominant insulin secretory defect with or without insulin resistance. Familial clustering as well as epidemiological studies has shown that genetic factors play a role in the development and progression of the disease. Among the genetic factors found to be associated with development of T2DM is the angiotensin-I converting enzyme (ACE gene, which is located on chromosome 17q23. This study was conducted to study the association between ACE gene insertion/deletion (I/D polymorphism and T2DM in a Lebanese diabetic cohort. Fifty-one patients with T2DM and 40 control subjects from different parts of Lebanon underwent genotyping for the ACE I/D, which was performed by PCR using specific primers. Chi-square and analysis of variance (ANOVA were used for asso-ciation studies and to assess the differences in the values among the groups. The distribution of the genotypes in the patients was as follows: 15/51 (29.4% were homozygous for deletion allele (DD genotype, 24/51 (47.1% were heterozygous (ID genotype, and 12/51 (23.5% were homo-zygous for insertion allele (II genotype. Among the control subjects, 16/40 (40% were homo-zygous for deletion (DD genotype, 13/40 (32.5% were heterozygous (ID genotype, and 11/40 (27.5% were homozygous for insertion (II genotype. The prevalence of the D-allele in T2DM patients (52.9% was not significantly different from that in the controls (56.3%. Thus, ACE I/D dimorphism cannot be considered a risk factor for T2DM in the Lebanese population.
Mazza, Maria; Guglielmetti, Chiara; Ingravalle, Francesco; Brusadore, Sonia; Langeveld, Jan P M; Ekateriniadou, Loukia V; Andréoletti, Olivier; Casalone, Cristina; Acutis, Pier Luigi
2017-07-01
The presence of lysine (K) at codon 222 has been associated with resistance to classical scrapie in goats, but few scrapie cases have been identified in 222Q/K animals. To investigate the contribution of the 222K variant to PrPres formation in natural and experimental Q/K scrapie cases, we applied an immunoblotting method based on the use of two different monoclonal antibodies, F99/97.6.1 and SAF84, chosen for their different affinities to 222K and 222Q PrP variants. Our finding that PrPres seems to be formed nearly totally by the 222Q variant provides evidence that the 222K PrP variant confers resistance to conversion to PrPres formation and reinforces the view that this mutation has a protective role against classical scrapie in goats.
48 CFR 52.222-50 - Combating Trafficking in Persons.
2010-10-01
....222-50 Combating Trafficking in Persons. As prescribed in 22.1705(a), insert the following clause...: ________ ________ ________ ________ ________ ________ [Contracting Officer shall insert title of directive/notice; indicate the document is attached or provide source (such as website link) for obtaining document; and, indicate the contract performance location...
Zhu, Ming; Zhang, Jie; Nie, Shaofa; Yan, Weirong
2012-09-01
There have been many studies concerning the associations of angiotensin-converting enzyme (ACE) I/D, angiotensinogen (AGT) M235T polymorphisms with pregnancy induced hypertension (PIH) among Chinese populations. However, the results were inconsistent, prompting the necessity of meta-analysis. Studies published in English and Chinese were mainly searched in EMbase, PubMed and CBM up to January 2012. Twenty-three studies with 3,551 subjects for ACE I/D and seven studies with 1,296 subjects for AGT M235T were included. Significant associations were found between ACE I/D and PIH under dominant, recessive and allelic models. A separate analysis confined to preeclampsia suggested that ACE I/D was associated with preeclampsia under recessive model and allelic model, but not dominant model. Stratified analyses were conducted as meta-regression analysis indicated that the sample size of case group was a significant source of heterogeneity, which suggested no significant association between ACE I/D and PIH in the subgroup of more than 100 cases. Associations were found between AGT M235T and PIH under dominant genetic model (OR = 1.59; 95 %CI: 1.04-2.42), recessive genetic model (OR = 1.60; 95 %CI: 1.07-2.40), and allelic model (OR = 1.40; 95 %CI: 1.17-1.68). No publication bias was found in either meta-analysis. The present meta-analysis suggested significant associations between ACE I/D, AGT M235T and PIH in Chinese populations. However, no significant association was found between ACE I/D and PIH in the subgroup of more than 100 cases. Studies with larger sample sizes are necessary to investigate the associations between gene polymorphisms and PIH in Chinese populations.
Gas exchange in the Pee Dee River based on 222Rn evasion
International Nuclear Information System (INIS)
Moore, W.S.; Elsinger, R.J.
1983-01-01
Excess 222 Rn concentrations decrease downstream in the fresh water section of the Pee Dee River. Ground water is the primary source of the excess 222 Rn to the River. Using the radon concentration gradients determined during four sampling periods, gas exchange rates based on the stagnant film model are calculated. Stagnant film thicknesses range from 19 μm to 48 μm and mass transfer coefficients range from 2.1 m/d to 4.1 m/d
Pinti, Daniele L; Retailleau, Sophie; Barnetche, Diogo; Moreira, Floriane; Moritz, Anja M; Larocque, Marie; Gélinas, Yves; Lefebvre, René; Hélie, Jean-François; Valadez, Arisai
2014-10-01
One hundred ninety-eight groundwater wells were sampled to measure the (222)Rn activity in the region between Montreal and Quebec City, eastern Canada. The aim of this study was to relate the spatial distribution of (222)Rn activity to the geology and the hydrogeology of the study area and to estimate the potential health risks associated with (222)Rn in the most populated area of the Province of Quebec. Most of the groundwater samples show low (222)Rn activities with a median value of 8.6 Bq/L. Ninety percent of samples show (222)Rn activity lower than 100 Bq/L, the exposure limit in groundwater recommended by the World Health Organization. A few higher (222)Rn activities (up to 310 Bq/L) have been measured in wells from the Appalachian Mountains and from the magmatic intrusion of Mont-Saint-Hilaire, known for its high level of indoor radon. The spatial distribution of (222)Rn activity seems to be related mainly to lithology differences between U-richer metasediments of the Appalachian Mountains and magmatic intrusions and the carbonaceous silty shales of the St. Lawrence Platform. Radon is slightly enriched in sodium-chlorine waters that evolved at contact with clay-rich formations. (226)Ra, the parent element of (222)Rn could be easily adsorbed on clays, creating a favorable environment for the production and release of (222)Rn into groundwater. The contribution of groundwater radon to indoor radon or by ingestion is minimal except for specific areas near Mont-Saint-Hilaire or in the Appalachian Mountains where this contribution could reach 45% of the total radioactive annual dose. Copyright © 2014 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Correa, Janine Nicolosi; Paschuk, Sergei Anatolyevich; Kappke, Jaqueline; Claro, Flavia Del; Perna, Allan Felipe Nunes; Reque, Marilson, E-mail: janine_nicolosi@hotmail.com [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy; Schelin, Hugo Reuters [Instituto de Pesquisa Pele Pequeno Principe (IPPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita Oliveira [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2015-04-15
This research objective was to assess the level of randon-222 concentration in well water of the metropolitan region of Curitiba, Parana. Current work presents the results of indoor {sup 222}Rn activity ground water samples from artesian wells from aquifers of the region. The studies of radon activity in water were performed using the radon detector AlphaGUARD. The calculations of initial radon activity in water were done considering the {sup 222}Rn decay correction as well as equilibrium level of {sup 222}Rn and {sup 226}Ra observed after 30 days of measurements. Obtained results show that about 70% of measured activity levels of {sup 222}Rn are higher than the recommended value of 11.1 Bq.L{sup -1}, which represent the risk for the human health associated with this radionuclide. The case study showed that previous measurements of radon are recommended for a construction project is implemented. In this case, it is observed that the radon concentrations decrease about 56% in the first water tank and 83% in the second water tank over the well. This fact shows that the actions for mitigation of radon are viable and do not require major modifications to the usual systems of construction. (author)
Drug evaluation: FavId, a patient-specific idiotypic vaccine for non-Hodgkin's lymphoma.
Czech Academy of Sciences Publication Activity Database
Reiniš, Milan
2007-01-01
Roč. 9, č. 3 (2007), s. 291-298 ISSN 1464-8431 Institutional research plan: CEZ:AV0Z50520514 Keywords : non-Hodgkin's lymphoma * lymphoma vaccine FavId Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.526, year: 2007
20 CFR 222.17 - “Child in care” when child of the employee is living with the claimant.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false âChild in careâ when child of the employee is living with the claimant. 222.17 Section 222.17 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222...
50 CFR 222.103 - Federal/state cooperation in the conservation of endangered and threatened species.
2010-10-01
... Federal regulations for grant administration and cost accounting principles. (3)(i) The payment of the... conservation of endangered and threatened species. 222.103 Section 222.103 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE...
dall'Acqua, Luisa
2011-08-01
The teleology of our research is to propose a solution to the request of "innovative, creative teaching", proposing a methodology to educate creative Students in a society characterized by multiple reference points and hyper dynamic knowledge, continuously subject to reviews and discussions. We apply a multi-prospective Instructional Design Model (PENTHA ID Model), defined and developed by our research group, which adopts a hybrid pedagogical approach, consisting of elements of didactical connectivism intertwined with aspects of social constructivism and enactivism. The contribution proposes an e-course structure and approach, applying the theoretical design principles of the above mentioned ID Model, describing methods, techniques, technologies and assessment criteria for the definition of lesson modes in an e-course.
International Nuclear Information System (INIS)
Sharman, G.
1992-01-01
Rn-222 enters dwellings as a component of soil gas drawn from the soil by mass flow driven by the pressure difference between the house and soil beneath. In a site on Northampton Sand Ironstone (Aalenian), a preferred path of emanation (hotspot) was found. A difference of 63 Bq L -1 Rn-222 was recorded in July between this point and another 3 m away. Rn-222 in this hotspot shows 12% less variation annually than the surrounding rock. During winter, Rn-222 values within 1.6 m of the house were 44% lower than those at more than 4 m away. Rn-222 showed a 99.5% negative correlation with wind run, showing that on this soil wind pressure can significantly reduce radon in the soil at 500 mm depth. Rn-220 in soil gas correlated positively at the 99.5% level with grass and air temperatures. Rn-220 was not associated with the hotspot. (Author)
Variations in radon-222 in soil and ground water at the Nevada Test Site
International Nuclear Information System (INIS)
Wollenberg, H.; Straume, T.; Smith, A.; King, C.Y.
1977-01-01
To help evaluate the applicability of variations of radon-222 in ground water and soil gas as a possible earthquake predictor, measurements were conducted in conjunction with underground explosions at the Nevada Test Site (NTS). Radon fluctuations in ground water have been observed during a sequence of aftershocks following the Oroville, California earthquake of 1 August 1975. The NTS measurements were designed to show if these fluctuations were in response to ground shaking; if not, they could be attributed to changes in earth strain prior to the aftershocks. Well waters were periodically sampled and soil-gas 222 Rn monitored prior to and following seven underground explosions of varying strength and distance from sampling and detector locations. Soil-gas 222 Rn contents were measured by the alpha-track method; well water 222 Rn by gamma-ray spectrometry. There was no clearly identifiable correlation between well-water radon fluctuations and individual underground tests. One prominent variation in soil-gas radon corresponded to ground shaking from a pair of underground tests in alluvium; otherwise, there was no apparent correlation between radon emanation and other explosions. Markedly lower soil-gas radon contents following the tests were probably caused by consolidation of alluvium in response to ground shaking
The ubiquitin ligase ASB4 promotes trophoblast differentiation through the degradation of ID2.
Directory of Open Access Journals (Sweden)
W H Davin Townley-Tilson
Full Text Available Vascularization of the placenta is a critical developmental process that ensures fetal viability. Although the vascular health of the placenta affects both maternal and fetal well being, relatively little is known about the early stages of placental vascular development. The ubiquitin ligase Ankyrin repeat, SOCS box-containing 4 (ASB4 promotes embryonic stem cell differentiation to vascular lineages and is highly expressed early in placental development. The transcriptional regulator Inhibitor of DNA binding 2 (ID2 negatively regulates vascular differentiation during development and is a target of many ubiquitin ligases. Due to their overlapping spatiotemporal expression pattern in the placenta and contrasting effects on vascular differentiation, we investigated whether ASB4 regulates ID2 through its ligase activity in the placenta and whether this activity mediates vascular differentiation. In mouse placentas, ASB4 expression is restricted to a subset of cells that express both stem cell and endothelial markers. Placentas that lack Asb4 display immature vascular patterning and retain expression of placental progenitor markers, including ID2 expression. Using JAR placental cells, we determined that ASB4 ubiquitinates and represses ID2 expression in a proteasome-dependent fashion. Expression of ASB4 in JAR cells and primary isolated trophoblast stem cells promotes the expression of differentiation markers. In functional endothelial co-culture assays, JAR cells ectopically expressing ASB4 increased endothelial cell turnover and stabilized endothelial tube formation, both of which are hallmarks of vascular differentiation within the placenta. Co-transfection of a degradation-resistant Id2 mutant with Asb4 inhibits both differentiation and functional responses. Lastly, deletion of Asb4 in mice induces a pathology that phenocopies human pre-eclampsia, including hypertension and proteinuria in late-stage pregnant females. These results indicate that
Dynamics of radon-222 near below ground surface
International Nuclear Information System (INIS)
Fukui, Masami; Katsurayama, Kousuke; Nishimura, Susumu.
1986-01-01
The concentrations and variation of 222 Rn were investigated both in unconfined groundwater and in the aerated zone to obtain information as to the behavior of Rn close to ground surface. The Rn concentrations in unconfined groundwater near the surface were depletive by the extent of about 50 % compared with that of lower part in a borehole, then the continuous extraction of groundwater causes pronounced increase of the concentration. The method, which monitors continuously the Rn concentration in such surroundings, was developed, where the unconfined groundwater extracted was injected into another borehole and sprayed gas was measured using an ionization chamber. The read-out values of this system well followed the variation of concentrations caused by the meteorological parameter, especially infiltrating water. The increase of 222 Rn concentration in the aerated zone above the water level was clearly observed following the ascendant of groundwater level caused by the infiltrating water, whereas the change of concentration in soil air just below the ground surface obeyed mainly to the wetness of soil and unconfined groundwater level rather than atmospheric pressure. (author)
20 CFR 222.36 - Relationship as grandchild or stepgrandchild.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as grandchild or stepgrandchild... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.36 Relationship as grandchild or stepgrandchild. A claimant will have the relationship of grandchild or stepgrandchild of an employee, or the...
Kinetics of ingested 222Rn in humans determined from measurements with 133Xe. Project summary report
International Nuclear Information System (INIS)
Correia, J.A.; Weise, S.B.; Callahan, R.J.; Strauss, H.W.
1987-12-01
The problem of naturally occurring 222-radon contamination has received a great deal of public and scientific attention over the past several years, and has become a major public health issue worldwide. The purpose of the work reported in this document was to provide information about the behavior of ingested 222-radon in the digestive system and other organs of the human body. 133-Xenon, an element which behaves in the same manner as 222-radon in tissue and differs only in tissue solubility, was used in studies on human subjects. The tissue solubility differences were accounted for by using the tissue/blood partition coefficients of the two gases
Eisenman, Laura T.; Farley-Ripple, Elizabeth; Culnane, Mary; Freedman, Brian
2013-01-01
Social networks of persons with intellectual disabilities (ID) have been characterized as smaller and less diverse than those of typical peers. Advocates have focused on strengthening those social networks by expanding circles of social support, protection, and friendship. As young adults with ID experience increasing levels of community…
Angiotensin-converting enzyme I/D polymorphism in chronic obstructive pulmonary disease
Directory of Open Access Journals (Sweden)
Pabst S
2009-12-01
Full Text Available Abstract Study objective The etiology of chronic obstructive lung disease (COPD is unclear. It is supposed to be the product of an exogenous antigenic stimulus, such as tobacco smoke, and an endogenous genetic susceptibility. The angiotensin-converting enzyme (ACE gene contains a polymorphism based on the presence (insertion [I] or absence (deletion [D] of a 287-bp nonsense domain, resulting in three different genotypes (II, ID and DD. The aim of the study was to find out whether the ACE gene polymorphism can determine the course of COPD. Patients and design We genotyped 152 Caucasian patients with COPD and 158 healthy controls for the ACE (I/D polymorphism. We divided the COPD group into one group of 64 patients with a stable course of disease, defined as less than three hospitalizations over the last three years due to COPD, and another group of 88 patients with an instable course with more than three hospitalizations. Results The I-allele was significantly associated with an increased risk for COPD in a dominant model (OR 1.67 (95% CI 1.00 to 2.78, p = 0.048, but not in a recessive or co-dominant model. Moreover, the I-allele of ACE (I/D was significantly increased in patients with a stable course of COPD (p = 0.012 compared with controls. In a dominant model (II/ID v DD we found an even stronger association between the I-allele and a stable course of COPD (OR 3.24 (95% CI 1.44 to 7.31, p = 0.003. Conclusion These data suggest that the presence of an ACE I-allele determines a stable course of COPD.
2013-01-04
... Services Group, Inc., Commercial/Actuarial/ Information Delivery Services (IDS)/Corporate & Financial... Assistance (TAA) applicable to workers and former workers of Hartford Financial Services Group, Inc., Commercial/ Actuarial/Information Delivery Services (IDS)/Corporate & Financial Reporting group, Hartford...
Using {sup 222}Rn as a tracer of geodynamical processes in underground environments
Energy Technology Data Exchange (ETDEWEB)
Valladares, D.L. [GEA, Instituto de Matemática Aplicada San Luis (IMASL), Universidad Nacional de San Luis, Consejo Nacional de Investigaciones Científicas y Técnicas, Ej. de los Andes 950, D5700HHW San Luis (Argentina); Silva, A.A.R. da [Instituto de Física, Universidade de São Paulo, P.O.Box 66318, 05314-970, São Paulo, SP (Brazil); Serviço Especializado em Engenharia de Segurança e Medicina do Trabalho, Departamento de Saúde, Universidade de São Paulo, Rua da Reitoria, 109, 05508-900, São Paulo, SP (Brazil); Lacerda, T. [Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/n" o, Gragoatá, 24210-340, Niterói, RJ (Brazil); Anjos, R.M., E-mail: meigikos@if.uff.br [Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/n" o, Gragoatá, 24210-340, Niterói, RJ (Brazil); Rizzotto, M.; Velasco, H.; Rosas, J.P. de [GEA, Instituto de Matemática Aplicada San Luis (IMASL), Universidad Nacional de San Luis, Consejo Nacional de Investigaciones Científicas y Técnicas, Ej. de los Andes 950, D5700HHW San Luis (Argentina); Tognelli, G. [Departamento de Geología, Universidad Nacional de San Luis, Ej. de los Andes 950, D5700HHW San Luis (Argentina); and others
2014-01-01
Radon levels in two old mines in San Luis, Argentina, were measured and analyzed, with the aim to assess the potential use of this radioactive noble gas as a tracer of geological processes in underground environments. La Carolina gold mine and Los Cóndores tungsten mine are today used as tourism mines. CR-39 nuclear track detectors were used for this purpose. Measurements were performed during both winter and summer seasons. The findings show that in these environments, significant radon concentrations are subject to large seasonal fluctuations, due to the strong dependence on natural ventilation with the outside temperature variations. For both mines, higher concentration values of {sup 222}Rn were observed in summer than in winter; with an extreme ratio of 2.5 times between summer and winter seasons for Los Cóndores mine. The pattern of radon transport inside La Carolina mine revealed, contrary to what was believed, that this mine behaves as a system with two entrances located at different levels. However, this feature can only be observed in the winter season, when there is a marked difference between the inside and outside temperatures of the mine. In the case of Los Cóndores mine, the radon concentration pattern distribution is principally established by air current due to chimney-effect in summer and winter seasons. In both cases, the analyses of radon pattern distribution appear as a good method to trace air currents, and then localize unknown ducts, fissures or secondary tunnels in subterranean environments. - Highlights: • {sup 222}Rn levels in two old mines in San Luis, Argentina • CR-39 nuclear track detectors were used for this purpose • higher concentration values of {sup 222}Rn were observed in summer than in winter • radon pattern distribution appear as a good method to trace air currents • it localizes unknown ducts, fissures or secondary tunnels in subterranean environments.
Ko, Jupil; Rosen, Adam B; Brown, Cathleen N
2017-09-12
To cross-culturally adapt the Identification Functional Ankle Instability for use with Korean-speaking participants. The English version of the IdFAI was cross-culturally adapted into Korean based on the guidelines. The psychometric properties in the Korean version of the IdFAI were measured for test-retest reliability, internal consistency, criterion-related validity, discriminative validity, and measurement error 181 native Korean-speakers. Intra-class correlation coefficients (ICC 2,1 ) between the English and Korean versions of the IdFAI for test-retest reliability was 0.98 (standard error of measurement = 1.41). The Cronbach's alpha coefficient was 0.89 for the Korean versions of IdFAI. The Korean versions of the IdFAI had a strong correlation with the SF-36 (r s = -0.69, p 10 was the optimal cutoff score to distinguish between the group memberships. The minimally detectable change of the Korean versions of the IdFAI score was 3.91. The Korean versions of the IdFAI have shown to be an excellent, reliable, and valid instrument. The Korean versions of the IdFAI can be utilized to assess the presence of Chronic Ankle Instability by researchers and clinicians working among Korean-speaking populations. Implications for rehabilitation The high recurrence rate of sprains may result into Chronic Ankle Instability (CAI). The Identification of Functional Ankle Instability Tool (IdFAI) has been validated and recommended to identify patients with Chronic Ankle Instability (CAI). The Korean version of the Identification of Functional Ankle Instability Tool (IdFAI) may be also recommend to researchers and clinicians for assessing the presence of Chronic Ankle Instability (CAI) in Korean-speaking population.
Tracing submarine groundwater discharge in the NE Gulf of Mexico by 222Rn
International Nuclear Information System (INIS)
Young, J.E.; Burnett, W.C.; Chanton, J.P.; Cable, P.H.; Corbett, D.R.
1993-01-01
Inputs of freshwater and dissolved components to the ocean by submarine groundwater discharge (SGD) have been largely neglected as source functions for biogeochemical budgets. In order to locate and quantify groundwater inputs, a tracing technique has been developed using 222 Rn, a member of the natural 238 U decay-series. Because 222 Rn has a short half-life (t 1/2 = 3.84 days), is an inert gas, is relatively easy to measure at low concentrations, and has concentrations in groundwater several orders of magnitude greater than seawater, it should make an excellent tracer. Excess 222 Rn concentrations far above ''normal'' ocean values were found in the bottom waters of the northeastern Gulf of Mexico, which suggests this region has significant groundwater discharge. After measuring high water column inventories of excess 222 Rn in this region, an advection/diffusion model was applied to evaluate potential benthic sources of radon. The model is designed to account for sediment diffusion of radon and includes a groundwater term for advective flow into the overlying water. Flow rates and concentrations are adjusted in the model to balance the large difference in the measured water column inventories and the inventory predicted by sediment diffusion alone. The vertical diffusive/advective transport determines the shape of the concentration gradient and fluxes at the sediment-water interface are calculate based on these terms. The authors work shows that SGD could account for as much as 95% of the radon inventory in these offshore waters
Le traitement de l’idéologie dans la sociologie de Luc Boltanski
Directory of Open Access Journals (Sweden)
David Vrydaghs
2006-10-01
Full Text Available IntroductionLe concept d’idéologie apparaît dans la sociologie de Luc Boltanski à partir du Nouvel Esprit du capitalisme, publié en 1999. L’auteur y revient dans La Condition fœtale, paru en 2004. On aurait donc pu se contenter de ces ouvrages pour examiner le traitement réservé à l’idéologie dans la sociologie de Luc Boltanski. On préférera pourtant revenir aux travaux antérieurs du sociologue, et ce pour deux raisons.D’abord parce que le concept d’idéologie tel qu’il est employé dans Le Nou...
Evaluation of the Micro-ID system for the identification of Yersinia pestis.
Harrison, D N; Williams, J E
1985-01-01
One hundred isolates of Yersinia pestis identified by conventional means were tested by the Micro-ID system to assess its reliability for distinguishing Y. pestis from other members of the family Enterobacteriaceae. The Micro-ID system gave Y. pestis as a choice for the identification of 89 of these cultures, although not always as the first choice. Most nitrate-negative strains of Y. pestis keyed out with Yersinia pseudotuberculosis as first choice and Y. pestis as second or fourth choice.
Group-ID based RFID Mutual Authentication
Directory of Open Access Journals (Sweden)
LEE, Y.
2013-11-01
Full Text Available For passive type RFID tags, EPCglobal Class 1 Generation-2 Revision is used widely as a de facto standard. As it was designed for low cost, it is quite vulnerable to security issues, such as privacy concerns. This paper presents a new RFID mutual authentication protocol, which is designed to be configured on EPC Gen2 platform and to meet various security requirements while providing efficiency using PRNG (Pseudo Random Number Generator. Group-ID is used to minimize the authentication time. Security analysis of the proposed protocol is discussed.
48 CFR 52.222-8 - Payrolls and Basic Records.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Payrolls and Basic Records....222-8 Payrolls and Basic Records. As prescribed in 22.407(a), insert the following clause: Payment for Overtime Premiums (JUN 2010) (a) Payrolls and basic records relating thereto shall be maintained by the...
Hanford Facility Dangerous Waste Permit Application, 222-S Laboratory Complex
International Nuclear Information System (INIS)
WILLIAMS, J.F.
2000-01-01
The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating treatment, storage, and/or disposal units, such as the 222-S Laboratory Complex (this document, DOE/RL-91-27). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1987 and 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needs defined by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the 222-S Laboratory Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this 222-S Laboratory Complex permit application documentation is current as of August 2000
Specificity of the Spectrophotometry for Detecting Aminopolyether K2.2.2 in 18F-FDG
Directory of Open Access Journals (Sweden)
ZHANG Jin-ming
2015-11-01
Full Text Available 氨基聚醚(K2.2.2含量是18F-FDG质控中的关键指标,比较了两种常用测量K2.2.2方法的专属性。分别采用分光光度计和半定量TLC 碘显色法测量了14个样品,其中9个阴性样品、2个阳性样品和3个供试品,并与LC-MS/MS测量对比。结果显示:9个阴性样品经分光光度计法测量均为阳性,K2.2.2的测量结果在6.7~470.0 μg/mL;2个阳性样品结果偏高(53,73 μg/mL),3个供试品的K2.2.2含量在14.3~19.2 μg/mL;半定量TLC 碘显色法测量9个阴性样品结果为阴性,2个阳性样品半定量结果与实际一致,3个供试品的K2.2.2含量低于10 μg/mL;LC-MS/MS法测量的14个样品的结果与半定量TLC 碘显色法的结果一致。以上结果表明,半定量TLC 碘显色法测量K2.2.2的专属性较好,适用于测量18F-FDG溶液中K2.2.2含量。
222-S Laboratory Quality Assurance Plan. Revision 1
International Nuclear Information System (INIS)
Meznarich, H.K.
1995-01-01
This Quality Assurance Plan provides,quality assurance (QA) guidance, regulatory QA requirements (e.g., 10 CFR 830.120), and quality control (QC) specifications for analytical service. This document follows the U.S Department of Energy (DOE) issued Hanford Analytical Services Quality Assurance Plan (HASQAP). In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. Quality assurance elements required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAMS-004) and Interim Guidelines and Specifications for Preparing Quality Assurance Project Plans (QAMS-005) from the US Environmental Protection Agency (EPA) are covered throughout this document. A quality assurance index is provided in the Appendix A. This document also provides and/or identifies the procedural information that governs laboratory operations. The personnel of the 222-S Laboratory and the Standards Laboratory including managers, analysts, QA/QC staff, auditors, and support staff shall use this document as guidance and instructions for their operational and quality assurance activities. Other organizations that conduct activities described in this document for the 222-S Laboratory shall follow this QA/QC document
Angiotensin-I converting enzyme gene and I/D polymorphism ...
Indian Academy of Sciences (India)
Angiotensin-I converting enzyme gene and I/D polymorphism distribution in the Greek population and a comparison with other European populations. Sekerli Eleni Katsanidis Dimitrios Papadopoulou Vaya Makedou Areti Vavatsi Norma Gatzola Magdalini. Research Note Volume 87 Issue 1 April 2008 pp 91-93 ...
The correlation between exhalation from rocks and indoor concentration of 222Rn in the Sydney area
International Nuclear Information System (INIS)
MCKenzie, D.R.; Lenzen, M.; Solomon, S.B.
2001-01-01
The results of a survey of indoor 222 Rn concentrations of 350 dwellings in the Sydney area are combined with measurements of 222 Rn exhalation rates of principal rock types in the survey area. A linear regression is predicted which yields a positive regression coefficient of b=2.4±0.3, a constant of a=3.4±0.5, and a correlation coefficient of R 2 =0.15. This correlation was found to be highly significant by using three different statistical tests. The ratio of the indoor 222 Rn concentrations in dwellings built on the two dominant rock types, the Wianamatta Shale and the Hawkesbury Sandstone, was found to be about 1.6. Copyright (2001) Australasian Radiation Protection Society Inc
Development of the PARA-ID Program to Simulate a Unified Viscoplasticity Behaviour
International Nuclear Information System (INIS)
Koo, Gyeong Hoi
2009-01-01
The PARA-ID code is a general purpose computer simulation program for a nonlinear cyclic material behavior with and without viscous effects, which can simulate various constitutive models such as - Prager Model - Armstrong and Frederick Model - Chaboche 3-decomposed rule Model - Chaboche 4-decomposed rule Model - Ohno and Wang Model - Unified Chaboche Viscoplastic Model In this paper, the unified Chaboche viscoplasticity model is investigated with some examples of application for a cyclic hardening material of 316L
12 CFR 222.22 - Scope and duration of opt-out.
2010-01-01
... SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.22 Scope and duration of opt-out.... (2) Continuing relationship—(i) In general. If the consumer establishes a continuing relationship... connection with— (A) A single continuing relationship or multiple continuing relationships that the consumer...
Yu, Andrea C; Zambrano, Regina M; Cristian, Ingrid; Price, Sue; Bernhard, Birgitta; Zucker, Marc; Venkateswaran, Sunita; McGowan-Jordan, Jean; Armour, Christine M
2017-06-01
Isolated 7p22.3p22.2 deletions are rarely described with only two reports in the literature. Most other reported cases either involve a much larger region of the 7p arm or have an additional copy number variation. Here, we report five patients with overlapping microdeletions at 7p22.3p22.2. The patients presented with variable developmental delays, exhibiting relative weaknesses in expressive language skills and relative strengths in gross, and fine motor skills. The most consistent facial features seen in these patients included a broad nasal root, a prominent forehead a prominent glabella and arched eyebrows. Additional variable features amongst the patients included microcephaly, metopic ridging or craniosynostosis, cleft palate, cardiac defects, and mild hypotonia. Although the patients' deletions varied in size, there was a 0.47 Mb region of overlap which contained 7 OMIM genes: EIP3B, CHST12, LFNG, BRAT1, TTYH3, AMZ1, and GNA12. We propose that monosomy of this region represents a novel microdeletion syndrome. We recommend that individuals with 7p22.3p22.2 deletions should receive a developmental assessment and a thorough cardiac exam, with consideration of an echocardiogram, as part of their initial evaluation. © 2017 Wiley Periodicals, Inc.
Rodriguez Viales, Rebecca; Diotel, Nicolas; Ferg, Marco; Armant, Olivier; Eich, Julia; Alunni, Alessandro; März, Martin; Bally-Cuif, Laure; Rastegar, Sepand; Strähle, Uwe
2015-03-01
The teleost brain has the remarkable ability to generate new neurons and to repair injuries during adult life stages. Maintaining life-long neurogenesis requires careful management of neural stem cell pools. In a genome-wide expression screen for transcription regulators, the id1 gene, encoding a negative regulator of E-proteins, was found to be upregulated in response to injury. id1 expression was mapped to quiescent type I neural stem cells in the adult telencephalic stem cell niche. Gain and loss of id1 function in vivo demonstrated that Id1 promotes stem cell quiescence. The increased id1 expression observed in neural stem cells in response to injury appeared independent of inflammatory signals, suggesting multiple antagonistic pathways in the regulation of reactive neurogenesis. Together, we propose that Id1 acts to maintain the neural stem cell pool by counteracting neurogenesis-promoting signals. © 2014 AlphaMed Press.
12 CFR 222.28 - Effective date, compliance date, and prospective application.
2010-01-01
... GOVERNORS OF THE FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.28... using eligibility information that you receive from an affiliate to make solicitations to a consumer if...
International Nuclear Information System (INIS)
Rabi, Jose A.; Mohamad, Abdulmajeed A.
2004-01-01
Radon-222 is a radionuclide exhaled from phosphogypsum by-produced at phosphate fertilizer industries. Alternative large-scale application of this waste may indicate a material substitute for civil engineering provided that environmental issues concerning its disposal and management are overcome. The first part of this paper outlines a steady-state two-dimensional model for 222 Rn transport through porous media, inside which emanation (source term) and decay (sink term) exist. Boussinesq approach is evoked for the laminar buoyancy-driven interstitial air flow, which is also modeled according to Darcy-Brinkman formulation. In order to account for simultaneous effects of entailed physical parameters, governing equations are cast into dimensionless form. Apart from usual controlling parameters like Reynolds, Prandtl, Schmidt, Grashof and Darcy numbers, three unconventional dimensionless groups are put forward. Having in mind 222 Rn transport in phosphogypsum-bearing porous media, the physical meaning of those newly introduced parameters and representative values for the involved physical parameters are presented. A limiting diffusion-dominated scenario is addressed, for which an analytical solution is deduced for boundary conditions including an impermeable phosphogypsum stack base and a non-zero fixed concentration activity at the stack top. Accordingly, an expression for the average Sherwood number corresponding to the normalized 222 Rn exhalation rate is presented
Li, Yanhua; Gu, Junjiao; Lu, Hong
2017-12-01
Several lines of evidence have indicated that growth arrest-specific transcript 5 (GAS5) functions as a tumor suppressor and is aberrantly expressed in multiple cancers. GAS5 was found to be downregulated in gastric cancer (GC) tissues, and ectopic expression of GAS5 inhibited GC cell proliferation. The present study aimed to explore the underlying mechanisms of GAS5 involved in GC cell proliferation. GAS5 and miR-222 expressions in GC cell lines were estimated by quantitative real-time polymerase chain reaction. The effects of GAS5 and miR-222 on GC cell proliferation were assessed by MTT assay and 5-bromo-2-deoxyuridine (BrdU) incorporation assays. The interaction between GAS5 and miR-222 was confirmed by luciferase reporter assay and RNA immunoprecipitation assay. The protein levels of the phosphatase and tensin homolog (PTEN), phosphorylated protein kinase B (Akt) (p-Akt), Akt, phosphorylated mammalian target of rapamycin (mTOR) (p-mTOR), and mTOR were determined by western blot. GAS5 was downregulated and miR-222 was upregulated in GC cells. GAS5 directly targeted and suppressed miR-222 expression. GAS5 overexpression and miR-222 inhibition suppressed cell proliferation, increased PTEN protein level and decreased p-Akt and p-mTOR protein levels in GC cells while GAS5 knockdown and miR-222 overexpression exhibited the opposite effects. Moreover, mechanistic analyses revealed that GAS5 regulated GC cell proliferation through the PTEN/Akt/mTOR pathway by negatively regulating miR-222. GAS5/miR-222 axis regulated proliferation of GC cells through the PTEN/Akt/mTOR pathway, which facilitated the development of lncRNA-directed therapy against this deadly disease.
Enhancing privacy of users in eID schemes
Shrishak, Kris; Erkin, Z.; Schaar, Remco
2016-01-01
In todays world transactions are increasingly being performed over the internetbut require identication of users as in face-to-face transactions. In order to facilitate eGovernance as well as other eCommerce services Electronic Identiation(eID) schemes, which intend to provide unique and reliable
Measurement of Rn-222 concentrations in building materials used in jordan
Energy Technology Data Exchange (ETDEWEB)
Ismail, A M; Abumyrad, K M; Kullab, M K; Albataina, B A [Physics Dept., Yarmouk University, 219-10 Irbid, (Jordan)
1995-10-01
In this work, the concentrations of the radiative inert gas Rn-222 emanated from the building materials that are commonly in jordan have been studied. For this purpose, samples of ten jordanian building materials of different masses were prepared in plastic cans sealed to passive integrated dosimeters containing CR-39 solid state nuclear track detectors which are very sensitive to alpha-particles. The Rn-222 concentrations in these samples range from 137 Bq/m{sup 3} to 267 Bq/m{sup 3} with an average of 189 Bq/m{sup 3}. These levels were found to be consistent with those measured by other workers in other countries. 4 figs., 2 tabs.
Measurement of Rn-222 concentrations in building materials used in jordan
International Nuclear Information System (INIS)
Ismail, A.M.; Abumyrad, K.M.; Kullab, M.K.; Albataina, B.A.
1995-01-01
In this work, the concentrations of the radiative inert gas Rn-222 emanated from the building materials that are commonly in jordan have been studied. For this purpose, samples of ten jordanian building materials of different masses were prepared in plastic cans sealed to passive integrated dosimeters containing CR-39 solid state nuclear track detectors which are very sensitive to alpha-particles. The Rn-222 concentrations in these samples range from 137 Bq/m 3 to 267 Bq/m 3 with an average of 189 Bq/m 3 . These levels were found to be consistent with those measured by other workers in other countries. 4 figs., 2 tabs
International Nuclear Information System (INIS)
Swindon, T.N.
1978-10-01
Radon-222 sources have been used in Australia for the treatment of patients since 1929 and the calculation of absorbed doses from such sources is well established. An alternative to radon-222 is gold-198 which, in suitable form, may be used for permanent implantations and for surface, interstitial or intra-cavitary applications. Because radon-222 and gold-198 have different characteristics, the data to be used in calculating the absorbed dose to a point in a treatment volume will depend on the particular source used. The data are related to the energies and abundances of the beta and gamma rays emitted from the nuclei and on their half-lives (Tsub(1/2)). The energies of the beta and gamma rays emitted by radon-222 (in equilibrium with its decay products) and by gold-198 are given
12 CFR 222.26 - Delivery of opt-out notices.
2010-01-01
... SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.26 Delivery of opt-out notices. (a... the affiliate providing the notice; or (4) Posts the notice on the Internet Web site at which the... affiliate providing the notice; or (3) Posts the notice on an Internet Web site without requiring the...
Radon-222 measurements aboard an airplane for the description of atmospheric diffusion
International Nuclear Information System (INIS)
Bogen, J.
1973-01-01
Radon-222 is absorbed aboard an airplane in tubes filled with 50 g of selected charcoal and cooked in Dewars by carbon dioxide and freon. After air collection at different heights up to 5 km, the tubes are evacuated and heated in the laboratory for desorption of the gas molecules and for transfer into a decay chamber covered with zinc-sulfide serving as a scintillator for the detection of alpha activity from radon-222 and its daughters. In general, the measurements show an exponential decrease of the concentration up to 5 km in height, if there is no cloud layer. The height for a reduction by a factor of two is about 900 meters. Assuming a constant diffusion coefficient K 0 up to 5 km, the measurements yield a K 0 of approximately 3.7 x 10 4 cm 2 s -1 . For flights in stratiform clouds a decrease is observed of the concentration up to a certain height, then radon-222 is again increasing or remains constant. This must be explained with respect to the meteorological situation. Assuming only a constant value for K 0 between the different flying heights, it was possible to appraise the development of the eddy diffusion coefficient with height
Directory of Open Access Journals (Sweden)
Carlana Ramlochansingh
Full Text Available Anesthetics are drugs that reversibly relieve pain, decrease body movements and suppress neuronal activity. Most drugs only cover one of these effects; for instance, analgesics relieve pain but fail to block primary fiber responses to noxious stimuli. Alternately, paralytic drugs block synaptic transmission at neuromuscular junctions, thereby effectively paralyzing skeletal muscles. Thus, both analgesics and paralytics each accomplish one effect, but fail to singularly account for all three. Tricaine methanesulfonate (MS-222 is structurally similar to benzocaine, a typical anesthetic for anamniote vertebrates, but contains a sulfate moiety rendering this drug more hydrophilic. MS-222 is used as anesthetic in poikilothermic animals such as fish and amphibians. However, it is often argued that MS-222 is only a hypnotic drug and its ability to block neural activity has been questioned. This prompted us to evaluate the potency and dynamics of MS-222-induced effects on neuronal firing of sensory and motor nerves alongside a defined motor behavior in semi-intact in vitro preparations of Xenopus laevis tadpoles. Electrophysiological recordings of extraocular motor discharge and both spontaneous and evoked mechanosensory nerve activity were measured before, during and after administration of MS-222, then compared to benzocaine and a known paralytic, pancuronium. Both MS-222 and benzocaine, but not pancuronium caused a dose-dependent, reversible blockade of extraocular motor and sensory nerve activity. These results indicate that MS-222 as benzocaine blocks the activity of both sensory and motor nerves compatible with the mechanistic action of effective anesthetics, indicating that both caine-derivates are effective as single-drug anesthetics for surgical interventions in anamniotes.
Occurrence of 222Rn and progeny in natural gas processing plants in western Canada
International Nuclear Information System (INIS)
Drummond, I.; Boucher, P.; Bradford, B.; Evans, H.; McLean, J.; Reczek, E.; Thunem, H.
1990-01-01
In Western Canada, there are many plants that process natural gas to remove impurities (CO 2 , H 2 S, H 2 O) and recover natural gas liquids (propane, butane, etc.). Trace quantities of 222 Rn present in the inlet stream are concentrated in streams rich with propane. Potential hazards to plant operators include direct inhalation of 222 Rn and progeny; exposure to gamma radiation from short-lived progeny deposited inside equipment; or inhalation of 210 Pb when contaminated equipment is opened for repair. Twenty-four plants operated by seven companies cooperated to assess these potential hazards. The findings indicate a substantial flux of 222 Rn and progeny passing through the plants, but little accumulation of radionuclides. In no case was there evidence of significant exposure of plant operators or maintenance personnel to ionizing radiation. Further investigation of pipeline operations, and chemical operations using natural gas liquids as feed stock, is recommended
Revocable ID-Based Signature with Short Size over Lattices
Directory of Open Access Journals (Sweden)
Ying-Hao Hung
2017-01-01
Full Text Available In the past, many ID-based signature (IBS schemes based on the integer factorization or discrete logarithm problems were proposed. With the progress on the development of quantum technology, IBS schemes mentioned above would become vulnerable. Recently, several IBS schemes over lattices were proposed to be secure against attacks in the quantum era. As conventional public-key settings, ID-based public-key settings have to offer a revocation mechanism to revoke misbehaving or malicious users. However, in the past, little work focuses on the revocation problem in the IBS schemes over lattices. In this article, we propose a new revocable IBS (RIBS scheme with short size over lattices. Based on the short integer solution (SIS assumption, we prove that the proposed RIBS scheme provides existential unforgeability against adaptive chosen-message attacks. As compared to the existing IBS schemes over lattices, our RIBS scheme has better performance in terms of signature size, signing key size, and the revocation mechanism with public channels.
Oberste, M S; Weaver, S C; Watts, D M; Smith, J F
1998-01-01
Venezuelan equine encephalitis (VEE) virus was isolated in 1993, 1994, and 1995 from human cases of acute, undifferentiated, febrile illness in the Peruvian Amazon Basin. Two virus isolates were recovered in 1994 from Peruvian soldiers at a jungle outpost near Pantoja in northern Peru, and 10 isolates were obtained from military personnel and civilians in 1993-1995 in Iquitos, an urban center in northeastern Peru. The genetic relationship of these isolates to other VEE virus strains was determined by sequencing 856-867 nucleotide reverse transcription-polymerase chain reaction fragments derived from the PE2 glycoprotein gene. The sequences were compared with those of other VEE virus strains, including representatives of the IAB, IC, ID, IE, II, and IIIC subtypes. The two Pantoja isolates were most closely related to subtype IC and ID viruses previously isolated in Colombia and Venezuela, and to the ID viruses isolated during the 1970s in Iquitos. All of the recent Iquitos isolates were similar to one another, but they were more closely related to Panamanian ID strains than to isolates previously obtained in Iquitos, Peru, or in Colombia and Venezuela. The recent Iquitos VEE viral isolates were the first Panama-genotype VEE ID virus strains identified outside of the Republic of Panama.
DEFF Research Database (Denmark)
Gibbs-Seymour, Ian; Oka, Yasuyoshi; Rajendra, Eeson
2015-01-01
We show that central components of the Fanconi anemia (FA) DNA repair pathway, the tumor suppressor proteins FANCI and FANCD2 (the ID complex), are SUMOylated in response to replication fork stalling. The ID complex is SUMOylated in a manner that depends on the ATR kinase, the FA ubiquitin ligase...
Identification of clinical yeasts by Vitek MS system compared with API ID 32 C.
Durán-Valle, M Teresa; Sanz-Rodríguez, Nuria; Muñoz-Paraíso, Carmen; Almagro-Moltó, María; Gómez-Garcés, José Luis
2014-05-01
We performed a clinical evaluation of the Vitek MS matrix-assisted laser desorption ionization-time-of-flight mass spectrometry (MALDI-TOF MS) system with the commercial database version 2.0 for rapid identification of medically important yeasts as compared with the conventional phenotypic method API ID 32 C. We tested 161 clinical isolates, nine isolates from culture collections and five reference strains. In case of discrepant results or no identification with one or both methods, molecular identification techniques were employed. Concordance between both methods was observed with 160/175 isolates (91.42%) and misidentifications by both systems occurred only when taxa were not included in the respective databases, i.e., one isolate of Candida etchellsii was identified as C. globosa by Vitek MS and two isolates of C. orthopsilosis were identified as C. parapsilosis by API ID 32 C. Vitek MS could not identify nine strains (5.14%) and API ID 32 C did not identify 13 (7.42%). Vitek MS was more reliable than API ID 32 C and reduced the time required for the identification of clinical isolates to only a few minutes.
[H 2 -Cryptand 222] 2+ (Br 3 – ) 2 as a Tribromide-Type Catalyst for ...
African Journals Online (AJOL)
A stable organic tribromide, [H2-cryptand 222]2+(Br3–)2 was utilized as an active catalyst for the trimethylsilylation/tetrahydropyranylation of alcohols. The method is general for the preparation of OH-protected aliphatic (acyclic and cyclic), aromatic, primary, secondary and tertiary alcohols. Keywords: [H2-cryptand ...
Energy Technology Data Exchange (ETDEWEB)
Cazula, Camila Dias
2015-07-01
Exposure of the general population to ionizing radiation comes mainly from natural sources. The main contribution is due to inhalation of radon (Rn-222), a gas that occurs naturally (UNSCEAR, 2000). The Rn-222 concentration in the environment is controlled by factors such as soil permeability and water content, the weather variability, materials used in the foundation and the usual positive pressure differential between the soil and the internal environment. Studies indicate that the concentration of radon shows a wide variation in the basement, ground floor and upper floors of buildings. The objective of this study is to determine radon levels in basements, ground floor and floors above ground level, at a university in the city of Sao Paulo and in one residential building in the city of Peruibe. Rn-222 measurements were performed using the method with nuclear track of solid state detectors (CR-39). The studied environments present Rn-222 concentration well below the values recommended by the International Commission on Radiological Protection, published in the 2009 document, of 300 Bq/m{sup 3} for homes and 1000 Bq/m{sup 3} for the workplace. In the residential building, the concentration of Ra-266, Th-232 and K-40 in the materials used in the building construction was also analyzed, by gamma spectrometry. The effective total dose for the resident due to external exposure was 0.8 mSv y{sup -1}, lower than the annual dose limit for the general public of 1 mSv y{sup -1}. (author)
Pugliese, Cara E.; Kenworthy, Lauren; Bal, Vanessa Hus; Wallace, Gregory L.; Yerys, Benjamin E.; Maddox, Brenna B.; White, Susan W.; Popal, Haroon; Armour, Anna Chelsea; Miller, Judith; Herrington, John D.; Schultz, Robert T.; Martin, Alex; Anthony, Laura Gutermuth
2015-01-01
Recent updates have been proposed to the Autism Diagnostic Observation Schedule-2 Module 4 diagnostic algorithm. This new algorithm, however, has not yet been validated in an independent sample without intellectual disability (ID). This multi-site study compared the original and revised algorithms in individuals with ASD without ID. The revised…
Energy Technology Data Exchange (ETDEWEB)
Bonifacio, J.; Iturbe, J.L
1992-02-15
The study of the present work consists on designing a system to measure gas {sup 222} Rn, using a surface barrier detector, in order to obtaining a more accuracy measure of this isotope by means of an alpha particle spectra and thus to try to avoid the influence of the radioactivity of the isotope descendants of short half life, which are also emitting of alpha particles, since by other methods its should make a series of corrections to obtain the real value of the radon activity. (Author)
The Danish eID Case: Twenty years of Delay
DEFF Research Database (Denmark)
Hoff, Jens Villiam; Hoff, Frederik Villiam
2010-01-01
the technological, organizational and legal dimensions of eID in Denmark, and comparing these with a number of other European countries made it possible to explain this paradox. Thus, the three main reasons for the special route development has taken in Denmark seems to be concerns over privacy, lack...
Mazza, Maria; Guglielmetti, Chiara; Ingravalle, Francesco; Brusadore, Sonia; Langeveld, Jan P. M.; Ekateriniadou, Loukia V.; Andréoletti, Olivier; Casalone, Cristina; Acutis, Pier Luigi
2017-01-01
The presence of lysine (K) at codon 222 has been associated with resistance to classical scrapie in goats, but few scrapie cases have been identified in 222Q/K animals. To investigate the contribution of the 222K variant to PrPres formation in natural and experimental Q/K scrapie cases, we applied an immunoblotting method based on the use of two different monoclonal antibodies, F99/97.6.1 and SAF84, chosen for their different affinities to 222K and 222Q PrP variants. Our finding that PrPres s...
Thoron (RN-220) interference in the determination of RN-222 exhalation rate of soils
Energy Technology Data Exchange (ETDEWEB)
Amaral, Déric S.; Farias, Emerson E.G.; Santos, Mariana L.O.; Silva, Karolayne E.M.; Hazin, Clovis A.; França, Elvis J., E-mail: emersonemiliano@yahoo.com [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Souza Neto, João A., E-mail: adauto@ufpe.br [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Geologia
2017-07-01
The transport of Rn-222 from the soil to the atmosphere known as exhalation is influenced by meteorological conditions and soil geophysical parameters. In closed and poorly ventilated rooms, this radioactive gas can reach high activity concentrations, in which the energy of alpha particles released by this radionuclide and its progeny is the second leading cause of lung cancer. Soil exhalation rate is an important parameter for assessing human health risks associated with radon. For radon determination using an exhalation chamber, an ionization chamber detector is used to count the electrical pulses generated by the interaction between the alpha particles produced by Rn-222 and its progeny and the air inside the chamber. In this work, the interference of thoron (Rn-220) in the determination of soil exhalation rate of Rn-222 was studied. For this, the RadonBOX exhalation chamber and the AlphaGuard ionization chamber detector were utilized for analyzing the same soil during two hours on different days under similar meteorological conditions. From zero up to approximately 2,400 s, the radon activity concentrations decreased. After 40 minutes, the radon concentrations started to increase, thereby allowing the calculation of soil exhalation rate. This initial decreasing could be explained by a high Rn-220 than Rn-222 presence in the soil, in which, because of its short half-life, after 40 minutes, most thoron present in the chamber has undergone so that the main alpha emitter become Rn-222. In order to confirm this, Rn-220 activity was estimated by the Ra-228 concentration in the soil determined after 30 days using High Resolution Gamma-Ray Spectrometry with HPGe detectors. Therefore, the thoron interference in the determination of soil radon exhalation rate was considered negligible after 40 minutes of measurement time for the analyzed soil. (author)
Seasonal variations of 222Rn and SGD fluxes to Ubatuba embayments, Sao Paulo
International Nuclear Information System (INIS)
Oliveira, J.; Costa, P.; Braga, E.S.
2006-01-01
We describe here an application of excess 222 Rn to estimate submarine groundwater discharge in a series of small embayments of Ubatuba, Sao Paulo State, Brazil. Excess 222 Rn inventories obtained in 11 vertical profiles varied from (3.3±1.1) x 10 3 to (19±5) x 10 3 dpm x m -2 . The estimated total fluxes required to support the inventories varied from (0.6±0.2) x 10 3 to (3.4±0.9) x 10 3 dpm x m -2 x d -1 . Considering these results, the submarine groundwater discharge advective rates necessary to balance the sub-pycnocline fluxes calculated in Ubatuba embayments ranged from 0.06 to 1.9 cm x d -1 . During the period of this investigation (from March/03 to May/2004), the highest 222 Rn in excess inventories were observed late in the summer season (March). Taking into account all vertical profiles established, the relative variability was 67%. Although, if we consider only the fluxes determined in both Flamengo and Fortaleza embayments, the relative variation was 21%. (author)
Time series analysis of soil Radon-222 recorded at Kutch region, Gujarat, India
International Nuclear Information System (INIS)
Madhusudan Rao, K.; Rastogi, B.K.; Barman, Chiranjib; Chaudhuri, Hirok
2013-01-01
Kutch region in Gujarat lies in a seismic vulnerable zone (seismic zone-v). After the devastating Bhuj earthquake (7.7M) of January 26, 2001 in the Kutch region several researcher focused their attention to monitor geophysical and geochemical precursors for earthquakes in the region. In order to find out the possible geochemical precursory signals for earthquake events, we monitored radioactive gas radon-222 in sub surface soil gas at Kutch region. We have analysed the recorded soil radon-222 time series by means of nonlinear techniques such as FFT power spectral analysis, empirical mode decomposition, multi-fractal analysis along with other linear statistical methods. Some fascinating and fruitful results originated out the nonlinear analysis of the said time series have been discussed in the present paper. The entire analytical method aided us to recognize the nature and pattern of soil radon-222 emanation process. Moreover the recording and statistical and non-linear analysis of soil radon data at Kutch region will assist us to understand the preparation phase of an imminent seismic event in the region. (author)
Safety evaluation for packaging 222-S laboratory cargo tank for onetime type B material shipment
International Nuclear Information System (INIS)
Nguyen, P.M.
1994-01-01
The purpose of this Safety Evaluation for Packaging (SEP) is to evaluate and document the safety of the onetime shipment of bulk radioactive liquids in the 222-S Laboratory cargo tank (222-S cargo tank). The 222-S cargo tank is a US Department of Transportation (DOT) MC-312 specification (DOT 1989) cargo tank, vehicle registration number HO-64-04275, approved for low specific activity (LSA) shipments in accordance with the DOT Title 49, Code of Federal Regulations (CFR). In accordance with the US Department of Energy, Richland Operations Office (RL) Order 5480.1A, Chapter III (RL 1988), an equivalent degree of safety shall be provided for onsite shipments as would be afforded by the DOT shipping regulations for a radioactive material package. This document demonstrates that this packaging system meets the onsite transportation safety criteria for a onetime shipment of Type B contents
Towards fraud-proof ID documents using multiple data hiding technologies and biometrics
Picard, Justin; Vielhauer, Claus; Thorwirth, Niels
2004-06-01
Identity documents, such as ID cards, passports, and driver's licenses, contain textual information, a portrait of the legitimate holder, and eventually some other biometric characteristics such as a fingerprint or handwritten signature. As prices for digital imaging technologies fall, making them more widely available, we have seen an exponential increase in the ease and the number of counterfeiters that can effectively forge documents. Today, with only limited knowledge of technology and a small amount of money, a counterfeiter can effortlessly replace a photo or modify identity information on a legitimate document to the extent that it is very diffcult to differentiate from the original. This paper proposes a virtually fraud-proof ID document based on a combination of three different data hiding technologies: digital watermarking, 2-D bar codes, and Copy Detection Pattern, plus additional biometric protection. As will be shown, that combination of data hiding technologies protects the document against any forgery, in principle without any requirement for other security features. To prevent a genuine document to be used by an illegitimate user,biometric information is also covertly stored in the ID document, to be used for identification at the detector.
Pugliese, Cara E.; Kenworthy, Lauren; Bal, Vanessa Hus; Wallace, Gregory L; Yerys, Benjamin E; Maddox, Brenna B.; White, Susan W.; Popal, Haroon; Armour, Anna Chelsea; Miller, Judith; Herrington, John D.; Schultz, Robert T.; Martin, Alex; Anthony, Laura Gutermuth
2015-01-01
Recent updates have been proposed to the Autism Diagnostic Observation Schedule-2 Module 4 diagnostic algorithm. This new algorithm, however, has not yet been validated in an independent sample without intellectual disability (ID). This multi-site study compared the original and revised algorithms in individuals with ASD without ID. The revised algorithm demonstrated increased sensitivity, but lower specificity in the overall sample. Estimates were highest for females, individuals with a verb...
Chen, B; Han, B H; Sun, X H; Lim, R W
1997-01-15
We have examined the role of an Id-like protein, Id3 (also known as HLH462), in the regulation of muscle-specific gene expression. Id proteins are believed to block expression of muscle-specific genes by preventing the dimerization between ubiquitous bHLH proteins (E proteins) and myogenic bHLH proteins such as MyoD. Consistent with its putative role as an inhibitor of differentiation, Id3 mRNA was detected in proliferating skeletal muscle cells, was further induced by basic fibroblast growth factor (bFGF) and was down-regulated in differentiated muscle cultures. Overexpression of Id3 efficiently inhibited the MyoD-mediated activation of the muscle-specific creatine kinase (MCK) reporter gene. Deletion analysis indicated that the C-terminal 15 amino acids of Id3 are critical for the full inhibitory activity while deleting up to 42 residues from the C-terminus of the related protein, Id2, did not affect its ability to inhibit the MCK reporter gene. Chimeric protein containing the N-terminal region of Id3 and the C-terminus of Id2 was also non-functional in transfected cells. In contrast, wild-type Id3, the C-terminal mutants, and the Id3/Id2 chimera could all interact with the E-protein E47in vitro. Additional studies indicated that truncation of the Id3 C-terminus might have adversely affected the expression level of the mutant proteins but the Id3/Id2 chimera was stably expressed. Taken together, our results revealed a more complex requirement for the expression and proper function of the Id family proteins than was hitherto expected.
Smith, C. G.; Cable, J. E.; Martin, J. B.; Roy, M.
2008-05-01
Pore water distributions of 222Rn (t1/2 = 3.83 d), obtained during two sampling trips 9-12 May 2005 and 6-8 May 2006, are used to determine spatial and temporal variations of fluid discharge from a seepage face located along the mainland shoreline of Indian River Lagoon, Florida. Porewater samples were collected from a 30 m transect of multi-level piezometers and analyzed for 222Rn via liquid scintillation counting; the mean of triplicate measurements was used to represent the porewater 222Rn activities. Sediment samples were collected from five vibracores (0, 10, 17.5, 20, and 30 m offshore) and emanation rates of 222Rn (sediment supported) were determined using a standard cryogenic extraction technique. A conceptual 222Rn transport model and subsequent numerical model were developed based on the vertical distribution of dissolved and sediment-supported 222Rn and applicable processes occurring along the seepage face (e.g. advection, diffusion, and nonlocal exchange). The model was solved inversely with the addition of two Monte Carlo (MC) simulations to increase the statistical reliability of three parameters: fresh groundwater seepage velocity (v), irrigation intensity (α0), and irrigation attenuation (α1). The first MC simulation ensures that the Nelder-Mead minimization algorithm converges on a global minimum of the merit function and that the parameters estimates are consistent within this global minimum. The second MC simulation provides 90% confidence intervals on the parameter estimates using the measured 222Rn activity variance. Fresh groundwater seepage velocities obtained from the model decrease linearly with distance from the shoreline; seepage velocities range between 0.6 and 42.2 cm d-1. Based on this linear relationship, the terminus of the fresh groundwater seepage is approximately 25 m offshore and total fresh groundwater discharge for the May-2005 and May-2006 sampling trips are 1.16 and 1.45 m3 d-1 m-1 of shoreline, respectively. We hypothesize
Energy Technology Data Exchange (ETDEWEB)
Liu, Chen; Jin, Rong [Department of Immunology, Peking University Health Science Center, Beijing (China); Wang, Hong-Cheng [Oklahoma Medical Research Foundation, Oklahoma City, OK (United States); Tang, Hui; Liu, Yuan-Feng; Qian, Xiao-Ping; Sun, Xiu-Yuan; Ge, Qing [Department of Immunology, Peking University Health Science Center, Beijing (China); Sun, Xiao-Hong, E-mail: sunx@omrf.org [Oklahoma Medical Research Foundation, Oklahoma City, OK (United States); Zhang, Yu, E-mail: zhangyu007@bjmu.edu.cn [Department of Immunology, Peking University Health Science Center, Beijing (China)
2013-06-21
Highlights: •Id1 expression enables naïve T cell proliferation without anti-CD28 co-stimulation. •Id1 expression facilitates T cells survival when stimulated with anti-CD3. •Elevation of IL-2 production by Id1 contributes increased proliferation and survival. •Id1 potentiates NF-κB activation by anti-CD3 stimulation. -- Abstract: Although the role of E proteins in the thymocyte development is well documented, much less is known about their function in peripheral T cells. Here we demonstrated that CD4 promoter-driven transgenic expression of Id1, a naturally occurring dominant-negative inhibitor of E proteins, can substitute for the co-stimulatory signal delivered by CD28 to facilitate the proliferation and survival of naïve CD4{sup +} cells upon anti-CD3 stimulation. We next discovered that IL-2 production and NF-κB activity after anti-CD3 stimulation were significantly elevated in Id1-expressing cells, which may be, at least in part, responsible for the augmentation of their proliferation and survival. Taken together, results from this study suggest an important role of E and Id proteins in peripheral T cell activation. The ability of Id proteins to by-pass co-stimulatory signals to enable T cell activation has significant implications in regulating T cell immunity.
Measurement of 222Rn, 220Rn and their decay products in high background radiation area in Yangjiang
International Nuclear Information System (INIS)
Yuan Yongling
2000-01-01
The investigators have measured concentrations of Rn-222, rn-220 and their decay products in high background radiation area (HBRA) and the neighboring control area (CA), as well as the equilibrium factor F for Rn-222. The average concentrations of Rn-222 in the air indoors and outdoors in the HBRA are 42.6 and 17.3 Bq/m 3 respectively, and CA, 13.2 and 11.7 Bq/m 3 , respectively. The average α-potential energy concentrations for daughters of Rn-222 indoors and outdoors in HBRA are 0.109 and 0.051 μJ/m 3 , CA, 0.045 and 0.041 μJ/m 3 , respectively. The average α-potential energy values for daughters of Rn-220 indoor and outdoor in HBRA are 0.249 and 0.053 μJ/m 3 , CA, 0.051 and 0.025 μJ/m 3 , respectively. With regard to equilibrium factor F for Rn-222, the authors have also measured 52 points of 10 hamlets in HBRA (indoor 31, outdoor 21), 9 points of 2 hamlets in CA (indoor 5, outdoor 4), respectively. These figures are 0.46, 0.53, 0.62 and 0.64, respectively
The development and psychometric evaluation of the Internet Disorder Scale (IDS-15).
Pontes, Halley M; Griffiths, Mark D
2017-01-01
Previously published research suggests that improvement in the assessment of Internet addiction (IA) is paramount in advancing the field. However, little has been done to address inconsistencies in the assessment of IA using a more updated framework. The aim of the present study was to develop a new instrument to assess IA based on a modification of the nine Internet Gaming Disorder (IGD) criteria as suggested by the American Psychiatric Association in the latest (fifth) edition of the Diagnostic and Statistical Manual of Mental Disorders (DSM-5), and to provide a taxonomy of the potential risk of IA risk among participants. A heterogeneous sample of Internet users (n=1105) was recruited online (61.3% males, mean age 33years). Construct validity of the new instrument - Internet Disorder Scale (IDS-15) - was assessed by means of factorial, convergent, and discriminant validity. Criterion-related validity and reliability were also investigated. Additionally, latent profile analysis (LPA) was carried out to differentiate and characterize Internet users based on their potential IA risk. The construct and criterion-related validity of the IDS-15 were both warranted. The IDS-15 proved to be a valid and reliable tool. Using the LPA, participants were classed as "low addiction risk" (n=183, 18.2%), "medium addiction risk" (n=456, 41.1%), and "high addiction risk" (n=455, 40.77%). Furthermore, key differences emerged among these classes in terms of age, relationship status, cigarette consumption, weekly Internet usage, age of Internet use initiation, and IDS-15 total scores. The present findings support the viability of using adapted IGD criteria as a framework to assess IA. Copyright © 2015 Elsevier Ltd. All rights reserved.
ACE I/D polymorphism in Indian patients with hypertrophic cardiomyopathy and dilated cardiomyopathy
DEFF Research Database (Denmark)
Rai, Taranjit Singh; Dhandapany, Perundurai Subramaniam; Ahluwalia, Tarun Veer Singh
2008-01-01
The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM).......The study was carried to determine the association of angiotensin converting enzyme (ACE) insertion/deletion (I/D) polymorphism with the risk of hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), and restrictive cardiomyopathy (RCM)....
Assessment of the relationship between ACE I/D gene polymorphism and renal allograft survival.
Yang, Chun-Hua; Lu, Yi; Chen, Xue-Xia; Xian, Wen-Feng; Tu, Wei-Feng; Li, Hong-Yan
2015-12-01
The relationship between the angiotensin-converting enzyme (ACE) insertion/deletion (I/D) gene polymorphism and renal allograft survival after renal transplantation from the published reports are still debatable. This study was performed to evaluate the relationship between the ACE I/D gene polymorphism and renal allograft survival after renal transplantation using meta-analysis. Eligible studies were identified from PubMed and Cochrane Library on 1 November 2014, and eligible studies were recruited and synthesized using a meta-analysis methodology. Twelve investigations were included in this meta-analysis for the assessment of the relationship between the ACE I/D gene polymorphism and renal allograft survival. In this meta-analysis, the ACE I/D gene polymorphism was not associated with renal allograft survival after renal transplantation for overall populations, Caucasians, Brazilians and Africans. Interestingly, the ACE D allele and DD genotype were associated with renal allograft survival after renal transplantation in the Asian population. ACE D allele and DD genotype were associated with renal allograft survival after renal transplantation in the Asian population. However, more studies should be performed to confirm this association. © The Author(s) 2015.
Energy Technology Data Exchange (ETDEWEB)
Perez, R; Germanier, A; Rubio, M [CEPROCOR, Cordoba (Argentina); Sbarato, D; Zappino, R [Observatorio Ambiental de la Municipalidad de Cordoba, Cordoba (Argentina)
1998-07-01
Full text: In this work measurements of the Radon ({sup 222}Rn) concentration in the inside of historical buildings which date back to the end of the 17th and the beginning of the 18th Centuries have been carried out in the city of Cordoba (Argentina). Meteorological factors such as room temperature and atmospheric pressure have not shown to affect, to a great extent, the results obtained. By comparing the concentration of {sup 222}Rn in environments at different levels we inferred that the soil underlying the buildings does not represent an important source of {sup 222}Rn. The main occurrence of the element was found in room walls, which shows that local building materials are an important source of {sup 222}Rn. Among the materials used in these buildings are granitic rocks, and to a lesser extent, lime, sand and marble. The {sup 222}Rn concentrations recorded in some of the rooms surveyed reach values which are close to the minimum intervene level set by international standards in 4pCi/l. The study of the effects of ventilation in the concentration of {sup 222}Rn allows us to conclude that its values decrease to accepted levels by means of a natural and efficient ventilation of the rooms. (author) [Spanish] Texto completo: En este trabajo se han realizado mediciones de la concentracion de radon (radon 222) en el interior de edificios de la ciudad de Cordoba que datan de finales del siglo XVII y comienzos del siglo XVIII. Las concentraciones de radon 222 se determinaron con un detector pasivo Radon Monitor 05-418, marca Victoreen. El mismo consta de una camara de difusion electrostatica y un detector de estado solido (Si) de juntura difundida. No se observo, en los resultados obtenidos, influencias causadas por factores meteorologicos como la temperatura ambiente y la presion atmosferica. Por comparacion de la concentracion de radon 222 en ambientes ubicados en distintas plantas se dedujo que el suelo subyacente bajo los edificios representa una fuente secundaria
Fijałkowska-Lichwa, L.; Przylibski, T. A.
2011-04-01
The authors investigated short-time changes in 222Rn activity concentration occurring yearly in two underground tourist facilities with limited air exchange with the atmosphere. One of them is Niedźwiedzia (Bear) Cave in Kletno, Poland - a natural space equipped with locks ensuring isolation from the atmosphere. The other site is Fluorite Adit in Kletno, a section of a disused uranium mine. This adit is equipped with a mechanical ventilation system, operated periodically outside the opening times (at night). Both sites are situated within the same metamorphic rock complex, at similar altitudes, about 2 km apart. The measurements conducted revealed spring and autumn occurrence of convective air movements. In Bear Cave, this process causes a reduction in 222Rn activity concentration in the daytime, i.e. when tourists, guides and other staff are present in the cave. From the point of view of radiation protection, this is the best situation. For the rest of the year, daily concentrations of 222Rn activity in the cave are very stable. In Fluorite Adit, on the other hand, significant variations in daily 222Rn activity concentrations are recorded almost all year round. These changes are determined by the periods of activity and inactivity of mechanical ventilation. Unfortunately this is inactive in the daytime, which results in the highest values of 222Rn activity concentration at the times when tourists and staff are present in the adit. Slightly lower concentrations of radon in Fluorite Adit are recorded in the winter season, when convective air movements carry a substantial amount of radon out into the atmosphere. The incorrect usage of mechanical ventilation in Fluorite Adit results in the most unfavourable conditions in terms of radiation protection. The staff working in that facility are exposed practically throughout the year to the highest 222Rn activity concentrations, both at work (in the adit) and at home (outside their working hours). Therefore, not very well
Olszowski, Tomasz; Adler, Grażyna; Janiszewska-Olszowska, Joanna; Safranow, Krzysztof; Chlubek, Dariusz
2015-01-01
The aim of the study was to examine the frequencies of the genotypes and alleles of ACE insertion/deletion (I/D) polymorphism and their association with dental caries in a sample of Polish children. The study subjects were 120 children with dental caries experience (cases) and 41 caries-free individuals (controls). The genotyping was performed using polymerase chain reaction. The genotype distributions of ACE I/D polymorphism were not statistically different between carious and control children. However, we found a borderline overrepresentation of the II + ID genotypes versus the DD genotype in the carious compared to the control group (69.2% and 51.2%, respectively, p = 0.057). Logistic regression analysis adjusted for age and sex revealed that I allele carriage was a significant predictor of dental caries susceptibility (OR = 2.14, 95% CI = 1.02-4.49, p = 0.041). In conclusion, the DD genotype of ACE I/D polymorphism might be protective against dental caries in Polish children. © 2015 S. Karger AG, Basel.
Applegate, Jeffrey R; Dombrowski, Daniel S; Christian, Larry Shane; Bayer, Meredith P; Harms, Craig A; Lewbart, Gregory A
2016-12-01
The purple-spined sea urchin ( Arbacia punctulata ) is commonly found in shallow waters of the western Atlantic Ocean from the New England area of the United States to the Caribbean. Sea urchins play a major role in ocean ecology, echinoculture, and biomedical research. Additionally, sea urchins are commonly displayed in public aquaria. Baseline parameters were developed in unanesthetized urchins for righting reflex (time to regain oral recumbency) and spine response time to tactile stimulus. Tricaine methanesulfonate (MS-222) was used to sedate and anesthetize purple-spined sea urchins and assess sedation and anesthetic parameters, including adhesion to and release from a vertical surface, times to loss of response to tactile stimulus and recovery of righting reflex, and qualitative observations of induction of spawning and position of spines and pseudopodia. Sedation and anesthetic parameters were evaluated in 11 individuals in three circumstances: unaltered aquarium water for baseline behaviors, 0.4 g/L MS-222, and 0.8 g/L MS-222. Induction was defined as the release from a vertical surface with the loss of righting reflex, sedation as loss of righting reflex with retained tactile spine response, anesthesia as loss of righting reflex and loss of tactile spine response, and recovery as voluntary return to oral recumbency. MS-222 proved to be an effective sedative and anesthetic for the purple-spined sea urchin at 0.4 and 0.8 g/L, respectively. Sodium bicarbonate used to buffer MS-222 had no measurable sedative effects when used alone. Anesthesia was quickly reversed with transfer of each individual to anesthesia-free seawater, and no anesthetic-related mortality occurred. The parameters assessed in this study provide a baseline for sea urchin anesthesia and may provide helpful comparisons to similar species and populations that are in need of anesthesia for surgical procedures or research.
222-S LABORATORY FUME HOOD TESTING STUDY
International Nuclear Information System (INIS)
RUELAS, B.H.
2007-01-01
The 222-S Laboratory contains 155 active fume hoods that are used to support analytical work with radioactive and/or toxic materials. The performance of a fume hood was brought into question after employees detected odors in the work area while mixing chemicals within the subject fume hood. Following the event, testing of the fume hood was conducted to assess the performance of the fume hood. Based on observations from the testing, it was deemed appropriate to conduct performance evaluations of other fume hoods within the laboratory
Secure OpenID Authentication Model by Using Trusted Computing
Directory of Open Access Journals (Sweden)
E. Ghazizadeh
2014-01-01
Full Text Available The growth of Internet online services has been very quick in recent years. Each online service requires Internet users to create a new account to use the service. The problem can be seen when each user usually needs more than one service and, consequently, has numerous accounts. These numerous accounts have to be managed in a secure and simple way to be protected against identity theft. Single sign-on (SSO and OpenID have been used to decrease the complexity of managing numerous accounts required in the Internet identity environment. Trusted Platform Module (TPM and Trust Multitenancy are great trusted computing-based technologies to solve security concerns in the Internet identity environment. Since trust is one of the pillars of security in the cloud, this paper analyzes the existing cloud identity techniques in order to investigate their strengths and weaknesses. This paper proposes a model in which One Time Password (OTP, TPM, and OpenID are used to provide a solution against phishing as a common identity theft in cloud environment.
Time-and-ID-Based Proxy Reencryption Scheme
Mtonga, Kambombo; Paul, Anand; Rho, Seungmin
2014-01-01
Time- and ID-based proxy reencryption scheme is proposed in this paper in which a type-based proxy reencryption enables the delegator to implement fine-grained policies with one key pair without any additional trust on the proxy. However, in some applications, the time within which the data was sampled or collected is very critical. In such applications, for example, healthcare and criminal investigations, the delegatee may be interested in only some of the messages with some types sampled wi...
Radikal konservativ idédebat og højreautoritær fascination i Danmark, ca. 1928-1940
DEFF Research Database (Denmark)
Holm, Adam
1999-01-01
Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle......Historie, Højreradikalisme, Konservatisme, Fascisme, Mellemkrigstid, Idéhistorie, Intellektuelle...
2010-10-01
... of the Service Contract Act to Contracts for Certain Services-Certification. 52.222-52 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Certification. As... Contract Act to Contracts for Certain Services—Certification (NOV 2007) (a) The offeror shall check the...
2010-10-01
... of the Service Contract Act to Contracts for Certain Services-Requirements. 52.222-53 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Requirements. As... Act to Contracts for Certain Services—Requirements (FEB 2009) (a) The services under this contract are...
Ha, Jae-Won; Lee, Jae-Ik; Kang, Dong-Hyun
2017-02-21
This study was conducted to investigate the basic spectral properties of a 222-nm krypton-chlorine (KrCl) excilamp and its inactivation efficacy against major foodborne pathogens on solid media, as well as on sliced cheese compared to a conventional 254-nm low-pressure mercury (LP Hg) lamp. Selective media and sliced cheese inoculated with Escherichia coli O157:H7, Salmonella enterica serovar Typhimurium, and Listeria monocytogenes were irradiated with a KrCl excilamp and a LP Hg lamp at the same dose. The KrCl excilamp showed full radiant intensity from the outset at a wide range of working temperatures, especially at low temperatures of around 0 to 10°C. Irradiation with 222nm UV-C showed significantly (P<0.05) higher inactivation capacity against all three pathogens than 254-nm radiation on both media and sliced cheese surfaces without generating many sublethally injured cells which potentially could recover. The underlying inactivation mechanisms of 222-nm KrCl excilamp treatment were evaluated by fluorescent staining methods and damage to cellular membranes and intracellular enzyme inactivation were the primary factors contributing to the enhanced bactericidal effect. The results of this study suggest that a 222-nm UV-C surface disinfecting system can be applied as an alternative to conventional LP Hg lamp treatment by the dairy industry. Copyright © 2016. Published by Elsevier B.V.
The 18F-labelled alkylating agent 2,2,2-trifluoroethyl triflate: synthesis and specific activity
International Nuclear Information System (INIS)
Johnstroem, P.; Stone-Elander, S.
1995-01-01
A method for synthesizing the alkylating agent 2,2,2-trifluoroethyl triflate labelled with [ 18 ]fluoride in the two position is presented. Ethyl [2- 18 )F]-trifluoroacetate was synthesized by the nucleophilic reaction of [ 18 F]F - with ethyl bromodifluoroacetate in DMSO (45-60%, 5 min, 80 o C) and subsequently converted to [2- 18 F]-2,2,2-trifluoroethanol using alane in THF (85-95%, 2 min, 40 o C. Reaction with triflic anhydride in 2,6-lutidine produced [2- 18 F]-2,2,2-trifluoroethyl triflate (70-80%, 1 min, 0 o C. In all three cases the product was removed from the reaction vessel by heating to distil under a stream of nitrogen. [2- 18 F]-2,2,2-Trifluoroethyl triflate was used to label 2-oxoquazepam by N-alkylation in a toulene:DMF mixture (80-85%, 20 min, 120 o C). Although no-carrier-added [ 18 )F]F - was used, considerable unlabelled ethyl trifluoroacetate was produced in the first reaction. Varying the conditions for the fluoro-debromination reaction did not appreciably improve the relative ratio of labelled to unlabelled ester. The specific activity of the labelled 1,4-benzodiazepine-2-one obtained from 1850 MBq [ 18 F]F - was found to be ≅37 MBq/μmol (1mCi/μmol). (Author)
222Radon concentration and irradiation dose inside the department of nuclear medicine in Wuhan
International Nuclear Information System (INIS)
Cheng Xiaoli; Wang Changyin; Gao Jianhua; Zou Xiaofeng
2002-01-01
Objective: Inspecting the high radioactivity area in department of nuclear medicine in Wuhan region and estimating the irradiation dose on relevant doctors. Methods: Select six 'three A' hospitals' high radioactivity area in department of nuclear medicine and common residential houses as examples. A half-year surveillance using 222 Rn detector (type LIH-2) was performed. Results: In high radioactivity rooms, imaging rooms residential houses, the average 222 Rn concentration are 27.8, 48.2, 27.1 (Bq·m -3 ) respectively. Effective dose equivalent absorbed by doctors in high radioactivity room and imaging room are 0.16 and 0.28 mSv. The authors estimated that the effective dose equivalent of doctors in these two room and common residents per year are 0.84, 0.70 and 0.64 mSv respectively. Conclusions: Doctors in imaging room and high radioactivity room are exposed to a relatively higher annual effective dose than common residents. But they are still within the normal range. Only two imaging rooms have high 222 Rn concentrations, which will cause potential harm
Radon-222 measurement in a uranium prospecting area in Brazil
International Nuclear Information System (INIS)
Binns, D.A.; Melo, V.P.; Gouvea, V.A.
1996-01-01
Rn-222 concentrations were determined in about 100 measuring points in an uranium prospecting area in the eastern part of Brazil. The single measurement results in open areas, identified as environmental points, present values between 4 ± 2 Bq/m -3 and 404 ± 16 Bq/m -3 with a mean value of 62 ± 10 Bq/m -3 . Comparing the mean values for each measuring point, the values obtained are between 15 ± 2 Bq/m -3 in the deposit for mineral samples and 245 ±7 Bq/m -3 for the central point, AN08, of the prospective mine. Makrofol SSNTD were used for the measurements and exposed for 120 days alternated periods from May 1992 to May 1994. (authors). 8 refs., 1 tab
Application of game theory for the interpretation of inventory differences (ID)
International Nuclear Information System (INIS)
Moglewer, S.
1978-01-01
In a study performed by the Test and Evaluation Branch, Division of Safeguards, at the U.S. Nuclear Regulatory Commission with contract assistance from Lawrence Berkeley Laboratory, the validity of the ID concept for estabilishing assurance concerning possible unauthorized diversion of SNM was examined. The evaluation methodology was based upon the theory of games and produced results that were quite different from those derived by classical statistical hypothesis testing. A model was developed based upon a decision maker's utilities and solved for generic facilities. Based upon the value of ID, obtained from each inventory, and specific for each facility, there is a best policy for estimating unauthorized deliberate diversion and establishing action limits (alarm thresholds). This paper presents the results of this study as applied to a generic facility
Directory of Open Access Journals (Sweden)
Gutmann Anja
2010-01-01
Full Text Available Abstract Background ID proteins are dominant negative inhibitors of basic helix-loop-helix transcription factors that have multiple functions during development and cellular differentiation. Ectopic (over-expression of ID1 extends the lifespan of primary human epithelial cells. High expression levels of ID1 have been detected in multiple human malignancies, and in some have been correlated with unfavorable clinical prognosis. ID1 protein is localized at the centrosomes and forced (over-expression of ID1 results in errors during centrosome duplication. Results Here we analyzed the steady state expression levels of the four ID-proteins in 18 tumor cell lines and assessed the number of centrosome abnormalities. While expression of ID1, ID2, and ID3 was detected, we failed to detect protein expression of ID4. Expression of ID1 correlated with increased supernumerary centrosomes in most cell lines analyzed. Conclusions This is the first report that shows that not only ectopic expression in tissue culture but endogenous levels of ID1 modulate centrosome numbers. Thus, our findings support the hypothesis that ID1 interferes with centrosome homeostasis, most likely contributing to genomic instability and associated tumor aggressiveness.
Martin, Lynn; Hirdes, John P.; Fries, Brant E.; Smith, Trevor F.
2007-01-01
This paper describes the development of the interRAI-Intellectual Disability (interRAI ID), a comprehensive instrument that assesses all key domains of interest to service providers relative to a person with an intellectual disability (ID). The authors report on the reliability and validity of embedded scales for cognition, self-care, aggression,…
International Nuclear Information System (INIS)
Zhao, Po; Lu, Yali; Liu, Lin; Zhong, Mei
2008-01-01
The relationships between the expression of ID2, EBV-LMP1 and P16(INK4A) in Chinese classical Hodgkin lymphoma are unknown and need exploring. Samples of classical Hodgkin lymphoma from 60 Chinese patients were analyzed for the expression of ID2, EBV-LMP1 and p16(INK4A) proteins by immunohistochemistry. ID2 protein was expressed in 83.3% of this group of classical Hodgkin lymphoma, staining strongly in both cytoplasm and nucleus of the Hodgkin and Reed-Sternberg (HRS) cells. EBV-LMP1 and P16(INK4A) were overexpressed in 85.0% and 71.7% of Hodgkin lymphoma, respectively. EBV-LMP1 was noted in the cytoplasm, membrane and nucleus of HRS cells; P16(INK4A) was in the nucleus and cytoplasm. Microscopically, ID2, EBV-LMP1 and P16(INK4A) staining distinguished the HRS cells from the complex background of lymphocytes. ID2 was positively correlated with EBV-LMP1(P < 0.01), but P16(INK4A) was inversely related to EBV-LMP1 (P < 0.05). It is suggested that ID2, EBV-LMP1 and P16(INK4A) could play an important role in the evolution of classical Hodgkin lymphoma, and be considered as potential adjunct markers to identify HRS cells in diagnosis
20 CFR 222.50 - When child dependency determinations are made.
2010-04-01
... RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.50 When child dependency... the presence of a child in the family group is that the child be dependent upon the employee. The... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When child dependency determinations are made...
Directory of Open Access Journals (Sweden)
Maria Fernanda De Mello Costa
2012-10-01
Full Text Available Angiotensin II is a key regulator of blood pressure and cardiovascular function in mammals. The conversion of angiotensin into its active form is carried out by Angiotensin I-Converting Enzyme (ACE. The measurement of ACE concentration in plasma or serum, its enzymatic activity, and the correlation between an insertion/deletion (I/D genetic polymorphism of the ACE gene have been investigated as possible indicators of superior athletic performance in humans. In this context, other indicators of superior adaptation to exercise resulting in better athletic performance (such as ventricular hypertrophy, VO2 max, and competition results were mostly used to study the association between ACE I/D polymorphism and improved performance. Despite the fact that the existing literature presents little consensus, there is sufficient scientific evidence to warrant further investigation on the usage of ACE activity and the I/D ACE gene polymorphism as biomarkers of superior athletic performance in humans of specific ethnicities or in athletes involved in certain sports. In this sense, a biomarker would be a substance or genetic component that could be measured to provide a degree of certainty, or an indication, of the presence of a certain trait or characteristic that would be beneficial to the athlete’s performance. Difficulties in interpreting and comparing the results of scientific research on the topic arise from dissimilar protocols and variation in study design. This review aims to investigate the current literature on the use of ACE I/D polymorphism as a biomarker of performance in humans through the comparison of scientific publications.
Design and construction of a system for determining Radon-222 through Alpha spectroscopy
International Nuclear Information System (INIS)
Bonifacio, J.; Iturbe, J.L.
1992-02-01
The study of the present work consists on designing a system to measure gas 222 Rn, using a surface barrier detector, in order to obtaining a more accuracy measure of this isotope by means of an alpha particle spectra and thus to try to avoid the influence of the radioactivity of the isotope descendants of short half life, which are also emitting of alpha particles, since by other methods its should make a series of corrections to obtain the real value of the radon activity. (Author)
The effect of radon 222 on the oral mucosa of rabbits
International Nuclear Information System (INIS)
Minta, A.; Minta, P.; Kochanski, W.
1975-01-01
In experiments on 52 rabbits the authors investigated the effects of radon 222 administered by inhalation on the oral mucosa. The experimental animals were divided into 3 groups: 1 - controls, 2 - receiving radon inhalations in concentration 1 nCi/1, 3- receiving similar inhalations in a concentration of 5 nCi/l of air. Sections involving the lower lip with the mucosa were obtained for investigations after 10, 20, 30 and 60 days of inhalation. In the group of animals receiving radon in lower concentration its stimulating effect manifested itself as stimulation of mesenchymal cells and vascular endothelium. In group 3 sebaceous glands, atrophy and excessive keratinization of epidermis. Taking into account the analogy of these processes the authors concluded that in balneotherapy of oral diseases radon water application with low content of radon 222 may be satisfactory and safe. (author)