WorldWideScience

Sample records for quail trunk nc

  1. Fibronectin promotes differentiation of neural crest progenitors endowed with smooth muscle cell potential

    International Nuclear Information System (INIS)

    Costa-Silva, Bruno; Coelho da Costa, Meline; Melo, Fernanda Rosene; Neves, Cynara Mendes; Alvarez-Silva, Marcio; Calloni, Giordano Wosgrau; Trentin, Andrea Goncalves

    2009-01-01

    The neural crest (NC) is a model system used to investigate multipotency during vertebrate development. Environmental factors control NC cell fate decisions. Despite the well-known influence of extracellular matrix molecules in NC cell migration, the issue of whether they also influence NC cell differentiation has not been addressed at the single cell level. By analyzing mass and clonal cultures of mouse cephalic and quail trunk NC cells, we show for the first time that fibronectin (FN) promotes differentiation into the smooth muscle cell phenotype without affecting differentiation into glia, neurons, and melanocytes. Time course analysis indicated that the FN-induced effect was not related to massive cell death or proliferation of smooth muscle cells. Finally, by comparing clonal cultures of quail trunk NC cells grown on FN and collagen type IV (CLIV), we found that FN strongly increased both NC cell survival and the proportion of unipotent and oligopotent NC progenitors endowed with smooth muscle potential. In contrast, melanocytic progenitors were prominent in clonogenic NC cells grown on CLIV. Taken together, these results show that FN promotes NC cell differentiation along the smooth muscle lineage, and therefore plays an important role in fate decisions of NC progenitor cells

  2. Skeletogenic fate of zebrafish cranial and trunk neural crest.

    Directory of Open Access Journals (Sweden)

    Erika Kague

    Full Text Available The neural crest (NC is a major contributor to the vertebrate craniofacial skeleton, detailed in model organisms through embryological and genetic approaches, most notably in chick and mouse. Despite many similarities between these rather distant species, there are also distinct differences in the contribution of the NC, particularly to the calvariae of the skull. Lack of information about other vertebrate groups precludes an understanding of the evolutionary significance of these differences. Study of zebrafish craniofacial development has contributed substantially to understanding of cartilage and bone formation in teleosts, but there is currently little information on NC contribution to the zebrafish skeleton. Here, we employ a two-transgene system based on Cre recombinase to genetically label NC in the zebrafish. We demonstrate NC contribution to cells in the cranial ganglia and peripheral nervous system known to be NC-derived, as well as to a subset of myocardial cells. The indelible labeling also enables us to determine NC contribution to late-forming bones, including the calvariae. We confirm suspected NC origin of cartilage and bones of the viscerocranium, including cartilages such as the hyosymplectic and its replacement bones (hymandibula and symplectic and membranous bones such as the opercle. The cleithrum develops at the border of NC and mesoderm, and as an ancestral component of the pectoral girdle was predicted to be a hybrid bone composed of both NC and mesoderm tissues. However, we find no evidence of a NC contribution to the cleithrum. Similarly, in the vault of the skull, the parietal bones and the caudal portion of the frontal bones show no evidence of NC contribution. We also determine a NC origin for caudal fin lepidotrichia; the presumption is that these are derived from trunk NC, demonstrating that these cells have the ability to form bone during normal vertebrate development.

  3. Effects of Divergent Selection Body Weight and the Quail Laying Eggs on some Physical and Mechanical Properties of Japanese Quail Eggs

    Directory of Open Access Journals (Sweden)

    mousareza baghani

    2016-08-01

    Full Text Available Introduction Breeding quail and quail egg industrial production because of the high nutritional value of these products has been developing these years. Considering the high demand and economical production, further development in the future is predicted. In order to design and effective utilization of the equipment for transportation, separation, packaging and storage, the physical and mechanical properties of quail eggs are needed. It is of great importance to study the factors which are influencing these properties. Strength of the shell is an important factor in determination of quail egg quality. Quail egg shell strength depends on several variables including specific gravity, egg weight and volume, shell thickness, weight and percentage of shell, hardness, breaking force, breaking energy, egg surface, farming conditions, type and species of birds, nutrition and geometric characteristics of eggs. Materials and Methods In this paper, initially in three phases, at 15 weeks, 19 weeks and 23 weeks, shell strength changes and physical properties of quail eggs on 90 quails during their first period of laying eggs were studied. Measured properties were included dimensions, weight, volume, specific gravity, shell thickness, weight and percentage of shell, breaking force, breaking energy, egg surface and some other properties. In the second part the effects of divergent selection for the bird’s body weight at four weeks of age on the quail eggs of fifth generation were studied. Measured properties were included dimensions, weight, volume, breaking force, breaking energy and some factors for direct and indirect measurement of strength of quail eggs. For direct measurement of the strength of eggshell of quail, two methods were employed: The first method was quasi-static compression test between two parallel plates of the universal testing machine and the second method was measuring specific gravity. In the first method, eggs were compressed between

  4. Quail and other short-lived birds.

    Science.gov (United States)

    Ottinger, M A

    2001-04-01

    Japanese quail are small galliforms that are migratory and generally live 2 to 3years in the wild. Although there is evidence for other environmental cues, they primarily respond to long daylength for regulation of reproduction. In contrast to the Common Tern, a long-lived sea bird that shows little evidence of reproductive aging, Japanese quail follow a well-defined process of aging with evidence of declining function in reproductive, metabolic, and sensory systems. Our studies focus on neuroendocrine changes associated with reproductive aging in the Japanese quail, with emphasis on the male in order to study both endocrine and behavioral components of reproduction and the process of reproductive aging.

  5. Spontaneous, Experimentally Induced, and Transmissible AA Amyloidosis in Japanese Quail ( Coturnix japonica).

    Science.gov (United States)

    Nakayama, Yumi; Kamiie, Junichi; Watanabe, Gen; Suzuki, Kazuhiko; Murakami, Tomoaki

    2017-11-01

    The authors describe a spontaneous case of amyloid A (AA) amyloidosis in an adult female Japanese quail ( Coturnix japonica). The bird developed AA amyloidosis secondary to chronic peritonitis caused by a Gram-negative bacillus infection. Mild amyloid deposition was also identified in the intestinal tract of apparently healthy adult individuals, suggesting that quail may develop intestinal amyloidosis with age. Based on these observations, it was hypothesized that quail can develop AA amyloidosis following inflammatory stimulation with lipopolysaccharide (LPS). Therefore, adult quail were repeatedly injected with LPS and the development of AA amyloidosis was confirmed. The amyloid deposition in this model increased when quail amyloid was intravenously injected as an amyloid-enhancing factor. The experiments were repeated with young quail, but amyloid deposits were not observed following LPS injections. However, AA amyloidosis did develop when quail amyloid was injected in addition to LPS. These results indicated that adult quail develop AA amyloidosis after inflammatory stimulation with LPS. Furthermore, quail AA amyloidosis was shown to have transmissibility regardless of age. Interestingly, the authors found that administration of chicken amyloid fibrils also induced AA amyloidosis in young quail. This is the first report of cross-species transmission of avian AA amyloidosis.

  6. Japanese quail performance under different stocking densities

    International Nuclear Information System (INIS)

    Fahmy, M.O.; EL-Faramawy, A.A.

    2004-01-01

    This experiment was conducted with Japanese quails at the poultry production farm (Poultry Research Unite, Nuclear Research Center, AEA, Inshas, Egypt) to determine the effects of stocking density on the growth, carcass composition, feed conversion, feed efficiency, corticosterone level, immune response and profit potential. A total of 924 Japanese quail chicks were brooded at 2 weeks of age in batteries at 44, 88 and 176 birds / m2 each of 3 replicates. Chicks brooded at 44 and 88 bird / m2 were grew significantly (P<0.05) during the experimental period more than those brooded at 176 bird/m2. Increasing birds density was associated with significant (P<0.05) increase in serum corticosterone level, carcass protein percent, live body weight per m2 and monetary returns. Carcass fat percent and immune response were reduced sharply with increasing quail stocking density. On the other hand, feed conversion was reduced, while feed efficiency was improved (P<0.05) by increasing quail stocking density

  7. Genetic variation and bottleneck in Japanese quail (Coturnix ...

    African Journals Online (AJOL)

    User

    2011-05-16

    May 16, 2011 ... The genetic structure of four strains of Japanese quail (Pharach, Panda, Tuxedo and Golden) was ... valuable laboratory species because of its small body ..... quail and cross-species amplification in chicken and guinea fowl.

  8. Profile Triglycerides Japanese Quail (Coturnix coturnix japonica After Giving Turmeric (Curcuma longa Powder

    Directory of Open Access Journals (Sweden)

    Sukarman Hadi jaya Putra

    2014-12-01

    Full Text Available The purpose of this study was to determine the triglyceride profile of Japanese quail (Coturnix coturnix japonica after being given the parameters of turmeric (Curcuma longa powder; feed intake, profiles of liver triglycerides, profiles of serum triglycerides and profiles of meat triglycerides. This study uses an experimental method with A Completely Randomized Design Pattern. Test animals used were 45 female Japanese quails were divided into 3 groups, namely; P0: quail were not given turmeric powder, P1: quail were given turmeric powder a dose of 54 mg/quail/day, P3: quail were given turmeric powder a dose of 108 mg/quail/day. Each group with 5 replications. Each repeat consists of 3 Japanese quails. Provision of treatment every day for 30 days starting from the age of 14 days. Data were analyzed using analysis of variance (ANOVA followed by Duncan's test with 95% confidence interval (α = 0.05 level. Analysis of the data used is software Minitab software 16. Results showed that the levels of turmeric powder are given in Japanese quail significant (P˂0.05 on liver triglyceride levels, serum and Japanese quail meat but had no significant effect (P˃0.05 on consumption feed. The results showed that the optimal dose of turmeric powder to lower triglyceride levels of Japanese quail is 108 mg/quail/day as evidenced by the highest decrease in liver triglyceride profiles, profiles of serum triglycerides and triglyceride profiles of Japanese quail meat compared with other treatments.

  9. Factors influencing methionine toxicity in young bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1981-01-01

    Young Bobwhite quail (Colinus virginianus) were fed low and adequate protein purified diets with and without excess methionine to evaluate factors affecting methionine toxicity. Growth of quail fed an adequate protein (27%) diet, without supplemental glycine, was depressed by 1.75% and 2.25% excess methionine. Supplemental glycine (.3%) alleviated growth depression caused by 2.25% excess methionine. Quail fed 1.75% and 2.25% excess methionine developed signs of toxicity characterized by weakness, a lowered, outstretched neck when moving, and ataxia. In addition, quail would fall on their sides when disturbed and spin with their heads retracted. These conditions were transient in nature. Growth of quail fed a low protein (18.9%) diet was depressed by 1% and 1.5% excess methionine and DL-homocystine. Quail fed 1% and 1.5% excess methionine in this diet also developed signs of toxicity, the incidence of which was greater and the duration longer than occurred with quail fed adequate protein. Supplementing a low protein (20.15%) diet with .3% or .6% glycine or threonine or a combination of these amino acids did not alleviate growth depression caused by 1.5% excess methionine; however, 2% and 3% supplemental glycine were somewhat effective. Supplements of glycine (2%, 3%) and threonine (1%) completely reversed growth depression from 1% excess methionine but did not influence growth of controls, indicating that both amino acids counteract methionine toxicity. Both glycine and threonine alone improved growth by about the same extent in diets with 1% or 1.5% excess methionine; however, these amino acids alleviated less than 30% of the growth depression resulting from 1.5% excess methionine. The effectiveness of glycine in alleviating methionine toxicity in a low protein diet was decreased, and hemoglobin levels were depressed with 1.5% excess methionine compared to less amounts.

  10. Detection of Genetic Relationship in the Tree of Life of Some Quail Through Molecular Markers Analyses

    Directory of Open Access Journals (Sweden)

    Lamiaa Elsayed Mokhtar Deef

    2017-08-01

    Full Text Available ABSTRACT Quail is an important and interesting group of galliform birds. The Common quail (Coturnix coturnix; the Japanese quail (Coturnix japonica; the Panda quail (Coturnix japonica; the Dotted white quail (Coturnix japonica and the Bobwhite quail (Colinus virginianus were used in this study. PCR-RFLP and SDS-proteins were performed to reveal the genetic characterization and genetic relationship of the studied quails. Analysis of fragments generated by digestion of PCR product with restriction enzyme NlaIII recorded highly polymorphic restriction profiles. There is a wide intraspecific COI, SEMA3E and TLX genes variability among the studied quails. Protein bands varied from10 to 18 between quails with minimum number of bands were in the Dotted white quail (10 bands and the maximum were in the Japanese quail (18 bands as measured by SDS-polyacrylamide gel electrophoresis. The Dotted white quail revealed the lowest similarity to the Bobwhite with a coefficient of 0.18 while The similarity coefficients between the Common quail and each one of the other quails were 0.67, 0.62, 0.45 and 0.42 for the Japanese, Panda, Dotted white and the Bobwhite quails, respectively. The results indicate that, PCR-RFLP and protein analyses are good techniques to evaluate genetic characterization and genetic relationship of these quails.

  11. Performance and carcass characteristics of Japanese quail as ...

    African Journals Online (AJOL)

    The effect of sex and the supplementation of the prebiotic, mannan oligosaccharides (MOS), the acidifier, calcium propionate (CPr) or their combination in the feed of Japanese quail (Coturnix japonica) on their performance and carcass quality was examined in this experimentation. Three hundred, 1-day old Japanese quail ...

  12. Trunk Stability, Trunk Strength and Sport Performance Level in Judo.

    Directory of Open Access Journals (Sweden)

    David Barbado

    Full Text Available Although trunk muscle function has been suggested to be a determinant of judo performance, its contribution to high-level performance in this sport has been poorly studied. Therefore, several tests were used to assess the differences in trunk muscle function between 11 international and 14 national level judo practitioners (judokas. Trunk strength and endurance were assessed using isokinetic tests and core stability was assessed using two protocols: 1 sudden loading, to assess trunk responses to unexpected external perturbations; 2 stable and unstable sitting, to assess the participants' ability to control trunk balance. No differences between groups were found for trunk flexor isokinetic strength, trunk responses against lateral and posterior loading and trunk control while sitting. However, international level judokas showed significantly higher trunk extensor isokinetic strength (p <0.05 and lower trunk angular displacement after anterior trunk loading (p <0.05 than national level judokas. Few and low (r < 0.512 significant correlations were found between strength, endurance and stability parameters, which suggests that trunk strength and endurance are not limiting factors for trunk stability in competitive judokas. These results support the importance of trunk extensor strength and trunk stability against forward perturbations in elite judo performance.

  13. Pairing Behavior of the Monogamous King Quail, Coturnix chinensis.

    Directory of Open Access Journals (Sweden)

    Elizabeth Adkins-Regan

    Full Text Available Animals with socially monogamous mating systems are valuable for discovering proximate mechanisms of prosocial behavior and close social relationships. Especially powerful are comparisons between related species that differ in monogamous tendency. Birds are the most socially monogamous vertebrates. Thus far most research on mechanisms of pairing has used zebra finches, which do not have a relative with a different mating system, however. The goal of the experiments reported here was to develop a new comparative avian system by studying the pairing behavior of a reportedly strongly monogamous quail, the king quail (Coturnix chinensis, a species in the same clade as the less monogamous Japanese quail (Coturnix japonica, the subject of much prior research. In Experiment 1 male-female pairs of king quail housed together were initially avoidant or aggressive but most rapidly progressed to allopreening and huddling. A separation-reunion paradigm reliably elicited both of these behaviors in males that had cohabited for one week. In Experiment 2 the allopreening and huddling behavior of males in cohabiting pairs was highly selective, and a majority of the males were aggressive toward a familiar female that was not the cohabitation partner. In Experiment 3 males were separated from their female cohabitation partners for 9-10 weeks and then given two-choice tests. All but one male spent more time near an unfamiliar female, which may have reflected aggression and shows recognition of and memory for the past pairing experience. Thus king quail show robust, selective and easy to measure pairing behavior that can be reliably elicited with simple separation-reunion testing procedures. Copulation is rarely seen during tests. The behavior of king quail is a striking contrast to that of Japanese quail, providing a new comparative system for discovering mechanisms of behavior related to close social relationships and monogamy.

  14. Pairing Behavior of the Monogamous King Quail, Coturnix chinensis.

    Science.gov (United States)

    Adkins-Regan, Elizabeth

    2016-01-01

    Animals with socially monogamous mating systems are valuable for discovering proximate mechanisms of prosocial behavior and close social relationships. Especially powerful are comparisons between related species that differ in monogamous tendency. Birds are the most socially monogamous vertebrates. Thus far most research on mechanisms of pairing has used zebra finches, which do not have a relative with a different mating system, however. The goal of the experiments reported here was to develop a new comparative avian system by studying the pairing behavior of a reportedly strongly monogamous quail, the king quail (Coturnix chinensis), a species in the same clade as the less monogamous Japanese quail (Coturnix japonica), the subject of much prior research. In Experiment 1 male-female pairs of king quail housed together were initially avoidant or aggressive but most rapidly progressed to allopreening and huddling. A separation-reunion paradigm reliably elicited both of these behaviors in males that had cohabited for one week. In Experiment 2 the allopreening and huddling behavior of males in cohabiting pairs was highly selective, and a majority of the males were aggressive toward a familiar female that was not the cohabitation partner. In Experiment 3 males were separated from their female cohabitation partners for 9-10 weeks and then given two-choice tests. All but one male spent more time near an unfamiliar female, which may have reflected aggression and shows recognition of and memory for the past pairing experience. Thus king quail show robust, selective and easy to measure pairing behavior that can be reliably elicited with simple separation-reunion testing procedures. Copulation is rarely seen during tests. The behavior of king quail is a striking contrast to that of Japanese quail, providing a new comparative system for discovering mechanisms of behavior related to close social relationships and monogamy.

  15. Detection of Marek's disease virus DNA in Japanese quail susceptible to atherosclerosis

    International Nuclear Information System (INIS)

    Pyrzak, R.; Shih, J.C.H.

    1986-01-01

    Marek's disease virus (MDV) was demonstrated as an etiological agent which causes atherosclerosis in the chicken. Since herpes viruses are ubiquitous, incidences of viral atherogenesis in humans and other animals were speculated. In this laboratory, the atherosclerosis susceptible (SUS) and resistant (RES) Japanese quail were developed as the animal model for atherosclerosis research. The susceptibility of the animal might be due to an infection of MDV or a related quail herpes virus (QHV). An initial attempt to isolate viruses from quail and an agar gel precipitin test for MDC were not positive. A DNA hybridization technique was used to determine whether the MDC-DNA existed in the quail cell. The gene library of MDV EcoRl DNA fragments was used to prepare the DNA probe, labeled with [ 32 P] by nick translation. Dot hybridizations were carried out by mixing the MDV-DNA probe with DNAs isolated from quail tissues. A high stringent condition was used. From this experiment it was found that the tissues from the SUS quail were hybridization positive, but most of them from RES quail were negative. When aortas were compared, the severe atherosclerotic had a strong hybridization (3-4 cop. of genome/cell) whereas the others hybridized moderately (1 cop./cell). It was concluded that genes from MDV or a QHV indeed existed in Japanese quail

  16. Histomorphometric study of brachiocephalic artery of Japanese quail.

    Science.gov (United States)

    Shariati, Sarah; Rahmanifar, Farhad; Tamadon, Amin

    2015-01-01

    Brachiocephalic arteries in quails are large arteries which are arising separately from the aortic arch. The aim of the present study was to determine the histomorphometric aspects of brachiocephalic arteries in the Japanese quail. The different layers of the brachiocephalic artery were studied quantitatively in 10, 20 and 60 days-old Japanese quail; (n = 6) and both sexes. Luminal diameter, thickness of the intima, media and adventitia, the percentage of the intima, media and adventitia, as compared with the total wall thickness were determined. It was found that luminal diameter and whole artery thickness increased by age (p < 0.05). In addition, the tunica media was the thickest layer, then tunica intima and at last tunica adventitia (p < 0.05). The muscularity of the right brachiocephalic artery was more than that of the left one (p < 0.05). Histomorphometric study of brachiocephalic arteries of Japanese quails showed that increasing of age causes increase of internal and external diameters of the artery and this increase in females was more than males.

  17. Pharmacokinetics of enrofloxacin and marbofloxacin in Japanese quails and common pheasants.

    Science.gov (United States)

    Lashev, L D; Dimitrova, D J; Milanova, A; Moutafchieva, R G

    2015-04-01

    The pharmacokinetics of enrofloxacin and marbofloxacin was studied in Japanese quails and common pheasants. Healthy mature birds from both species and both genders were treated intravenously and orally with enrofloxacin (10 mg/kg) and marbofloxacin (5 mg/kg). After intravenous administration enrofloxacin was extensively metabolised to ciprofloxacin. Metabolites of marbofloxacin were not detected. Values of volume of distribution were respectively 4.63 l/kg and 3.67 l/kg for enrofloxacin and 1.56 l/kg and 1.43 l/kg for marbofloxacin. In quails, total body clearance values were higher than those in pheasants and other avian species. After oral application enrofloxacin was rapidly absorbed in quails, more rapidly than marbofloxacin. Pheasants absorbed both antimicrobials at a lower rate. Higher bioavailability was observed for marbofloxacin (118%). Relatively low bioavailability was established in quails for enrofloxacin (26.4%), accompanied by extensive conversion to ciprofloxacin. Generally, quails absorbed and eliminated both fluoroquinolones more rapidly than pheasants; the latter showed pharmacokinetics similar to poultry. Because of favourable pharmacokinetic properties, marbofloxacin should be preferred for oral administration in Japanese quails and pheasants for treatment of infections caused by equally susceptible pathogens.

  18. Coronavirus–associated enteritis in a quail farm

    Directory of Open Access Journals (Sweden)

    Antonio Camarda

    2010-01-01

    Full Text Available An enteric syndrome observed in semi-intensively reared quails is described. The affected birds showed depression, severe diarrhoea and dehydration. The mortality occurred particularly in young birds. At necropsy, the prominent lesion was catarrhal enteritis. Laboratory investigations demonstrated the presence of coronavirus in the gut of dead animals. No additional pathogens were detected. To our knowledge, this is the first evidence for the presence of CoVs in quail with enteritis.

  19. Effect of Led Lighting Colors for Laying Japanese Quails

    Directory of Open Access Journals (Sweden)

    KC Nunes

    Full Text Available ABSTRACT Time of exposure and light intensity rearing house may affect the performance and egg quality of laying quails. This research aimed at evaluating the live performance, egg quality, biometry of the reproductive system, and the gastrointestinal tract of Japanese quails (Coturnix coturnix japonica exposed to artificial light-emitting diodes (LED of different colors in comparison with fluorescent lamps. A total of 240 Japanese quails were distributed in completely randomized experimental design with four treatments (fluorescent lamp, and green, red, or blue LED lamps with six replicates of 10 birds each. Average egg weight and eggshell thickness were different (p0.05. The oviduct of 64-d-old hens exposed to green LED lighting was shorter (p<0.05 than those exposed to the fluorescent lamp. Red LED can be used to replace the fluorescent lamps, as they promote the same live performance, egg quality, and morphological development of the reproductive tract of laying Japanese quails.

  20. Leader Cells Define Directionality of Trunk, but Not Cranial, Neural Crest Cell Migration

    Directory of Open Access Journals (Sweden)

    Jo Richardson

    2016-05-01

    Full Text Available Collective cell migration is fundamental for life and a hallmark of cancer. Neural crest (NC cells migrate collectively, but the mechanisms governing this process remain controversial. Previous analyses in Xenopus indicate that cranial NC (CNC cells are a homogeneous population relying on cell-cell interactions for directional migration, while chick embryo analyses suggest a heterogeneous population with leader cells instructing directionality. Our data in chick and zebrafish embryos show that CNC cells do not require leader cells for migration and all cells present similar migratory capacities. In contrast, laser ablation of trunk NC (TNC cells shows that leader cells direct movement and cell-cell contacts are required for migration. Moreover, leader and follower identities are acquired before the initiation of migration and remain fixed thereafter. Thus, two distinct mechanisms establish the directionality of CNC cells and TNC cells. This implies the existence of multiple molecular mechanisms for collective cell migration.

  1. Caecal worm, Aulonocephalus pennula, infection in the northern bobwhite quail, Colinus virginianus

    Directory of Open Access Journals (Sweden)

    Nicholas R. Dunham

    2017-04-01

    Full Text Available Parasitic nematodes that infect quail have been understudied and long been dismissed as a problem in quail management. Within the Rolling Plains ecoregion of Texas, an area that has experienced quail population “boom and bust” cycles and ultimately a general decline, the need to determine why Northern bobwhite (Colinus virginianus populations are diminishing has increased in priority. Previously, caecal parasites have been documented to cause inactivity, weight loss, reduced growth, inflammation to the caecal mucosa, and even death. The caecal worm Aulonocephalus pennula is an intestinal nematode parasite that is commonly found within the caecum of quail, as well as many other avian species. In the Rolling Plains ecoregion, A. pennula has been documented to have as high as a 98% prevalence in bobwhite quail samples; however, the effect it has on its host is not well understood. The present study documents A. pennula causes no pathological changes within the caeca of the Northern bobwhite. However, there is concern for disruption of digestion and the possible implications of infection for wild bobwhite quail survival are discussed.

  2. Comparative reproductive and physiological responses of northern bobwhite and scaled quail to water deprivation

    Science.gov (United States)

    Giuliano, W.M.; Patino, R.; Lutz, R.S.

    1998-01-01

    We compared reproductive and physiological responses of captive female northern bobwhite (Colinus virginianus) and scaled quail (Callipepla squamata) under control and water deprivation conditions. Scaled quail required less food and water to reproduce successfully under control conditions than northern bobwhite. Additionally, in scaled quail, serum osmolality levels and kidney mass were unaffected by water deprivation, whereas in northern bobwhite, serum osmolality levels increased and kidney mass declined. This finding indicates that scaled quail may have osmoregulatory abilities superior to those of northern bobwhite. Under control conditions, northern bobwhite gained more body mass and produced more but smaller eggs than scaled quail. Under water deprivation conditions, northern bobwhite lost more body mass but had more laying hens with a higher rate of egg production than scaled quail. Our data suggest that northern bobwhite allocated more resources to reproduction than to body maintenance, while scaled quail apparently forego reproduction in favor of body maintenance during water deprivation conditions.

  3. Effect of chamomile extract on the welfare of laying Japanese quail

    Directory of Open Access Journals (Sweden)

    Karine Isabela Tenório

    Full Text Available ABSTRACT The objective of this study was to evaluate the effect of chamomile extract on Japanese quail on their performance, animal behavior, tonic immobility, body injuries, and surface temperature. The trial was conducted using 108 quail distributed in a completely randomized experimental design, with three treatments (0, 2.5, and 5.0 g chamomile/kg of feed, six replicates, and six birds per treatment, evaluated in six measures repeated in time (14, 28, 42, 56, 70, and 84 days of trial. The inclusion of chamomile presented a quadratic effect on sitting behavior, estimating the inclusion of 1.8 g chamomile/kg to maximize this behavior. There was a decreasing linear effect for aggressive pecking, that is, the higher the inclusion of chamomile in the diet, the lower the expression of this behavior. The inclusion of 1.8-5.0 g chamomile/kg in a Japanese quail diet reduces the behavior of aggressive pecking, in addition to keeping the birds seated longer. These results are innovative because they show in the literature for the first time that chamomile supplemented in Japanese quail diets has the capacity to modulate the behavior of the quail, leading to an improvement in the welfare of quail raised in cages.

  4. Comparison of trunk kinematics in trunk training exercises and throwing.

    Science.gov (United States)

    Stodden, David F; Campbell, Brian M; Moyer, Todd M

    2008-01-01

    Strength and conditioning professionals, as well as coaches, have emphasized the importance of training the trunk and the benefits it may have on sport performance and reducing the potential for injury. However, no data on the efficacy of trunk training support such claims. The purpose of this study was to examine the maximum differential trunk rotation and maximum angular velocities of the pelvis and upper torso of participants while they performed 4 trunk exercises (seated band rotations, cross-overs, medicine ball throws, and twisters) and compare these trunk exercise kinematics with the trunk kinematics demonstrated in actual throwing performance. Nine NCAA Division I baseball players participated in this study. Each participant's trunk kinematics was analyzed while he performed 5 repetitions of each exercise in both dominant and nondominant rotational directions. Results indicated maximum differentiated rotation in all 4 trunk exercises was similar to maximum differentiated rotation (approximately 50-60 degrees) demonstrated in throwing performance. Maximum angular velocities of the pelvis and upper torso in the trunk exercises were appreciably slower (approximately 50% or less) than the angular velocities demonstrated during throwing performance. Incorporating trunk training exercises that demonstrate sufficient trunk ranges of motion and velocities into a strength and conditioning program may help to increase ball velocity and/or decrease the risk injury.

  5. Studies on the riboflavin, niacin, pantothenic acid and choline requirements of young bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1974-01-01

    Four experiments were conducted to examine the riboflavin, niacin, pantothenic acid and choline requirements of young Bobwhite quail. Quail fed purified diets deficient in either riboflavin, niacin, pantothenic acid or choline grew poorly and high mortality occurred by 5 weeks of age. Under the conditions of these experiments, it was found that: (1) young quail require approximately 3.8 mg. riboflavin/kg. diet for satisfactory growth and survival; (2) no more than 31 mg. niacin/kg. diet are required for normal growth and survival of young quail; (3) the requirement for pantothenic acid is higher than has previously been reported, quail in these studies requiring 12.6 mg. pantothenic acid/kg. feed for growth and survival; and (4) the requirement for choline for reducing mortality is approximately 1000 mg./kg., while the amount necessary for normal growth of young quail is no greater than 1500 mg./kg. when the diet contains ample amounts of methionine. Quail fed a niacin-deficient diet developed stiff, shortened feathers and an erythema about the head; those receiving a riboflavin-deficient ration developed enlarged hocks and bowed legs, as did quail fed diets low or devoid of choline. Aside from slow growth, poor feathering was the only other indication that a deficient diet was being fed when quail were placed on a basal ration without pantothenic acid for five weeks.

  6. Characterization of Rous sarcoma virus-related sequences in the Japanese quail.

    Science.gov (United States)

    Chambers, J A; Cywinski, A; Chen, P J; Taylor, J M

    1986-08-01

    We detected sequences related to the avian retrovirus Rous sarcoma virus within the genome of the Japanese quail, a species previously considered to be free of endogenous avian leukosis virus elements. Using low-stringency conditions of hybridization, we screened a quail genomic library for clones containing retrovirus-related information. Of five clones so selected, one, lambda Q48, contained sequence information related to the gag, pol, and env genes of Rous sarcoma virus arranged in a contiguous fashion and spanning a distance of approximately 5.8 kilobases. This organization is consistent with the presence of an endogenous retroviral element within the Japanese quail genome. Use of this element as a high-stringency probe on Southern blots of genomic digests of several quail DNA demonstrated hybridization to a series of high-molecular-weight bands. By slot hybridization to quail DNA with a cloned probe, it was deduced that there were approximately 300 copies per diploid cell. In addition, the quail element also hybridized at low stringency to the DNA of the White Leghorn chicken and at high stringency to the DNAs of several species of jungle fowl and both true and ruffed pheasants. Limited nucleotide sequencing analysis of lambda Q48 revealed homologies of 65, 52, and 46% compared with the sequence of Rous sarcoma virus strain Prague C for the endonuclease domain of pol, the pol-env junction, and the 3'-terminal region of env, respectively. Comparisons at the amino acid level were also significant, thus confirming the retrovirus relatedness of the cloned quail element.

  7. QUAIL: A Quantitative Security Analyzer for Imperative Code

    DEFF Research Database (Denmark)

    Biondi, Fabrizio; Wasowski, Andrzej; Traonouez, Louis-Marie

    2013-01-01

    Quantitative security analysis evaluates and compares how effectively a system protects its secret data. We introduce QUAIL, the first tool able to perform an arbitrary-precision quantitative analysis of the security of a system depending on private information. QUAIL builds a Markov Chain model...... of the system’s behavior as observed by an attacker, and computes the correlation between the system’s observable output and the behavior depending on the private information, obtaining the expected amount of bits of the secret that the attacker will infer by observing the system. QUAIL is able to evaluate...... the safety of randomized protocols depending on secret data, allowing to verify a security protocol’s effectiveness. We experiment with a few examples and show that QUAIL’s security analysis is more accurate and revealing than results of other tools...

  8. [Effect of krypton-containing gas mixture on Japanese quail embryo development].

    Science.gov (United States)

    Kussmaul', A R; Gur'eva, T S; Dadasheva, O A; Pavlov, N B; Pavlov, B N

    2008-01-01

    Investigated were effects of gas mixture with up to 3.0 kgs/cm2 of krypton on the embryonic development of domesticated Japanese quail (Coturnix coturnix japonica dom.). Results demonstrated absence of a serious krypton effect on Japanese quail embryos. Development of embryos proceeded in due course; morphometrically the experimental embryos were essentially similar to controls. It should be noted that despite exposure to acute hypoxic hypoxia during the initial 12 hours of development in the krypton-containing gas mixture, viability of quail embryos was high enough which can be ascribed to the krypton protective action. Besides, an additional experiment showed that krypton partial pressure of 5-5.5 kgs/cm2 produces the narcotic effect on adult Japanese quails.

  9. Microsatellite loci in Japanese quail and cross-species amplification in chicken and guinea fowl

    Directory of Open Access Journals (Sweden)

    Mizutani Makoto

    2002-03-01

    Full Text Available Abstract In line with the Gifu University's initiative to map the Japanese quail genome, a total of 100 Japanese quail microsatellite markers isolated in our laboratory were evaluated in a population of 20 unrelated quails randomly sampled from a colony of wild quail origin. Ninety-eight markers were polymorphic with an average of 3.7 alleles per locus and a mean heterozygosity of 0.423. To determine the utility of these markers for comparative genome mapping in Phasianidae, cross-species amplification of all the markers was tested with chicken and guinea fowl DNA. Amplification products similar in size to the orthologous loci in quail were observed in 42 loci in chicken and 20 loci in guinea fowl. Of the cross-reactive markers, 57.1% in chicken and 55.0% in guinea fowl were polymorphic when tested in 20 birds from their respective populations. Five of 15 markers that could cross-amplify Japanese quail, chicken, and guinea fowl DNA were polymorphic in all three species. Amplification of orthologous loci was confirmed by sequencing 10 loci each from chicken and guinea fowl and comparing with them the corresponding quail sequence. The microsatellite markers reported would serve as a useful resource base for genetic mapping in quail and comparative mapping in Phasianidae.

  10. Effect of various probiotics on growth performance of Japanese quails

    Directory of Open Access Journals (Sweden)

    P. R. Sirsat

    Full Text Available An experiment was conducted to study the effect of various probiotics on the performance of Japanese Quails. One hundred Japanese quail chicks were weighed individually and they were uniformly distributed equally to four dietary treatments consisting 25 birds in each. The starter and finisher diets were containing ME 2800 and 2600 Kcal/kg and protein 25 and 23 % respectively. The group T0(Controll fed standard quail diet and T1,T2 and T3 were fed probiotic Saccharomyces cerevisiae, Lactobacillus sporogenes and Saccharomyces boulardii @ 0.05 % in diet. The study was conducted for six weeks in the same managemental condition. Weekly live body weight and feed consumption were recorded. The group supplemented with Saccharomyces cerevisiae resulted in significantly higher growth rate and showed higher weight gain. The average feed efficiency and nitrogen retention were significantly higher in group supplemented with Saccharomyces cerevisiae. The cost of production /100gm of meat was found to be Rs.7.10, 6.84, 7.55 and 8.37 respectively in T0 to T3 groups. Thus, the study indicated that supplementation of Saccharomyces cerevisiae in the diet of Japanese quails was effective in improving performance of the quails. [Vet World 2009; 2(8.000: 321-322

  11. Stimulation of Egg Production in Japanese Quails by Enriching Feed with Residual Yeast

    Directory of Open Access Journals (Sweden)

    Letitia Oprean

    2010-05-01

    Full Text Available Quail eggs are more and more approved for consumers because they bring many benefits to the human body. Therefore, quails breeding for eggs production have become a very profitable business. Residual yeast may be a nutritional supplement, especially rich in vitamins and proteins. This article studies the influence of residual beer yeast on egg laying in Japanese quails. In order to be integrated into the diet of quails the yeast has undergone a process of autolysis; its influence has been examined on separate groups. The results were reported as a percentage compared with the control group, where the feed does not contain this supplement. Due to its content rich in vitamins and proteins, the residual beer yeast used in feeding the quails bred for eggs stimulates egg laying.

  12. Genetic parameters of growth, body, and egg traits in Japanese quails

    African Journals Online (AJOL)

    SARAH

    2014-07-31

    Jul 31, 2014 ... egg traits as well as genetic and phenotypic relationships between these traits in Japanese quails reared in the ... Japanese quail is the smallest avian species farmed .... 2 = cross classified “family” variance component.

  13. Humoral immunity of Japanese quail subjected to microwave radiation during embryogeny

    International Nuclear Information System (INIS)

    Hamrick, P.E.; McRee, D.I.; Thaxton, P.; Parkhurst, C.R.

    1977-01-01

    Fertile Japanese quail eggs were exposed to continuous wave microwave radiation at an intensity of 5 mW/cm 2 (50 W/m 2 ) and a frequency of 2450 Mhz. The absorbed power density was determined to be 4.03 W/kg. The eggs were exposed throughout the first 12 days of the normal incubation period of 17.5 days. Non-exposed control eggs were incubated in a chamber identical to the exposure chamber. After hatching, exposed and control quail were reared in the conventional laboratory manner. Weekly body weight measurements were made to compare the growth patterns of exposed and control quail. The weights of the exposed male at the ages of 4 and 5 weeks were 12 and 7%, respectively, less than the control males. These differences approached statistical significance (P<=0.05). At 5 weeks of age the quail were challenged with sheep red blood cells (SRBC) and the levels of the anti-SRBC antibodies were determined. The levels of specific anti-SRBC antibodies, determined 4 days after antigen challenges, were of the same magnitude for both the exposed and control quail. Following this assessment of humoral immunity, the quail were sacrificed and the bursa of Fabricius and spleen were removed and a comparison was made of exposed and control birds. The weights of the bursa of Fabricius and spleen were not altered significantly by the microwave exposure. (author)

  14. A survey of Japanese quail (Coturnix coturnix japonica) farming in selected areas of Bangladesh.

    Science.gov (United States)

    Nasar, Abu; Rahman, Aminoor; Hoque, Nazmul; Kumar Talukder, Anup; Das, Ziban Chandra

    2016-09-01

    To investigate the status, problems and prospects of Japanese quail (Coturnix coturnix japonica) farming in selected areas of Bangladesh. The study was conducted in 14 districts of Bangladesh, viz., Dhaka, Narayanganj, Munshiganj, Mymensingh, Netrakona, Faridpur, Jessore, Khulna, Satkhira, Kushtia, Bogra, Naogaon, Comilla, and Sylhet during the period from July 2011 to June 2012. A total of 52 quail farmers were interviewed for data collection using a structured questionnaire. Focus group discussions were also carried out with unsuccessful farmers and those want to start quail farming. Workers of quail farms, quail feeds and medicine suppliers, quail eggs and meat sellers were also interviewed regarding the issue. Out of 52 farms, 86.5% were operated by male, 67.3% farmers did not receive any training and 92.3% farmers had no earlier experience of quail farming although 58.0% farmers primary occupation was quail farming. Most of the farms (63.4%) were mixed in type having ≤5000 birds of two or three varieties. About 80.7% farms were operated separately round the year with no other poultry and 83.0% farmers wanted to expand their farming. The average pullet weight 145.0±0.12, 110.0±0.07, 120.0±0.22, and 128.0±0.17 g; age at the first lay 46.0±0.04, 42.0±0.31, 42.0±0.09, and 45.2±0.05 days; rearing period 15.0±0.01, 12.0±0.14, 15.0±0.32, and 15.2±0.18 months; culling period 15.5±0.14, 13.0±0.06, 15.0±0.03, and 15.4±0.26 months were for layer, parent stock, hatchery, and mixed farms, respectively. Most of the layer farms had an average egg production of ≤5000/day and net profit BDT 0.75/egg. However, an average number of birds, hatchability and net profit per day-old-chick were ≤5000, 76.8% and BDT 2.75, respectively, in the hatchery. Broiler quails were sold at 30 days with mean weight of 110.8 g and net profit BDT 9.02/bird. The major constraints of quail farming were higher feed price, outbreak of endemic diseases, lack of proper knowledge

  15. Short barb: a feather structure mutation in Japanese quail.

    Science.gov (United States)

    Fulton, J E; Roberts, C W; Nichols, C R; Cheng, K M

    1982-12-01

    A type of feather structure abnormality in Japanese quail resulting in shortened barbs on contour feathers was found to be controlled by a single autosomal recessive gene, sh (short barb). The mutation was first identified in a full-sib family from the University of British Columbia wild type line. Unlike other feather structure mutations in Japanese quail reported previously in literature, the short barb mutation is not associated with poor reproduction.

  16. A survey of Japanese quail (Coturnix coturnix japonica farming in selected areas of Bangladesh

    Directory of Open Access Journals (Sweden)

    Abu Nasar Md. Aminoor Rahman

    2016-09-01

    Full Text Available Aim: To investigate the status, problems and prospects of Japanese quail (Coturnix coturnix japonica farming in selected areas of Bangladesh. Materials and Methods: The study was conducted in 14 districts of Bangladesh, viz., Dhaka, Narayanganj, Munshiganj, Mymensingh, Netrakona, Faridpur, Jessore, Khulna, Satkhira, Kushtia, Bogra, Naogaon, Comilla, and Sylhet during the period from July 2011 to June 2012. A total of 52 quail farmers were interviewed for data collection using a structured questionnaire. Focus group discussions were also carried out with unsuccessful farmers and those want to start quail farming. Workers of quail farms, quail feeds and medicine suppliers, quail eggs and meat sellers were also interviewed regarding the issue. Results: Out of 52 farms, 86.5% were operated by male, 67.3% farmers did not receive any training and 92.3% farmers had no earlier experience of quail farming although 58.0% farmers primary occupation was quail farming. Most of the farms (63.4% were mixed in type having ≤5000 birds of two or three varieties. About 80.7% farms were operated separately round the year with no other poultry and 83.0% farmers wanted to expand their farming. The average pullet weight 14.5±0.12, 11.0±0.07, 12.0±0.22, and 12.8±0.17 g; age at the first lay 46.0±0.04, 42.0±0.31, 42.0±0.09, and 45.2±0.05 days; rearing period 15.0±0.01, 12.0±0.14, 15.0±0.32, and 15.2±0.18 months; culling period 15.5±0.14, 13.0±0.06, 15.0±0.03, and 15.4±0.26 months were for layer, parent stock, hatchery, and mixed farms, respectively. Most of the layer farms had an average egg production of ≤5000/day and net profit BDT 0.75/egg. However, an average number of birds, hatchability and net profit per day-old-chick were ≤5000, 76.8% and BDT 2.75, respectively, in the hatchery. Broiler quails were sold at 30 days with mean weight of 110.8 g and net profit BDT 9.02/bird. The major constraints of quail farming were higher feed price

  17. Distribution and metabolism of selenite and selenomethionine in the Japanese quail.

    Science.gov (United States)

    Anan, Yasumi; Ohbo, Ai; Tani, Yuta; Hatakeyama, Yoshiko; Yawata, Ayako; Ogra, Yasumitsu

    2012-05-01

    Compared to the many studies on the physiological and toxicological effects of selenium (Se) in mammals, avian Se metabolism is still an unexplored topic. Some birds are useful as poultry for human nutrition. Moreover, birds belong to higher trophic levels in the biosphere and thus may play an important role in Se circulation in the ecosystem in the same way as mammals do. In this study, we analyzed the distribution and metabolism of Se in an experimental bird, the Japanese quail, which was fed drinking water containing sodium selenite or selenomethionine (SeMet). The highest concentration of Se was detected in the pancreas, followed by down feathers, liver, and kidneys. SeMet was more efficiently incorporated into the quail than selenite. The specific and preferable distribution of Se to the high molecular weight fraction in the serum of the quail was observed only in the SeMet-ingestion group. As in mammals, selenosugar and trimethylselenonium were the major metabolites in quail excreta. Three unknown Se metabolites were detected by HPLC-ICP-MS. Although part of the metabolic pathway of Se in the Japanese quail fed selenite and SeMet was the same as that observed in mammals, the bird also showed certain avian-specific metabolic process for Se.

  18. The development of ovary in quail's embryo | Rong | African Journal ...

    African Journals Online (AJOL)

    The experiment was conducted to study the development of ovary in quails' embryos which were incubated for 4 to 17 days and incubated out for 1 day. The quails' embryos or gonads were cut out and HE staining was carried out. The results showed that when embryo was hatched for 4 days, lots of primordial germ cells ...

  19. Quail FMO3 gene cloning, tissue expression profiling, polymorphism detection and association analysis with fishy taint in eggs.

    Directory of Open Access Journals (Sweden)

    Fengtao Mo

    Full Text Available Quail eggs comprise a significant and favourable part of table eggs in certain countries. Some quail eggs, however, present fishy off-flavor which directly influences their quality. It is reported that flavin-containing monooxygenase 3 (FMO3 is associated with fish-odour trait in human and animal products. FMO3 is responsible for the degradation of trimethylamine (TMA in vivo. Loss-of-function mutations in FMO3 gene can result in defective TMA N-oxygenation, giving rise to disorder known as "fish-odour syndrome" in human, as well as the fishy off-flavor in cow milk and chicken eggs. In order to reveal the genetic factor of fishy taint in quail eggs, we cloned the cDNA sequence of quail FMO3 gene, investigated FMO3 mRNA expression level in various tissues, detected SNPs in the coding region of the gene and conducted association analysis between a mutation and the TMA content in quail egg yolks. The 1888 bp cDNA sequence of quail FMO3 gene encoding 532 amino acids was obtained and characterized. The phylogenetic analysis revealed quail FMO3 had a closer relationship with chicken FMO3. The FMO3 mRNA was highly expressed in liver and kidney of quail. Nine SNPs were detected in the coding sequence of quail FMO3 gene, including a nonsense mutation (Q319X which was significantly associated with the elevated TMA content in quail egg yolks. Genotype TT at Q319X mutation loci was sensitive to choline. With addition of choline in the feed, the quails with homozygote TT at the Q319X mutation loci laid fish-odour eggs, indicating an interaction between genotype and diet. The results indicated that Q319X mutation was associated with the fishy off-flavor in quail eggs. Identification of the unfavorable allele T of quail FMO3 gene can be applied in future quail breeding to eliminate fishy off-flavor trait in quail eggs.

  20. Hematological and biochemical effects of chronic CO exposure on the Japanese quail

    Energy Technology Data Exchange (ETDEWEB)

    Jaeger, J.J.; McGrath, J.J.

    1975-01-01

    Japanese Quail were exposed to a concentration of 300 to 350 ppm CO to maintain an equilibrium carboxyhemoglobin concentration of 30% for a period of 4 weeks. Compared to a control group of birds maintained in an identical chamber, the CO-exposed quail demonstrated increases in hematocrit ratio and hemoglobin concentration. At the end of the exposure period, the CO-exposed quail had significantly larger plasma glucose concentrations than the control birds. Cardiac and skeletal muscle carbohydrate stores were not affected by chronic CO exposure.

  1. [Composition of chicken and quail eggs].

    Science.gov (United States)

    Closa, S J; Marchesich, C; Cabrera, M; Morales, J C

    1999-06-01

    Qualified food composition data on lipids composition are needed to evaluate intakes as a risk factor in the development of heart disease. Proximal composition, cholesterol and fatty acid content of chicken and quail eggs, usually consumed or traded, were analysed. Proximal composition were determined using AOAC (1984) specific techniques; lipids were extracted by a Folch's modified technique and cholesterol and fatty acids were determined by gas chromatography. Results corroborate the stability of eggs composition. Cholesterol content of quail eggs is similar to chicken eggs, but it is almost the half content of data registered in Handbook 8. Differences may be attributed to the analytical methodology used to obtain them. This study provides data obtained with up-date analytical techniques and accessory information useful for food composition tables.

  2. Eyeworm infections of Oxyspirura petrowi, Skrjabin, 1929 (Spirurida: Thelaziidae), in species of quail from Texas, New Mexico and Arizona, USA.

    Science.gov (United States)

    Dunham, N R; Kendall, R J

    2017-07-01

    Northern bobwhite (Colinus virginianus) and Scaled quail (Callipepla squamata) have been declining steadily throughout much of their historical range over the past few decades. Even the Rolling Plains of Texas, historically rich with wild quail and one of the last remaining quail strongholds, has been suffering a population decline, most notably since 2010. Gambel's quail (Callipepla gambelii) have also been experiencing their own decline throughout their respective range, but not as significant as that of other species of quail. Eyeworms (Oxyspirura petrowi) in quail have been recognized for years but not thoroughly studied until recently. New research reveals that O. petrowi infection can cause inflammation, oedema, and cellular damage to the eye of the quail host. The objective of this research was to better understand the prevalence of the eyeworm infection in different quail species, expand on known distribution, and determine if there is a relationship between location and species infected with eyeworms. Northern bobwhite, Scaled quail and Gambel's quail were hunter-donated from one county within Texas, New Mexico and Arizona, and examined for the prevalence, mean abundance and mean intensity of eyeworm infection from November 2013 to February 2014. Quail from every location were found to have individuals with a varying degree of eyeworm infection. This is the first study to document eyeworm infection in Gambel's quail and in quail in New Mexico and Arizona, and reports the highest eyeworm infection found in Northern bobwhite and Scaled quail.

  3. Association of Tyrosinase (TYR and Tyrosinase-related Protein 1 (TYRP1 with Melanic Plumage Color in Korean Quails (

    Directory of Open Access Journals (Sweden)

    Ying Xu

    2013-11-01

    Full Text Available TYR (Tyrosinase and TYRP1 (Tyrosinase-related protein 1 play crucial roles in determining the coat color of birds. In this paper, we aimed to characterize the relationship of TYR and TYRP1 genes with plumage colors in Korean quails. The SNPs were searched by cDNA sequencing and PCR-SSCP in three plumage color Korean quails (maroon, white and black plumage. Two SNPs (367T→C and 1153C→T were found in the coding region of TYRP1 gene, but had no significant association with plumage phenotype in Korean quails. The expression of TYR was higher in black plumage quails than that in maroon plumage quails. In contrast, the expression of TYRP1 was lower in black plumage quails than that in maroon plumage quails. This study suggested that the melanic plumage color in Korean quails may be associated with either increased production of TYR or decreased production of TYRP1.

  4. improving the hygienic quality of quail carcasses by gamma irradiation

    International Nuclear Information System (INIS)

    Nasr, E.H.A.

    2002-01-01

    this investigation aimed to use gamma irradiation doses as compared to chemical preservative sodium tripolyphosphate (stpp) for increasing the shelf-life and improving the hygienic quality of quail carcasses during cold and frozen storage. one hundred quail carcasses were examined for the presence of salmonella. the examination illustrated that 70 carcasses from all examined carcasses were positive for salmonella. therefore, the contaminated quail carcasses were gamma irradiated at 2,4,6 and 8 kGy doses and soaking in 3% stpp and the effect of these treatments on the organoleptic, microbiological aspects and chemical properties during cold (4±1 o C) and frozen storage (-18 o C) of samples under investigation were evaluated .the results indicated that, the chemical composition of samples did not alter by gamma irradiation and soaking in STPP treatments. furthermore, treatments had no deleterious effects on the organoleptic properties of quail samples. irradiation of samples at doses of 2,4,6 and 8 kGy or soaking in STPP greatly reduced its microbial count and prolonged its shelf- life for 12,15,21,24 and 9 days at 4±1 o C, respectively against only 6 days for control samples

  5. Complete nucleotide sequence of the Coturnix chinensis (blue-breasted quail) mitochondrial genome and a phylogenetic analysis with related species.

    Science.gov (United States)

    Nishibori, M; Tsudzuki, M; Hayashi, T; Yamamoto, Y; Yasue, H

    2002-01-01

    Coturnix chinensis (blue-breasted quail) has been classically grouped in Galliformes Phasianidae Coturnix, based on morphologic features and biochemical evidence. Since the blue-breasted quail has the smallest body size among the species of Galliformes, in addition to a short generation time and an excellent reproductive performance, it is a possible model fowl for breeding and physiological studies of the Coturnix japonica (Japanese quail) and Gallus gallus domesticus (chicken), which are classified in the same family as blue-breasted quail. However, since its phylogenetic position in the family Phasianidae has not been determined conclusively, the sequence of the entire blue-breasted quail mitochondria (mt) genome was obtained to provide genetic information for phylogenetic analysis in the present study. The blue-breasted quail mtDNA was found to be a circular DNA of 16,687 base pairs (bp) with the same genomic structure as the mtDNAs of Japanese quail and chicken, though it is smaller than Japanese quail and chicken mtDNAs by 10 bp and 88 bp, respectively. The sequence identity of all mitochondrial genes, including those for 12S and 16S ribosomal RNAs, between blue-breasted quail and Japanese quail ranged from 84.5% to 93.5%; between blue-breasted quail and chicken, sequence identity ranged from 78.0% to 89.6%. In order to obtain information on the phylogenetic position of blue-breasted quail in Galliformes Phasianidae, the 2,184 bp sequence comprising NADH dehydrogenase subunit 2 and cytochrome b genes available for eight species in Galliformes [Japanese quail, chicken, Gallus varius (green junglefowl), Bambusicola thoracica (Chinese bamboo partridge), Pavo cristatus (Indian peafowl), Perdix perdix (gray partridge), Phasianus colchicus (ring-neck pheasant), and Tympanchus phasianellus (sharp-tailed grouse)] together with that of Aythya americana (redhead) were examined using a maximum likelihood (ML) method. The ML analyses on the first/second codon positions

  6. Influence of dietary protein and excess methionine on choline needs for young bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1982-01-01

    Experiments were conducted with young Bobwhite quail (Colinus virginianus) to investigate the effect of differing dietary protein levels and nondetrimental amounts of excess methionine on choline needs. Growth and feed consumption of quail fed an adequate (27.3%) protein purified diet supplemented with 2000 mg/kg of choline were unaffected by increasing the level of excess methionine to 1.75%; however, greater amounts (2.0%, 2.25%) of excess methionine depressed growth (P less than .01), reduced feed consumption (P less than .01), and decreased feed utilization (P less than .05). Quail fed a purified diet containing 13.85% protein and 515 mg/kg of choline grew poorly. Growth was unaffected by additional choline in this diet. Growth was suboptimal among quail fed purified diets containing adequate or high (41.55%) levels of protein in which choline was limiting; however, a high level of protein did not in itself affect performance. Growth was improved by supplemental choline in these diets. Growth of quail fed purified diets with up to 1.35% excess methionine which were limiting (531 mg/kg) in choline was less than that of groups fed 2000 mg/kg of added dietary choline (P less than .01); however, excess methionine did not significantly influence growth of quail fed choline-deficient diets. These experiments indicate that neither high dietary protein nor excess methionine, fed at non-growth-depressing levels, increases dietary choline needs for young Bobwhite quail.

  7. Analisis Migrasi Radio Trunking Analog ke Radio Trunking Digital di Indonesia

    Directory of Open Access Journals (Sweden)

    Riza Azmi

    2013-09-01

    Full Text Available Dalam Tabel Alokasi Spektrum Frekuensi di Indonesia pada catatan kaki INS9 dan INS13 disebutkan bahwa alokasi pada pita-pita frekuensi yang digunakan untuk teknologi trunking direncanakan dimigrasi ke sistem komunikasi trunking digital pada waktu yang akan ditentukan oleh pemerintah. Terkait dengan hal itu, studi ini bertujuan untuk mengkaji bagaimana kelayakan migrasi dari sistem trunking analog ke sistem trunking digital dan hal-hal yang terkait dengannya. Dengan menggunakan analisis biaya dan manfaat (Cost-Benefit Analysis studi ini melihat bahwa migrasi hanya dapat dilakukan jika umur masing-masing lisensi dari operator telah berakhir, atau dengan kata lain pemerintah dapat mendorong transisi ke digital dengan menerbitkan lisensi baru yaitu lisensi trunking digital.

  8. Nutritional potassium requirement for laying Japanese quails

    Directory of Open Access Journals (Sweden)

    Fernando Guilherme Perazzo Costa

    2011-12-01

    Full Text Available The objective of this study was to evaluate the potassium requirement for laying Japanese quails. Two hundred and forty quails were distributed in a randomized block design, with five treatments and six replicates, with eight birds each. The treatments consisted of a basal diet deficient in potassium (K (2.50 g/kg, supplemented with potassium carbonate, to replace the inert, to reach levels of 2.50, 3.50, 4.50, 5.50 and 6.50 (g/kg of K in the diet. There was a quadratic effect of K levels on feed intake, egg production, egg mass and feed conversion per egg mass and per egg dozen, estimating the requirements of 4.26, 4.41, 4.38, 4.43 and 4.48 (g/kg of K diet, respectively. There was no significant effect on the levels of K in the diet on egg weight, albumen weight, percentage of yolk or shell and yolk color. However, yolk and shell weights reduced and the albumen percentage increased linearly with increasing levels of K in the diet. Despite the reduction of shell weight, the increased levels of K did not influence the specific gravity and shell thickness. The use of 4.41 g/kg of potassium is recommended in the diet for laying Japanese quails.

  9. Influence of protein level and supplemental methionine in practical rations for young endangered masked bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1982-01-01

    A study was conducted to examine the protein requirement of young endangered masked Bobwhite quail (Colinus virginianus ridgwayi). Five practical starting rations containing 24 to 32% protein were fed alone and supplemented with methionine for 5 weeks. Supplemental methionine significantly improved growth of quail fed diets containing 24 and 26% protein. Increasing the protein level improved growth of quail fed unsupplemented diets but did not do so when diets contained supplemental methionine. A methionine-supplemented ration containing 24% protein appeared adequate for supporting rapid growth of masked Bobwhite quail.

  10. TRUNK LEAN DURING A SINGLE-LEG SQUAT IS ASSOCIATED WITH TRUNK LEAN DURING PITCHING.

    Science.gov (United States)

    Plummer, Hillary A; Oliver, Gretchen D; Powers, Christopher M; Michener, Lori A

    2018-02-01

    Impaired trunk motion during pitching may be a risk factor for upper extremity injuries. Specifically, increased forces about the shoulder and elbow have been observed in pitchers with excessive contralateral trunk lean during pitching. Because of the difficulty in identifying abnormal trunk motions during a high-speed task such as pitching, a clinical screening test is needed to identify pitchers who have impaired trunk motion during pitching. The purpose of this study was to determine the relationship between the degree of lateral trunk lean during the single-leg squat and amount of trunk lean during pitching and if trunk lean during pitching can be predicted from lean during the single-leg squat. Controlled Laboratory Study; Cross-sectional. Seventy-three young baseball pitchers (11.4 ± 1.7 years; 156.3 ± 11.9 cm; 50.5 ± 8.8 kg) participated. An electromagnetic tracking system was used to obtain trunk kinematic data during a single-leg squat task (lead leg) and at maximum shoulder external rotation of a fastball pitch. Pearson correlation coefficients for trunk lean during the single-leg squat and pitching were calculated. A linear regression analysis was performed to determine if trunk lean during pitching can be predicted from lean during the single-leg squat. There was a positive correlation between trunk lean during the single-leg squat and trunk lean during pitching (r = 0.53; plean during the single-leg squat predicted the amount of lateral trunk lean during pitching (R 2 = 0.28; p lean during an SLS and pitching. Trunk lean during the single-leg squat explained 28% of the variance in trunk lean during pitching. Diagnosis, level 3.

  11. Genetic evaluation of European quails by random regression models

    Directory of Open Access Journals (Sweden)

    Flaviana Miranda Gonçalves

    2012-09-01

    Full Text Available The objective of this study was to compare different random regression models, defined from different classes of heterogeneity of variance combined with different Legendre polynomial orders for the estimate of (covariance of quails. The data came from 28,076 observations of 4,507 female meat quails of the LF1 lineage. Quail body weights were determined at birth and 1, 14, 21, 28, 35 and 42 days of age. Six different classes of residual variance were fitted to Legendre polynomial functions (orders ranging from 2 to 6 to determine which model had the best fit to describe the (covariance structures as a function of time. According to the evaluated criteria (AIC, BIC and LRT, the model with six classes of residual variances and of sixth-order Legendre polynomial was the best fit. The estimated additive genetic variance increased from birth to 28 days of age, and dropped slightly from 35 to 42 days. The heritability estimates decreased along the growth curve and changed from 0.51 (1 day to 0.16 (42 days. Animal genetic and permanent environmental correlation estimates between weights and age classes were always high and positive, except for birth weight. The sixth order Legendre polynomial, along with the residual variance divided into six classes was the best fit for the growth rate curve of meat quails; therefore, they should be considered for breeding evaluation processes by random regression models.

  12. Egg quality of quails fed low methionine diet supplemented with betaine

    Science.gov (United States)

    Ratriyanto, A.; Indreswari, R.; Dewanti, R.; Wahyuningsih, S.

    2018-03-01

    This experiment investigated the effect of betaine supplementation to low methionine diet on egg quality of quails. A total of 340 laying quails (Coturnix coturnix japonica) was divided into 4 dietary treatments with 5 replicates of 17 quails each. The experiment was assigned in a completely randomized design. The four dietary treatments were the low methionine diet (0.3% methionine) without betaine supplementation and the low methionine diet supplemented with 0.07, 0.14, and 0.21% betaine. The experimental diets were applied for 8 weeks and the egg quality traits were measured at the age of 16 and 20 weeks. The data were subjected to analysis of variance, and when the treatment indicated significant effect, it was continued to orthogonal polynomial test to determine the optimum level of betaine. Increasing dietary levels of betaine increased the fat content of the egg with the linear regression of y = 11.0949 + 4.1914x (R2 = 0.18). However, supplementation of betaine did not affect protein content, yolk, albumen, and eggshell percentage. It can be concluded that betaine supplementation up to 0.21% to low methionine diet only had little effect in improving the quality traits of quail eggs.

  13. Immunotoxicity of trenbolone acetate in Japanese quail

    Science.gov (United States)

    Quinn, M.J.; McKernan, M.; Lavoie, E.T.; Ottinger, M.A.

    2007-01-01

    Trenbolone acetate is a synthetic androgen that is currently used as a growth promoter in many meat-exporting countries. Despite industry laboratories classifying trenbolone as nonteratogenic, data showed that embryonic exposure to this androgenic chemical altered development of the immune system in Japanese quail. Trenbolone is lipophilic, persistent, and released into the environment in manure used as soil fertilizer. This is the first study to date to assess this chemical's immunotoxic effects in an avian species. A one-time injection of trenbolone into yolks was administered to mimic maternal deposition, and subsequent effects on the development and function of the immune system were determined in chicks and adults. Development of the bursa of Fabricius, an organ responsible for development of the humoral arm of the immune system, was disrupted, as indicated by lower masse, and smaller and fewer follicles at day 1 of hatch. Morphological differences in the bursas persisted in adults, although no differences in either two measures of immune function were observed. Total numbers of circulating leukocytes were reduced and heterophil-lymphocyte ratios were elevated in chicks but not adults. This study shows that trenbolone acetate is teratogenic and immunotoxic in Japanese quail, and provides evidence that the quail immune system may be fairly resilient to embryonic endocrine-disrupting chemical-induced alterations following no further exposure posthatch.

  14. Comparison of the characteristics in hen and quail corneas as experimental models of refractive surgery.

    Science.gov (United States)

    Gonçalves, G C; Pérez-Merino, P; Martínez-García, M C; Barcía, A; Merayo-Loves, J

    2016-07-01

    To compare the histological, morphological and the biophysical measurements between hen and quail corneas, in order to determine which of them were better suited for use as an animal model for research into corneal refractive surgery. A study was performed using the biophysical measurements of the cornea (curvature, thickness, refraction, and axial length) of 20 animals (10 hens and 10 quails). The corneas were then prepared for histological analysis under microscopy light. The analysis showed that both groups have the same number of corneal layers as the human cornea and with an evident Bowman's layer. The thickness of the hen cornea and axial length of the eye, 225.3±18.4μm and 12.8±0.25mm, respectively, were larger than that of the quail (Phen central cornea, 3.65±0.08mm, was greater than that for the quail (Ppower of each cornea was similar. The proportion of total corneal thickness of the hen stroma, 82.6%, was more similar to that of the human than was the quail stroma, 72.5%. Within the hen stroma, the density of keratocytes, 8.57±1.49 per 5,000μm(2), was about half that in the quail stroma (Phen cornea, the stromal thickness and proportional similarity of the corneal layers with human cornea, the hen maybe better than the quail as an alternative species suitable for use in studies of corneal refractive surgery. Copyright © 2016 Sociedad Española de Oftalmología. Published by Elsevier España, S.L.U. All rights reserved.

  15. Effect Of Pyridoxine Injection In Japanese Quail Eggs On HATCHABILITY, Performance And Some Physiological Parameters

    International Nuclear Information System (INIS)

    ELSAYED, M.A.; WAKWAK, M.M.; MAHROSE, KH.M.

    2010-01-01

    The present study was carried out at the poultry farm found in the Nuclear Research Center, Atomic Energy Authority, Inshas, Sharkia Governorate, Egypt, during January 2009. A total number of two hundreds and seventy five quail eggs were used in an experiment of a completely randomized design to estimate hatchability percentage, chick weight at hatch, growth performance, some blood parameters and carcass traits of Japanese quails as affected by injecting their eggs with pyridoxine. Eggs were divided into 5 groups (55 eggs each); the first group (without injection) was served as control while the second group was injected in the width end of the egg with 500 μl saline. The third, fourth and fifth groups were injected in the width end of the Japanese quail eggs with 40, 80 and 120 μg pyridoxine, respectively, dissolved in 500 μl saline. Hatchability percentage, live body weight, daily body weight gain and some organ weights (liver, gizzard and heart) were studied. At the end of the experiment, blood samples were collected for analyses. It was observed that the groups of quail eggs received 120 μg pyridoxine injection recorded the highest hatchability percent. Chick weight at hatch was non-significantly affected by saline solution injection. The birds hatched from the groups of quail eggs received 120μg pyridoxine recorded the highest live body weight, especially during the 2 nd and 3 rd weeks of age. The daily body weight gain was significantly affected by pyridoxine injection only during the intervals of 1 to 2, 3 to 4 and from 1 to 6 weeks of age. Serum total protein, albumin and globulin concentrations were highly significantly elevated in the birds hatched from the groups of quail eggs received 120μg pyridoxine than other groups. Serum AST activity was highly significantly increased in the birds hatched from the groups of quail eggs received 40 μg pyridoxine than other groups while serum ALT activity and calcium concentration were non

  16. Pathobiology and transmission of highly and low pathogenic avian influenza viruses in European quail (Coturnix c. coturnix).

    Science.gov (United States)

    Bertran, Kateri; Dolz, Roser; Busquets, Núria; Gamino, Virginia; Vergara-Alert, Júlia; Chaves, Aida J; Ramis, Antonio; Abad, F Xavier; Höfle, Ursula; Majó, Natàlia

    2013-03-28

    European quail (Coturnix c. coturnix) may share with Japanese quail (Coturnix c. japonica) its potential as an intermediate host and reservoir of avian influenza viruses (AIV). To elucidate this question, European quail were experimentally challenged with two highly pathogenic AIV (HPAIV) (H7N1/HP and H5N1/HP) and one low pathogenic AIV (LPAIV) (H7N2/LP). Contact animals were also used to assess the viral transmission among birds. Severe neurological signs and mortality rates of 67% (H7N1/HP) and 92% (H5N1/HP) were observed. Although histopathological findings were present in both HPAIV-infected groups, H5N1/HP-quail displayed a broader viral antigen distribution and extent of microscopic lesions. Neither clinical nor pathological involvement was observed in LPAIV-infected quail. Consistent long-term viral shedding and effective transmission to naive quail was demonstrated for the three studied AIV. Drinking water arose as a possible transmission route and feathers as a potential origin of HPAIV dissemination. The present study demonstrates that European quail may play a major role in AI epidemiology, highlighting the need to further understand its putative role as an intermediate host for avian/mammalian reassortant viruses.

  17. Metabolic effects of quail eggs in diabetes-induced rats: comparison with chicken eggs

    Directory of Open Access Journals (Sweden)

    Eric Lontchi-Yimagou

    2016-10-01

    Full Text Available Background: Quail eggs as a food item have recently been introduced into the diet of some Cameroonians. These eggs are being sold in local markets, but with many unfounded health claims. One claim is that quail eggs can reduce blood glucose levels in diabetics. It was therefore necessary to evaluate the effect of consuming quail eggs on blood glucose levels, lipid profiles, and oxidative stress parameters in diabetes-induced rats. Methods: Twenty Wistar rats weighing, on average, 250 g were divided into four groups of five rats each. Group 1 consisted of rats with normal blood glucose, and the other three groups (2, 3, and 4 consisted of diabetes-induced rats achieved by intravenous injection of streptozotocin. During 16 days, rats in groups 1 and 2 received distilled water; and rats in groups 3 and 4 received quail and chicken eggs, respectively, with gastroesophageal probe at a dose of 1 mL/200 g body weight. Fasting blood glucose levels were determined in all the groups on the 1st, 7th, 14th, and 17th days after induction of diabetes. On the 17th day, the fasting rats were sacrificed, and blood and liver samples were collected for biochemical analyses. Results: In 17 days, the consumption of quail and chicken eggs had no effect on blood glucose levels of diabetic rats. Total cholesterol levels were higher in groups 3 (75.59 mg/dL and 4 (59.41 mg/dL compared to group 2 (55.67 mg/dl, although these differences were not significant (all p>0.05. Triglyceride levels were significantly higher (p <0.05 in groups 3 (106.52 mg/dL and 4 (109.65 mg/dL compared to group 2 (65.82 mg/dL. Quail eggs had no effect on oxidative stress parameters (malondialdehyde, hydroperoxides, and catalase. Conclusions: The consumption of quail eggs by diabetic rats at the tested dose had no effect on blood glucose level and oxidative stress parameters and may have a negative effect on lipid profile.

  18. Influence of hydrocolloidal silver nanoparticles on gastrointestinal microflora and morphology of enterocytes of quails

    DEFF Research Database (Denmark)

    Sawosz, Ewa; Binek, Marian; Grodzik, Marta

    2007-01-01

    The objective of the present study was to examine the effects of hydrocolloidal silver nanoparticles (Ag-nano) on microbial profile of caecum and morphology of enterocytes in duodenum of Japanese quail, as a model animal for poultry. Quails (Coturnix coturnix japonica) (10 d old) were randomly...... killed and samples of duodenum and caeca microflora were collected. This initial investigation demonstrated that silver nanoparticles did not influence emphatically microflora of quail caecum; however, water containing 25 mg/kg of Ag-nano significantly increased the population of lactic acid bacteria...

  19. Effect of Katuk leaf (Sauropus androgynus L. Merr suplementation in the diet on reproductive function of Quail

    Directory of Open Access Journals (Sweden)

    Sri Subekti

    2008-10-01

    Full Text Available Katuk (Sauropus androgynus L Merr is known to contain carotenoids, vitamin E, vitamin C, protein, and sterol compounds. This study was aimed to determine whether phytosterol in Sauropus androgynus (SA leaf affected the reproductive system of female quails. One hundred and fifty female quails were raised from 2-27 weeks old and divided into three dietary treatment, with five replicates and 10 quails in each replicate. The treatment diets were: 1 control group: diet without katuk leaf meal; 2 diet with 9% SA ethanol extract (TEK; 3 Diet containing 9% SA meal (TDK. The TDK-fed quails laid their first eggs at 46 day of age, compared with the TEK (52 day and the control groups (53 day. The highest fertility (94.55% and hatchability (93.29% were obtained from the TDK fed quails at the age of 23 and 24 weeks, respectively. These findings indicated that the reproductive system of female quails were improved not only by phytosterol in SA leaf, but also by the β-carotene, vitamin C, α-tocopherol in SA leaf.

  20. Characterization and Digestibility of Detoxified Castor Oil Meal for Japanese Quails

    OpenAIRE

    Santos,PA dos; Ludke,MCMM; Ludke,JV; Rabello,CBV; Santos,MJB dos; Torres,TR

    2015-01-01

    ABSTRACT These experiments were performed to determine the chemical composition, coefficients of nutrient and energy metabolizability, amino acid composition, and cytotoxicity of different castor oil meals subjected to different detoxification processes and added to the diet of Japanese quails. In the trial, 180 46-d-old female Japanese quails were distributed according to a completely randomized design into five treatments and with replicates of six bird each. The treatments consisted of fol...

  1. Studies on the protein and sulfur amino acid requirements of young bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1977-01-01

    Four experiments were conducted with purified diets to examine the influence of protein level and to estimate the sulfur amino acid (S.A.A.) requirement of young Bobwhite quail (Colinus virginianus). These studies demonstrated (I) that 26% protein was sufficient for rapid growth when the diet was supplemented with methionine; (2) that diets containing higher levels of protein (29.3% and 31.3%) failed to support satisfactory growth unless they contained supplemental methionine; and (3) that young Bobwhite quail require no more than 1.0% sulfur-containing amino acids for optimal growth and efficiency of feed utilization. A fifth experiment was conducted to examine the protein and S.A.A. requirements of young Bobwhite quail using practical rations and to compare results with those obtained with purified diets. Diets containing 24%, 26% and 28% protein were supplied with and without supplemental methionine in a five week study. Results showed significant growth responses to protein and supplemental methionine. Responses showed that Bobwhite quail require no more than 26% protein for maximum growth and efficiency of feed utilization when the S.A.A. level of the diet was approximately 1.0%. The results were in close agreement with those obtained with purified diets. These findings define more precisely than had been known the quantitative requirements of young Bobwhite quail for protein and for the S.A.A. necessary for optimal growth.

  2. Trunk proprioception adaptations to creep deformation.

    Science.gov (United States)

    Abboud, Jacques; Rousseau, Benjamin; Descarreaux, Martin

    2018-01-01

    This study aimed at identifying the short-term effect of creep deformation on the trunk repositioning sense. Twenty healthy participants performed two different trunk-repositioning tasks (20° and 30° trunk extension) before and after a prolonged static full trunk flexion of 20 min in order to induce spinal tissue creep. Trunk repositioning error variables, trunk movement time and erector spinae muscle activity were computed and compared between the pre- and post-creep conditions. During the pre-creep condition, significant increases in trunk repositioning errors, as well as trunk movement time, were observed in 30° trunk extension in comparison to 20°. During the post-creep condition, trunk repositioning errors variables were significantly increased only when performing a 20° trunk extension. Erector spinae muscle activity increased in the post-creep condition, while it remained unchanged between trunk repositioning tasks. Trunk repositioning sense seems to be altered in the presence of creep deformation, especially in a small range of motion. Reduction of proprioception acuity may increase the risk of spinal instability, which is closely related to the risk of low back pain or injury.

  3. Nutritional requirements of digestible threonine for growing meat-type quails

    Directory of Open Access Journals (Sweden)

    Ana Paula Silva Ton

    2013-07-01

    Full Text Available The objective of this study was to estimate the nutrient requirements of digestible threonine for meat-type quails (Coturnix coturnix sp in the growth phase. A total of 1350 not sexed meat-type quails were distributed in a completely randomized design with six threonine levels (10.80, 11.50, 12.20, 12.90, 13.60 and 14.30 g/kg as fed, five replications and 45 quails per experimental unit, from 1 to 14 days of age. The threonine levels in the diet had a quadratic effect on body weight, feed intake and weight gain. Estimates for highest body weight (79.41 g, feed intake (128.96 g/bird and weight gain (70.73 g were observed with diets containing 12.60 g/kg of digestible threonine. According to the LRP model, the threonine intake was estimated at 13.40 g/kg of digestible threonine. Protein deposition rate and energy retained in the carcass showed quadratic effect, with estimated digestible threonine levels of 11.80 and 12.00 g/kg in the diet for maximum protein deposition rate (2.00 g/bird and retained energy in the carcass (15.88 kcal/g, respectively. There was a linear effect on feed cost per kg of live weight gain as threonine levels were increased. Nutritional requirement of digestible threonine for meat-type quails for maximum growth is 12.60 g/kg, corresponding to a digestible threonine:digestible lysine ratio of 67.02.

  4. The positive expression of genotype VII Newcastle disease virus (Malaysian isolate in Japanese quails (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Lizma Felisha Mazlan

    2017-05-01

    Full Text Available Aim: Genotype VII Newcastle disease virus (NDV is the most predominant NDV strains that circulating in Malaysia; thus, this study was aimed to determine the susceptibility of Japanese quails toward genotype VII NDV. Clinical signs, gross pathological lesions of organs, positive detection of virus in organs and cloacal swabs, as well as the expression of the antibody titer, were used as parameters to assess the susceptibility of Japanese quails following infection of genotype VII NDV. Materials and Methods: About 20 quails were divided into three groups (n=8 for Groups A and B; n=4 for the control group. The quails in the Groups A and B were infected via intraocular route with 0.03 ml of 103.5 ELD50 and 107.0 ELD50 of NDV strain IBS 002, respectively, while the control group received 1x phosphate-buffered saline. Cloacal swabs and necropsy were taken on day 7 post-infection for all quails were subjected to one-step reverse transcription real-time quantitative polymerase chain reaction (RT-qPCR for detection of virus and examination for gross pathological lesion, respectively. Blood serums of infected quails were taken on day 10, 14, and 21 post-day infections and were subjected for hemagglutination inhibition (HI assay. Results: Depression and ruffled feathers, trachea rales, leg paralysis, and torticollis were shown in some of the quails in both infected groups. Based on statistical analysis, there was no significant difference (p>0.05 in clinical signs between the infected groups. The results for RT-qPCR were found to be negative for all groups, and no gross pathological lesions of organs observed for quails in both infected groups. Trachea, proventriculus, and cecal tonsil were taken for the detection of NDV by RT-qPCR, and some of the organ samples showed positive detection of virus in both infected groups. HI assay showed an increase in mean titers of antibody across time and between infected groups. Conclusion: In summary, Japanese quails

  5. Performance of Japanese quails fed diets with low-protein and isoleucine

    OpenAIRE

    Santos, Graciene Conceição dos; Garcia, Edivaldo Antônio; Vieira Filho, Javer Alves; Molino, Andréa de Britto; Pelicia, Kleber; Berto, Daniella Aparecida

    2016-01-01

    ABSTRACT. Aiming to assess isoleucine levels in low protein diets for laying Japanese quails, 648 quails of 182 days of age were distributed in experimental block design with six treatments and six replicates of 18 birds each. Treatments consisted of a basal level corresponding to 0.672% isoleucine and supplemented with isoleucine to the levels of 0.816, 0.960; 1.104; 1.248%. The experimental diets were compared to a control diet containing 20% CP. The parameters studied were: performance, eg...

  6. Effect of Long-Term Hypodynamy on Alkaline Phosphatase Activity of Small Intestine in Japanese Quail Chicks

    Directory of Open Access Journals (Sweden)

    Ľ. Lenhardt

    2007-01-01

    Full Text Available The functional development of the small intestine was investigated in Japanese quail chicks subjected to simulated microgravity (hypodynamy on the second day after hatching and reared under these conditions to 63 days of age. On days 5, 7, 14, 21, 28, 35, 42, 56 and 63 the activity of brush-border-bound alkaline phosphatase (AP in the duodenum and jejunum were determined in experimental animals as well as in control quail chicks housed in a floor box during these periods. As compared with control quails the experimental animals displayed a significantly increased enzyme activity until day 42 in the duodenum and day 35 in the jejunum (P < 0.001 whereas in older quails no significant enzymatic differences between these groups was found. However, a decrease in food consumption due to a partial physical constraint cannot be excluded. Moreover, the results suggested that the activity of AP in the control birds did not change substantially during all the periods examined. In contrast, in older hypodynamy quail the AP activity significantly decreased in the duodenum on days 56 and 63 and in the jejunum on days 42, 56 and 63, respectively. These results indicate that a the enhanced intestinal function in early periods of life may reflect the higher sensitivity of small intestine to simulated weightlessness, b the decrease of the AP activity in older animals to the level of controls might be considered as a part of intestinal mechanisms involved in adaptation of quail chicks to long-term hypodynamy, c different activity of AP in the small intestine of Japanese quail may not have resulted only from hypodynamy but also due to decreased food intake.

  7. Genetic characterization of egg weight, egg production and age at first egg in quails

    NARCIS (Netherlands)

    Marubayashi Hidalgo, A.; Martins, E.N.; Santos, A.L.; Quadros, T.C.O.; Ton, A.P.S.; Teixeira, R.

    2011-01-01

    The objective of this research was to estimate genetic parameters for the traits egg weight, egg production in 189 days and age at first egg in three laying quails and one meat line of quails. Data was analyzed by Bayesian procedures using Gibbs sampling. The heritability estimates for egg weight,

  8. Reduced mortality among young endangered masked bobwhite quail fed oxytetracycline-supplemented diets

    Science.gov (United States)

    Serafin, J.A.

    1982-01-01

    Two experiments were conducted to examine the effect of oxytetracycline-supplemented diets on mortality of young endangered masked bobwhite quail (Colinus virginianus ridgwayi). Inclusion of oxytetracycline at 200 g per ton in the feed for 6 weeks resulted in a marked, significant reduction in mortality of young masked bobwhite quail raised in captivity. Including the antibiotic in feed during the first week of life reduced mortality as effectively as feeding it for a longer period.

  9. Egg-laying substrate selection for optimal camouflage by quail.

    Science.gov (United States)

    Lovell, P George; Ruxton, Graeme D; Langridge, Keri V; Spencer, Karen A

    2013-02-04

    Camouflage is conferred by background matching and disruption, which are both affected by microhabitat. However, microhabitat selection that enhances camouflage has only been demonstrated in species with discrete phenotypic morphs. For most animals, phenotypic variation is continuous; here we explore whether such individuals can select microhabitats to best exploit camouflage. We use substrate selection in a ground-nesting bird (Japanese quail, Coturnix japonica). For such species, threat from visual predators is high and egg appearance shows strong between-female variation. In quail, variation in appearance is particularly obvious in the amount of dark maculation on the light-colored shell. When given a choice, birds consistently selected laying substrates that made visual detection of their egg outline most challenging. However, the strategy for maximizing camouflage varied with the degree of egg maculation. Females laying heavily maculated eggs selected the substrate that more closely matched egg maculation color properties, leading to camouflage through disruptive coloration. For lightly maculated eggs, females chose a substrate that best matched their egg background coloration, suggesting background matching. Our results show that quail "know" their individual egg patterning and seek out a nest position that provides most effective camouflage for their individual phenotype. Copyright © 2013 Elsevier Ltd. All rights reserved.

  10. Determining population trends and conservation status of the common quail (Coturnix coturnix in Western Europe

    Directory of Open Access Journals (Sweden)

    Puigcerver, M.

    2012-01-01

    Full Text Available In this paper we review the conservation status and population trends of the common quail (Coturnix coturnix from 1900 to the present. Data are sometimes contradictory with regard to the status of this species as it has some features that make it difficult to produce reliable population estimates. Recent data clearly suggest, either at a local scale or at a trans–national scale, that the Atlantic common quail populations have remained stable in the last two decades, and that restocking practices with farm–reared quails (hybrids with the Japanese quail, Coturnix japonica do not affect our estimates. The complex movement patterns showed by this species require special attention. Analysis of ring recoveries can give important information, especially about the nomadic movement of quails in search of suitable habitats after the destruction of winter cereal crops due to harvesting. Thus, when developing a breeding distribution model for this species, continuously updated information on seasonal habitat and weather must be included for optimal prediction. Including fortnightly data of vegetation indices in distribution models, for example, has shown good results. Obtaining reliable predictions about changes in species distribution and movements during the breeding period could provide useful knowledge about the conservation status and population trends and would help in the design of future management measures.

  11. COELIAC TRUNK BRANCHING PATTERN AND VARIATION

    Directory of Open Access Journals (Sweden)

    Jude Jose Thomson

    2017-01-01

    Full Text Available BACKGROUND Anatomical variations involving the visceral arteries are common. However, variations in coeliac trunk are usually asymptomatic, they may become important in patients undergoing diagnostic angiography for gastrointestinal bleeding or prior to an operative procedure. This study was useful for knowing the possible morphological variations before an upper abdominal surgery. MATERIALS AND METHODS This was a descriptive study done by cadaveric dissection, conducted on thirty cadavers. The coeliac trunk being examined for its origin, branching pattern, distribution, and variations. Results were statistically analysed and compared with the previous studies. RESULTS In our study, 60% of the coeliac trunk shows variations and 40% have normal branching pattern. A complete absence of coeliac trunk was observed in one case. In the present study the Right inferior phrenic artery arising from coeliac trunk in 2 cases (6.6% and left inferior phrenic artery arising from coeliac trunk in 3 cases (9.9%. Both inferior phrenic arteries are arising from coeliac trunk in 2 cases (6.6%. The common hepatomesenteric trunk and gastro splenic trunk was found in 1 case (3.3%. Hepatosplenic trunk was found in 2 cases (6.6%. In another 2 cases (6.6% gastric and hepatic artery originate from coeliac trunk but splenic artery has a separate origin from abdominal aorta. An absent trunk was also found in 1 case (3.3%. In 5 cases (16.7% showed trifurcation with variation in the branching pattern. CONCLUSION The branching pattern and extreme degree variability in coeliac trunk as brought out in the observations of the present study make it obvious that the present study almost falls in description with previous studies.

  12. Isolation and serological differentiation of a herpesvirus from bobwhite quail (Colinus virginianus, L. 1758).

    Science.gov (United States)

    Kaleta, E F; Marschall, H J; Glünder, G; Stiburek, B

    1980-01-01

    An infectious agent was isolated from the liver of bobwhite quails (Colinus virginianus, L. 1758). The agent was sensitive to chloroform and its multiplication was inhibited by 5-iodine-2-deoxy-uridine. It passed filters with a pore diameter of 220 nm and more but not 100 nm filters. Electron microscopic examination revealed numerous nucleocapsids with hollow capsomeres and few enveloped particles in the supernatant fluids of infected cultures. The nucleocapsids were calculated to have 162 capsomeres on their surface. Using the plaque reduction method for neutralization tests no serological cross reactions could be detected between the quail isolate and sera against Marek's disease virus, turkey herpes-virus (HV), duck enteritis HV, infectious laryngotracheitis HV, amazon parrot HV, great horned owl HV, eagle owl HV, snowy owl HV, falcon HV, pigeon HV, Lake Victoria Cormorant HV, and stork HV. The isolate from bobwhite quail did only cross-react with antiserum against crane HV. It is concluded that the isolated virus is a member of the avian herpesvirus group and it is proposed to tentatively term it herpesvirus colinum (from Colinus virginianus = bobwhite quail).

  13. Evaluation of quail and chicken embryos for the detection of botulinum toxin serotypes A, B, E and F activity

    Science.gov (United States)

    Comparison of quail (Coturnix japonica) and chicken (Gallus domesticus) embryos for the detection of BoNT/A activity was conducted using equal dosages of toxin/g of embryo (quail at 7 g and chickens at 48 g). Quail embryos were injected at 0, 0.5 to 50 ng adn chicken embryos at 0, 3.4 to 342 ng and...

  14. Comparative toxicity of coniine, an alkaloid of Conium maculatum (poison hemlock), in chickens, quails, and turkeys.

    Science.gov (United States)

    Frank, A A; Reed, W M

    1990-01-01

    Coniine, an alkaloid of Conium maculatum (poison hemlock), was administered by gavage to immature chickens, quails, and turkeys at 0, 25, 50, and 100 mg/kg body weight. At 25 mg coniine/kg body weight, clinical signs were observed only in quails (2/10) and consisted of excitement, depression, hypermetria, seizures, opisthotonos, and flaccid paralysis. Chickens (9/10) and quails (8/10) dosed at 50 mg/kg body weight were affected, and several birds of each species died (2/10 and 5/10, respectively). Turkeys (7/10) were affected only when dosed at 100 mg/kg body weight, and quails (6/10), turkeys (4/10), and chickens (10/10) died at this dose. There were no gross or microscopic lesions. Coniine was detected in skeletal muscle and liver of birds dying after ingestion and was present in some survivors 7 days post-treatment.

  15. Spatial orientation in Japanese quails (Coturnix coturnix japonica.

    Directory of Open Access Journals (Sweden)

    Tim Ruploh

    Full Text Available Finding a given location can be based on a variety of strategies, for example on the estimation of spatial relations between landmarks, called spatial orientation. In galliform birds, spatial orientation has been demonstrated convincingly in very young domestic chicks. We wanted to know whether adult Japanese quails (Coturnix coturnix japonica without food deprivation are also able to use spatial orientation. The quails had to learn the relation of a food location with four conspicuous landmarks which were placed in the corners of a square shaped arena. They were trained to find mealworms in three adjacent food cups in a circle of 20 such cups. The rewarded feeders were located during training between the same two landmarks each of which showed a distinct pattern. When the birds had learned the task, all landmarks were displaced clockwise by 90 degrees. When tested in the new situation, all birds redirected their choices with respect to the landmark shift. In subsequent tests, however, the previously correct position was also chosen. According to our results, quails are using conspicuous landmarks as a first choice for orientation. The orientation towards the previously rewarded location, however, indicates that the neuronal representation of space which is used by the birds also includes more fine grain, less conspicuous cues, which are probably also taken into account in uncertain situations. We also presume that the rare orientation towards never rewarded feeders may be due to a foraging strategy instead of being mistakes.

  16. Detection of botulinum toxin types A, B, E, and F activity using the quail embryo

    Science.gov (United States)

    We recently demonstrated an effective new model for the detection of botulinum toxin type A using quail embryos in place of the mouse model. These experiments demonstrated that the Japanese quail embryo at 15 days of incubation was an effective vertebrate animal model to detect the activity of botu...

  17. Enhancement of parathion toxicity to quail by heat and cold exposure

    Science.gov (United States)

    Rattner, B.A.; Becker, J.M.; Nakatsugawa, T.

    1987-01-01

    Effects of ambient temperature on the acute oral toxicity of parathion were investigated in Japanese quail (Coturnix japonica) maintained at thermoneutral temperature (26.degree. C) or exposed to elevated (37.degree. C) or reduced (4.degree. C) temperatures commonly encountered by free-ranging wild birds. Based upon estimates of the median lethal dosage, there was up to a two-fold enhancement of parathion toxicity in birds chronically exposed to heat or cold. Twenty-four hours after administration of a low dosage (4 mg/kg body wt, po), there was markedly greater cholinesterase inhibition in surviving heat-exposed quail compared with those reared at 26.degree. C (e.g., brain acetylcholinesterase depression of 42% versus 12%). There were no differences in hepatic activities of parathion oxidase, paraoxonase, or paraoxon deethylase which could account for greater toxicity to chronically heat-exposed birds. In contrast, 4 mg parathion/kg wt elicited less plasma cholinesterase inhibition in cold-exposed quail compared to thermoneutral controls (e.g., birds is substantially influenced by environmental temperature.

  18. Performance of Japanese quails fed diets with low-protein and isoleucine

    Directory of Open Access Journals (Sweden)

    Graciene Conceição Santos

    2016-05-01

    Full Text Available Aiming to assess isoleucine levels in low protein diets for laying Japanese quails, 648 quails of 182 days of age were distributed in experimental block design with six treatments and six replicates of 18 birds each. Treatments consisted of a basal level corresponding to 0.672% isoleucine and supplemented with isoleucine to the levels of 0.816, 0.960; 1.104; 1.248%. The experimental diets were compared to a control diet containing 20% CP. The parameters studied were: performance, egg quality, total solids and nitrogen in the excreta. There was a linear increase only for isoleucine intake with increasing levels of isoleucine in the diets. The comparison of mean values of each combination of isoleucine levels for diets with 16% CP with the control with 20% CP showed that the intake of CP and isoleucine, egg weight, nitrogen excretion and yolk color were significantly affected. For Japanese quail fed diets with 16% CP, with isoleucine level at 0.672%, meets the requirements for obtaining satisfactory performance and egg quality and promoted a reduction in nitrogen excretion.

  19. Pb Speciation Data to Estimate Lead Bioavailability to Quail

    Data.gov (United States)

    U.S. Environmental Protection Agency — Linear combination fitting data for lead speciation of soil samples evaluated through an in-vivo/in-vitro correlation for quail exposure. This dataset is associated...

  20. DETERMINATION OF OPTIMUM THREONINE REQUIREMENTS OF JAPANESE QUAIL (Coturnix coturnix japonica CHICKS REARED UNDER TROPICAL ENVIRONMENT

    Directory of Open Access Journals (Sweden)

    Isaac Samuel

    2017-12-01

    Full Text Available Threonine, like most amino acids, is traditionally noted for its role in protein synthesis. However, dietary threonine concentration required for the maximum performance of Japanese quails is yet to be determined, therefore, a study was conducted to determine the optimum threonine requirement of Japanese quail chicks in the tropical environment. A total of four hundred and fifty, two weeks old quail chicks (mixed sexes were randomly allocated to five dietary treatments (0.67, 0.81, 0.95, 1.08 and 1.22 % total threonine and replicated thrice in a completely randomized design (CRD. There were no significant differences (P>0.05 in average weight gain, average feed intake, feed conversion ratio and age at first lay of quails fed the dietary treatments. Weight of first egg laid was significantly (P0.05 similar for all treatments. There were significant differences (P0.05. It was concluded that the performance of birds were not influenced by the dietary treatments up to the highest dietary level of threonine studied (1.22%. Therefore, it is possible that the optimum dietary level of threonine may be above 1.22 %. Further studies will be necessary to establish higher doses of dietary threonine requirement of Japanese quails reared under tropical climatic environment.

  1. Effect of Transient Treatment with Propylthiouracil on Some Reproduction Traits and Live Weight of Japanese Quails

    Directory of Open Access Journals (Sweden)

    B Sogut

    Full Text Available ABSTRACT This study was conducted to investigate the effects of transient treatment with propylthiouracil (PTU on some reproduction traits and live weight of quails. The trial lasted 8 weeks. To accomplish this goal, 700 1-day-old quail chicks were used, randomly divided into 8 groups. PTU was added to feed by 0.1% and 0.5% /wt. The first 4 groups had 0.5% PTU at the age of 2-4, 4-6, 6-8 and 2-8 wk., respectively. The 5 th, 6 th and 7 th groups had 0.1% PTU at the age of 2-4, 4-6 and 6-8 wk., respectively, and the 8 th group was the control with no PTU. Quails were bled at 60 days of age. Then right and left testes were taken out and weighed. At the end of the trail, least square means of the live weight of the treatment groups were higher than the control (p<0.05. Similar results (p<0.05 were observed for testis weight, testis diameter and fertility rate. As a result, it can be said that the inclusion of PTU in quail rations positively affects the live weight and reproduction traits of quails.

  2. Short-term spatial memory responses in aged Japanese quail selected for divergent adrenocortical stress responsiveness.

    Science.gov (United States)

    Suhr, C L; Schmidt, J B; Treese, S T; Satterlee, D G

    2010-04-01

    Stress-induced glucocorticoids can dampen learning and spatial memory via neuronal damage to the hippocampus. Cognition losses can be transient (associated with acute stress episodes) or permanent as in aged individuals who show chronic glucocorticoid-induced accelerated brain aging and neurodegeneration (dementia). Thus, chronic versus acute stress effects on spatial memory responses of quail selected for reduced (low stress, LS) or exaggerated (high stress, HS) plasma corticosterone (B) response to brief restraint were assessed. Aged food-motivated male LS and HS quail were tested for 10 min in a feed-baited 8-arm radial arm maze (RAM) 1) at 255 d of age (quail who had experienced lifelong management stressors but who were otherwise never intentionally stressed; that is, chronically stressed birds), 2) on the next day post-acute stressor treatment (5 min of restraint), and 3) on the next day without treatment (acute stress recovery). The RAM tests used the win-shift procedure in which visited arms were not rebaited. Radial arm maze performance was measured by determination of the total number of arm choices made, the number of correct entries made into baited arms out of the first 8 choices, the time required to make a choice, and the number of pellets eaten. Line effects (P LS), and number of pellets eaten (HS RAM testing nor its interaction with line further influenced these variables. Thus, although selection for divergent plasma B responsiveness to an acute stressor was found to be associated with severe impairment of spatial memory in aged male HS compared with LS quail, the observed spatial memory impairments (HS > LS) could not be further altered by acute stressor treatment. Line differences in cognition may reflect lifelong management-induced stress episodes that periodically produce higher plasma B responses in HS than LS quail, which underlie HS quail memory deficits, or other etiologies, or both.

  3. Effect of feed supplement containing earthworm meal (Lumbricus rubellus) on production performance of quail (Coturnix coturnix japonica)

    Science.gov (United States)

    Istiqomah, L.; Sakti, A. A.; Suryani, A. E.; Karimy, M. F.; Anggraeni, A. S.; Herdian, H.

    2017-12-01

    The objective of this study was to evaluate the effect of feed supplement (FS) contained earthworm meal (EWM) on production performance of laying quails. Twenty weeks-old of 360 Coturnix coturnix japonica quails were used in a Completely Randomized Design (CRD) with three dietary treatments A = CD (control without FS), B = CD + 0.250 % of FS, and C = CD + 0.375 % of FS during 6 weeks of experimental period. Each treatment in 4 equal replicates in which 30 quails were randomly allocated into 12 units of cages. Variable measured were feed intake, feed conversion ratio, feed efficiency, mortality rate, hen day production, egg weight, and egg uniformity. Data were statistically analyzed by One Way ANOVA and the differences among mean treatments are analysed using Duncan’s Multiple Range Test (DMRT). The results showed that administration of 0.375% FS based on earthworm meal, fermented rice bran, and skim milk impaired the feed conversion ratio and increased the feed efficiency. The experimental treatments did not effect on feed intake, mortality, hen day production, egg weight, and egg uniformity of quail. It is concluded that administration of feed supplement improved the growth performance of quail.

  4. Effects of pushing height on trunk posture and trunk muscle activity when a cart suddenly starts or stops moving.

    Science.gov (United States)

    Lee, Yun-Ju; Hoozemans, Marco J M; van Dieën, Jaap H

    2012-01-01

    Unexpected sudden (un)loading of the trunk may induce inadequate responses of trunk muscles and uncontrolled trunk motion. These unexpected perturbations may occur in pushing tasks, when the cart suddenly starts moving (unloading) or is blocked by an obstacle (loading). In pushing, handle height affects the user's working posture, which may influence trunk muscle activity and trunk movement in response to the perturbation. Eleven healthy male subjects pushed a 200 kg cart with handles at shoulder and hip height in a start condition (sudden release of brakes) and a stop condition (bumping into an obstacle). Before the perturbation, the baseline of the trunk inclination, internal moment and trunk extensor muscle activity were significantly higher when pushing at hip height than at shoulder height. After the perturbation, the changes in trunk inclination and internal moment were significantly larger when pushing at shoulder height than at hip height in both conditions. The opposite directions of changes in trunk inclination and internal moment suggest that the unexpected perturbations caused uncontrolled trunk motion. Pushing at shoulder height may impose a high risk of low-back injury due to the low trunk stiffness and large involuntary trunk motion occurring after carts suddenly move or stop.

  5. Lighting programs for male and female meat quails (Coturnix coturnix) raised in equatorial region.

    Science.gov (United States)

    Aguiar, G C; Freitas, E R; Watanabe, P H; Figueiredo, C W S; Silva, L P; Nascimento, G A J; Lima, R C; Nepomuceno, R C; Sá, N L

    2017-09-01

    The aim of the present study was to evaluate the effect of lighting programs for male and female meat quails raised in an equatorial region on performance and carcass traits. A total of 1,500 sexed quails (Coturnix coturnix) was distributed in a completely randomized design in a 2 × 3 factorial arrangement, with 2 sexes (male and female) and 3 lighting programs (natural, intermittent, and continuous) with 5 replicates of 50 birds. The lighting programs were applied in the period from 7 to 49 d of age, being natural (12 h and 30 min of natural light and 11 h and 30 min of dark), intermittent (12 h and 30 min of natural light and 5 h and 30 min of artificial light, alternating lighting periods with one h and 06 min and periods of darkness with one h and 12 min), and continuous (23 h of natural + artificial light and one h of dark). Regardless of lighting program, female quails were heavier than males, and birds subjected to natural light weighed less than those exposed to continuous and intermittent lighting programs. Quails exposed to intermittent and continuous light presented higher weight gain and feed intake, and worse feed conversion ratio compared to birds under a natural light regimen. It is concluded that in an equatorial region, it is possible to use a lighting program with only natural light for raising male and female meat quails from 7 to 49 d of age. © 2017 Poultry Science Association Inc.

  6. Age Maturity of Female Japanese Quails Fed Diets Containing Katuk Leave Meal (Sauropus androgynus L.Merr.

    Directory of Open Access Journals (Sweden)

    R Wiradimadja

    2007-05-01

    Full Text Available This experiment was conducted to study the effects of katuk leave meal on sexual maturity in Japanese quail. Three hundred female Japanese quails, with 4 weeks age, were assigned into a completely randomized design with 4 treatments i.e., R1 (diet with neither katuk leave meal nor cholesterin, R2 (diet without katuk leave meal + 0.10% cholesterin, R3 (diet with 15% katuk leave meal without cholesterin, and R4 (diet with 15% katuk leave meal + 0.10% cholesterin. The parameters measured were estradiol hormone in plasma, and age maturity (five percent henday production. Estradiol hormone was measured with Radioimmunoassay. The data were collected and analyzed by using completely randomized design. The results showed that the addition of 15% katuk leave meal in the diet significantly decreased the estrogen concentration (P<0.05, so that slow down on the age maturity of female Japanese quail. (Animal Production 9(2: 67-72 (2007Key Words : Katuk leave meal, estradiol hormone, age maturity, quail

  7. The influence of a probiotic supplementation on memory in quail suggests a role of gut microbiota on cognitive abilities in birds.

    Science.gov (United States)

    Parois, Severine; Calandreau, Ludovic; Kraimi, Narjis; Gabriel, Irène; Leterrier, Christine

    2017-07-28

    The gut microbiota is involved in host behaviour and memory in mammals. Consequently, it may also influence emotional behaviour and memory in birds. Quail from two genetic lines with different fearfulness (LTI: long tonic immobility, n=37; STI: short tonic immobility, n=32) were either or not supplemented with a probiotic (Pediococcus acidilactici) from hatching. Emotional reactivity was measured in a tonic immobility test (d6 and 7 of age) and two open-field tests (d13-15; d22-24). Memory was measured in a test rewarded with mealworms, where quail had to remember the cups previously visited (d34-36). Quail endured a 5-days stress period from days 17 to 21 to help revealing the potentially beneficial effect of the probiotic. As expected, STI quail were less fearful compared to the LTI quail (p0.05), except in the tonic immobility test where supplemented STI quail had lower immobility duration (p=0.0001). Regarding the memory test, the two lines had similar performances. Quail fed with probiotics made fewer errors (p=0.040). There was no significant correlation between traits of emotional reactivity and of memory. In conclusion, the supplementation with Pediococcus acidilactici as a probiotic, affected a specific trait of emotional reactivity in STI quail, and improved memory in both lines, whichstrengthens the idea that the influence of gut microbiota on the host behaviour and memory seen in mammals is shared by birds. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. The effect of organic quail egg supplementation on the blood lipid profile of white mice (Rattus Norvegicus L.) during the lactation period

    Science.gov (United States)

    lestari purba, Sri; Rini Saraswati, Tyas; Isdadiyanto, Sri

    2018-05-01

    Background: Quail eggs contain a considerable amount of complete nutritional sources such as carbohydrates, proteins, fats, and micronutrients. However, they also have a high cholesterol level, which can potentially cause atherosclerosis and chronic heart diseases. The response of the body to foods containing is influenced by factors such as ethnicity, genetics, and hormonal and nutrient status of the consumer. The cholesterol level of quail eggs can be reduced by manipulating the feed using supplemental organic feed. Organic quail eggs have been believed to correct the lipid profile of white mice during the lactation phase. Purpose: The aim of this study was to analyze the effect of feed containing organic quail eggs on the blood lipid profile of white mice (Rattus norvegicus L.) during the lactation phase. Materials and Methods: This experimental study was conducted using a completely randomized design with four experiments and five repetitions. Experimental mice: T0 mice were used as control; T1 mice were supplemented with quail eggs produced by quails that were fed with standard feed; T2 mice were supplemented with eggs produced by quails fed with standard organic feed; and T3 mice were supplemented with eggs produced by quails fed with organic feed with the addition of cassava leaf flour, mackerel flour, and turmeric powder. Quail egg supplementation was administered to the mice from the early pregnancy period till the end of the lactation phase. The acquired data were analyzed using ANOVA. SPSS version 16.0 software for Windows was used for data analyses. Results and summary: Feeding the white mice with different compositions of organic quail egg supplements had no effect on the consumption of feed and water, body weight, and lipid profile (including total cholesterol, LDL, HDL, and triglyceride) during the lactation phase (P > 0.05).

  9. Trunk Robot Rehabilitation Training with Active Stepping Reorganizes and Enriches Trunk Motor Cortex Representations in Spinal Transected Rats

    Science.gov (United States)

    Oza, Chintan S.

    2015-01-01

    Trunk motor control is crucial for postural stability and propulsion after low thoracic spinal cord injury (SCI) in animals and humans. Robotic rehabilitation aimed at trunk shows promise in SCI animal models and patients. However, little is known about the effect of SCI and robot rehabilitation of trunk on cortical motor representations. We previously showed reorganization of trunk motor cortex after adult SCI. Non-stepping training also exacerbated some SCI-driven plastic changes. Here we examine effects of robot rehabilitation that promotes recovery of hindlimb weight support functions on trunk motor cortex representations. Adult rats spinal transected as neonates (NTX rats) at the T9/10 level significantly improve function with our robot rehabilitation paradigm, whereas treadmill-only trained do not. We used intracortical microstimulation to map motor cortex in two NTX groups: (1) treadmill trained (control group); and (2) robot-assisted treadmill trained (improved function group). We found significant robot rehabilitation-driven changes in motor cortex: (1) caudal trunk motor areas expanded; (2) trunk coactivation at cortex sites increased; (3) richness of trunk cortex motor representations, as examined by cumulative entropy and mutual information for different trunk representations, increased; (4) trunk motor representations in the cortex moved toward more normal topography; and (5) trunk and forelimb motor representations that SCI-driven plasticity and compensations had caused to overlap were segregated. We conclude that effective robot rehabilitation training induces significant reorganization of trunk motor cortex and partially reverses some plastic changes that may be adaptive in non-stepping paraplegia after SCI. PMID:25948267

  10. Effect of gamma irradiation on the hatchability and embryonic development of quail eggs

    International Nuclear Information System (INIS)

    Oroszlany, P.; Sinkovicsne Hlubik, I.

    1979-01-01

    The effect of different doses of gamma irradiation on the embryonic development of quail and hen's eggs was examined. The goals of the examinations were to determine the LD 50 and LD 100 values, to establish the effect of single and multiple irradiation on embryonic development and to get some information on the embryonation of eggs produced by quails and their progeny grown from irradiated eggs. It was shown that 200 rad dose has significant stimulation effect of the hatching results of quail eggs. The LD 50 and LD 100 values were about 800 to 850 rad and 1600 rad, respectively. Repeated irradiation on the progeny-generations proved to be unambiguously deleterious on embryonation. High doses changed the rhythm of embryonal mortality, showing a peak under the irradiation and in the first three days of incubation, and significantly enhanced the number of teratological types. (author)

  11. Trunk robot rehabilitation training with active stepping reorganizes and enriches trunk motor cortex representations in spinal transected rats.

    Science.gov (United States)

    Oza, Chintan S; Giszter, Simon F

    2015-05-06

    Trunk motor control is crucial for postural stability and propulsion after low thoracic spinal cord injury (SCI) in animals and humans. Robotic rehabilitation aimed at trunk shows promise in SCI animal models and patients. However, little is known about the effect of SCI and robot rehabilitation of trunk on cortical motor representations. We previously showed reorganization of trunk motor cortex after adult SCI. Non-stepping training also exacerbated some SCI-driven plastic changes. Here we examine effects of robot rehabilitation that promotes recovery of hindlimb weight support functions on trunk motor cortex representations. Adult rats spinal transected as neonates (NTX rats) at the T9/10 level significantly improve function with our robot rehabilitation paradigm, whereas treadmill-only trained do not. We used intracortical microstimulation to map motor cortex in two NTX groups: (1) treadmill trained (control group); and (2) robot-assisted treadmill trained (improved function group). We found significant robot rehabilitation-driven changes in motor cortex: (1) caudal trunk motor areas expanded; (2) trunk coactivation at cortex sites increased; (3) richness of trunk cortex motor representations, as examined by cumulative entropy and mutual information for different trunk representations, increased; (4) trunk motor representations in the cortex moved toward more normal topography; and (5) trunk and forelimb motor representations that SCI-driven plasticity and compensations had caused to overlap were segregated. We conclude that effective robot rehabilitation training induces significant reorganization of trunk motor cortex and partially reverses some plastic changes that may be adaptive in non-stepping paraplegia after SCI. Copyright © 2015 the authors 0270-6474/15/357174-16$15.00/0.

  12. Improving the microbial safety and quality of quail carcasses by gamma irradiation

    International Nuclear Information System (INIS)

    Rady, A.H.; Khalaf, H.H.; Afifi, E.A.; Nasr, E.H.

    2002-01-01

    This investigation aims to study the possibility of using gamma irradiation for improving the microbial safety quality of quail carcasses. One hundred quail carcasses were examined for the presence of salmonella. The examination illustrated that 70 carcasses from all examined carcasses were positive for salmonella. therefore, the contaminated quail carcasses were gamma irradiated at 2, 4 and 6 kGy doses and the effects of these treatments on the microbiological aspects and chemical properties of samples under investigation were evaluated. The results indicated that, the chemical composition of samples did not alter by gamma irradiation treatment. Furthermore, irradiation of samples at doses of 2, 4 and kGy greatly reduced its microbial count. Moreover, irradiation doses of 2 and 4 kGy completely destroyed salmonella and enterococcus faecalis, respectively. In addition, the acid value, peroxide value and thiobarbituric acid value were increased after irradiation. On the other hand, irradiation treatment had no real effects on the total volatile basic nitrogen content and amino acid composition of samples under investigation

  13. Metabolizable energy levels for meat quails from 15 to 35 days of age

    Directory of Open Access Journals (Sweden)

    Jorge Cunha Lima Muniz

    Full Text Available ABSTRACT: This trial was carried out to evaluate the effects of dietetic metabolizable energy levels on performance and carcass traits of meat quails from 15 to 35 days old. Five hundred sixty, 15-d old, meat quails were randomly assigned to five treatments (2.850; 2.950; 3.050; 3.150 e 3.250kcal of ME kg-1 of diet, with eight replicates and fourteen birds per experimental unit. Feed intake, protein and lysine intake and feed conversion decreased linearly as the metabolizable energy content of diets increased (P0.05 by the treatments. Diets did not influence (P>0.05 carcass traits as dry matter, moisture and protein content in carcass. However a quadratic effect (P<0.04 were observed on carcass fat content. Based on these results, the adequate metabolizable energy level to ensure better meat quails' growth is 3.250kcal of ME kg-1 diet, that corresponds to a metabolizable energy: crude protein ratio of 139,24.

  14. Growth and carcass characteristics of Japanese quails ( Coturnix ...

    African Journals Online (AJOL)

    The values of other primal cuts were statistically similar (P>0.05). Therefore, it is concluded that substituting synthetic vitamin mineral premixes with natural vitamin mineral premixes in diets is possible with no adverse effects on performance and carcass characteristics of growing Japanese quail. Key words: Proprietary ...

  15. Genetic variation and bottleneck in Japanese quail ( Coturnix ...

    African Journals Online (AJOL)

    The genetic structure of four strains of Japanese quail (Pharach, Panda, Tuxedo and Golden) was investigated by 12 microsatellite markers in Iran. Whole blood samples were collected from 200 individuals belonging to four strains and genomic DNA was extracted by salting out procedure. The 12 microsatellite markers ...

  16. Feed efficiency of diets with different energy and protein concentrations supplemented with methionine in laying quails

    Science.gov (United States)

    Ratriyanto, A.; Indreswari, R.; Nuhriawangsa, A. M. P.; Purwanti, E.

    2018-03-01

    The study was conducted to evaluate the feed efficiency of quail diets containing different concentrations of metabolizable energy (ME) and crude protein (CP) with constant ratio and supplemented with methionine. Four hundred laying quails (Coturnix coturnix japonica) were randomly assigned to four experimental diets in a 2×2 factorial arrangement. Each dietary treatment used 5 replicates of 20 quails. Two basal diets were formulated to contain 2,800 kcal kg-1 ME and 18.7% CP (High ME-CP) and 2,600 kcal kg-1 ME and 17.3% CP (Low ME-CP). Each basal diet was supplemented with 0 and 0.12% methionine. The High ME-CP diets generated lower feed consumption but higher egg mass and feed efficiency (Pprotein efficiency ratio (PHigh ME-CP supplemented with methionine resulted the highest feed efficiency followed by the Low ME-CP supplemented with methionine, while both High ME-CP and Low ME-CP without methionine supplementation resulted the lowest feed efficiency (PHigh ME-CP supplemented with 0.12% methionine provided benefit to improve the feed efficiency in laying quails.

  17. Effect of organic selenium and zinc on the performance and egg quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    VC Cruz

    2011-06-01

    Full Text Available The present study aimed at evaluating the effect of the dietary inclusion of organic trace minerals selenium and zinc on the performance and internal and external egg quality of Japanese quails submitted to heat stress. Data on egg production, feed conversion (kg feed intake/kg eggs and dozen eggs, egg weight, egg specific gravity, eggshell thickness and weight, Haugh unit, yolk index, albumen index and mortality (% of 144 quails were evaluated for 112 days, divided in eight cycles of 14 days. Birds were distributed according to a randomized block experimental design into four treatments (control; 0.3ppm Se; 60ppm Zn and 0.3ppm Se + 60ppm Zn with six replicates each. There were no differences (p> 0.05 in egg production (%, egg mass (g/hen/day, feed conversion per egg mass (kg/kg, feed conversion per dozen eggs (kg/dz, average egg weight (g, egg specific gravity, eggshell thickness and weight (g, Haugh unit, yolk index, albumen index and mortality (%. However, quails fed the combination of Se and Zn presented higher (p < 0.05 feed intake (28.73 g/hen/day. Those fed only organic selenium had higher average daily egg production (30.17 eggs/day, and those fed the diet only supplemented with zinc presented higher mortality (p < 0.05. The results of the present study suggest that the supplementation of organic trace minerals in Japanese quails diets submitted to heat stress does not significantly influence quail performance and internal egg quality, whereas the supplementation of the combination of organic Zn and Se increases feed intake.

  18. Role Of SYNBIOTICS And Low Level GAMMA Irradiation Treatments In Improving Performance Of Japanese Quails

    International Nuclear Information System (INIS)

    ABU-TALEB, A.M.

    2009-01-01

    A total number of 800 Japanese quail eggs were obtained from a parent flock maintained the poultry research unit of the Biological Application Department, Nuclear Research Centre at Inshas, Egypt, and used in the present study. Before incubating the eggs, they were divided into two equal groups of 400 eggs each; the 1 st group was exposed to a low level of gamma irradiation at 50 rad before sitting while the 2 nd group did not exposed to gamma irradiation. After hatching of the two groups, fertility, hatchability, embryonic mortality and hatching weight were determined. Hatched quail chicks from each group (1 and 2) were divided into four identical subgroups and all fed the basal diet but with a different supplement. The diet of the 1 st subgroup was supplemented with 2.5% Lactobacilli, the 2 nd with 1.5% lactose, the 3 rd with 2.5% Lactobacilli plus 1.5% lactose, while the 4 th subgroup was fed the basal diet only and served as control. The results showed decreased embryonic mortality and increased hatchability and hatching weight due to exposing quail eggs to low level of gamma radiation as compared to non-exposed eggs. The average body weight and the relative weights of carcass, testis and oviduct, egg production, egg weight, serum total protein, albumin, globulins, RBC, WBC and Hb values were increased significantly (P th week due to adding Lactobacilli and lactose to the basal diet. Significant reduction (P<0.05) in the intestinal wall index was observed due to adding Lactobacilli and lactose to the basal diet of hatched quails. In conclusion, adding Lactobacilli and/or lactose to the basal diet of hatched Japanese quails improved performance as well as blood constituents and intestinal wall index. The magnitude of this improvement was even greater when both supplements were combined. In addition, the exposure of eggs to low level of gamma radiation (50 rad) improved hatchability and hatching weight of Japanese quail eggs, but no relationship to dietary

  19. Behaviour of Japanese Quail Eggs Under Mechanical Compression

    Czech Academy of Sciences Publication Activity Database

    Buchar, J.; Nedomová, Š.; Trnka, Jan; Strnková, J.

    2015-01-01

    Roč. 18, č. 5 (2015), s. 1110-1118 ISSN 1094-2912 Institutional support: RVO:61388998 Keywords : quail egg * compression * rupture force Subject RIV: GM - Food Processing Impact factor: 1.586, year: 2015 http://www.tandfonline.com/doi/abs/10.1080/10942912.2013.862634#.VNI0aC7z_PM

  20. Shelf life of fresh air packaged and precooked vacuum packaged quails

    Directory of Open Access Journals (Sweden)

    Francesca Piras

    2013-11-01

    Full Text Available The shelf-life of 3 batches (Q1, Q2, Q3 of quail meat, were examined. Q1 were cut and seasoned with commercial olive oil, stoned green olive and sliced bacon. Q2 were divided into two subgroups: Q2.1 produced in the previously described conditions; Q2.2 seasoned also with rosemary. Quails were placed in lowdensity polystirene barrier trays and aerobically packaged. Q3 quails were boiled in salted hot water for 40 min, seasoned with myrtle leafs, placed in low density polyethylene bags and vacuum packaged. All samples were stored at +2 and +7°C. Analysis were conducted at 0, 3, 7, 9 and 14 days (T0, T3, T7, T9, and T14, respectively. For all the samples, pH measurement and microbial analysis [total viable count (TVC, Enterobacteriaceae, E. coli, Lactobacillus spp. (LAB, Pseudomonas spp., Brochothrix thermosphacta, coagulase-negative Staphylococci (CNS, Enterococcus spp., yeasts and moulds, Salmonella spp., Listeria monocytogenes] were performed. Initial TVC levels of fresh quails (ca. 4 log CFU/g were rather high and this may be due to the microbial population of the raw material. In Q1 and Q2.1 samples, TVC reached the value of 7 log, which is considered as the upper acceptability limit for fresh poultry meat (after T9 under storage at +2°C and after T7 at +7°C. In Q2.2 samples such limit was reached earlier, after T3. In Q3 samples, lower TVC levels were recorded and did not reach the above mentioned limit, not even at the end of storage. However, mean counts >5 log were reached, maybe because of a post-cooking cross-contamination. Salmonella spp. prevalence was 33% in Q1, Q2.1 and Q2.2 samples.

  1. Organizational effects of diethylstilbestrol on brain vasotocin and sexual behavior in male quail.

    Science.gov (United States)

    Viglietti-Panzica, Carla; Montoncello, Barbara; Mura, Elena; Pessatti, Marzia; Panzica, GianCarlo

    2005-04-15

    In Japanese quail, we previously described a sexual dimorphism of the parvocellular vasotocin system of the limbic region that, as the reproductive behavior, is steroid-sensitive and is organized during embryonic life by the exposure to estradiol. We verified in this study whether diethylstilbestrol, a chemical xenoestrogen, has analogous organizational effects on the vasotocin system of limbic regions and on copulatory behavior of male Japanese quail. We injected in the yolk sac of 3 day-old quail embryos diethylstilbestrol or estradiol benzoate (a treatment which suppresses male copulatory behavior in adulthood and reduces vasotocin innervation), or sesame oil (control). No further hormonal manipulations were performed after hatching. Sexual behavior was recorded in males at the age of 6 weeks. Estradiol- and diethylstilbestrol-treated males exhibited a total suppression of copulatory behavior. After behavioral tests, all males were sacrificed and brain sections processed for vasotocin immunocytochemistry. Significant decrease in the density of vasotocin immunoreactivity was detected in the medial preoptic nucleus, in the bed nucleus of stria terminalis, and in the lateral septum of diethylstilbestrol-treated males. The magnocellular vasotocin neurons were, in contrast, not affected. In conclusion, the present data demonstrate that embryonic treatment with diethylstilbestrol induces a full sex reversal of behavioral phenotype as well as a significant decrease of vasotocin expression in the preoptic-limbic region in male Japanese quail. Therefore, the parvocellular vasotocin system could represent an optimal model to investigate the effects of pollutants on neural circuits controlling reproductive functions.

  2. Effects of selection for yolk cholesterol on growth and meat quality in Japanese quail (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Marek Bednarczyk

    2010-01-01

    Full Text Available Descendants ( of S18 generation of Japanese quails (Coturnix coturnix japonica, selected for low (line 11, n=15 or for high (line 12, n=6 yolk cholesterol content were used for this experiment. The high (12 and low (11 lines were developed from a control egg type (line13 wild color plumage stock 07, from Poultry Breeding Station in Ivanka at Danube (Slovakia that was maintained without conscious selection. The results of selected lines were compared to this one from unselected lines, egg type (line 13, n=15 and meat type (line 8, n=15, to study productive performance (growth and carcass weight as well as meat quality traits (intramuscular collagen properties, fatty and cholesterol content. The birds were grown up to 35 days of age. Quails were fed ad libitum with commercial diets according to their ages. Animals had free access to water during the experiment. The body weight of the quails was controlled every week (from week 1 to 5. At the slaughter (at avg. weight of 104.0, 107.7, 110.6 g vs 209.3 g for lines 11, 12, 13 vs 8, respectively; P<0.05 the hot carcass weight was recorded and dressing percentage was calculated. Pectoralis superficialis muscles were removed from the carcasses to assess intramuscular collagen (IMC properties (collagen and crosslink concentrations, intramuscular lipid and cholesterol contents. Growth and slaughter performance, intramuscular fat percentage and IMC properties of Pectoralis superficialis were not different between the birds selected for low (line 11 and high (line 12 yolk cholesterol content and were also found to be similar between the quails of egg type and those selected for yolk cholesterol content (lines 11 and 12. Compared to the birds of egg type line and those selected for yolk cholesterol content, the quails of meat type had higher growth and carcass traits (P<0.05, while meat quality traits were found to be similar. The meat of the quails selected for low cholesterol in the egg yolk (line 11

  3. Scanning Electron Microscopic Studies of the Pecten Oculi in the Quail (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Aris F. Pourlis

    2013-01-01

    Full Text Available The main purpose of this study is to extend the microscopic investigations of the pecten oculi in the quail in order to add some information on the unresolved functional anatomy of this unique avian organ. The pecten oculi of the quail was studied by scanning electron microscopy. Eighteen- to-twenty two highly vascularised accordion-like folds were joined apically by a heavily pigmented bridge of tissue, which holds the pecten in a fanlike shape, widest at the base. The structure of the double layered limiting membrane was recorded. The presence of hyalocytes with macrophage-like appearance was illustrated. It is assumed that the pecten oculi of the quail resembles that of the chicken. Illustrated morphological features of this species may add information on the active physiological role of the pecten. But still, the functional significance of this organ is a matter of controversies.

  4. Trunk imbalance in adolescent idiopathic scoliosis.

    Science.gov (United States)

    Fortin, Carole; Grunstein, Erin; Labelle, Hubert; Parent, Stefan; Ehrmann Feldman, Debbie

    2016-06-01

    Trunk imbalance (ie, frontal trunk shift measured with a plumb line from C7 to S1) is part of the clinical evaluation in adolescent idiopathic scoliosis (AIS), but its prevalence and relationship with scoliosis, back pain, and health-related factors are not well documented. The principal objectives are to document trunk imbalance prevalence and to explore the association between trunk imbalance and the following factors: Cobb angle, type of scoliosis, back pain, function, mental health, and self-image. The secondary objective is to determine back pain prevalence and the relationship between back pain and each of the following: Cobb angle, function, mental health, and self-image. This is a cross-sectional study in a scoliosis clinic of a tertiary university hospital center. The sample includes youth with AIS (N=55). The outcome measures were trunk imbalance prevalence and magnitude, and back pain prevalence and intensity using the Numeric Pain Rating Scale (NPRS) and the Scoliosis Research Society-22 (SRS-22) pain score, and the function, self-image, and mental health domains of the SRS-22. Trunk imbalance and back pain were assessed in 55 patients with AIS (Cobb angle: 10-60°). Patients completed the SRS-22 questionnaire and the NPRS. Correlations were done between trunk imbalance and scoliosis (Cobb angle, type of scoliosis), back pain (NPRS and SRS-22 pain score), and health-related factors using Pearson correlation coefficients (r) and logistic regression models. Trunk imbalance prevalence is 85% and back pain prevalence is 73%. We found fair to moderate significant positive correlation between trunk imbalance and Cobb angle (r=0.32-0.66, pself-image, or type of scoliosis. Lower self-reported pain significantly correlated with lower Cobb angles (r=0.29, p=.03), higher function (r=0.55, p=.000), higher self-image (r=0.44, p=.001), and better mental health (r=0.48, p=.000). There was a trend for trunk imbalance to be related with lower pain in logistic regression

  5. [Quantitative changes in the ultrastructure of myocardial cells in Japanese quail during hypergravity, hypodynamia and space flight].

    Science.gov (United States)

    Bózner, A; Boda, K; Dostál, J; Matĕjková, Z; Devecka, V

    1993-03-01

    The experimental work aimed at the quantitative ultrastructure of the myocardial cells of the Japanese quail Coturnix coturnix japonica during hypergravitation, hypodynamism and space flight in a Soviet satellite. For the determination of quantitative changes of the myocardial ultrastructure a morphometrical method was used with parameters like the number of mitochondria, average mitochondrial size, relative mitochondrial volume, deficiency of cristae and relative volume of myofibrils. The quails were observed in 3 groups. The absolute control consisted of quails living in normal Earth conditions, in the laboratory group the quails were exposed to conditions of hypergravitation and hypodynamism in a specially constructed centrifuge, and in the flying group the quails were exposed to space flight in a Soviet orbital station MIR. In the group of absolute controls no pathological changes of the myocardial ultrastructure were found. In the flying group there were no significant changes, with the exception of decreased relative volume of myofibrils, which however agrees with the findings on symptoms corresponding to human and animal heart weakness during space flights. In the laboratory group, pathological changes were observed in each of the fractions. The most significant pathological findings were found in the group controls in the center and in hypergravitation combined with hypodynamism. It can be concluded that the laboratories can simulate conditions induced by the start and flight of space ships. (Fig. 2, Ref, 8.)

  6. COMPARISON OF SLAUGHTER VALUE IN PHARAOH QUAIL OF DIFFERENT AGES

    Directory of Open Access Journals (Sweden)

    Anna WILKANOWSKA

    2011-07-01

    Full Text Available The effect of age of Pharaoh quails on dressing percentage, carcass composition, and sensory and physicochemical properties of their meat was determined. Compared to 42-day-old birds, Pharaoh quail aged 33 days had lower body weight (169.1 vs 139.4 g, carcass weight (111.7 vs 88.8 g and dressing percentage (66.1 vs 63.7%. The carcasses of 42-day-old birds contained more breast muscles (30.9%, leg muscles (18.3%, skin with subcutaneous fat (6.5% and remainders of the carcass (31.0% compared to birds at 33 days of age (30.8; 16.7; 6.2 and 30.0%, respectively. Older birds showed higher values of pH15, redness (a* and yellowness (b* and lower values of sensory meat properties except aroma intensity.

  7. Distribution of orally administered and chronically fed sup(95m)Tc in Japanese quail tissues and eggs

    International Nuclear Information System (INIS)

    Thomas, J.M.; Cadwell, L.L.; Cataldo, D.A.; Garland, T.R.

    1986-01-01

    In the present study, male and female Japanese quail were chronically fed alfalfa grown on solutions containing TcO 4 which was mixed into a commercial turkey starter. The objective was to estimate concentration ratios and transfer coefficients from Tc incorporated into alfalfa tissue to quail eggs, edible tissues and other organs. (author)

  8. Utilization of Katuk (Sauropus androgynus L Merr meal and extract as ration substitution to produce low chollesterol Japanese Quail product

    Directory of Open Access Journals (Sweden)

    Sri Subekti

    2006-12-01

    Full Text Available Katuk (Sauropus androgynus L Merr is known to contain carotenoids, vitamin E, vitamin C, protein and phytosterol compound. This study was aimed to determine the ability of phytosterols in Sauropus androgynus (SA leaf to obtain poultry product that has low cholesterol content. One hundred fifty female quails were raised from 2-27 weeks old, divided into three treatment diets, five replicates with 10 quails in each replicate. The treatment diets were: 1 Control group: diet without katuk leaf meal; 2 Diet with 9% SA ethanol 70% extract (SAE; 3 Diet containing 9% SA meal (SAM. Kolesterols were determined with CHOD-PAP-Method by Human, there is enzymatic Colorimetric Test for Cholesterol with Lipid Clearing Factor. The result showed that total cholesterol in the egg yolk, carcass and liver of SAE and SAM treated quails were lower (P<0.05 than that of the control-treated quails, except the cholesterol content in the serum. These findings indicated that the cholesterol concentration of female quails was decreased due to phytosterol content in katuk leaf.

  9. Cocaine induces state-dependent learning of sexual conditioning in male Japanese quail.

    Science.gov (United States)

    Gill, Karin E; Rice, Beth Ann; Akins, Chana K

    2015-01-01

    State dependent learning effects have been widely studied in a variety of drugs of abuse. However, they have yet to be studied in relation to sexual motivation. The current study investigated state-dependent learning effects of cocaine in male Japanese quail (Coturnix japonica) using a sexual conditioning paradigm. Cocaine-induced state-dependent learning effects were investigated using a 2×2 factorial design with training state as one factor and test state as the other factor. During a 14-day training phase, male quail were injected once daily with 10mg/kg cocaine or saline and then placed in a test chamber after 15min. In the test chamber, sexual conditioning trials consisted of presentation of a light conditioned stimulus (CS) followed by sexual reinforcement. During the state dependent test, half of the birds received a shift in drug state from training to testing (Coc→Sal or Sal→Coc) while the other half remained in the same drug state (Coc→Coc or Sal→Sal). Results showed that male quail that were trained and tested in the same state (Coc→Coc or Sal→Sal) showed greater sexual conditioning than male quail that were trained and tested in different states (Sal→Coc) except when cocaine was administered chronically prior to the test (Coc→Sal). For the latter condition, sexual conditioning persisted from cocaine training to the saline test. The findings suggest that state dependent effects may alter sexual motivation and that repeated exposure to cocaine during sexual activity may increase sexual motivation which, in turn, may lead to high risk sexual activities. An alternative explanation for the findings is also discussed. Copyright © 2014 Elsevier Inc. All rights reserved.

  10. Sex Determination of Japanese Quails (Coturnix Coturnix Japonica using with Zoometric Measurements

    Directory of Open Access Journals (Sweden)

    Tülin Çiçek Rathert

    2017-09-01

    Full Text Available The difficulty of sex determination in most poultry species causes significant financial losses for poultry production as birds cannot be separated at early stages of growth for meat or egg production. Therefore it is important to determine bird’s sex with zoometric parameters. This study was carried out to determine the sex of Japanese quails with zoometric measurements, such as live weight, body length, chest depth and chest width. Eighty-eight male and female Japanese quail chicks were used individually for live weight, chest depth (mm, chest width (mm and body length (mm with using digital scaled balance and caliper for every week over a period of six weeks. The weekly collected data were applied to t test for estimating the sex discrimination. The Pearson’s correlation was applied for examining the interrelationship between sex and biometric traits. The results indicated that there was a significant positive correlation between live weight and body length beginning with the 2nd week. Therefore, zoometric measurement of these body traits is suitable for discriminating the sex of Japanese quails in early phase of life.

  11. Evaluation of pomegranate (Punica granatum pericarp aqueous extract on Eimeria spp. from Japanese quails (Coturnix japonica

    Directory of Open Access Journals (Sweden)

    Bruno P. Berto

    2014-06-01

    Full Text Available Antibacterial, anti-inflammatory and antiparasitic properties have been associated with the extract of pomegranate (Punica granatum in several animals and conditions. The Japanese quail (Coturnix japonica, originated from North Africa, Europe and Asia, is used worldwide as an experimental animal and model for aviculture. The current study investigated the effects of the pomegranate pericarp aqueous extract on the shedding, viability and morphometry of three Eimeria spp. from Japanese quails, besides the weight gain and genotoxic activity. Although the pomegranate is recognized by multiple properties, including anti-coccidial, in the current study the results are contrary. The treated group shed greater amount of oocysts; the sporulation times and viability were similar in both groups; despite some morphometric differences, these were not expressive; weight gains were similar; and the pomegranate had insignificant effect genotoxic. Finally, these results suggest that the pomegranate pericarp extract did not influence on Eimeira spp. from Japanese quails; therefore, the pomegranate pericarp extract is not suggested in the prevention/treatment of coccidiosis in Japanese quails, or at least not using methods of preparation and administration applied in this study.

  12. Trunk Robot Rehabilitation Training with Active Stepping Reorganizes and Enriches Trunk Motor Cortex Representations in Spinal Transected Rats

    OpenAIRE

    Oza, Chintan S.; Giszter, Simon F.

    2015-01-01

    Trunk motor control is crucial for postural stability and propulsion after low thoracic spinal cord injury (SCI) in animals and humans. Robotic rehabilitation aimed at trunk shows promise in SCI animal models and patients. However, little is known about the effect of SCI and robot rehabilitation of trunk on cortical motor representations. We previously showed reorganization of trunk motor cortex after adult SCI. Non-stepping training also exacerbated some SCI-driven plastic changes. Here we e...

  13. USE OF SACCHROMYCES CERVISIAE TO SUPPRESS THE EFFECTS OF FUMONISIN MYCOTOXICOSIS IN JAPANESE QUAIL

    International Nuclear Information System (INIS)

    ABU TALEB, A.M.

    2008-01-01

    In this study, 400 unsexed Japanese quail chicks (1 day old) were used. The quail chicks were randomly assigned into four groups of 100 birds in each. The first group was served as control. The other experimental groups were fed on a basal diet supplemented with 0.5% yeast/kg diet (G2), 0.5% yeast/kg diet ± 200 mg fumonicin-B1/kg diet (G3) and 200 mg fumonicin-B1/kg diet (G4). The results showed significant increases in mortality rate, GPT (ALT), GOT (AST), cholesterol, uric acid, creatinine and alpha-fetoprotein (AFP) and decreases in body weight, hatchability, fertility and hatching weight, serum total proteins, globulin and glutathione peroxidase (GPx) activity in group of quails received fumonisin (G4) in comparison with the control group (G1) and all treatments. Yeast led to partial improvement in the parameters in group two (G2). Also, yeast suppressed the toxic effect of fumonisin B-1 (G3)

  14. USE OF SACCHROMYCES CERVISIAE TO SUPPRESS THE EFFECTS OF FUMONISIN MYCOTOXICOSIS IN JAPANESE QUAIL

    Energy Technology Data Exchange (ETDEWEB)

    ABU TALEB, A M [Biological Applications Dept., Radioisotope Applications Division, Nuclear Research Center, Abou-Zaable, Inshas (Egypt)

    2008-07-01

    In this study, 400 unsexed Japanese quail chicks (1 day old) were used. The quail chicks were randomly assigned into four groups of 100 birds in each. The first group was served as control. The other experimental groups were fed on a basal diet supplemented with 0.5% yeast/kg diet (G2), 0.5% yeast/kg diet {+-} 200 mg fumonicin-B1/kg diet (G3) and 200 mg fumonicin-B1/kg diet (G4). The results showed significant increases in mortality rate, GPT (ALT), GOT (AST), cholesterol, uric acid, creatinine and alpha-fetoprotein (AFP) and decreases in body weight, hatchability, fertility and hatching weight, serum total proteins, globulin and glutathione peroxidase (GPx) activity in group of quails received fumonisin (G4) in comparison with the control group (G1) and all treatments. Yeast led to partial improvement in the parameters in group two (G2). Also, yeast suppressed the toxic effect of fumonisin B-1 (G3)

  15. Genetic parameters for quail body weights using a random ...

    African Journals Online (AJOL)

    A model including fixed and random linear regressions is described for analyzing body weights at different ages. In this study, (co)variance components, heritabilities for quail weekly weights and genetic correlations among these weights were estimated using a random regression model by DFREML under DXMRR option.

  16. Helminth community of scaled quail (Callipepla squamata) from western Texas.

    Science.gov (United States)

    Landgrebe, Jill N; Vasquez, Barbara; Bradley, Russell G; Fedynich, Alan M; Lerich, Scott P; Kinsella, John M

    2007-02-01

    Forty-eight scaled quail (Callipepla squamata) were collected during August 2002 at Elephant Mountain Wildlife Management Area in Brewster County, Texas, and examined for helminths. Eight species of helminths were found (5 nematodes and 3 cestodes), representing 2,811 individuals. Of these species, Gongylonema sp., Procyrnea pileata, and Choanotaenia infundibulum are reported from scaled quail for the first time. Prevalence of Aulonocephalus pennula, Gongylonema sp., Oxyspirura petrowi, Physaloptera sp., P. pileata, C. infundibulum, Fuhrmannetta sp., and Rhabdometra odiosa was 98, 2, 56, 4, 60, 2, 25, and 35%, respectively. Aulonocephalus pennula numerically dominated, accounting for 88% of total worms. Statistical analyses were performed on the 5 species with > or = 25% prevalence using the after-hatch-year host sample (n = 38). Prevalence of P. pileata was higher (P = 0.049) in females than in males and higher (P = 0.037) in the sample collected from the site that had spreader dams (berms 1-2 m high and 4-55 m long constructed in varying sizes to catch and retain rainfall) than the control site (no spreader dams). Higher rank mean abundance of A. pennula and O. petrowi (P = 0.0001 and P = 0.0052, respectively) was found in the host sample collected from the site that had spreader dams than the control site. A host gender-by-collection site interaction (P = 0.0215) was observed for P. pileata. Findings indicate that scaled quail are acquiring indirect life cycle helminths in arid western Texas habitats.

  17. Whole-Genome de novo Sequencing Of Quail And Grey Partridge

    DEFF Research Database (Denmark)

    Holm, Lars-Erik; Panitz, Frank; Burt, Dave

    2011-01-01

    The development in sequencing methods has made it possible to perform whole genome de novo sequencing of species without large commercial interests. Within the EU-financed QUANTOMICS project (KBBE-2A-222664), we have performed de novo sequencing of quail (Coturnix coturnix) and grey partridge...... (Perdix perdix) on a Genome Analyzer GAII (Illumina) using paired-end sequencing. The amount of generated sequences amounts to 8 to 9 Gb for each species. The analysis and assembly of the generated sequences is ongoing. Access to the whole genome sequence from these two species will enable enhanced...... comparative studies towards the chicken genome and will aid in identifying evolutionarily conserved sequences within the Galliformes. The obtained sequences from quail and partridge represent a beginning of generating the whole genome sequence for these species. The continuation of establishing the genome...

  18. COMPARATIVE EFFICACY OF DETOMIDINE AND DETOMIDINE - KETAMINE COCKTAIL IN QUAILS

    Directory of Open Access Journals (Sweden)

    U. F. Durrani, M. Ashraf and A. Khalid¹

    2005-10-01

    Full Text Available Twenty adult healthy quails (Coturnix coturnix were divided into two equal groups. One group was administered detomidine (2.4 mg/kg, I/M and other group was administered detomidine-ketamine cocktail (1.2 mg/kg + 30 mg/kg, I/M. Detomidine slowly and smoothly induced a light sedation accompanied by superficial analgesia, hypoventilation, hypothermia and bradycardia in all birds. Detomidine-ketamine cocktail rapidly and smoothly induced a deep anaesthesia accompanied by deep analgesia, hypoventilation, hypothermia and bradycardia and complete loss of all reflexes in all birds. In both groups, recovery from sedation and anaesthesia was smooth and of short duration. From this study it was concluded that for minor and least painful procedures in quails detomidine can be used alone, while for major and painful surgical procedures detomidine-ketamine combination should be preferred.

  19. Growth performance, meat quality traits, and genetic mapping of quantitative trait loci in 3 generations of Japanese quail populations (Coturnix japonica).

    Science.gov (United States)

    Tavaniello, S; Maiorano, G; Siwek, M; Knaga, S; Witkowski, A; Di Memmo, D; Bednarczyk, M

    2014-08-01

    The current research was conducted to compare growth, carcass traits, pH, intramuscular collagen (IMC) properties, and genetic bases of IMC and carcasses (breast-muscle weight) of different lines and generations of adult males and females of Japanese quail (Coturnix japonica). Forty-four quails (generation F0), 22 Pharaoh (F-33) meat-type males and 22 Standard (S-22) laying-type females, were crossed to produce the F1 hybrids generation. The F2 generation was created by mating one F1 male with one F1 female, full siblings. The birds, randomly chosen from F0 (22 males and 22 females), F1 (22 males and 22 females), and F2 (84 males and 152 females) were raised to 20 wk of age in collective cages. Quails were fed ad libitum commercial diets. At slaughter, all birds were individually weighed (after a fasting period of 12 h) and dressing yield (without giblets) was calculated. The carcasses were then dissected. Genomic DNA was extracted from all of the blood, and 30 microsatellite markers located on 2 quail chromosomes were genotyped. The F -: 33 quails had higher in vivo and postmortem performances and a higher abdominal fat percentage than those of the egg line. Meat from S -: 22 quails had a slower collagen maturation (hydroxylysylpyridinoline crosslink/collagen) and a higher ultimate pH. The F1 and F2 generations showed an evident sexual dimorphism, and an additional effect could be due to hybrid heterosis evident in F2. Meat from quails of F1 and F2 generations had a lower IMC amount with a higher degree of collagen maturation compared with parental lines. Two statistically significant QTL have been detected on quail chromosome 2 (CJA02): a QTL with an additive effect (0.50) for IMC in the marker bracket GUJ0037 and GUJ0093; a second QTL with additive (1.32) and dominant (1.91) effects for breast-muscle weight in the marker bracket GUJ0084 and GUJ0073. To our knowledge, this is the first report of a QTL associated with breast-muscle weight and IMC in quail and

  20. Trunk Muscle Function Deficit in Youth Baseball Pitchers With Excessive Contralateral Trunk Tilt During Pitching.

    Science.gov (United States)

    Oyama, Sakiko; Waldhelm, Andrew G; Sosa, Araceli R; Patel, Ravina R; Kalinowski, Derick L

    2017-09-01

    Pitching technique is one of many factors that affect injury risk. Exhibiting excessive contralateral trunk tilt (CLT) during pitching has been linked to higher ball speed but also to increased joint loading. Deficit in trunk muscle strength has been suggested as an underlying cause of this movement pattern. The purpose of the study was to compare trunk muscle strength between youth baseball pitchers with varying degree of CLT during pitching. Cross-sectional study. Baseball practice fields. Twenty-eight youth baseball pitchers. Pitching technique was captured using a video camera. Based on the 2-dimensional trunk contralateral flexion angle, pitchers were categorized into low (30 degrees) CLT groups. Maximum isometric strength tests for trunk flexion, extension, and bilateral rotation, measured using a dynamometer. The pitchers with high CLT (n = 10) had longer pitching experience (P = 0.014), produced higher ball speed (P = 0.003) compared with the pitchers with moderate (n = 10) and low (n = 8) CLT, but demonstrated greater asymmetry in trunk rotation strength (relative weakness in rotation strength toward dominant side) compared with the pitchers with low CLT (P = 0.015). Excessive CLT may be a strategy that young pitchers learn to achieve higher ball velocity but also may be associated with imbalance between the oblique muscles on dominant and nondominant side, which may be acquired from repetitive pitching. Strengthening and emphasizing the use of dominant side oblique muscles may keep pitchers from leaning excessively during pitching and thus decrease joint loading.

  1. The Effect of Fasting Pattern on Biological Performance of Quail at Early Production Period

    OpenAIRE

    Tugiyanti, Efka

    2005-01-01

    The objective of this research was to find out the effect of fasting pattern on biological performance of quail at early production period. 50 kg commercial feed, vitamins and medicine were applied on 140 heads of seven old day quail.  Four different fasting pattern were employed as treatment, i.e. ad libitum diet (Po); every two days fasting (P1); every three days fasting (P2); every four days fasting (P3); and every five days fasting (P4).   Ad libitum amount of  corn and water were offered...

  2. An Anomalous Branching of Coeliac Trunk

    Directory of Open Access Journals (Sweden)

    Jadhav Surekha D

    2013-07-01

    Full Text Available Anatomical variations of the coeliac trunk arevery common. A variation of coeliac trunk oc-curs due to the developmental abnormalities inthe ventral splanchnic arteries. Present paperhighlights a rare variation of branching patternof coeliac trunk which was observed during rou-tine dissection. In a 63 year old male cadaver,we observed a bifurcation of coeliac trunk intoshort hepato-splenic and longer hepato-gastrictrunks. The hepato-splenic trunk divided intocommon hepatic artery and splenic artery. Cys-tic artery originated from proper hepatic arteryand then proper hepatic artery divided into rightand left hepatic arteries. Hepato-gastric trunkran laterally and upward, and then it divided intotwo branches: a left gastric artery and left ac-cessory hepatic artery. Knowledge of this rarevariation is clinically very important for sur-geons, especially while performing liver trans-plantation, gastric, gallbladder surgeries andtransarterial chemoembolization for hepatictumor and during invasive procedures like an-giography and also other radiological studies.

  3. INFLUENCE OF TRIBULUS TERRESTRIS EXTRACT SUPPLEMENTATION ON LAYING PRODUCTIVITY AND EGGS QUALITY IN JAPANESE QUAILS

    Directory of Open Access Journals (Sweden)

    Martina Nickolova

    2011-01-01

    Full Text Available The aim of the current work was to examine the influence of Bulgarian phytoproduct VemoHerb T (dry extract of Tribulus terrestris –TT on laying productivity of Japanese quails (Coturnix coturnix japonica and their egg morphological and sensor properties. A trial was organized with 52 female and 16 male Japanese quails from the breed Faraon at the age of 44 days randomly divided in four groups – control and three experimental groups, 13 female and 4 male each. All birds were fed ad libitum the same compound feed for Japanese quails. The trial lasted 10 weeks. The experimental groups received with the drink water the tested product in following daily doses: 4mg/kg body weight (10weeks; 10mg/kg body weight (the first 5 weeks of the trial; 10mg/kg body weight (10 weeks for Ist, IInd , IIInd experimental groups respectively. The addition of TT-extract improved significantly the laying productivity. It was found significant higher values of egg weight, albumen - and yolk weight in quails from IInd and IIIrd experimental groups. There was a tendency to increase the egg shell weight and egg shell thickness in all treated groups in comparison to the control group. The usе of VemoHerb T did not aggravate the sensor properties of the quails’ eggs.

  4. Effects of Herbal Essential Oil Mixture as a Dietary Supplement on Egg Production in Quail

    Directory of Open Access Journals (Sweden)

    Metin Çabuk

    2014-01-01

    Full Text Available One hundred and eighty 7-week-old laying quail were fed various diets over a 12-week period. The diets included a control diet (without essential oil mixture (EOM or antibiotics (ANTs, a basal diet including EOM (24 mg/kg feed, and a basal diet including an ANT (avilamycin, 10 mg/kg feed. Each treatment comprised 4 replications with 4 cages (15 quail per cage, amounting to 60 quail per treatment group. Diets (in mash form and water were provided for ad libitum consumption. EOM consisted of 6 different essential oils derived from the following herbs: oregano (Origanum sp., laurel leaf (Laurus nobilis L., sage leaf (Salvia triloba L., myrtle leaf (Myrtus communis, fennel seeds (Foeniculum vulgare, and citrus peel (Citrus sp.. In comparison with the control diet, adding supplements such as EOM and ANTs to the basal diet increased egg production in quail (P<0.001. However, egg production was similar between EOM and ANT treatment groups. Moreover, there were no differences between the treatment groups with regard to egg weight. Feed intake was not affected by EOM or ANT supplementation, whereas feed conversion ratio was significantly improved by EOM and ANT supplementation. Thus, we concluded that EOM has beneficial effects as a dietary supplement on egg production and feed conversion ratio.

  5. Molecular study for the sex identification in Japanese quails ...

    African Journals Online (AJOL)

    use

    2011-12-14

    Dec 14, 2011 ... The aim of this study was to determine the sex of. Japanese quail (Coturnix japonica) by DNA analysis. Chromo ... M, 100 bp DNA ladder (Fermentas, Germany); lane 1, negative control. (without DNA) .... low cost and reduced risk of contamination, and preven- .... Improving the reliability of molecular sexing.

  6. Responses of growing Japanese quails that received selenium from selenium enriched kale sprout (Brassica oleracea var. alboglabra L.).

    Science.gov (United States)

    Chantiratikul, Anut; Chinrasri, Orawan; Pakmaruek, Pornpan; Chantiratikul, Piyanete; Thosaikham, Withpol; Aengwanich, Worapol

    2011-12-01

    The objectives of this study were to determine the effect of selenium (Se) from Se-enriched kale sprout (Brassica oleracea var. alboglabra L.) on the performance and Se concentrations in tissues of growing Japanese quails. Two hundred quails were divided into five treatments. Each treatment consisted of four replicates and each replicate contained ten quails in a completely randomize design. The experiment was conducted for 5 weeks. The treatments were T1, control diet; T2, control diet plus 0.2 mg Se/kg from sodium selenite; T3, T4, and T5, control diet plus 0.2, 0.5, and 1.0 mg Se/kg from Se-enriched kale sprout. The results revealed that Se supplementation had no impact on feed intake, performance, and carcass characteristics of quails (p > 0.05). However, Se supplementation from both sodium selenite and Se-enriched kale sprout increased (p kale sprout. The results indicate that Se from Se-enriched kale sprout offers no advantage over Se from sodium selenite on tissue Se concentration.

  7. Bovine meat and bone meal is an economically viable alternative in quail feeding in the initial phase

    Directory of Open Access Journals (Sweden)

    Carla C. Pizzolante

    2016-06-01

    Full Text Available Quail egg production has experienced a steep rise in the last decade. Nutrition is the main factor affecting productive potential in the poultry industry, as appropriate nutritional management is necessary to ensure the maintenance of optimal physical conditions, growth and the production of high quality products. Meat and bone meal (MBM has often been used in the poultry industry as an alternative and cost-effective source of protein in partial replacement of corn and soybean meal. However, there have been no studies to date that have investigated the effect of dietary MBM on the performance of quail or on the costs of production in the starter phase. This is particularly important considering that this phase is characterized by large investments by producers, without immediate economic return. In this study, we investigated whether partial replacement of soybean meal (SBM by meat and bone meal (MBM in the diet of Japanese quail during the starter phase is a viable alternative that would maintain or improve their productive and economic performance. Our results show that the inclusion of MBM in the diet of quail reduces feeding costs by up to 6% without impairing productive performance.

  8. Bovine meat and bone meal is an economically viable alternative in quail feeding in the initial phase.

    Science.gov (United States)

    Pizzolante, Carla C; Kakimoto, Sérgio K; Moraes, José E; Saccomani, Ana Paula O; Soares, Daniela F; Paschoalin, Gustavo C; Budiño, Fábio E L

    2016-05-31

    Quail egg production has experienced a steep rise in the last decade. Nutrition is the main factor affecting productive potential in the poultry industry, as appropriate nutritional management is necessary to ensure the maintenance of optimal physical conditions, growth and the production of high quality products. Meat and bone meal (MBM) has often been used in the poultry industry as an alternative and cost-effective source of protein in partial replacement of corn and soybean meal. However, there have been no studies to date that have investigated the effect of dietary MBM on the performance of quail or on the costs of production in the starter phase. This is particularly important considering that this phase is characterized by large investments by producers, without immediate economic return. In this study, we investigated whether partial replacement of soybean meal (SBM) by meat and bone meal (MBM) in the diet of Japanese quail during the starter phase is a viable alternative that would maintain or improve their productive and economic performance. Our results show that the inclusion of MBM in the diet of quail reduces feeding costs by up to 6% without impairing productive performance.

  9. Age determination in juvenile bobwhite quail

    Science.gov (United States)

    Petrides, G.A.; Nestler, R.B.

    1943-01-01

    Following methods described by Louis Bureau (1911, 1913) in France,tabulations were made (1) of the ages at which captivity-reared bob-white quail (Colinus virginianus) dropped their juvenal remiges, and (2) the rates at which post-juvenal replxcement primaries grew. These were arranged so as to permit the determination of age in healthv birds from one to five months of age. The degree of individual variation was much greater than that found by Bureau, however. and limits accuracy in age determination after the 10th week..... The post-juvenal wing molt began on the birds' 28th day and ended when the quail were 146 to 154 days old.The post-juvenal body molt was found to take place largely between the 70th and 100th days. The juvenal rectrices were renewed from the 62nd to the 122nd days, the new feathers being as long as their longest coverts when the birds were 116 days old. The color of the tarsi varied from pink, at 32 days of age, to straw color at 60 days, and yellow-gray from 83 to 180 days. At six months, the color of the beak was identical with that of adults.....Unlike several other game bird species, the flexibility of the lower jaw was not an accurate index to age in bob-whites older than 11 weeks. Rigor mortis and freezing were found to hinder the testing of this criterion.

  10. Age-related reduction of trunk muscle torque and prevalence of trunk sarcopenia in community-dwelling elderly: Validity of a portable trunk muscle torque measurement instrument and its application to a large sample cohort study.

    Science.gov (United States)

    Sasaki, Eiji; Sasaki, Shizuka; Chiba, Daisuke; Yamamoto, Yuji; Nawata, Atsushi; Tsuda, Eiichi; Nakaji, Shigeyuki; Ishibashi, Yasuyuki

    2018-01-01

    Trunk muscle weakness and imbalance are risk factors for postural instability, low back pain, and poor postoperative outcomes. The association between trunk muscle strength and aging is poorly understood, and establishing normal reference values is difficult. We aimed to establish the validity of a novel portable trunk muscle torque measurement instrument (PTMI). We then estimated reference data for healthy young adults and elucidated age-related weakness in trunk muscle strength. Twenty-four university students were enrolled to validate values for PTMI, and 816 volunteers from the general population who were recruited to the Iwaki Health Promotion Project were included to estimate reference data for trunk muscle strength. Trunk flexion and extension torque were measured with PTMI and KinCom, and interclass correlation coefficients (ICC) were estimated to evaluate the reliability of PTMI values. Furthermore, from the young adult reference, the age-related reduction in trunk muscle torque and the prevalence of sarcopenia among age-sex groups were estimated. The ICC in flexion and extension torque were 0.807 (psarcopenia increased with age, and the prevalence due to flexion torque was double that of extension torque. Flexion torque decreased significantly after 60 years of age, and extension torque decreased after 70 years of age. In males over age 80, trunk muscle torque decreased to 49.1% in flexion and 63.5% in extension. In females over age 80, trunk muscle torque decreased to 60.7% in flexion and 68.4% in extension. The validity of PTMI was confirmed by correlation with KinCom. PTMI produced reference data for healthy young adults, and demonstrated age-related reduction in trunk muscle torque. Trunk sarcopenia progressed with aging, and the loss of flexion torque began earlier than extension torque. At age 80, trunk muscle torque had decreased 60% compared with healthy young adults.

  11. Molecular study for the sex identification in Japanese quails ...

    African Journals Online (AJOL)

    In many birds' species such as Japanese quail, sex determination in young and many adult birds is very difficult. Nowadays, sex identification of animals throughout their lives is possible by molecular genetic techniques such as polymerase chain reaction (PCR). The aim of this study was to determine the sex of Japanese ...

  12. Haemosporidian infection in captive masked bobwhite quail (Colinus virginianus ridgwayi), an endangered subspecies of the northern bobwhite quail

    Science.gov (United States)

    Pacheco, M. Andreína; Escalante, Ananias A.; Garner, Michael M.; Bradley, Gregory A.; Aguilar, Roberto F.

    2011-01-01

    The avian haemosporidian parasites (phylum Apicomplexa) are taxonomically diverse and cosmopolitan in distribution; infecting most bird families. Sources of concern are reports of clinical haemosporidian infections in birds kept as part of zoo and aviary collections. Recently, severe and acute mortality episodes have been reported in masked bobwhite quail (Colinus virginianus ridgwayi), an endangered subspecies from the American Southwest. Two hundred and five eggs of the captive flock held in Arivaca, Arizona, were hatched at a zoo in the American Southwest. Thirty four sub-adult or adult animals had lesions associated with tissue phases of hemoparasites, especially vasculitis, ventricular leiomyositis and ulcerative pododermatitis. Molecular techniques applied to blood collected from the zoo’s last twelve remaining animals resulted in the detection of a Plasmodium juxtanucleare-like and Haemoproteus sp. parasites. A Raven (Corvus corax), in a contiguous exhibit, was positive for the same Plasmodium juxtanucleare-like parasite, but remained asymptomatic for three years following detection. These findings indicate that other birds in the exhibit within the zoo premises could act as reservoirs. We conclude that haemosporidian infections could be a factor in the demise of the captive masked bobwhite quails housed at the zoo. We suggest that active surveillance for haemoporidian parasites should be incorporated as a precaution to ex-situ conservation efforts of susceptible endangered species. PMID:21726940

  13. Isolation and characterization of Ornithobacterium rhinotracheale in the commercial turkey, quail flocks and domestic pigeons by bacteriological and molecular methods

    Directory of Open Access Journals (Sweden)

    Banani, M.

    2011-12-01

    Full Text Available Ornithobacterium rhinotracheale (ORT is a respiratory pathogen which has been isolated throughout the world from numerous bird species. The present study was designed to isolate and characterize the ORT from domestic turkeys, quails and pigeons. For this purpose, 250 samples from each bird species (turkey, quail and pigeon with or without respiratory signs were tested by taking of tracheal swabs. In addition, respiratory tissue samples (tracheal and lung, from 250 slaughtered turkeys, 50 slaughtered quails and 100dead pigeons were also subjected to culture for ORT as tracheal swabs. Respiratory tissues were also tested for bacterial DNA by using polymerase chain reaction (PCR. In general, 30 isolates including 4 isolates from turkeys, 3 isolates from quails and 23 isolates from pigeons were identified as ORT by bacteriologicalmethod and then confirmed by PCR. Bacterial DNA was detected in 20%, 50% and 35% of respiratory tissues in turkeys, quails and pigeons respectively. Five ORT isolates from pigeon and all four isolates from turkey showed smaller colony size, while other isolates had larger colonies when cultured in blood agar. Fifty percent of the isolates with larger colony but none of the isolates with small colony size could agglutinate red blood cells (RBCs. All of the isolates were sensitive to danofloxacin and chloramphenicolwhile more than 90% of pigeon isolates were resistant to ampicillin. All of turkey and quail and 30% of pigeon isolates were resistant to tetracycline. Our ORT isolates showed high identity (98%- 100% insequence of 16S rRNA gene to related data in GeneBank.

  14. The Use of Sweet Almond Meal as a Protein Source in Japanese Quails Diets

    Directory of Open Access Journals (Sweden)

    Arjomandi MA

    2015-12-01

    Full Text Available In the first experiment, the chemical composition, apparent metabolizable energy (AME, AME corrected for nitrogen (AMEn, true metabolizable energy (TME, TME corrected for nitrogen (TMEn values of the sweet almond meal were determined in adult Leghorn cockerels. The second experiment was performed to evaluate the effects of different levels of sweet almond meal at 0, 100, 200 and 300 g/kg on Japanese quail's growth performance, some blood metabolites, relative weight of different organs, meat quality and egg yolk cholesterol in a completely randomized design with 288 Japanese quails including 4 treatments, 4 replicates and 18 birds per replicate. The metabolizable energy values of sweet almond meal were following: AME = 3734, AMEn = 3648, TME = 3908, TMEn = 3746 kcal/kg as fed basis. Feed intake, feed conversion ratio and live weight gain and relative weight of different organs in the birds fed diets with different levels of the sweet almond meal were not statistically different from control. A sweet almond meal at 300 g/kg level showed the lower serum total cholesterol and low-density lipoprotein (P < 0.05 compared to control and 100 g/kg sweet almond meal. Dietary treatments had no significant effect on the total cholesterol content of quail's eggs. Malondialdehyde concentration in breast meat samples after 40 days freezing decreased, whereas the level of sweet almond meal increased (P < 0.01. In general, a sweet almond meal without any adverse effect on growth performance is a good source of energy and protein and can be used up to 300 g/kg of the Japanese quail diets.

  15. Infection levels of the eyeworm Oxyspirura petrowi and caecal worm Aulonocephalus pennula in the northern bobwhite and scaled quail from the Rolling Plains of Texas.

    Science.gov (United States)

    Dunham, N R; Peper, S T; Downing, C; Brake, E; Rollins, D; Kendall, R J

    2017-09-01

    Northern bobwhite (Colinus virginianus) and scaled quail (Callipepla squamata) have experienced chronic declines within the Rolling Plains ecoregion of Texas. Parasitic infection, which has long been dismissed as a problem in quail, has not been studied thoroughly until recently. A total of 219 northern bobwhite and 101 scaled quail from Mitchell County, Texas were captured and donated from 2014 to 2015, and examined for eyeworm (Oxyspirura petrowi) and caecal worm (Aulonocephalus pennula) infections. In 2014, bobwhites averaged 19.6 ± 1.8 eyeworms and 98.6 ± 8.2 caecal worms, and 23.5 ± 2.1 eyeworms and 129.9 ± 10.7 caecal worms in 2015. Scaled quail averaged 4.8 ± 1.0 eyeworms and 50 ± 6.8 caecal worms in 2014, and 5.7 ± 1.3 eyeworms and 38.1 ± 7.1 caecal worms in 2015. This study expands the knowledge of parasitic infection in quail inhabiting the Rolling Plains of Texas. A significant difference was documented in O. petrowi infection between species but there was no significant difference in A. pennula between quail species. No significant difference was detected in parasite infection between the sexes of both northern bobwhite and scaled quail. This study also documented the highest reported O. petrowi infection in both species of quail. Additional research is needed on the life history and infection dynamics of O. petrowi and A. pennula infections to determine if there are individual- and/or population-level implications due to parasitic infection.

  16. Modified saponification and HPLC methods for analyzing carotenoids from the retina of quail: implications for its use as a nonprimate model species.

    Science.gov (United States)

    Toomey, Matthew B; McGraw, Kevin J

    2007-09-01

    To investigate carotenoid content in the retina of Japanese quail (Coturnix japonica), for comparison with carotenoids in human retina, and to assess the effects of different saponification procedures on the recovery of quail retinal carotenoids. Extracted retinal carotenoids were saponified with methods adapted from recent studies, then identified and quantified with reverse-phase high-performance liquid chromatography (HPLC). To assess the effects of saponification conditions on carotenoid recovery from quail retina, we varied base concentration and the total time of saponification across a wide range and again used HPLC to compare carotenoid concentrations among conditions. Astaxanthin and galloxanthin were the dominant carotenoids recovered in the quail retina, along with smaller amounts of five other carotenoids (lutein, zeaxanthin, 3'-epilutein, epsilon-carotene, and an unidentified carotenoid). Astaxanthin was sensitive to saponification conditions; recovery was poor with strong bases (0.2 and 0.5 M KOH) and best with weak bases (0.01 and 0.2 M KOH). In contrast, xanthophyll carotenoids (galloxanthin, zeaxanthin, lutein, 3'-epilutein, and the unknown) were best recovered with strong base after 6 hours of saponification at room temperature. The recovery of epsilon-carotene was not affected by saponification conditions. Separate chemical hydrolysis procedures--using a strong base to recover xanthophylls and a weak base to recover astaxanthin--should be used for maximizing recovery of quail retinal carotenoids. Because the dominant carotenoids in quail retina are absent in human retina, and because of their different packaging (e.g., esterified in oil droplets) and light-absorbance properties compared with xanthophylls in the human eye, use of the quail as a model organism for studying human retinal carotenoids should be approached with caution.

  17. DDE increased the toxicity of parathion to coturnix quail

    Science.gov (United States)

    Ludke, J.L.

    1977-01-01

    Adult male Japanese quail (Coturnix coturnix) were exposed to DDE or chlordane in the diet and subsequently dosed with parathion or paraoxon. Pretreatment with 5 or 50 ppm DDE in the diet for 12 weeks resulted in increased cholinesterase (ChE) activity in plasma, but not in the brain. Dietary concentrations of 5 and 50 ppm DDE caused increased susceptibility of quail that were challenged with parathion or paraoxon. The increased mortality resulting from DDE pretreatment was reflected in brain ChE inhibition. The synergistic action of DDE was apparent after 3 days of exposure to 50 ppm DDE and 1 week of exposure to 5 ppm DDE. Birds exposed for 3 weeks to 5 or 50 ppm DDE retained their DDE-potentiated sensitivity to parathion after 2 weeks on clean diet. Chlordane pretreatment resulted in decreased susceptibility (antagonism) to parathion, but not to paraoxon dosage. Implications of differing responses in ChE and mortality among controls, DDE-, and chlordane-pretreated birds after parathion or paraoxon dosage are discussed.

  18. Vegetation attached to the elephant trunk.

    Science.gov (United States)

    Tanaka, Akiko; Sakamoto, Toshihito; Okada, Kenji; Okita, Yutaka

    2013-09-01

    The elephant trunk technique is used as a standard method in the approach to staged repair of extensive thoracic aneurysms. Here, we present a rare case of a graft infection, in which vegetation was attached to the distal end of the elephant trunk. A 36-year old male who had undergone total arch replacement with elephant trunk installation for type A aortic dissection was readmitted for high-grade fever. At the time of admission, Osler's nodules were present and brain magnetic resonance imaging showed multiple small emboli and haemorrhages. Transoesophageal echocardiography could not locate any sign of infection within the cardiac chambers, but disclosed vegetation attached to the elephant trunk. He underwent successful emergent graft replacement of the lesion, and no recurrence of the infection has been observed.

  19. INCLUSION OF GUAVA WASTES IN THE DIET OF EUROPEAN QUAILS

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Lemos Camelo

    2015-07-01

    Full Text Available This experiment was conducted to analyze the performance and carcass characteristics of European quail fed agroindustry residue of guava in substitution of corn. 140 birds were used, distributed in a completely randomized design. The treatments consisted of a control diet and four diets with levels of guava waste inclusion (2.5, 5.0, 7.5 and 10.0% to a diet based on corn and soybean meal. There were no significant differences (P> 0.05 for the variables: weight gain, feed intake, feed conversion, feed efficiency, weight and carcass yield and prime cuts (breast, drumstick and thigh wings, back , neck, head, feet and foodstuffs organs (heart, liver and gizzard. The guava waste can be used as alternative ingredient in the diets of European quail in the period of 16-38 days of age, up to the level of 10% inclusion without depressing the performance and yield of poultry carcasses.

  20. Age-related reduction of trunk muscle torque and prevalence of trunk sarcopenia in community-dwelling elderly: Validity of a portable trunk muscle torque measurement instrument and its application to a large sample cohort study.

    Directory of Open Access Journals (Sweden)

    Eiji Sasaki

    Full Text Available Trunk muscle weakness and imbalance are risk factors for postural instability, low back pain, and poor postoperative outcomes. The association between trunk muscle strength and aging is poorly understood, and establishing normal reference values is difficult. We aimed to establish the validity of a novel portable trunk muscle torque measurement instrument (PTMI. We then estimated reference data for healthy young adults and elucidated age-related weakness in trunk muscle strength. Twenty-four university students were enrolled to validate values for PTMI, and 816 volunteers from the general population who were recruited to the Iwaki Health Promotion Project were included to estimate reference data for trunk muscle strength. Trunk flexion and extension torque were measured with PTMI and KinCom, and interclass correlation coefficients (ICC were estimated to evaluate the reliability of PTMI values. Furthermore, from the young adult reference, the age-related reduction in trunk muscle torque and the prevalence of sarcopenia among age-sex groups were estimated. The ICC in flexion and extension torque were 0.807 (p<0.001 and 0.789 (p<0.001, respectively. The prevalence of sarcopenia increased with age, and the prevalence due to flexion torque was double that of extension torque. Flexion torque decreased significantly after 60 years of age, and extension torque decreased after 70 years of age. In males over age 80, trunk muscle torque decreased to 49.1% in flexion and 63.5% in extension. In females over age 80, trunk muscle torque decreased to 60.7% in flexion and 68.4% in extension. The validity of PTMI was confirmed by correlation with KinCom. PTMI produced reference data for healthy young adults, and demonstrated age-related reduction in trunk muscle torque. Trunk sarcopenia progressed with aging, and the loss of flexion torque began earlier than extension torque. At age 80, trunk muscle torque had decreased 60% compared with healthy young adults.

  1. Trunk biomechanics during hemiplegic gait after stroke: A systematic review.

    Science.gov (United States)

    Van Criekinge, Tamaya; Saeys, Wim; Hallemans, Ann; Velghe, Silke; Viskens, Pieter-Jan; Vereeck, Luc; De Hertogh, Willem; Truijen, Steven

    2017-05-01

    Stroke commonly results in trunk impairments that are associated with decreased trunk coordination and limited trunk muscle strength. These impairments often result in biomechanical changes during walking. Additionally, the so-called pelvic step might be influenced by these impairments. Therefore, the aim of this review was twofold. First, to gain more insight into trunk biomechanics during walking in stroke patients compared to healthy individuals. Second, to investigate the influence of walking speed on trunk biomechanics. The search strategy was performed by the PRISMA guidelines and registered in the PROSPERO database (no. CRD42016035797). Databases MEDLINE, Web of Science, Cochrane Library, ScienceDirect, and Rehabdata were systematically searched until December 2016. Sixteen of the 1099 studies met the eligibility criteria and were included in this review. Risk of bias was assessed by the Newcastle-Ottawa Scale. The majority of studies reported on trunk kinematics during walking, data on trunk kinetics and muscle activity is lacking. Following stroke, patients walk with increased mediolateral trunk sway and larger sagittal motion of the lower trunk. Although rotation of the upper trunk is increased, the trunk shows a more in-phase coordination. Acceleration of the trunk diminishes while instability and asymmetry increase as there are less movement towards the paretic side. However, it is of great importance to differentiate between compensatory trunk movements and intrinsic trunk control deficits. Specific exercise programs, assistive devices and orthoses might be of help in controlling these deficits. Importantly, studies suggested that more natural trunk movements were observed when walking speed was increased. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. EFFECT OF USING SOME MEDICINAL PLANTS (ANISE, CHAMOMILE AND GINGER) ON PRODUCTIVE AND PHYSIOLOGICAL PERFORMANCE OF JAPANESE QUAIL

    International Nuclear Information System (INIS)

    ABU TALEB, A.M.; HAMODI, S.J.; EL AFIFI, SH.F.

    2008-01-01

    This experiment was conducted to evaluate the effects of adding medicinal plants to Japanese quail diet on their performance and some metabolic functions. Four hundred, one day old, unsexed Japanese quails were used in this study. Quails were divided equally into four groups of 100 birds each according to medicinal plant additives. Group one was control (without additives, and the other groups contained 0.3% from anise (group 2), chamomile (group 3) and ginger (group 4). The end of the experiment was terminated when birds were 6 weeks old. Body weight, feed intake, some organs weight and some blood parameters were measured.The results indicated that addition of medicinal plants (anise, chamomile and ginger) improved growth rate, carcass and the relative weights of spleen, ovary and testis. Also, significant increases were observed in RBC, WBC, Hb, PCV, total protein and globulin. There was reduction in cholesterol in treated groups as compared to the control.The present results confirmed the beneficial effects of dietary medicinal plants (anise, chamomile and ginger) to improve the health condition as well as the productive and physiological characteristics of quails

  3. COMPARATIVE HISTOMORPHOLOGICAL STUDY ON THE THYMUS WITH REFERENCE TO ITS IMMUNOLOGICAL IMPORTANCE IN QUAIL, CHICKEN AND DUCK

    Directory of Open Access Journals (Sweden)

    M. R. Senapati

    2015-06-01

    Full Text Available A comparative histomorphological study was conducted on thymus of broiler chicken, duck and quail. The thymus of all three species of post-hatch (adult birds showed a thin connective tissue capsule. However, fine septa originating from the capsule divided the organ into incomplete but distinct lobules in chicken, whereas lobules were ill defined in both quail and duck. Each lobule, in turn, was composed of a peripheral cortex, densely studded with lymphocytes and a central medulla that was enriched with epithelial reticular cells. So, the cortex appeared more basophilic than that of medulla. But the concentration of lymphocyte, an immune competent cell was highest in chicken followed by duck and quail. Hassall’s corpuscles like structures were found inside the medulla as pale stained diffuse body. General histo-architecture was almost similar in all the birds.

  4. [The composition of lipids and lipid peroxidation in the pancreas of quails exposed to nitrates and correction by the amaranth's seeds].

    Science.gov (United States)

    Tsekhmistrenko, S I; Ponomarenko, N V

    2013-01-01

    Researches of features of lipid composition, functioning of the system of antioxidant defense, maintenance of lipid peroxidation products in the quail's pancreas on the early postnatal ontogenesis stages are conducted for actions of nitrates and feeding with amaranth's seeds in mixed fodder. The arrival of nitrates in the organism of quails results in the decline of general lipids maintenance and nonetherified fat acids in the pancreas. Using of amaranth's seeds in mixed fodder on the background of the nitrate loading results in the increase of activity of the enzimes system of antioxidant defence, the growth of general lipid level in the quail's pancreas. Thus in correlation with separate classes of lipid maintenance of cholesterol goes down for certain, whereas the maintenance of triacylglycerols and ethers of cholesterol rises. The results obtained in the researches show the ability of amaranth's seeds to avert oxidative stress in quail's pancreas under nitrates influence.

  5. Ascorbic acid and melatonin reduce heat-induced performance inhibition and oxidative stress in Japanese quails.

    Science.gov (United States)

    Sahin, N; Onderci, M; Sahin, K; Gursu, M F; Smith, M O

    2004-02-01

    1. The effects of ascorbic acid (L-ascorbic acid) and melatonin supplementation on performance, carcase characteristics, malondialdehyde (MDA) as lipid peroxidation indicator, ascorbic acid, retinol, tocopherol and mineral status in the Japanese quail (Coturnix coturnix japonica) exposed to high ambient temperature were evaluated. 2. Two hundred and forty Japanese quails (10 d old) were randomly assigned to 8 treatment groups consisting of 10 replicates of three birds each. The birds were kept in a temperature-controlled room at 22 degrees C (Thermoneutral, TN groups) or 34 degrees C (for 8 h/d; 09:00 to 17:00 h; Heat stress, HS groups). Birds in both TN and HS were fed either a basal (control) diet or the basal diet supplemented with 250 mg of L-ascorbic acid/kg of diet (Ascorbic acid group), 40 mg of melatonin/kg of diet (Melatonin group) or both (Ascorbic acid + Melatonin group). 3. Supplementing heat-stressed quails with ascorbic acid and melatonin improved performance compared with the control group. Effects generally were greatest in quails supplemented with both ascorbic acid and melatonin. 4. Although supplementation did not consistently restore the concentrations of serum ascorbic acid, retinol and tocopherol to those of TN groups, these concentrations increased significantly with supplementation. Furthermore, serum and liver MDA and serum cholesterol and glucose concentrations were lower in the supplemented groups than in the heat-stressed controls. 5. Within each environment, excretion of Ca, P, Mg, Zn, Fe and Cr were lowest in the combination group and, in all cases, highest in the HS group. Interactions between diet and temperature were detected for live weight gain, cold carcase weight, MDA, ascorbic acid, tocopherol concentrations and excretion of zinc. 6. The results of the study indicate that ascorbic acid and melatonin supplementation attenuate the decline in performance and antioxidant and mineral status caused by heat stress and such

  6. Egg shell quality in Japanese quail: characteristics, heritabilities and genetic and phenotypic relationships.

    Science.gov (United States)

    Narinc, D; Aygun, A; Karaman, E; Aksoy, T

    2015-07-01

    The objective of the present study was to estimate heritabilities as well as genetic and phenotypic correlations for egg weight, specific gravity, shape index, shell ratio, egg shell strength, egg length, egg width and shell weight in Japanese quail eggs. External egg quality traits were measured on 5864 eggs of 934 female quails from a dam line selected for two generations. Within the Bayesian framework, using Gibbs Sampling algorithm, a multivariate animal model was applied to estimate heritabilities and genetic correlations for external egg quality traits. The heritability estimates for external egg quality traits were moderate to high and ranged from 0.29 to 0.81. The heritability estimates for egg and shell weight of 0.81 and 0.76 were fairly high. The genetic and phenotypic correlations between egg shell strength with specific gravity, shell ratio and shell weight ranging from 0.55 to 0.79 were relatively high. It can be concluded that it is possible to determine egg shell quality using the egg specific gravity values utilizing its high heritability and fairly high positive correlation with most of the egg shell quality traits. As a result, egg specific gravity may be the choice of selection criterion rather than other external egg traits for genetic improvement of egg shell quality in Japanese quails.

  7. Uses of irradiation or sodium tripolyphosphate for shelf-life extension of quail carcasses

    International Nuclear Information System (INIS)

    Rady, A.H.; Khalaf, H.H.; Afifi, E.A.; Nasr, E.H.

    2002-01-01

    this investigation aims to study the possibility of using gamma iraadiation or sodium tripolyphoshate (STPP) for increasing shelf-life of quail carcasses during cold storage. The quail carcasses were gamma irradiated at 4, 6 and 8 kGy or soaked in 3% STPP. The effect of these treatments on the organoleptic, microbiological aspects and chemical properties of samples under investigation were evaluated during cold storage (4± 1C degree). The results indicated that, the chemical compositions of samples did not alter by gamma irradiation or soaking in STPP. Futhermore, treatment had no deterious effects on the organoleptic properties of quail samples. Meanwhile, irradiation of samples at doses of 4, 6 and 8 kGy or soaking in STPP greatly reduced its microbial count and prolonged the shelf-life for 15,21,24 and 9 days at 4 ± 1 Cdegree in comparison with 6 days for control samples. Moreover, the acid value (A.V), peroxide value (P.V) and thiobarbituric acid (TBA) value were increased after irradiation, while total volatile basic nitrogen (TVBN) content had no real change by this treatment. On the other hand, soakking in STPP treatment decreased these values and gradual increases were observed during cold storage

  8. Performance, carcass traits, meat quality and amino acid profile of different Japanese quails strains.

    Science.gov (United States)

    Nasr, Mohammed A F; Ali, El-Shimaa M R; Hussein, Mohamed A

    2017-12-01

    Poultry production is considered one of the prospective opportunities to accomplish sustainable and quick production of superior protein to challenge the growing mandate for animal protein. Therefore, this study was aimed to explore the difference on growth performance, carcass traits, meat quality and amino acid profile of different Japanese quails strains. A total of 480 quail chicks of four different plumage colors (120 of each white, golden, gray and brown) were collected after hatching. At 6 week of age, birds were stunned and decapitated to determine the physical meat quality, thiobarbituric acid reactive substances and amino acid profile. White quails had the highest weight of slaughter, carcass, dressing, carcass yield, liver, gizzard, heart and spleen (197.27 g, 169.27 g, 91%, 82%, 6.63 g, 6.53 g, 2.27 g and 0.40 g, respectively). Also, they had the highest Ph U , lightness, yellowness and water holding capacity with the lowest level of redness, cooking losses and thiobarbituric acid in pectoral (6.28, 46.40, 12,46, 22.17, 9.20, 19.21 and 0.44, respectively) and thigh muscles (6.37, 42.30, 11.51, 26.01, 10.12 and 0.93, respectively). Moreover, they possessed the highest level of all essential (11.68 and 10.16 g/100 g protein in pectoral and thigh muscles, respectively) and non essential amino acids (13.27 and 12.54 g/100 g protein in pectoral and thigh muscles, respectively). Therefore, the current study revealed that white quails had the heaviest body weight with the best carcass traits and meat quality.

  9. Influence of some probiotics on blood components, productive and reproductive performance of japanese quails

    Energy Technology Data Exchange (ETDEWEB)

    Abu-Taleb, A M; Ezzat, I E; El-Barkouky, E [Biological Applications Department, Radioisotope Applications Division, Nuclear Research Centre, Cairo (Egypt)

    2006-07-01

    The current study was conducted to evaluate the effect of adding some probiotics into diets of Japanese quails on productive and reproductive performance, blood constituents, immune response and intestinal wall thickness. A total number of 500 one day old, unsexed Japanese quail chicks were used. Five experimental groups were assigned in the present study, where the 1st group (G1) was provided with protexin at 5 g/litre (5 days weekly). The 2nd group (G2) contained medi stress of 0.75 g/litre (5 days weekly), the 3rd group (G3) was fed a basal diet contained bioaction at 5g/kg, the 4th group (G4) involved a basal diet with active dried yeast (Saccharomyces cerevisiae) at 0.1 g/kg daily and group 5 were fed the basal diet without probiotics supplementation (control). The results showed that the average body weight, egg production and egg weight were significantly increased due to adding probiotics and 0.1g/kg yeast into diets. Feed conversion ratio and mortality were improved significantly and the most improvement was recorded at 1.0% yeast and protexin. Similar improvement was recorded for hatch ability and hatching weight. There were reductions in intestinal wall thickness due to adding 0.1 g/kg yeast or protexin. The values of HI titer against sheep RBCs were increased significantly as compared to the control, which may lead to an enhancement of immune response of Japanese quails. Blood protein, globulin and FSH hormone were increased significantly. In conclusion, adding some probiotics into diets of Japanese quails improved productive, reproductive performance, blood constituents, immune response and intestinal wall thickness.

  10. Influence of some probiotics on blood components, productive and reproductive performance of japanese quails

    International Nuclear Information System (INIS)

    Abu-Taleb, A.M.; Ezzat, I.E.; El-Barkouky, E.

    2006-01-01

    The current study was conducted to evaluate the effect of adding some probiotics into diets of Japanese quails on productive and reproductive performance, blood constituents, immune response and intestinal wall thickness. A total number of 500 one day old, unsexed Japanese quail chicks were used. Five experimental groups were assigned in the present study, where the 1st group (G1) was provided with protexin at 5 g/litre (5 days weekly). The 2nd group (G2) contained medi stress of 0.75 g/litre (5 days weekly), the 3rd group (G3) was fed a basal diet contained bioaction at 5g/kg, the 4th group (G4) involved a basal diet with active dried yeast (Saccharomyces cerevisiae) at 0.1 g/kg daily and group 5 were fed the basal diet without probiotics supplementation (control). The results showed that the average body weight, egg production and egg weight were significantly increased due to adding probiotics and 0.1g/kg yeast into diets. Feed conversion ratio and mortality were improved significantly and the most improvement was recorded at 1.0% yeast and protexin. Similar improvement was recorded for hatch ability and hatching weight. There were reductions in intestinal wall thickness due to adding 0.1 g/kg yeast or protexin. The values of HI titer against sheep RBCs were increased significantly as compared to the control, which may lead to an enhancement of immune response of Japanese quails. Blood protein, globulin and FSH hormone were increased significantly. In conclusion, adding some probiotics into diets of Japanese quails improved productive, reproductive performance, blood constituents, immune response and intestinal wall thickness

  11. Nutrient digestibility of vegetables waste flour on male quail (Coturnix coturnix japonica)

    Science.gov (United States)

    Pramono, A.; Primadhani, M. S.; Swastike, W.; Sutrisno, J.

    2018-03-01

    The aim of this research is to determine the nutrient digestibility of vegetables waste flour on of male quail. Four hundred male quails were divided into four groups with five replications. The experiment is Completely Randomized Design and the data were analyzed by analyses of variants. The experimental diets were P0 = basal diet, P1 = 97% basal diet + 3% vegetables waste flour, P2 = 94% basal diet + 6% vegetables waste flour, and P3 = 91% basal diet + 9% vegetables waste flour. The observed variables were the digestibility of dry matter, crude protein and extract ether. Result showed that of the addition of vegetable waste flour in the diet had no effect on crude protein digestibility (P>0.05), however shown significant effect on dry matter (P digestibility.

  12. Estimation of genetic parameters for carcass traits in Japanese quail ...

    African Journals Online (AJOL)

    The aim of this study was to estimate genetic parameters of some carcass characteristics in the Japanese quail. For this aim, carcass weight (Cw), breast weight (Bw), leg weight (Lw), abdominal fat weight (AFw), carcass yield (CP), breast percentage (BP), leg percentage (LP) and abdominal fat percentage (AFP) were ...

  13. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  14. Chemical composition of solar dried blood and the ruminal content and its effect on performance of Japanese quails.

    Science.gov (United States)

    Mishra, Jyotiprabha; Abraham, Robinson J J; Rao, V Appa; Rajini, R Asha; Mishra, B P; Sarangi, N R

    2015-01-01

    The aim was to determine the chemical composition of solar dried blood and rumen content (DBRC) and further ascertain the concentration at which DBRC could be included in Japanese quail diets without any adverse effect on its performance. Feeding trial on the effect of DBRC on performance of Japanese quails was studied up to 5 weeks. 252 numbers of day old (Nandanam Type III breed) Japanese quails were purchased from Poultry Research Station, Madhavaram and divided into 7 batches (control+ six treatments) each consisting of 36 birds. The DBRC was included at 0%, 5%, 10%, 15%, 20%, 25% and 30% in diets as control, treatment-1 (T1), treatment-2 (T2), treatment-3 (T3), treatment-4 (T4), treatment-5 (T5) and treatment-6 (T6) respectively in a completely randomized design to replace soybean meal in Japanese quail feed. The birds were provided with ad-labidum feed and drinking water ad-libitum during the entire experimental period. The crude protein (CP), crude fiber (CF), ether extract (EE) and ash contents of DBRC were 35.87%, 17.40%, 3.6% and 12.6%, respectively. The amount of essential amino acids and non-essential amino acid content were found to be 12.98 and 4.87 (g/100 g of feed) respectively in DBRC feed. Result showed that all birds fed DBRC diets performed better than the control group. Mortality was unaffected by dietary treatments. There was a significant difference (p<0.01) observed in weight gain in treatment groups compared to the control. Up to 30% DBRC could be incorporated in the diets of Japanese quails without any adverse effects on its performance.

  15. The Effect of Divergent Selection on 4-wk BW on the Shape of Growth Curve in Japanese Quail

    Directory of Open Access Journals (Sweden)

    H Beyki

    2011-12-01

    Full Text Available The current study was conducted to investigate the effect of short-term divergent selection on the shape growth curve in different lines of Japanese quail. The Quail lines utilized in this study were two divergently selected for high (HW and low (LW 4-wk body weight during 7 generation and also a control line (C. The Richard function parameters were used to describe growth curves of different lines. The weight at hatch was approximately similar among lines (8.08 g, 7.55 g and 8.76 g for HW, LW and C line respectively. The results of current study indicated that the selected lines (HW & LW were immediately diverged from the C line after hatch. Sexes within each line had no difference in average growth rate, age and body weight at inflection point and adult body weight. However significant differences were found in the growth curve parameters among lines. The results of current study indicated that short term divergent selection for 4-wk BW in Japanese quail can change the growth pattern and the carcass compartments of the selected birds. Therefore to avoid undesirable side effects due to selection in Japanese quails it is recommended to consider the growth pattern changes of the selected birds in the breeding programs

  16. Toxicity of dietary Heliotropium dolosum seed to Japanese quail.

    Science.gov (United States)

    Eroksuz, Y; Eroksuz, H; Ozer, H; Ilhan, N; Cevik, A; Yaman, I; Ceribasi, A O

    2002-10-01

    Five groups of 30 male Japanese quail, each 7-w-old, were fed diets containing 0, 1, 3, 5, or 10% (w/w) of dehulled H dolosum seed. Half of the birds from the each group were killed at 6 and 24 w after beginning of the trial. At the end of 6th w, neither mortality nor clinical sign occurred in test groups. In the 5 and 10% inclusion levels, mild to moderate hepatic injury was detected as evidenced by mild karyomegaly, moderate fatty change, focal or portal fibrosis, bile duct hyperplasie, and ovalocyte proliferation along with lower serum protein and albumin levels. By the termination of the experiment (24 w), 5 birds died in the 10% dosed group. Hepatic cirrhosis was the most prominent finding in the 5 and 10% group; at these levels, serum protein and albumin values decreased significanty while billuribin and ALP levels increased. Based on relative weights and histological evaluations, testicularatrophywasdosedependent. These results partly affirm earlier studies that the quail is highly resistant to the toxic effects of H dolosumseed. However, the resistance to H dolosum is less than Senecio Jacobae and Crotalaria spectabilis when considering tissue injury.

  17. Trunk Flexibility Improvement in Response to Powered Assisted Exercise

    Directory of Open Access Journals (Sweden)

    B.S. Bains

    2016-07-01

    Full Text Available Background study: Flexibility in human spine has always plays an important role in dexterity and seamless ambulatory activities. When optimum range is not maintained by the trunk column, due to lack of flexibility, the posture gets affected resulting in reduce trunk rotation flexibility and mobility hence loss of complete trunk rotation. Objective: The purpose of this study is to determine the effect of Shapemaster Power Assisted Exercise Equipment (SPAEE on trunk flexibility. Methodology: Twenty healthy individual ages between 40 to 60 years were randomly divided into control and exercise groups. Shapemaster exercise program performed two times per week for 5 weeks and 45 minutes per session. Before and after 10 sessions of Shapemaster exercise protocol, Seated trunk rotation test was used to measure trunk flexibility. Results: Repeated measurement ANOVA were used to analysis data between groups. The results of this study illustrated that after 10th sessions trunk flexibility significantly improved (F (1.0, 18 = 11.732, p < 0.003. Conclusion: In conclusion results were determined that SPAEE is safe and it did effectively enhance flexibility among individual healthy adults. Keyword: Shapemaster Power Assisted Exercise Equipment (SPAEE, Trunk Flexibility, Healthy individual

  18. Dietary cadmium and enteropathy in the Japanese quail: histochemical and ultrastructural studies

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, M.E.; Fox, M.R.S.

    1974-01-01

    Cadmium was fed to young Japanese quail, at a level of 75 mg. per kg. of diet, from hatching to 4 weeks of age. Cadmium produced gross, microscopic, and ultrastructural lesions in the proximal small intestine of these quail, similar to those occurring in human malabsorption syndromes, celiac disease, nontropical sprue, and tropical sprue. The small intestines of the quail were dilated and thin walled. Villi were short and thick and had a dense cellular infiltrate in the lamina propria. The striated border was thin but stained for neutral mucopolysaccharides, as did the normal border. Some villi were covered with stratified epithelial cells. Hypertrophy and hyperplasia of goblet were seen, but the mucin stained for weakly acidic mucopolysaccharides, as did the normal cells. At the ultrastructural level, microvilli of both absorptive and goblet cells were markedly shortened, particularly near the tips of the villi. Absorptive cells were atrophic, and there was s diminution of the usual cellular organelles. Granular cisternae were long and tortuous, mitochondria were dense and small, and large lysosome-like bodies and large lipid droplets accumulated in the cytoplasm, but there was a decrease in the normal small, pale and dark lipid droplets. The cellular infiltrate of the lamina propria included groups of plasma cells with dilated cisternae. There were large, irregular, electron-dense bodies in the endothelium of large veins and degeneration of some nerve plexuses in the muscularis propria. 31 references, 21 figures.

  19. Value added by Spirulina platensis in two different diets on growth performance, gut microbiota, and meat quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    Mohamed S. Yusuf

    2016-11-01

    Full Text Available Aim: The growth promoting effect of the blue-green filamentous alga Spirulina platensis (SP was observed on meat type Japanese quail with antibiotic growth promoter alternative and immune enhancing power. Materials and Methods: This study was conducted on 180 Japanese quail chicks for 4 weeks to find out the effect of diet type (vegetarian protein diet [VPD] and fish meal protein diet [FMPD]- Spirulina dose interaction (1 or 2 g/kg diet on growth perfor-mance, gut microbiota, and sensory meat quality of growing Japanese quails (1-5 weeks old. Results: Data revealed improvement (p<0.05 of weight gain, feed conversion ratio and European efficiency index due to 1, 2 g (SP/kg VPD, and 2 g (SP/kg FMPD, respectively. There was a significant decrease of ileum mean pH value by 1 g (SP/kg VPD. Concerning gut microbiota, there was a trend toward an increase in Lactobacilli count in both 1; 2 g (SP/kg VPD and 2 g (SP/kg FMPD. It was concluded that 1 or 2 g (SP/kg vegetarian diet may enhance parameters of performance without obvious effect on both meat quality and gut microbiota. Moreover, 1 and/or 2 g (SP may not be invited to share fish meal based diet for growing Japanese quails. Conclusion: Using of SP will support the profitable production of Japanese quails fed vegetable protein diet.

  20. Fertility and hatchability of Japanese quail eggs under semi arid ...

    African Journals Online (AJOL)

    Some factors affecting the fertility and hatchability of Japanese quail eggs were studied at the Poultry Unit of the University of Maiduguri Livestock Teaching and Research Farm. A total of 1850 eggs were used for the study and data collected were subjected to Analysis of Variance. The mean values of fertility, hatchability of ...

  1. Effect of different levels of selenium and vitamin E on blood biochemical parameters in the Japanese quail

    Directory of Open Access Journals (Sweden)

    hossein zadeh adamnejad

    2015-11-01

    Full Text Available Co-administration of vitamin E and selenium has positive effects on growth performance of avian species, but their effect is not fully elicited in the Japanese quail. Also, controversial reports exist for the effect of vitamin E and selenium on avian performance. This study was designed to investigate the effect of different levels of selenium (0, 0.2 and 0.4 mg/kg and vitamin E (0, 150 and 300 mg/kg in the diet of the Japanese quail. Birds received mesh diet from the start of the study, then selenium and vitamin E were added on day 17. At the end of the study, after food deprivation for 6 hours, Japanese quail (1 male and 1 female were selected and blood samples collected for biochemical investigations and determination of glucose, albumin, total protein, cholesterol, triglyceride, HDL and LDL levels. There was significant decrease in cholesterol, glucose, and triglyceride levels and significant decrease in albumin and total protein levels on day 35 (p

  2. Arthropods vector grapevine trunk disease pathogens.

    Science.gov (United States)

    Moyo, P; Allsopp, E; Roets, F; Mostert, L; Halleen, F

    2014-10-01

    Arthropod-mediated dispersal of pathogens is known in many cropping systems but has never been demonstrated for grapevine trunk disease pathogens. Arthropods from vineyards were screened for the presence of pathogens associated with Petri disease and esca using cultural and molecular techniques. The ability of the most abundant pathogen-carrying species to inoculate healthy grapevine vascular tissues was also determined. Millipedes and ants were allowed to associate with a DsRed- Express-transformed Phaeomoniella chlamydospora, after which they were exposed to freshly pruned healthy grapevines under controlled conditions and wounds were monitored for subsequent infection. In addition, the possibility of millipede excreta, commonly found on pruning wounds in the field, to act as inoculum source was determined. A diverse arthropod fauna was associated with declining grapevines and many of these carried trunk disease pathogens. However, spiders, the ant Crematogaster peringueyi, and the millipede Ommattoiulus moreleti were the most abundant pathogen carriers. The ant and millipede species fed on pruning wound sap and effectively transmitted trunk disease pathogens. Millipede excreta contained viable spores of Phaeomoniella chlamydospora and may serve as an inoculum source. Numerous arthropods, including beneficial predators, are potential vectors of grapevine trunk disease pathogens. Our results highlight the need for an integrated approach, including targeted management of ants and millipedes at the time of pruning, to limit the spread of grapevine trunk diseases.

  3. Species specificity of social reinstatement in Japanese quail Coturnix japonica genetically selected for high or low levels of social reinstatement behaviour.

    Science.gov (United States)

    Mills, A D; Jones, R B; Faure, J M

    1995-05-01

    Divergent lines of Japanese quail Coturnix japonica showing high (HSR) or low (LSR) levels of social reinstatement (SR) behaviour (as measured in a treadmill apparatus) have been developed. However, it was not known if selection had influenced social reinstatement tendencies in a general or a species-specific fashion. Therefore, the present study compared the SR behaviour of quail chicks of the HSR and LSR lines and of a Control line when the goal box of the treadmill was empty or when it contained small, same-species groups of either Japanese quail, domestic fowl or Guinea fowl chicks. The results clearly demonstrated that the SR behaviour of Japanese quail chicks is species-specific and that this specificity has not been influenced during genetic selection, over sixteen generations, of the HSR and LSR lines. The HSR chicks showed more locomotor activity in the treadmill than did those of the other lines regardless of the nature of the goal-box stimulus. The results are discussed in terms of general activity, underlying fearfulness and social motivation.

  4. Studi Perencanaan Migrasi Sistem Digital Oleh Penyelenggara Radio Trunking di Indonesia

    Directory of Open Access Journals (Sweden)

    Awangga Febian Surya Admaja

    2013-06-01

    Full Text Available Sistem Radio Trunking merupakan sistem radio yang berbasis repeater untuk satu atau lebih menara dengan menggunakan lebih dari satu frekuensi, dimana pengguna secara semi-privat dapat memiliki kanal tersendiri untuk melakukan pembicaraan secara grup. Di Indonesia, alokasi pada pita frekuensi radio trunking analog direncanakan akan digunakan untuk trunking digital, dimana aplikasi sistem radio trunking  yang baru harus menggunakan teknologi trunking digital dan sistem analog yang ada disyaratkan untuk beralih ke teknologi digital. Studi ini bertujuan untuk melihat seberapa besar kesiapan dari penyelenggara radio trunking di Indonesia dalam melakukan migrasi radio trunking digital. Studi ini menggunakan pendekatan kualitatif melalui wawancara mendalam dan didukung dengan data kuantitatif untuk menunjukkan nilai indeks kesiapan dari penyelenggara radio trunking. Studi ini menghasilkan nilai indeks kesiapan dari sampel penyelenggara radio trunking dengan skema perencanaan migrasi sesuai dengan nilai indeks kesiapan.

  5. Characterization and Digestibility of Detoxified Castor Oil Meal for Japanese Quails

    Directory of Open Access Journals (Sweden)

    PA dos Santos

    2015-12-01

    Full Text Available ABSTRACT These experiments were performed to determine the chemical composition, coefficients of nutrient and energy metabolizability, amino acid composition, and cytotoxicity of different castor oil meals subjected to different detoxification processes and added to the diet of Japanese quails. In the trial, 180 46-d-old female Japanese quails were distributed according to a completely randomized design into five treatments and with replicates of six bird each. The treatments consisted of following detoxification methods of castor oil meal: Castor oil meal A (CMA - recovery in alcohol at 80 °C for 20 minutes and drying at 80 °C; castor oil meal B (CMB and C (CMC - recovery in alcohol at 80 °C for 6 minutes, neutralization with 5% NaOH, and drying under direct sunlight sun for two days (CMB or pelleted (CMC; castor oil meal D (CMD - recovery in alcohol at 110 °C for 15 minutes and drying at 110 °C. Castor oil meal was added replacing 20% of the reference diet. There was slight chemical composition variation (1.21% in crude protein, 6% in dry matter, 2.2% in ether extract and 64 kcal/kg in gross energy among the castor oil meals submitted to the different treatments. The castor oil meal submitted to treatment C showed the highest amino acid values. In the cytotoxicity test, treatment D presented lower ricin activity. Castor oil meals A, C, and D may be included in Japanese quail diets; however, castor oil meal D is recommended due to the simplicity its industrial process, its low toxicity, and metabolizability coefficients obtained.

  6. Productivity and selenium concentrations in egg and tissue of laying quails fed selenium from hydroponically produced selenium-enriched kale sprout (Brassica oleracea var. alboglabra L.).

    Science.gov (United States)

    Chinrasri, Orawan; Chantiratikul, Piyanete; Maneetong, Sarunya; Chookhampaeng, Sumalee; Chantiratikul, Anut

    2013-12-01

    This study aimed to determine the effectiveness of Se from hydroponically produced Se-enriched kale sprout (HPSeKS) on productive performance, egg quality, and Se concentrations in egg and tissue of laying quails. Two-hundred quails, 63 days of age, were divided into four groups. Each group consisted of five replicates and each replicate had ten birds, according to a completely randomized design. The experiment lasted for 6 weeks. The dietary treatments were T1 (control diet), T2 (control diet plus 0.2 mg Se/kg from sodium selenite), T3 (control diet plus 0.2 mg Se/kg from Se-enriched yeast), T4 (control diet plus 0.2 mg Se/kg from HPSeKS). The findings revealed that productive performance and egg quality of quails were not altered (p > 0.05) by Se sources. Whole egg Se concentrations of quails fed Se from HPSeKS and Se-enriched yeast were higher (p  0.05), but higher (p < 0.05) than that of quails fed Se from sodium selenite. The results reveal that Se from HPSeKS did not change the performance and egg quality of quails. The effectiveness of Se from HPSeKS was comparable to that of Se-enriched yeast, which was higher than that of Se from sodium selenite.

  7. Effect of feeding camphor (Eucalyptus Globules) levels on some immunity characteristics, growth and gut microflora of japanese quails

    International Nuclear Information System (INIS)

    Abu Taleb, A.M.; Salah, H.M.; Ezzat, I.E.; El Barkouky, E.

    2003-01-01

    This experiment was conducted to evaluate the effect of adding Eucalyptus globules Egypt to Japanese quail diet on performance and some metabolic functions and immunity. Four hundred,one day old, unsexed japanese quails were used in this study. Quails were divided equally into four groups containing 100 birds in each. Each group contained 4 replicates of 25 birds. Group one was supplemented with 1% Egypt in basal diet, group two was supplemented with 2% Egypt in basal diet, group three was used as negative control (-ve)without any addition of antibiotic in diet or water, while group four represented the positive control (+ ve) by addition antibiotics (0.5 g neomycin sulphate +0.5 g oxytetracyclin) in drinking water for 5 days post hatching. The experimented diet contained 3200 Kcal ME/kg and 24% crude proteins. The end of the experiment was terminated when birds were 6 weeks old. Body weight, mortality, some organs weighs and some blood parameters were measured and some microbial population of small intestines was counted. Results indicated that the addition of Egypt led to significant increase in quails body weights, spleen, bursa and ovary and the measures of total proteins, globulins, haemagglutination inhibition (HI)and triiodothyronine (T3). Decrease in mortality ratio and less counts of microflora and salmonella of gut were also achieved as a result of diet camphor addition

  8. Early life stress shapes female reproductive strategy through eggshell pigmentation in Japanese quail

    Czech Academy of Sciences Publication Activity Database

    Duval, C.; Zimmer, C.; Mikšík, Ivan; Cassey, P.; Spencer, K.A.

    2014-01-01

    Roč. 208, Nov 1 (2014), s. 146-153 ISSN 0016-6480 Institutional support: RVO:67985823 Keywords : breeding conditions * early-life stress * eggshell pigmentation * Japanese quail Subject RIV: ED - Physiology Impact factor: 2.470, year: 2014

  9. Experimental Assessment of the Pathogenicity of Avian Influenza Virus H9N2 Subtype in Japanese Quail (Coturnix Coturnix Japanica

    Directory of Open Access Journals (Sweden)

    Asasi, K.

    2010-07-01

    Full Text Available H9N2 avian influenza A viruses are endemic in poultry of many Eurasian countries and have caused repeated human infections in Asia since 1998. It has been also reported that H9N2 can cause high mortality in commercial broiler farms in Iran previously. However there was no report of H9N2 outbreak in any other species. In order to evaluate the pathogenicity of H9N2 virus in Japanese quail, 145 Japanese quail were randomly divided into 5 separate groups (116 quails in the treatment and 29 quails in the control groups. The experimental groups infected via oral rout, eye drop, intramuscular injection and spray method at the age of 32 days with 106.5 EID50/bird. The virus A/chicken/Iran/ZMT-101/98(H9N2 was kindly provided obtained from Razi vaccine& serum institute with EID50=108. The blood samples were experimented the day before use to show freedom from antibodies to influenza A and more specifically, the H9 subtype. The clinical signs and antibody titer of the infected chicks were also monitored. Five birds of each group were bled at 10 and 20 days post infection (DPI, and 20 birds of each group at 30 DPI were bled. The immune response to infection was measured by Haemmaglutination Inhibition (HI test using the H9N2 virus as antigen. Feed & water consumption were recorded on daily bases before and after inoculation. Body weight of each group was also recorded on weekly bases before and after inoculation. During the current study clinical signs such as sneezing, gasping, depression observed in challenged groups followed by decreasing in laying (1-17%. High HI antibody titers of AIV subtype H9 was seen in 10 DPI. The quails exhibited no decrease in food and water consumption and all quails were growing well and did not show any abnormality.

  10. Effects of exposure to clothianidin on the reproductive system of male quails.

    Science.gov (United States)

    Tokumoto, Junko; Danjo, Megumi; Kobayashi, Yoshihiro; Kinoshita, Kyoko; Omotehara, Takuya; Tatsumi, Atsutoshi; Hashiguchi, Mineo; Sekijima, Tsuneo; Kamisoyama, Hiroshi; Yokoyama, Toshifumi; Kitagawa, Hiroshi; Hoshi, Nobuhiko

    2013-01-01

    Clothianidin (CTD) is a neonicotinoid developed in the 1990s as an insecticide having selective toxicity, but it was later found to cause reproductive abnormalities in rats through oxidative stress. There is an attempt to preserve endangered animals, including the Japanese crested ibis, in Japan. However, there is a concern that neonicotinoid affects the reproduction of this bird, since it is used in its habitat. CTD toxicity in the birds is poorly understood, so we investigated whether or not the daily oral administration of CTD has any deleterious effects on the reproductive functions of mature male quails as experimental animals. The animals were randomly divided into four groups of 6 or 7 quails each, treated orally with 0, 0.02, 1 or 50 mg CTD/kg body weight (Control, CTD0.02, CTD1 and CTD50). After that the males bred with untreated females to estimate the egg weights, and rates of fertilization and normal development, the testes, liver and spleen were examined histologically. Vacuolization and the number of germ cells having fragmented DNA in seminiferous tubules, and the number and size of vacuoles in hepatocytes increased dose-dependently. There were no significant differences in egg weights and fertilization rates between the groups, but some eggs of the CTD1 and CTD50 groups failed to develop, and embryonic length decreased dose-dependently. Thus, it was found that CTD affected the reproduction of the male quail through the fragmentation of germ cells and the inhibition or delay of embryonic development.

  11. Reproductive performance of breeder quails fed diets supplemented with L-cysteine-coated iron oxide nanoparticles.

    Science.gov (United States)

    Mohammadi, H; Farzinpour, A; Vaziry, A

    2017-04-01

    The objective of this study was to investigate the effects of L-cysteine-coated iron oxide nanoparticles on reproductive performance in breeder quails. The five treatment diets consisted of (i) negative control diet not supplemented with iron, (ii) positive control diet supplemented with 60 mg/kg of Fe 3 O 4 and (iii) experimental diets supplemented with 0.6, 6 and 60 mg/kg of L-cysteine-coated iron oxide nanoparticles. A total of 100 seven-day-old quail chicks were weighed and randomly placed to five groups of five replicate cages. Four quails (one male and three females) were raised in each cage (50 × 15 × 17 cm). Egg production, feed consumption and egg weight were recorded daily and calculated on a hen per day basis. Egg components, fertility, hatchability and day-old chicks hatched from their eggs were measured at the end of the experiment. The percentage of egg production and egg mass of the 6 mg/kg Fe 3 O 4 -Cys NPs group were significantly higher than those of the control groups. Throughout the experimental period, the highest weekly egg weight was recorded for the 60 mg/kg Fe 3 O 4 -Cys NPs group. Fertility was improved by diet supplemented with iron, both FeSO 4 and Fe 3 O 4 -Cys NPs. The breeder fed Fe 3 O 4 -Cys NPs had the highest day-old chicks weight. The results of this study showed that Fe 3 O 4 nanoparticles that were coated by L-cysteine could improve availability and utilization of iron in diet. Finally, it was proposed that Fe 3 O 4 -Cys NPs could be used as feed additives in quails. © 2017 Blackwell Verlag GmbH.

  12. Effect of Increasing Yolk Testosterone Levels on Early Behaviour in Japanese Quail Hatchlings

    Directory of Open Access Journals (Sweden)

    M. Okuliarová

    2007-01-01

    Full Text Available The aim of our study was to investigate effects of increased testosterone content in egg yolk on early behaviour of 1- and 2-day-old Japanese quail. Three different doses of testosterone (0.25; 2.5 and 25 ng, not exceeding a physiological range, were examined in three separate experiments. Testosterone propionate dissolved in 20 μl olive oil was injected into the yolk before the onset of incubation. Behaviour of newly hatched chicks was recorded in response to both a novel environment in the open-field test and manual restraining in the test of tonic immobility (TI. Behavioural consequences of embryonic exposure to elevated testosterone were observed in the open-field test in all three experiments which indicated inhibition of behavioural responses in hatchlings. Birds treated with testosterone in ovo displayed longer latency to leave the start square, decreased locomotor activity, enhanced defecation and lower number of distress calls as compared to control birds. In TI test, the influence of treatment was manifested at the highest concentration only. Hatchlings from testosterone treated eggs expressed longer duration of TI and required less attempts to induce TI in comparison with the control group. Our results demonstrated increased fearfulness of Japanese quail chicks hatched from eggs with experimentally elevated testosterone content. The effect is specific for a short period after hatching since previous studies reported stimulatory effect of yolk testosterone on behaviour of Japanese quail later in ontogeny.

  13. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  14. Assemblages of saproxylic beetles on large downed trunks of oak.

    Science.gov (United States)

    Milberg, Per; Bergman, Karl-Olof; Sancak, Kerem; Jansson, Nicklas

    2016-03-01

    Old living oaks (Quercus robur) are known as a very species-rich habitat for saproxylic beetles, but it is less clear to what extent such veteran trees differ from an even rarer feature: downed trunks of large oaks. In this study, we set out to sample this habitat, using window traps, with two aims: (1) to describe the variation of assemblages among downed trunks of different type and (2) to compare beetles on downed oaks with data from veteran standing trees. The results showed that trunk volume and sun exposure better explained assemblages as well as species numbers on downed trunks than did decay stage. Furthermore, species classified as facultative saproxylic species showed weak or no differentiation among downed trunks. Species with different feeding habits showed no apparent differentiation among downed trunks. Furthermore, species composition on dead, downed oak trunks differed sharply from that of living, veteran oaks. Wood or bark feeders were more common on veterans than downed trunks, but there was no difference for those species feeding on fungi or those feeding on insects and their remains. In conclusion, for a successful conservation of the saproxylic beetle fauna it is important to keep downed oak trunks, and particularly large ones, in forest and pastures as they constitute a saproxylic habitat that differs from that of living trees.

  15. Comparison of trunk activity during gait initiation and walking in humans.

    Directory of Open Access Journals (Sweden)

    Jean-Charles Ceccato

    Full Text Available To understand the role of trunk muscles in maintenance of dynamic postural equilibrium we investigate trunk movements during gait initiation and walking, performing trunk kinematics analysis, Erector spinae muscle (ES recordings and dynamic analysis. ES muscle expressed a metachronal descending pattern of activity during walking and gait initiation. In the frontal and horizontal planes, lateroflexion and rotation occur before in the upper trunk and after in the lower trunk. Comparison of ES muscle EMGs and trunk kinematics showed that trunk muscle activity precedes corresponding kinematics activity, indicating that the ES drive trunk movement during locomotion and thereby allowing a better pelvis mobilization. EMG data showed that ES activity anticipates propulsive phases in walking with a repetitive pattern, suggesting a programmed control by a central pattern generator. Our findings also suggest that the programs for gait initiation and walking overlap with the latter beginning before the first has ended.

  16. Effect of dietary supplementation of hemp seed (Cannabis sativa L.) on meat quality and egg fatty acid composition of Japanese quail (Coturnix coturnix japonica).

    Science.gov (United States)

    Yalcin, H; Konca, Y; Durmuscelebi, F

    2018-02-01

    This study was conducted in two separate experiments. Experiment I was conducted to investigate the effects of hemp seed (HS) on meat quality traits, and experiment II was designed to determine egg fatty acid (FA) composition in Japanese quail (Coturnix coturnix japonica). In experiment I and experiment II treatments, groups were as follows: (i) control (not included HS0), (ii) 5% HS inclusion to diets, (iii) 10% HS inclusion to diets and (iv) 20% HS inclusion to diets. In experiment I, a total of 192 7-day-old-quail were fed with HS diets for 5 weeks, and end of the experiment I, a total of 64 quail (16 each) slaughtered and meat samples were analysed for meat colour, pH, cooking and thawing loss and FA composition. In experiment II, a total of 120 8-week-old laying quail were fed with experimental diets for 6 weeks and egg FA composition were determined. Breast meat cooking loss was significantly lower in 20% supplemented group (p egg samples were linearly increased with increasing the dietary HS ratio (p eggs (p egg yolk omega-3 FA content and decrease cooking loss of quail meats. © 2017 Blackwell Verlag GmbH.

  17. CONTROL OF APERTURE CLOSURE INITIATION DURING TRUNK-ASSISTED REACH-TO-GRASP MOVEMENTS

    Science.gov (United States)

    Rand, Miya K.; Van Gemmert, Arend W. A.; Hossain, Abul B.M.I.; Shimansky, Yury P.; Stelmach, George E.

    2012-01-01

    The present study investigated how the involvement and direction of trunk movement during reach-to-grasp movements affect the coordination between the transport and grasping components. Seated young adults made prehensile movements in which the involvement of the trunk was varied; the trunk was not involved, moved forward (flexion), or moved backward (extension) in the sagittal plane during the reach to the object. Each of the trunk movements was combined with an extension or flexion motion of the arm during the reach. Regarding the relation between the trunk and arm motion for arm transport, the onset of wrist motion relative to that of the trunk was delayed to a greater extent for the trunk extension than for the trunk flexion. The variability of the time period from the peak of wrist velocity to the peak of trunk velocity was also significantly greater for trunk extension compared to trunk flexion. These findings indicate that trunk flexion was better integrated into the control of wrist transport than trunk extension. In terms of the temporal relationship between wrist transport and grip aperture, the relation between the time of peak wrist velocity and the time of peak grip aperture did not change or became less steady across conditions. Therefore, the stability of temporal coordination between wrist transport and grip aperture was maintained despite the variation of the pattern of intersegmental coordination between the arm and the trunk during arm transport. The transport-aperture coordination was further assessed in terms of the control law according to which the initiation of aperture closure during the reach occurs when the hand crosses a hand-to-target distance threshold for grasp initiation that is a function of peak aperture, wrist velocity and acceleration, trunk velocity and acceleration, and trunk-to-target distance at the time of aperture closure initiation. The participants increased the hand-to-target distance threshold for grasp initiation in

  18. Control of aperture closure initiation during trunk-assisted reach-to-grasp movements.

    Science.gov (United States)

    Rand, Miya K; Van Gemmert, Arend W A; Hossain, Abul B M I; Shimansky, Yury P; Stelmach, George E

    2012-06-01

    The present study investigated how the involvement and direction of trunk movement during reach-to-grasp movements affect the coordination between the transport and grasping components. Seated young adults made prehensile movements in which the involvement of the trunk was varied; the trunk was not involved, moved forward (flexion), or moved backward (extension) in the sagittal plane during the reach to the object. Each of the trunk movements was combined with an extension or flexion motion of the arm during the reach. Regarding the relationship between the trunk and arm motion for arm transport, the onset of wrist motion relative to that of the trunk was delayed to a greater extent for the trunk extension than for the trunk flexion. The variability of the time period from the peak of wrist velocity to the peak of trunk velocity was also significantly greater for trunk extension compared to trunk flexion. These findings indicate that trunk flexion was better integrated into the control of wrist transport than trunk extension. In terms of the temporal relationship between wrist transport and grip aperture, the relationship between the time of peak wrist velocity and the time of peak grip aperture did not change or become less steady across conditions. Therefore, the stability of temporal coordination between wrist transport and grip aperture was maintained despite the variation of the pattern of intersegmental coordination between the arm and the trunk during arm transport. The transport-aperture coordination was further assessed in terms of the control law according to which the initiation of aperture closure during the reach occurs when the hand crosses a hand-to-target distance threshold for grasp initiation, which is a function of peak aperture, wrist velocity and acceleration, trunk velocity and acceleration, and trunk-to-target distance at the time of aperture closure initiation. The participants increased the hand-to-target distance threshold for grasp

  19. Green synthesis and characterisation of platinum nanoparticles using quail egg yolk

    Science.gov (United States)

    Nadaroglu, Hayrunnisa; Gungor, Azize Alayli; Ince, Selvi; Babagil, Aynur

    2017-02-01

    Nanotechnology is extensively used in all parts today. Therefore, nano synthesis is also significant in all explored areas. The results of studies conducted have revealed that nanoparticle synthesis is performed by using both chemical and physical methods. It is well known that these syntheses are carried out at high charge, pressure and temperature in harsh environments. Therefore, this study investigated green synthesis method that sustains more mild conditions. In this study, quail egg yolk having high vitamin and protein content was prepared for green synthesis reaction and used for the synthesis of platinum nanoparticles in the reaction medium. Reaction situations were optimised as a function of pH, temperature, time and concentration by using quail egg yolk. The results showed that the highest platinum nanoparticles were synthesised at 20 °C and pH 6.0 for 4 h. Also, optimal concentration of metal ions was established as 0.5 mM. The synthesised platinum nanoparticles were characterised by using UV spectrum, X-ray diffraction and scanning electron microscope.

  20. Factorial correspondence analysis of fear-related behaviour traits in Japanese quail.

    Science.gov (United States)

    Mignon-Grasteau, S; Roussot, O; Delaby, C; Faure, J M.; Mills, A; Leterrier, C; Guéméné, D; Constantin, P; Mills, M; Lepape, G; Beaumont, C

    2003-02-28

    Factorial correspondence analysis was performed on 341 quails from a F2 cross between two lines divergently selected on the duration of tonic immobility over 29 generations. Several fear- or stress-related traits were recorded, i.e. tonic immobility duration, number of inductions needed to induce tonic immobility, open-field behaviour (time spent walking, latency before first movement and number of defecations), asymmetry of tibia lengths and corticosterone concentration after restraint stress. Variables were categorised in classes and analysed by factorial correspondence analysis. The first axis was mostly described by open-field behaviour, and the second by tonic immobility traits (duration of tonic immobility and number of inductions), which showed that these behaviours were almost independent. No relationship was found between axes of the factorial correspondence analysis and corticosterone concentration or asymmetry of tibia lengths, showing that these variables reflected other characteristics of stress susceptibility than those described by tonic immobility and open-field behaviour. These results show that reaction to stress of quails is a multidimensional trait and cannot be summarised by one trait.

  1. Comparative pharmacokinetics of enrofloxacin, danofloxacin, and marbofloxacin after intravenous and oral administration in Japanese quail (Coturnix coturnix japonica).

    Science.gov (United States)

    Haritova, Aneliya; Dimitrova, Dimitrichka; Dinev, Toncho; Moutafchieva, Rumyana; Lashev, Lubomir

    2013-03-01

    A population approach was used to evaluate the pharmacokinetic parameters of 3 fluoroquinolones administered to Japanese quail (Coturnix coturnix japonica). Healthy adult quail (n = 50) were divided into 3 groups, each administered a separate intravenous and oral dose of the compounded drug: enrofloxacin at 10 mg/kg (n = 18; 9 male, 9 female), danofloxacin at 10 mg/kg (n = 12; 6 male, 6 female), and marbofloxacin at 5 mg/kg (n = 20; 10 male, 10 female). A fourth group was used as a control (n = 5). Enrofloxacin was metabolized extensively to ciprofloxacin, while no metabolites of either danofloxacin or marbofloxacin were detected. The volume of distribution was high, greater than 1 in all cases, and highest for danofloxacin, followed by enrofloxacin, then marbofloxacin. The total body clearance was higher in quail than that reported for other avian species with the exception of ostriches. As in mammals, the lowest clearance rate of the 3 fluoroquinolones was observed for marbofloxacin. Enrofloxacin was absorbed most rapidly, followed by marbofloxacin, then danofloxacin. The highest bioavailability was observed for danofloxacin followed by marbofloxacin, while very low bioavailability with significant conversion to ciprofloxacin was observed for enrofloxacin. Population analysis showed low intersubject variability for danofloxacin and marbofloxacin in contrast to that for enrofloxacin and its main metabolite, ciprofloxacin. Because of their more favorable pharmacokinetic properties after oral administration, either danofloxacin or marbofloxacin appears to be preferable to enrofloxacin for the treatment of susceptible bacterial infection in Japanese quail.

  2. Normal xeroradiographic and radiographic anatomy of the bobwhite quail (Colinus virginianus), with reference to other galliform species

    International Nuclear Information System (INIS)

    Smith, B.J.; Smith, S.A.

    1991-01-01

    The purpose of this study was to provide a reference for xeroradiographic and conventional radiographic anatomy of the bobwhite quail (Colinus virginianus) as a representative of the avian order Galliformes. The heads, bodies, wings, and pelvic limbs of four adult birds were radiographed using xeroradiographic and conventional radiographic techniques. Nine xeroradiographs and their corresponding conventional radiographs were selected, and the xeroradiographs labeled to illustrate the normal anatomy of these regions. A xeroradiograph of the tarsometatarsus of the domestic peacock (Pavo cristatus) was also included to demonstrate the metatarsal spur, which is not present in the quail

  3. Variance components for body weight in Japanese quails (Coturnix japonica

    Directory of Open Access Journals (Sweden)

    RO Resende

    2005-03-01

    Full Text Available The objective of this study was to estimate the variance components for body weight in Japanese quails by Bayesian procedures. The body weight at hatch (BWH and at 7 (BW07, 14 (BW14, 21 (BW21 and 28 days of age (BW28 of 3,520 quails was recorded from August 2001 to June 2002. A multiple-trait animal model with additive genetic, maternal environment and residual effects was implemented by Gibbs sampling methodology. A single Gibbs sampling with 80,000 rounds was generated by the program MTGSAM (Multiple Trait Gibbs Sampling in Animal Model. Normal and inverted Wishart distributions were used as prior distributions for the random effects and the variance components, respectively. Variance components were estimated based on the 500 samples that were left after elimination of 30,000 rounds in the burn-in period and 100 rounds of each thinning interval. The posterior means of additive genetic variance components were 0.15; 4.18; 14.62; 27.18 and 32.68; the posterior means of maternal environment variance components were 0.23; 1.29; 2.76; 4.12 and 5.16; and the posterior means of residual variance components were 0.084; 6.43; 22.66; 31.21 and 30.85, at hatch, 7, 14, 21 and 28 days old, respectively. The posterior means of heritability were 0.33; 0.35; 0.36; 0.43 and 0.47 at hatch, 7, 14, 21 and 28 days old, respectively. These results indicate that heritability increased with age. On the other hand, after hatch there was a marked reduction in the maternal environment variance proportion of the phenotypic variance, whose estimates were 0.50; 0.11; 0.07; 0.07 and 0.08 for BWH, BW07, BW14, BW21 and BW28, respectively. The genetic correlation between weights at different ages was high, except for those estimates between BWH and weight at other ages. Changes in body weight of quails can be efficiently achieved by selection.

  4. Continuous Static Gait with Twisting Trunk of a Metamorphic Quadruped Robot

    Directory of Open Access Journals (Sweden)

    C. Zhang

    2018-01-01

    Full Text Available The natural quadrupeds, such as geckos and lizards, often twist their trunks when moving. Conventional quadruped robots cannot perform the same motion due to equipping with a trunk which is a rigid body or at most consists of two blocks connected by passive joints. This paper proposes a metamorphic quadruped robot with a reconfigurable trunk which can implement active trunk motions, called MetaRobot I. The robot can imitate the natural quadrupeds to execute motion of trunk twisting. Benefiting from the twisting trunk, the stride length of this quadruped is increased comparing to that of conventional quadruped robots.In this paper a continuous static gait benefited from the twisting trunk performing the increased stride length is introduced. After that, the increased stride length relative to the trunk twisting will be analysed mathematically. Other points impacting the implementation of the increased stride length in the gait are investigated such as the upper limit of the stride length and the kinematic margin. The increased stride length in the gait will lead the increase of locomotion speed comparing with conventional quadruped robots, giving the extent that natural quadrupeds twisting their trunks when moving. The simulation and an experiment on the prototype are then carried out to illustrate the benefits on the stride length and locomotion speed brought by the twisting trunk to the quadruped robot.

  5. The effects of “Beijing grass” in diets on growth performance, humoral antibody and carcass characteristics in quails

    Directory of Open Access Journals (Sweden)

    Chethanond, U.

    2005-08-01

    Full Text Available Pharmacological study on Beijing grass (Bj. grass: Murdannia loriformis showed immunomodulator and anticancer activities. Thus, the effect of Bj. grass in diets was investigated in Japanese quails (aged 0-6 weeks on growth performances, humoral immunity and carcass characteristics. 708 1-day-old quails (Corturnix type which had no vaccination program were used in this study. They were experimented using completely randomized design and were divided into 6 treatments consisted of 4 replications with 27-31 heads each. The treatments were assigned as follows: Treatment 1 (T1 no vaccination and no Bj.grass, Treatment 2 (T2 vaccination and no Bj.grass, Treatment 3 (T3 vaccination and 3% Bj.grass, Treatment 4 (T4 vaccination and 6% Bj.grass, Treatment 5 (T5 vaccination and 9% Bj.grass and Treatment 6 (T6 vaccination and 10% Bj.grass juice (w/v. Vaccination program by 1 Newcastle disease + Infectious Bronchitis and 2 Pox were given at 1 and 3 weeks. Approximately 25% of quails were bled for determination of packed cell volume, gamma globulin levels and ND-HI titers. All male quails were put to sleep at 6 weeks. The results showed weight gain in the 3rd week was different in treatments using Bj. grass and treatments using control diet which body weight gain reduced when the level of Bj. grass increased (p 0.05. It was noted that not more than 6% Bj. grass could be used in quail diet without abnormal clinical signs. However, the more grass showed the tendency of poor weight gain. There were no differences in packed cell volume or gamma IgG level and ND-HI titers did not reach protection level. For carcass characteristics, Bj. grass 3% in diet gave the best carcass characteristics. (p < 0.05 In addition there was a dose-related reduction of abdominal fat (P=0.001.

  6. Eimeria spp. from Japanese quails (Coturnix japonica: new characteristic features and diagnostic tools

    Directory of Open Access Journals (Sweden)

    Bruno P. Berto

    2013-12-01

    Full Text Available The Japanese quail Coturnix japonica originated from North Africa, Europe and Asia, is used worldwide as an experimental animal and model for aviculture. The current paper characterizes Eimeria bateri, Eimeria tsunodai and Eimeria uzura recovered from C. japonica. Based on the fact that quails have a global distribution, as are their coccidia, the findings of this study should provide the means for diagnosis of those Eimeria spp. in other regions and continents. Eimeria bateri showed the greatest intensity of infection and shed oocysts from the fourth day after infection; in contrast, E. tsunodai and E. uzura shed oocysts from the fifth day after infection. The three species shared a high degree of similarity and were all polymorphic. Yet, the application of line regressions, histograms and ANOVA provided means for the identification of these species. Finally, the algorithm was very efficient since verified that resultant values were not superimposed.

  7. Classification of the coefficients of variation of parameters evaluated in Japanese quail experiments

    Directory of Open Access Journals (Sweden)

    DHV Leal

    2014-06-01

    Full Text Available The objective of this study was to design a classification range of the coefficients of variation (CV of traits used in experiments with eggtype Japanese quails (Coturnix coturnix japonica. The journal Revista Brasileira de Zootecnia was systematically reviewed, using the key word 'quail' during the period of January, 2000 to 2010. The CV of feed intake (g/bird/d, egg production (%/bird/d, egg weight (g, egg mass (g/bird/d, feed conversion ratio per dozen eggs (g/dozen, feed conversion ratio per egg mass (g/g, and egg specific gravity (g/mL were collected. For each parameter, CV were classified using the following median (MD and pseudo-sigma (PS ratio as follows: low (CV MD + 2PS. According to the results, it was concluded that each parameter has a specific classification range that should be taken into account when evaluating experimental precision.

  8. Atrazine triggers developmental abnormality of ovary and oviduct in quails (Coturnix Coturnix coturnix) via disruption of hypothalamo-pituitary-ovarian axis

    International Nuclear Information System (INIS)

    Qin, Lei; Du, Zheng-Hai; Zhu, Shi-Yong; Li, Xue-Nan; Li, Nan; Guo, Jing-Ao; Li, Jin-Long; Zhang, Ying

    2015-01-01

    There has been a gradual increase in production and consumption of atrazine (ATR) in agriculture to meet the population rising demands. Female reproduction is necessary for growth and maintenance of population. However, ATR impact on females and particularly ovarian developmental toxicity is less clear. The aim of this study was to define the pathways by which ATR exerted toxic effects on ovarian development of ovary and hypothalamo-pituitary-ovarian (HPO) axis. Female quails were dosed by oral gavage from sexual immaturity to maturity with 0, 50, 250 and 500 mg ATR/kg/d for 45 days. ATR had no effect on mortality but depressed feed intake and growth and influenced the biochemical parameters. Notably, the arrested development of ovaries and oviducts were observed in ATR-exposed quails. The circulating concentrations of E2, P, LH and PRL were unregulated and FSH and T was downregulated in ATR-treated quails. The mRNA expression of GnRH in hypothalamo and LH in pituitary and FSH in ovary was downregulated significantly by ATR exposure and FSH and PRL in pituitary were upregulated. ATR exposure upregulated the level of P450scc, P450arom, 3β-HSD and 17β-HSD in ovary and downregulated ERβ expression in female quails. However, ATR did not change ERα expression in ovary. This study provides new insights regarding female productive toxicology of ATR exposure. Ovary and oviduct in sexually maturing females were target organs of ATR-induced developmental toxicity. We propose that ATR-induced developmental abnormality of ovary and oviduct is associated with disruption of gonadal hormone balance and HPO axis in female quails. - Highlights: • ATR triggers arrested development of ovarian and oviduct. • Ovary and oviduct are target organs of ATR-induced developmental toxicity. • Atrazine causes hormone adjustment disorder in female quails. • Atrazine upregulates steroidogenic factor and downregulates ERβ factor in ovary. • Atrazine disrupted the hypothalamo

  9. Vitamin K supplementation for meat quail in growth of 1 to 14 days old

    Directory of Open Access Journals (Sweden)

    Caroline Espejo Stanquevis

    2015-12-01

    Full Text Available The experiment was carried outto determine the levels of vitamin K for meat quails (Coturnixcoturnixsp from 1 to 14 days of age. Atotal of 2200 birds were used, complete by random experimental design, with 8 treatments, 5 repetitions and 55 meat quails per experimental unit. The levels of vitamin K supplementation were 0; 0.7; 1.0; 1.3; 1.6; 1.9; 2.2; 2.5 mg/kg diets. The performance was measured through weighing weekly from the birds and feed, and at the end of the experiment was carried out collects blood and bones for the assessment of bone quality parameters. The levels of vitamin K supplementation had no influence on performance orbone quality, except thatthe bone density and calcium concentration of the femur and the bone density of the tibia showeda quadratic effect, with estimates of 0.98; 0.92 and 1.18 respectively. The length of the tibia showed a linear increase according to the levels of vitamin K. There was no effect in the concentration of serum calcium, but there was a quadratic effect in the concentration of alkaline phosphatase. The vitamin K supplementation did not affect the performance of the meat quails from 1 to 14 days of age, showing that the amount of vitamin K present in ground corn and soybean meal-based diets is sufficient to meet the needs of the birds’ performance.

  10. The effect of mustard seed meal (Sinapis arvensis on thyroid hormones and liver enzymes in Japanese quails (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Sajjad Mohebali

    2016-07-01

    Full Text Available Objective: To investigate the effect of wild black mustard seed meal on thyroid hormones (thyroxine and thyroid-stimulating hormone in Japanese quails and also study the ability of FeSO4 to alleviate the possible negative effect of mustard meal on thyroid hormones in these birds for the first time. Methods: The experimental procedure was undertaken on 28 quails which were randomly assigned to a control and 6 test groups with 4 quails in each group for 28 days, during which the control group received basic diet with no mustard meal whereas the test groups (No. 2, 3 and 4 received mustard meal (5%, 10% and 15%, respectively and test groups (No. 5, 6 and 7 received FeSO4 (1%-treated mustard meal (5%, 10% and 15%, respectively on the basic of basic diet. Results: The group fed on 15% non-treated mustard seed meal had the least thyroxine level and its level backed to normal in group fed on 15% FeSO4-treated mustard seed meal although this group had the highest alanine transaminase and aspartate transaminase levels. Conclusions: We concluded that up to 10% FeSO4 mustard seed meal could be incorporated in the quail diet successfully with the least damage to thyroids and livers, but further investigations on these birds are still needed to confirm this hypothesis.

  11. Dopamine modulates male sexual behavior in Japanese quail in part via actions on noradrenergic receptors.

    Science.gov (United States)

    Cornil, Charlotte A; Dejace, Christel; Ball, Gregory F; Balthazart, Jacques

    2005-08-30

    In rats, dopamine (DA) facilitates male sexual behavior through its combined action on D1- and D2-like receptors, in the medial preoptic area (MPOA) as well as other brain areas. In Japanese quail, systemic injections of dopaminergic drugs suggested a similar pharmacology but central injections have never been performed. Recent electrophysiological experiments demonstrated that DA effects in the MPOA of quail are mediated mainly through the activation of alpha2-noradrenergic receptors. Previous studies of DA action on behavior used specific dopaminergic agonists/antagonists and therefore unintentionally avoided the potential cross-reaction with alpha2-receptors. The present study was thus designed to investigate directly the effects of DA on male sexual behavior and to test whether the interaction of DA with heterologous receptors affects this behavior. Intracerebroventricular (i.c.v.) injection of DA or NE inhibited copulation in a dose-dependent manner. Systemic injections of yohimbine, an alpha2-noradrenergic antagonist, modulated copulation in a bimodal manner depending on the dose injected. Interestingly, a behaviorally ineffective dose of yohimbine markedly reduced the inhibitory effects of DA when injected 15min before. Together, these results show for the first time that i.c.v. injections of DA itself inhibit male sexual behavior in quail and suggest that the interaction of DA with alpha2-receptors has behavioral significance.

  12. Ovarian radiographic and direct measurements of Japanese Quail ( Coturnix coturnix japonica submitted to light restriction

    Directory of Open Access Journals (Sweden)

    M. Albuquerque

    Full Text Available ABSTRACT Often, in pet birds, any stimulus to lay eggs is unwanted in order to reduce reproductive diseases and disorders. The objectives of this study were: to determine the time necessary to promote ovary involution after an eight hour photoperiod using laying Japanese quails (Coturnix coturnix japonica; to connect the ovarian radiographic measurements with egg production; and to compare these measurements with direct ovary data obtained at necropsy. Birds were separated into three groups: 12h/24d (control group - 12h photoperiod for 24 days, 8h/24d and 8h/36d (8h photoperiod for 24 and 36 days. After euthanasia, all cadavers were x-rayed to measure ovary length and height. Birds were necropsied to measure ovarian length and weight. Results: radiographic ovary length demonstrated strong and positive correlation (r=0.96 with direct ovary length of all three groups; laying quails showed higher ovary height (p=0.025 and length (p=0.009 than non-laying quails; eight hours of artificial light per day promotes ovary length (p=0.025 and weight (p=0.009 reduction. Conclusions: radiography can estimate the ovary measure and indicate posture; an eight hour photoperiod of 24 days is not enough to promote ovarian regression, while the use of reduced photoperiod for 36 days promotes significant ovary involution.

  13. 49 CFR 571.401 - Standard No. 401; Interior trunk release.

    Science.gov (United States)

    2010-10-01

    .... Requirements. S4.1 Each passenger car with a trunk compartment must have an automatic or manual release... possible for a person trapped inside the trunk compartment of a passenger car to escape from the compartment. S2. Application. This standard applies to passenger cars that have a trunk compartment. This...

  14. Tissue localization of DDT and PCB isomers (octa- and tetrachlorobiphenyl) in laying quails

    International Nuclear Information System (INIS)

    Brandt, I.; Hoegman, P.-G.; Larsson, Y.; Olsson, S.

    1978-01-01

    Whole-body autoradiography of DDT- 14 C, 2,2',4,5'-tetrachlorobiphenyl- 14 C and 2,2',3,3',4,4',5,6'=octachlorobiphenyl- 14 C in laying quails indicated a strong deposition of radioactivity in the yolk of the growing follicles and the egg, confirming this to be a significant excretion route of lipophilic environmental pollutants in laying birds. A specific uptake of DDT and octachlorobiphenyl, but not of tetrachlorobiphenyl, was observed in the cortical cords of the adrenals. The octachlorobiphenyl was concentrated also in the ovarian stroma. Both DDT and the tetrachlorobiphenyl were excreted in the bile juice to the small intestine. No such excretion of octachlorobiphenyl was observed, indicating its rate of metabolization to be low. All compounds were accumulated and stored in the body fat. A previously described specific accumulation of 2,2',4,5'-tetrachlorobiphenyl in the respiratory tract of mice was not observed in the quail. (author)

  15. Observing of tree trunks and other cylindrical objects using GPR

    Science.gov (United States)

    Jezova, Jana; Lambot, Sebastien

    2016-04-01

    Trees are a part of our everyday life, hence it is important to prevent their collapse to protect people and urban infrastructures. It is also important to characterize tree wood properties for usages in construction. In order to investigate internal parts of tree trunks non-invasively, ground-penetrating radar (GPR), or in this case, ultra-wideband microwave radar as a general tool, appears to be a very promising technology. Nevertheless, tree trunk tomography using microwave radar is a complicated task due to the circular shape of the trunk and the very complex (heterogeneous and anisotropic) internal structures of the trunk. Microwave sensing of tree trunks is also complicated due to the electromagnetic properties of living wood, which strongly depend on water content, density and temperature of wood. The objective of this study is to describe tree trunk radar cross sections including specific features originating from the particular circumferential data acquisition geometry. In that respect, three experiments were performed: (1) numerical simulations using a finite-difference time-domain software, namely, gprMax 2D, (2) measurements on a simplified laboratory trunk model including plastic and cardboard pipes, sand and air, and (3) measurements over a real tree trunk. The analysis was further deepened by considering: (1) common zero-offset reflection imaging, (2) imaging with a planar perfect electrical conductor (PEC) at the opposite side of the trunk, and (3) imaging with a PEC arc at the opposite side of the trunk. Furthermore, the shape of the reflection curve of a cylindrical target was analytically derived based on the straight-ray propagation approximation. Subsequently, the total internal reflection (TIR) phenomenon occurring in cylindrical objects was observed and analytically described. Both the straight-ray reflection curve and TIR were well observed on the simulated and laboratory radar data. A comparison between all experiments and radar

  16. RESEARCH ON THE QUAIL EGGS ALBUMEN CONTENT IN SOME HEAVY METALS

    Directory of Open Access Journals (Sweden)

    I. VIZITIU

    2015-12-01

    Full Text Available Out of a sample batch of 20 Japanese quails, Pharaoh race, with an age of 100 days and weighing 245 g, approximately 200 eggs were collected at the peak phase of the laying period. The eggs were measured, weighed and broken, separating the albumen from the other components. The data obtained served to calculate the physical and morphological indices. Primary chemical composition, caloricity, heavy metals content were first determined, the following data being obtained: quail eggs albumen has an average weight of 7.1025±0.061g, an average volume of 7.158±0.09cm3, an average density of 1.0168±0.0139 g/cm3 and an index (of freshness of 0.0797±0.0015. The albumen contains: 86.76% water, 13.24% dry matter, 0.835% mineral matter, 11.37% protein, 1.03% non-nitrogenous extractive substances and a caloricity of 289.498 kJ for 100 g product. The average content of heavy metals in albumen was: 1.33*10-3 ppm, for cadmium; 8.83*10-2 ppm, for zinc; 1.005 ppm, for cooper and 0.0 ppm, respectively, for lead.

  17. COMPARATIVE EFFICACY OF DETOMIDINE AND DETOMIDINE - KETAMINE COCKTAIL IN QUAILS

    OpenAIRE

    U. F. Durrani, M. Ashraf and A. Khalid¹

    2005-01-01

    Twenty adult healthy quails (Coturnix coturnix) were divided into two equal groups. One group was administered detomidine (2.4 mg/kg, I/M) and other group was administered detomidine-ketamine cocktail (1.2 mg/kg + 30 mg/kg, I/M). Detomidine slowly and smoothly induced a light sedation accompanied by superficial analgesia, hypoventilation, hypothermia and bradycardia in all birds. Detomidine-ketamine cocktail rapidly and smoothly induced a deep anaesthesia accompanied by deep analgesia, hypove...

  18. Influence of the method of fluoride administration on toxicity and fluoride concentrations in Japanese quail

    Science.gov (United States)

    Fleming, W.J.; Schuler, C.A.

    1988-01-01

    Young Japanese quail (Coturnix japonica) were administered NaF for 16 d either in their diet or by esophageal intubation. Based on the total fluoride ion (Emg F-) intake over the l6-d experimental period, fluoride administered by intubation was at least six times more toxic than that fed in the diet. Dietary concentrations of 1,000 ppm F- (Emg F- for 16 d = approx. 144) produced no mortality, whereas intubated doses produced 73% or greater mortality in all groups administered 54 mg F- /kg/d or more (Emg F- for 16 d _ approx. 23 mg). GraphIc companson of the regression of log F- ppm in femurs/mg F- intake showed that fluoride levels in the femurs of quail administered fluoride by intubation were higher than in those administered fluoride in the diet.

  19. Microwave sensing of tree trunks

    Science.gov (United States)

    Jezova, Jana; Mertens, Laurence; Lambot, Sebastien

    2015-04-01

    The main subject of this research is the observation of the inner part of living tree trunks using ground-penetrating radar (GPR). Trees are everyday part of human life and therefore it is important to pay attention to the tree conditions. The most obvious consequence of the poor tree condition is dead or injury caused by falling tree. The trunk internal structure is divided into three main parts: heartwood, sapwood and bark, which make this medium highly anisotropic and heterogeneous. Furthermore, the properties of the wood are not only specie-dependent but also depend on genetic and on environmental conditions. In urban areas the main problem for the stability of the trees relies in the apparition of decays provoked by fungi, insect or birds. This results in cavities or decreasing of the support capacity of the tree. GPR has proved itself to be a very powerful electromagnetic tool for non-destructive detection of buried objects. Since the beginning of the 20th century it has been used in several different areas (archaeology, landmine detection, civil engineering, ...). GPR uses the principle of the scattering of the electromagnetic waves that are radiated from a transmitting antenna. Then the waves propagate through the medium and are reflected from the object and then they are received by a receiving antenna. The velocity of the scattered signal is determined primarily by the permittivity of the material. The optimal functionality of the GPR was investigated using the numerical simulation tool gprMax2D. This tool is based on a Finite-Difference Time-Domain (FDTD) numerical model. Subsequently, the GPR functionality was tested using the laboratory model of a decayed tree trunk. Afterwards, the results and lessons learnt in the simplified tests will be used in the processing of the real data and will help to achieve deeper understanding of them. The laboratory model of the tree trunk was made by plastic or carton pipes and filled by sand. Space inside the model

  20. Nutcracker syndrome associated with celiacomesentric trunk anomaly: case report

    Directory of Open Access Journals (Sweden)

    Al-Zoubi NA

    2017-12-01

    Full Text Available Nabil A Al-Zoubi,1 Ibrahim F Al-Ghalayini,1,2 Radwan Al-Okour1,2 1Department of Surgery, 2Division of Urology, Jordan University of Science and Technology, Irbid, Jordan Introduction: Nutcracker syndrome is a rare disease entity that is caused by entrapment of the left renal vein between the aorta and superior mesenteric artery, usually due to abnormal branching of the superior mesenteric artery from the aorta causing renal venous hypertension. The symptoms vary from asymptomatic hematuria to severe pelvic congestion. Celiacomesenteric trunk anomaly is a rare variation of splanchnic artery anomaly that occurs when the celiac trunk and superior mesenteric arteries have a common origin from the aorta. A disease involving the rarely encountered celiacomesenteric trunk anomaly is extremely uncommon. To our knowledge, association between nutcracker syndrome and celiacomesentric trunk anomaly has not been reported in the literature.Case presentation: A 14-year-old boy with no significant past medical history presented with a 3-year painless hematuria. CT-angiogram revealed anterior nutcracker syndrome with celiacomesenteric trunk anomaly. The patient was managed conservatively with close follow-up.Conclusion: Nutcracker syndrome associated with celiacomesenteric trunk anomaly is extremely uncommon and is a rare cause of hematuria in children. Whether this abnormal anatomy is the cause of nutcracker syndrome or just an association should be investigated. Moreover, awareness of this anatomical variation may help in planning therapeutic options and reducing the chance of surgical iatrogenic injuries. Keywords: nutcracker syndrome, celiacomesenteric trunk, hematuria in children

  1. Anomalous Posterior Intercostal Arterial Trunk Arising From the Abdominal Aorta

    Energy Technology Data Exchange (ETDEWEB)

    Jie, Bing, E-mail: jbshh@163.com; Yu, Dong, E-mail: yudong-mail@126.com; Jiang, Sen, E-mail: jasfly77@vip.163.com [Tongji University School of Medicine, Department of Radiology, Shanghai Pulmonary Hospital (China)

    2016-04-15

    A common trunk of the ipsilateral posterior intercostal artery (PIA) arising from the thoracic aorta is usually an anatomical variation. However, a common trunk of bilateral posterior intercostal arterial trunk (PIAT) arising from the abdominal aorta is rare. It is important to recognize this anatomical variation of PIA when performing interventional radiological procedures. We present a rare case of an anomalous PIAT that originated from the abdominal aorta in a patient with hemoptysis caused by tuberculosis sequelae. Bilateral 4th to 11th PIAs arose from a common trunk and the trunk arising from the posterior aspect of the abdominal aorta at the level of T12/L1 intervertebral space. The pathological right 4th and 5th PIAs and bronchial arteries were embolized. Hemoptysis has been controlled for 3 months.

  2. Interactive Trunk Extraction from Forest Point Cloud

    Directory of Open Access Journals (Sweden)

    T. Mizoguchi

    2014-06-01

    Full Text Available For forest management or monitoring, it is required to constantly measure several parameters of each tree, such as height, diameter at breast height, and trunk volume. Terrestrial laser scanner has been used for this purpose instead of human workers to reduce time and cost for the measurement. In order to use point cloud captured by terrestrial laser scanner in the above applications, it is an important step to extract all trees or their trunks separately. For this purpose, we propose an interactive system in which a user can intuitively and efficiently extract each trunk by a simple editing on the distance image created from the point cloud. We demonstrate the effectiveness of our proposed system from various experiments.

  3. Trunk repositioning errors are increased in balance-impaired older adults.

    Science.gov (United States)

    Goldberg, Allon; Hernandez, Manuel Enrique; Alexander, Neil B

    2005-10-01

    Controlling the flexing trunk is critical in recovering from a loss of balance and avoiding a fall. To investigate the relationship between trunk control and balance in older adults, we measured trunk repositioning accuracy in young and balance-impaired and unimpaired older adults. Young adults (N = 8, mean age 24.3 years) and two groups of community-dwelling older adults defined by unipedal stance time (UST)-a balance-unimpaired group (UST > 30 seconds, N = 7, mean age 73.9 years) and a balance-impaired group (UST tested in standing trunk control ability by reproducing a approximately 30 degrees trunk flexion angle under three visual-surface conditions: eyes opened and closed on the floor, and eyes opened on foam. Errors in reproducing the angle were defined as trunk repositioning errors (TREs). Clinical measures related to balance, trunk extensor strength, and self-reported disability were obtained. TREs were significantly greater in the balance-impaired group than in the other groups, even when controlling for trunk extensor strength and body mass. In older adults, there were significant correlations between TREs and three clinical measures of balance and fall risk, UST and maximum step length (-0.65 to -0.75), and Timed Up & Go score (0.55), and between TREs and age (0.63-0.76). In each group TREs were similar under the three visual-surface conditions. Test-retest reliability for TREs was good to excellent (intraclass correlation coefficients > or =0.74). Older balance-impaired adults have larger TREs, and thus poorer trunk control, than do balance-unimpaired older individuals. TREs are reliable and valid measures of underlying balance impairment in older adults, and may eventually prove to be useful in predicting the ability to recover from losses of balance and to avoid falls.

  4. Annotated Draft Genome Assemblies for the Northern Bobwhite (Colinus virginianus) and the Scaled Quail (Callipepla squamata) Reveal Disparate Estimates of Modern Genome Diversity and Historic Effective Population Size.

    Science.gov (United States)

    Oldeschulte, David L; Halley, Yvette A; Wilson, Miranda L; Bhattarai, Eric K; Brashear, Wesley; Hill, Joshua; Metz, Richard P; Johnson, Charles D; Rollins, Dale; Peterson, Markus J; Bickhart, Derek M; Decker, Jared E; Sewell, John F; Seabury, Christopher M

    2017-09-07

    Northern bobwhite ( Colinus virginianus ; hereafter bobwhite) and scaled quail ( Callipepla squamata ) populations have suffered precipitous declines across most of their US ranges. Illumina-based first- (v1.0) and second- (v2.0) generation draft genome assemblies for the scaled quail and the bobwhite produced N50 scaffold sizes of 1.035 and 2.042 Mb, thereby producing a 45-fold improvement in contiguity over the existing bobwhite assembly, and ≥90% of the assembled genomes were captured within 1313 and 8990 scaffolds, respectively. The scaled quail assembly (v1.0 = 1.045 Gb) was ∼20% smaller than the bobwhite (v2.0 = 1.254 Gb), which was supported by kmer-based estimates of genome size. Nevertheless, estimates of GC content (41.72%; 42.66%), genome-wide repetitive content (10.40%; 10.43%), and MAKER-predicted protein coding genes (17,131; 17,165) were similar for the scaled quail (v1.0) and bobwhite (v2.0) assemblies, respectively. BUSCO analyses utilizing 3023 single-copy orthologs revealed a high level of assembly completeness for the scaled quail (v1.0; 84.8%) and the bobwhite (v2.0; 82.5%), as verified by comparison with well-established avian genomes. We also detected 273 putative segmental duplications in the scaled quail genome (v1.0), and 711 in the bobwhite genome (v2.0), including some that were shared among both species. Autosomal variant prediction revealed ∼2.48 and 4.17 heterozygous variants per kilobase within the scaled quail (v1.0) and bobwhite (v2.0) genomes, respectively, and estimates of historic effective population size were uniformly higher for the bobwhite across all time points in a coalescent model. However, large-scale declines were predicted for both species beginning ∼15-20 KYA. Copyright © 2017 Oldeschulte et al.

  5. Annotated Draft Genome Assemblies for the Northern Bobwhite (Colinus virginianus and the Scaled Quail (Callipepla squamata Reveal Disparate Estimates of Modern Genome Diversity and Historic Effective Population Size

    Directory of Open Access Journals (Sweden)

    David L. Oldeschulte

    2017-09-01

    Full Text Available Northern bobwhite (Colinus virginianus; hereafter bobwhite and scaled quail (Callipepla squamata populations have suffered precipitous declines across most of their US ranges. Illumina-based first- (v1.0 and second- (v2.0 generation draft genome assemblies for the scaled quail and the bobwhite produced N50 scaffold sizes of 1.035 and 2.042 Mb, thereby producing a 45-fold improvement in contiguity over the existing bobwhite assembly, and ≥90% of the assembled genomes were captured within 1313 and 8990 scaffolds, respectively. The scaled quail assembly (v1.0 = 1.045 Gb was ∼20% smaller than the bobwhite (v2.0 = 1.254 Gb, which was supported by kmer-based estimates of genome size. Nevertheless, estimates of GC content (41.72%; 42.66%, genome-wide repetitive content (10.40%; 10.43%, and MAKER-predicted protein coding genes (17,131; 17,165 were similar for the scaled quail (v1.0 and bobwhite (v2.0 assemblies, respectively. BUSCO analyses utilizing 3023 single-copy orthologs revealed a high level of assembly completeness for the scaled quail (v1.0; 84.8% and the bobwhite (v2.0; 82.5%, as verified by comparison with well-established avian genomes. We also detected 273 putative segmental duplications in the scaled quail genome (v1.0, and 711 in the bobwhite genome (v2.0, including some that were shared among both species. Autosomal variant prediction revealed ∼2.48 and 4.17 heterozygous variants per kilobase within the scaled quail (v1.0 and bobwhite (v2.0 genomes, respectively, and estimates of historic effective population size were uniformly higher for the bobwhite across all time points in a coalescent model. However, large-scale declines were predicted for both species beginning ∼15–20 KYA.

  6. Effects of Artichoke (Cynara scolymus L. Leaf Meal and Vitamin E on Productive Performance, Intestinal Microflora and Morphology in Japanese Quail

    Directory of Open Access Journals (Sweden)

    Samadi F

    2015-06-01

    Full Text Available A total of 240, one-day-old quail chicks (Coturnix coturnix japonica were used to study the effects of Artichoke leaf meal (ALM and vitamin E in diet on growth performance, ileal microbial populations and intestinal morphology in a 42-d trial. This experiment was performed as a completely randomized design with 4 replicates of 15 quails each, using a 4 × 2 factorial arrangement with diet and gender as the main effects. Four dietary treatments were formulated by addition of 2 levels (1.5 and 3 percent of ALM and 300 mg/Kg vitamin E to the basal diet. Supplementing basal diet with ALM did not improve growth performance at different rearing periods, whereas dietary vitamin E increased feed intake and body weight gain at day 21 of age (P. The ileal populations of lactobacillus and coliforms was not affected by dietary ALM treatments, whereas vitamin E increased the population of total aerobic bacteria (P≤0.04. The ileal villus height (P≤0.01 and crypt depth (P≤0.008 were reduced in quails fed on diets with ALM and vitamin E. The quails fed diets containing 3 percent ALM and 300 mg/Kg vitamin E had higher villus height:crypt depth ratio. The thickness of muscularies (P≤0.04 and mucosa (P≤0.0007 layers were decreased in birds fed diets containing ALM than control birds. Birds treated with ALM and vitamin E showed a shorter intestinal length (P≤0.02 and a lower pancereas relative weight. The results of this study showed that supplementing diet by ALM (1.5 and 3% and 300 mg/Kg vitamin E did not improve growth performance, ileal microbiota pupolations and intestinal morphometric indices in Japanese quail.

  7. Evaluation of non-invasive trunk sprays and trunk-injected emamectic benzoate

    Science.gov (United States)

    Deborah G. McCullough; D.L. Cappaert; T.M. Poland; A.C. Anulewicz; P. Lewis; J. Molongoski

    2008-01-01

    In 2007, we continued to evaluate two neo-nicotinoid insecticides, imidacloprid and dinotefuron, applied as non-invasive trunk sprays to control emerald ash borer (EAB), Agrilus planipennis Fairmaire. Neo-nicotinoid products are widely used to protect landscape ash trees because they are relatively safe for humans and non-target species. These...

  8. The effect of nano-selenium particles and sodium selenite on humoral immunity indices of quails using foods contaminated with aflatoxin B1

    Directory of Open Access Journals (Sweden)

    Ebrahim Talebi

    2017-08-01

    Full Text Available This experiment was conducted to evaluate the ability of inhibition of aflatoxin B1 by various sources of selenium and to compare the effect of nano selenium and sodium selenite on humoral immunity of quails. The experiment was performed in a completely randomized design (CRD using six treatments and four replicates of ten quail chicks per replicate. Two hundred forty quails were divided in six groups vis. control: without aflatoxin B1 and without selenium. Group2: 1ppm aflatoxin B1 and without selenium. Group3: 1 ppm aflatoxin B1 and 0.3 ppm nano selenium. Group4: 1 ppm aflatoxin B1 and 0.3 ppm sodium selenite. Group5: 1 ppm aflatoxin B1 and 0.6 ppm nano selenium. Group6: 1ppm aflatoxin B1 and 0.6 ppm sodium selenite. To evaluate the humoral immunity response 0.2­ml of sheep red blood cell (SRBC solution was injected into breast muscle of quails at day 35 and blood sampling was conducted after a week. Newcastle vaccine was injected at day 28 and the antibody titer was determined after two weeks. The highest level of titer of antibody against the SRBC solution was related to the group which received 0.06 ppm nano selenium (p

  9. Traceability of animal meals in Japanese quail eggs using the technique of 13C e 15N* stable isotopes

    Directory of Open Access Journals (Sweden)

    C Mori

    2013-03-01

    Full Text Available The objective of this study was to trace the inclusion of bovine meat and bone meal (BMBM in the diet of Japanese quails by analyzing eggs and egg fractions (yolk and albumen by the technique of carbon-13 (13C and nitrogen-15 (15N stable isotopes. In the trial, 120 Japanese quails were distributed in six treatments with four replicates of five birds each. The following treatments were applied: feed based on corn and soybean meal, containing graded BMBM inclusions (0, 1, 2, 3, 4 or 5%. After 42 days, 20 eggs per treatment were randomly collected for three consecutive days. Ten eggs were used for yolk and albumen sample collection, and ten for total egg sample collection. It was possible to detect the dietary inclusion of 1% BMBM in the egg and its fractions. Therefore, the technique of isotopes 13C and 15N is able of tracing since 1% inclusion level of BMBM in the diet of Japanese quails in eggs and their fractions.

  10. Altered embryonic development in northern bobwhite quail (Colinus virginianus induced by pre-incubation oscillatory thermal stresses mimicking global warming predictions.

    Directory of Open Access Journals (Sweden)

    Kelly S Reyna

    Full Text Available Global warming is likely to alter reproductive success of ground-nesting birds that lay eggs normally left unattended for days or even weeks before actual parental incubation, especially in already warm climates. The native North American bobwhite quail (Colinus virginianus is such a species, and pre-incubation quail eggs may experience temperatures ≥45°C. Yet, almost nothing is known about embryonic survival after such high pre-incubation temperatures. Freshly laid bobwhite quail eggs were exposed during a 12 day pre-incubation period to one of five thermal regimes: low oscillating temperatures (25-40°C, mean = 28.9°C, high oscillating temperatures (30-45°C, mean = 33.9°C, low constant temperatures (28.85°C, high constant temperatures (mean = 33.9°C, or commercially employed pre-incubation temperatures (20°C. After treatment, eggs were then incubated at a standard 37.5°C to determine subsequent effects on embryonic development rate, survival, water loss, hatching, and embryonic oxygen consumption. Both quantity of heating degree hours during pre-incubation and specific thermal regime (oscillating vs. non-oscillating profoundly affected important aspects of embryo survival and indices of development and growth Pre-incubation quail eggs showed a remarkable tolerance to constant high temperatures (up to 45°C, surviving for 4.5±0.3 days of subsequent incubation, but high oscillating pre-incubation temperature increased embryo survival (mean survival 12.2±1.8 days and led to more rapid development than high constant temperature (maximum 38.5°C, even though both groups experienced the same total heating degree-hours. Oxygen consumption was ~200-300 μl O2.egg.min-1 at hatching in all groups, and was not affected by pre-incubation conditions. Oscillating temperatures, which are the norm for pre-incubation quail eggs in their natural habitat, thus enhanced survival at higher temperatures. However, a 5°C increase in pre

  11. Altered embryonic development in northern bobwhite quail (Colinus virginianus) induced by pre-incubation oscillatory thermal stresses mimicking global warming predictions.

    Science.gov (United States)

    Reyna, Kelly S; Burggren, Warren W

    2017-01-01

    Global warming is likely to alter reproductive success of ground-nesting birds that lay eggs normally left unattended for days or even weeks before actual parental incubation, especially in already warm climates. The native North American bobwhite quail (Colinus virginianus) is such a species, and pre-incubation quail eggs may experience temperatures ≥45°C. Yet, almost nothing is known about embryonic survival after such high pre-incubation temperatures. Freshly laid bobwhite quail eggs were exposed during a 12 day pre-incubation period to one of five thermal regimes: low oscillating temperatures (25-40°C, mean = 28.9°C), high oscillating temperatures (30-45°C, mean = 33.9°C), low constant temperatures (28.85°C), high constant temperatures (mean = 33.9°C), or commercially employed pre-incubation temperatures (20°C). After treatment, eggs were then incubated at a standard 37.5°C to determine subsequent effects on embryonic development rate, survival, water loss, hatching, and embryonic oxygen consumption. Both quantity of heating degree hours during pre-incubation and specific thermal regime (oscillating vs. non-oscillating) profoundly affected important aspects of embryo survival and indices of development and growth Pre-incubation quail eggs showed a remarkable tolerance to constant high temperatures (up to 45°C), surviving for 4.5±0.3 days of subsequent incubation, but high oscillating pre-incubation temperature increased embryo survival (mean survival 12.2±1.8 days) and led to more rapid development than high constant temperature (maximum 38.5°C), even though both groups experienced the same total heating degree-hours. Oxygen consumption was ~200-300 μl O2.egg.min-1 at hatching in all groups, and was not affected by pre-incubation conditions. Oscillating temperatures, which are the norm for pre-incubation quail eggs in their natural habitat, thus enhanced survival at higher temperatures. However, a 5°C increase in pre-incubation temperature

  12. Neuroanatomical localization of endocrine control of reproductive behavior in the Japanese quail (Coturnix japonica)

    International Nuclear Information System (INIS)

    Watson, J.T. III.

    1989-01-01

    Steroid autoradiography and systematic and intracranial steroid treatment were undertaken to determine the neuroanatomical loci which are sufficient to activate steroid sensitive behaviors in the Japanese quail. (1) Autoradiographic localization of steroid binding cells was performed on male and female quail brains using tritiated ( 3 H) testosterone (T), estradiol (E2), or 5α-dihydrotestosterone (DHT). The distributions of labelled cells in the quail brain following 3 H-T or 3 H-E2 injection and autoradiography were similar to one another. The distribution of labelled cells following 3 H-DHT autoradiography was limited in comparison to that following 3 H-T autoradiography. Males were found to have more labelled cells than females in nucleus taeniae. (2) Intracranial implantation of minute pellets of testoterone propionate (TP) and estradiol benzoate (EB) was performed to determine neuroanatomical loci at which steroids activate sexual behavior. Both TP and EB implants in the preoptic area (POA) activated male copulatory behavior. (3) Systematic injection of aromatase inhibitor prior to and concurrent with implantation completely blocked copulatory behavior in males with TP implants in the POA but failed to block copulation in males with EB implants in the POA. (4) Intact males and castrated males given 5 dosages of systematic EB treatment were tested for sexual behavior, and blood samples from each group were assayed for E2 concentration. (5) Midbrain DHTP implants were activated crowing without significantly stimulating peripheral androgen-sensitive tissues, but the effect on crowing was not localized to any one nucleus

  13. The effects of Bobath-based trunk exercises on trunk control, functional capacity, balance, and gait: a pilot randomized controlled trial.

    Science.gov (United States)

    Kılınç, Muhammed; Avcu, Fatma; Onursal, Ozge; Ayvat, Ender; Savcun Demirci, Cevher; Aksu Yildirim, Sibel

    2016-02-01

    The aim of this study was to investigate the effects of Bobath-based individually designed trunk exercises on trunk control, upper and lower extremity function, and walking and balance in stroke patients. The main aim of treatment was to eliminate individual trunk impairments during various patient functions. The study was planned as an assessor-blinded, randomized controlled trial. A total of 22 patients volunteered to participate in the study. Trunk function, functional capacity, and gait were assessed with the Trunk Impairment Scale (TIS), stroke rehabilitation assessment of movement (STREAM), and a 10-m walking test, respectively. The Berg Balance Test (BBT), functional reach (FR), and timed up-and-go (TUG) tests were used to evaluate balance. After the initial assessment, the patients were divided randomly into two groups, the study group (12 patients) and the control group (10 patients). The mean age of the patients in the study group was 55.91 years (duration of stroke 58.66 months) and that of the control group was 54.00 years (duration of stroke 67.20 months). Individual training programs were determined for the patients in the study group, taking into consideration their evaluation results; and strengthening, stretching, range of motion, and mat exercises were determined for the control group according to their functional level. The participants in both groups were taken into the physiotherapy program for 12 weeks, 3 days a week for 1 hour a day. In group analyses, both groups showed improvement in STREAM, TIS, and TUG tests. Only the study group produced significant gains in the BBT, FR, and 10 m walking tests (P 0.05). Individually developed exercise programs in the Bobath concept improve trunk performance, balance, and walking ability in stroke patients more than do conventional exercises.

  14. Muscular condition and trunk stability in judoka of national and international level

    Directory of Open Access Journals (Sweden)

    Casto Juan-Recio

    2013-12-01

    Full Text Available Background: It is theorized that the development of the ability to stabilize the trunk may improve the performance of a judoka because it improves body balance control and optimizes force transmission from the lower extremities to the upper limbs. However, there is a lack of scientific evidence to establish a clear relationship between trunk stability and performance in judo.Aim: The purpose of this study was to determine whether the quantification of trunk stability and muscular strength and endurance allowed differentiation between national level (n = 7 and international level judoka (n = 6. In addition, the relationship between trunk stability and muscular strength and endurance of the muscles involved in trunk stability control was analyzed.Method: To assess trunk stability, trunk responses to sudden loads applied by a pneumatic mechanism were analyzed, as well as trunk postural control through an unstable sitting paradigm. Muscular strength and endurance were assessed via a flexion and extension trunk test using an isokinetic dynamometer.Results/Conclusions: International level judokas showed lower CoP displacement in the most complex task in unstable seat (7.00 ± 1.19 vs 8.93 ± 1.45 mm, T = .025 and higher absolute and relative peak torque in extensor muscles (7.05 ± 0.87 vs 5.74 ± 0.72 Nm, T = .013 than national level judoka. According to these results, core stability and trunk muscular condition are important qualities in the physical training of elite judoka. Correlational analysis found no relation between the analyzed variables, thus muscular strength and endurance appear to have a non-significant effect on performance in the trunk stability tests.

  15. Isolation, identification, and serotyping of Avibacterium paragallinarum from quails in Indonesia with typical infectious coryza disease symptoms

    Directory of Open Access Journals (Sweden)

    Agnesia Endang Tri Hastuti Wahyuni

    2018-04-01

    Full Text Available Background and Aim: Infectious coryza (IC or snot is an infectious upper respiratory disease affecting chickens and birds, including quails, and it is caused by Avibacterium paragallinarum. The symptoms of IC are facial swelling, malodorous nasal discharge, and lacrimation. This study aimed to isolate, identify, and serotype the A. paragallinarum of snot in quails and to determine the sensitivity and resistance to several antibiotics. Materials and Methods: Nine quails from Yogyakarta, Indonesia with typical snot disease symptoms were used in this study. The nasal swab was obtained and directly streaked onto a chocolate agar plate and blood agar plate (BAP, then incubated in 5% CO2 at 37°C for 24-48 h. Staphylococcus spp. was cross-streaked onto the BAP to show the satellite growth. The observation of the morphology of the suspected colony, Gram staining, and biochemical tests (catalase test, oxidase test, urease test, peptone test, and carbohydrate fermentation such as maltose, mannitol, lactose, and sorbitol are done to identify the species of bacteria. This research also detects the serovar of A. paragallinarum using hemagglutination inhibition test. The antibiotic sensitivity tests were also performed using several antibiotics against five A. paragallinarum isolates that were cultured on Mueller-Hinton Agar and added with antibiotic discs, then incubated in 5% CO2 at 37°C for 24-48 h. Results: Five isolates out of nine suspected isolates (55.5% were A. paragallinarum. The growth of isolates from quails did not depend on the nicotinamide adenine dinucleotide (NAD (NAD-independent. Sensitivity test was done using the five identified A. paragallinarum isolates, results showed that they were 100% sensitive to amoxicillin (AMC and ampicillin (AMP; 100% resistant toward amikacin (AK, erythromycin (E, gentamycin (CN, and tetracycline (TE; 80% resistant toward kanamycin (K and trimethoprim (W; 60% resistant toward chloramphenicol (C; and 20

  16. Hepatic microsomal metabolism of BDE-47 and BDE-99 by lesser snow geese and Japanese quail.

    Science.gov (United States)

    Krieger, Lisa K; Szeitz, András; Bandiera, Stelvio M

    2017-09-01

    In the present study, we investigated the oxidative biotransformation of 2,2',4,4'-tetrabromodiphenyl ether (BDE-47) and 2,2',4,4',5-pentabromodiphenyl ether (BDE-99) by liver microsomes from wild lesser snow geese (Chen caerulescens caerulescens) and domesticated Japanese quail (Coturnix japonica). Formation of hydroxy-metabolites was analyzed using an ultra-high performance liquid chromatography-tandem mass spectrometry-based method. Incubation of BDE-47 with avian liver microsomes produced sixteen hydroxy-metabolites, eight of which were identified using authentic standards. The major metabolites formed by liver microsomes from individual lesser snow geese were 4-hydroxy-2,2',3,4'-tetrabromodiphenyl ether (4-OH-BDE-42), 3-hydroxy-2,2',4,4'-tetrabromodiphenyl ether (3-OH-BDE-47), and 4'-hydroxy-2,2',4,5'-tetrabromodiphenyl ether (4'-OH-BDE-49). By comparison, 4-OH-BDE-42 and 4'-OH-BDE-49, but not 3-OH-BDE-47, were major metabolites of Japanese quail liver microsomes. Unidentified metabolites included monohydroxy- and dihydroxy-tetrabromodiphenyl ethers. Incubation of BDE-99 with avian liver microsomes produced seventeen hydroxy-metabolites, twelve of which were identified using authentic standards. The major metabolites formed by lesser snow goose liver microsomes were 2,4,5-tribromophenol, 3-OH-BDE-47, 4'-OH-BDE-49, 4-hydroxy-2,2',3,4',5-pentabromodiphenyl ether (4-OH-BDE-90), and 5'-hydroxy-2,2',4,4',5-pentabromodiphenyl ether (5'-OH-BDE-99). By comparison, the major metabolites produced by liver microsomes from Japanese quail included 6-hydroxy-2,2',4,4'-tetrabromodiphenyl ether (6-OH-BDE-47) and 2-hydroxy-2',3,4,4',5-pentabromodiphenyl ether (2-OH-BDE-123), but not 3-OH-BDE-47. Unidentified metabolites consisted of monohydroxy-pentabromodiphenyl ethers, monohydroxy-tetrabromodiphenyl ethers and dihydroxy-tetrabromodiphenyl ethers. Another difference between the two species was that formation rates of BDE-47 and BDE-99 metabolites were greater with liver

  17. Distribution and excretion of /sup 115m/cadmium and its transfer to egg and bone in laying female and estrogenized male Japanese quail

    Energy Technology Data Exchange (ETDEWEB)

    Nishimura, M; Sakuta, M; Okamoto, K; Urakawa, N

    1974-01-01

    The distribution of /sup 115m/cadmium and its transfer to the egg were investigated in laying Japanese quail. Furthermore, the influence of estrogens on the tissue uptake of /sup 115m/cadmium was analyzed in adult male quail. Whole-body sections of a laying quail were prepared. Autoradiograms were made in birds killed 1, 24, 48, 96, 192 and 384 hours after a single injection of /sup 115m/cadmium chloride. During the first 48 hours following the injection, high concentrations of /sup 115m/cadmium were detected in the liver, kidneys, pancreas, proventriculus, uterus and small intestine. In eggs laid, /sup 115m/cadmium was detected only in the yolk. Its amount in the yolk was the highest in the second egg and decreased afterwards in the increasing order of oviposition sequence. The amount of the second egg was 0.21 percent of the given. In the male quail after estrogenization, the concentration of /sup 115m/cadmium increased in the femur and decreased in the liver, whole blood, and blood corpuscle, but was not affected at all in the kidney or blood plasma. These effects were dependent on the dose of estradiol benzoate. The cumulative contents of /sup 115m/cadmium in feces and urine for 192 hours were 28.42 +/- 0.73 (mean +/- standard error) percent of the dose given in laying quail, 25.83 +/- 0.91 percent in untreated males, and 27.81 +/- 0.63 percent in estrogenized males. It appeared that the increased uptake of cadmium in the femur by the estrogenization was roughly parallel with the formation of intramedullary bone. 22 references, 8 figures.

  18. Performance of japanese quails fed feeds containing different corn and limestone particle sizes

    Directory of Open Access Journals (Sweden)

    DA Berto

    2007-09-01

    Full Text Available This study aimed at evaluating performance and egg quality of Japanese quails fed feeds containing different corn and limestone particle sizes. A total number of 648 birds in the peak of production was distributed in a random complete block experimental design, using a 2x3 factorial arrangement (2 corn particle sizes and 3 limestone particle sizes. Birds were designated to one of two blocks, with six replicates of 18 birds each. Mean geometric diameter (MGD values used were 0.617mm and 0.723mm (corn fine and coarse particle sizes, respectively, and 0.361mm, 0.721mm, and 0.947mm (limestone fine, intermediate and coarse particle sizes, respectively. The following treatments were applied: T1: fine corn feed, with 100% fine limestone; T2: fine corn feed, with 50% fine limestone and 50% intermediate limestone; T3: fine corn feed, with 50% fine limestone and 50% coarse limestone; T4: coarse corn feed, with 100% fine limestone; T5: coarse corn feed, with 50% fine limestone and 50% intermediate limestone; T6: coarse corn feed, with 50% fine limestone and 50% coarse limestone. The experiment lasted 112 days, consisting of 4 cycles of 28 days. No significant interaction was observed among corn and limestone particle sizes for any of the analyzed parameters. There were no significant effects (p>0.05 of the tested corn particle sizes on quail performance or egg quality. There were significant (p<0.05 isolated effects of limestone particle size only on the percentage of cracked eggs, which was reduced when birds fed 50% coarse limestone (0.947mm and 50% fine limestone (0.361mm as compared to those fed 100% fine limestone. Therefore, the inclusion of 50% coarse limestone (0.947mm is recommended for quail egg production.

  19. Trunk lean gait decreases multi-segmental coordination in the vertical direction.

    Science.gov (United States)

    Tokuda, Kazuki; Anan, Masaya; Sawada, Tomonori; Tanimoto, Kenji; Takeda, Takuya; Ogata, Yuta; Takahashi, Makoto; Kito, Nobuhiro; Shinkoda, Koichi

    2017-11-01

    [Purpose] The strategy of trunk lean gait to reduce external knee adduction moment (KAM) may affect multi-segmental synergy control of center of mass (COM) displacement. Uncontrolled manifold (UCM) analysis is an evaluation index to understand motor variability. The purpose of this study was to investigate how motor variability is affected by using UCM analysis on adjustment of the trunk lean angle. [Subjects and Methods] Fifteen healthy young adults walked at their preferred speed under two conditions: normal and trunk lean gait. UCM analysis was performed with respect to the COM displacement during the stance phase. The KAM data were analyzed at the points of the first KAM peak during the stance phase. [Results] The KAM during trunk lean gait was smaller than during normal gait. Despite a greater segmental configuration variance with respect to mediolateral COM displacement during trunk lean gait, the synergy index was not significantly different between the two conditions. The synergy index with respect to vertical COM displacement during trunk lean gait was smaller than that during normal gait. [Conclusion] These results suggest that trunk lean gait is effective in reducing KAM; however, it may decrease multi-segmental movement coordination of COM control in the vertical direction.

  20. The effect of diet and host genotype on ceca microbiota of Japanese quail fed a cholesterol enriched diet.

    Science.gov (United States)

    Liu, Shasha; Bennett, Darin C; Tun, Hein M; Kim, Ji-Eun; Cheng, Kimberly M; Zhang, Hongfu; Leung, Frederick C

    2015-01-01

    Two Japanese quail strains, respectively atherosclerosis-susceptible (SUS) and -resistant (RES), have been shown to be good models to study cholesterol metabolism and transportation associated with atherosclerosis. Our objective was to examine possible difference in cecal microbiota between these strains when fed a control diet and a cholesterol enriched diet, to determine how host genotype and diet could affect the cecal microbiome that may play a part in cholesterol metabolism. A factorial study with both strains and two diets (control, cholesterol) was carried out. Cecal content was collected from 12 week old quail that have been on their respective diets for 6 weeks. DNA was extracted from the samples and the variable region 3-5 of the bacterial 16S rRNA gene was amplified. The amplicon libraries were subjected to pyrosequencing. Principal Component Analysis (PCA) of β-diversity showed four distinct microbiota communities that can be assigned to the 4 treatment groups (RES/control, RES/cholesterol, SUS/control, SUS/cholesterol). At the Phylum level, the 4 treatment groups has distinct Firmicutes community characteristics but no significant difference in Bacteroidetes. Eubacterium dolichum was rare in RES/control but became overabundant in RES/cholesterol. An unclassified species of Lactobacillaceae was found in abundance in SUS/control but the same species was rare in RES/cholesterol. On the other hand, two Lactobacillus species were only found in RES/control and an unclassified Lachnospiraceae species was abundant in RES/cholesterol but rare in SUS/control. The abundance of four species of Lachnospiraceae, three species of Ruminococcaceae and one species of Coprobacillaceae was positively correlated with plasma Total Cholesterol, plasma LDL, and LDL/HDL ratio. Our study of cecal microbiota in these quail has demonstrated that selection for susceptibility/resistance to diet induced atherosclerosis has also affected the quail's cecal environment to host

  1. Trunk stabilization exercises for healthy individuals

    Directory of Open Access Journals (Sweden)

    Francisco J Vera-Garcia

    2014-01-01

    Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2014v16n2p200   The aim of this study was to analyze the trunk muscular response during different variations of some of the most popular stabilization exercises: front-bridge, back-bridge, side-bridge, and bird-dog. Surface electromyography was bilaterally re-corded from rectus abdominis, external and internal oblique and erector spinae during 25 variations of the aforementioned exercises. Compared to the conventional form of the front- and side-bridge, performing these exercises kneeling on a bench or with elbows extended reduced the muscular challenge. Conversely, performing the back-bridge with elbows extended elicited higher muscular activation than the conventional exercise. While bridge exercises with double leg support produced the highest activation levels in those muscles that counteracted gravity, single leg support while bridging increased the activation of the trunk rotators, especially internal oblique. The highest activation levels were found in three exercises: sagittal walkout in a front-bridge position, rolling from right side-bridge into front-bridge position, and side-bridge with single leg support on a BOSUTMbalance trainer. Although the exercises performed on unstable surfaces usu-ally enhanced the muscle activation, performing the exercises on the BOSUTMbalance trainer did not always increase the trunk muscle activity. Overall, this information may be useful to guide fitness instructors and clinicians when establishing stabilization exercise progressions for the trunk musculature.

  2. Comparison between the effects of animal and plant basal diets on productivity of Japanese quails

    International Nuclear Information System (INIS)

    Abu-Taleb, A.M.

    2004-01-01

    The outbreak of bovine spongiform encephalopathy (BSE) disease in cattle, known as m ad cow disease , make the European commission to take an action for preventing the spread of such disease by banning the feeding ruminant tissue and animal by-products to farm animals. This study suggested to compare between two basal diets originated from either plants or animal and their effects on some physiological parameters related to the bird growth. A total number of 800 one day old unsexed Japanese quails were used in this study. Quails were divided equally into two groups containing 400 birds each. Each group contained 4 replicates of 100 birds. Group one the birds were fed on animal diet and group two fed on plant diet. The two diets contained 24% crude protein (CP) and 4% fat and contains 3200 Kcal/kg diet in starter, while the layer diet contained 21% CP and 4% fat and contains 3000 Kcal/kg diet. Growth data were obtained by weighing the quails individually every week until 6 th weeks, 6 th months and 1 2th months. Eggs were collected daily and weighed for eight months starting from the onset of first egg lying. At 8 th month, a sample of 8 quails was sacrificed, organ weighted and blood samples were collected. Carcass composition was performed to determine % fat, % protein, % ash and total moisture. Hematological and histological parameters, liver and kidney functions, total protein, albumin, globulin, estradiol, testosterone, cholesterol and total lipids were evaluated. The results showed significant increase in body weights gain in one and three weeks only in animal protein diet but no difference were shown between animal and plant diet after 4 weeks and until 12 month. No difference between animal and plant diets were noted in total dry solids (TDS), fat %, ash and protein of TDS and egg production. Levels of serum estradiol, testosterone, total protein, albumin, hematological parameters and total lipids showed non-significant values. The histological parameters

  3. Effects of the usage of dried brewing yeast in the diets on the performance, egg traits and blood parameters in quails.

    Science.gov (United States)

    Yalçın, S; Erol, H; Ozsoy, B; Onbaşılar, I; Yalçın, S

    2008-12-01

    This experiment was carried out to determine the effects of the usage of dried brewing yeast in quail diets on laying performance, egg traits and blood parameters. A total of 240 Japanese quails (Coturnix coturnix japonica) aged 10 weeks were randomly allocated into one control group and three treatment groups. Each group was divided into five replicates as subgroups, comprising 12 quails each. Dried brewing yeast (Saccharomyces cerevisiae) was used at the levels of 1.5%, 3.0% and 4.5% in the diets of the first, second and third treatment groups, respectively. Soyabean meal was replaced with dried brewing yeast. The diets were formulated to be isocaloric and isonitrogenous. The experimental period lasted 18 weeks. Dietary treatments did not significantly affect body weight, daily feed intake, daily protein intake, egg production, egg weight, feed efficiency, mortality, egg shell thickness, egg albumen index, egg yolk index, egg Haugh unit, the percentages of egg shell, albumen and yolk, excreta moisture and small intestinal pH. Inclusion of 3% and 4.5% dried brewing yeast in diets reduced egg yolk cholesterol concentration as mg per yolk and mg per g yolk (P brewing yeast was significantly lower (P brewing yeast resulted in significant increases (P brewing yeast. It is concluded that dried brewing yeast can be used up to 4.5% in the diets of laying quails without adverse effects on the measured parameters.

  4. File list: DNS.Emb.20.AllAg.Embryonic_trunk [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.Emb.20.AllAg.Embryonic_trunk mm9 DNase-seq Embryo Embryonic trunk SRX191030 htt...p://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/DNS.Emb.20.AllAg.Embryonic_trunk.bed ...

  5. Effects of Propolis, Royal Jelly, Bee Pollen and Ronozyme Supplementation in Diets of Japanese Quails (Coturnix Coturnix Japonica) on Yolk Lipid Peroxidation

    OpenAIRE

    Yılmaz S; Tatli Seven P; Kaya E

    2017-01-01

    This study discovers the possible effect propolis, royal jelly, bee pollen and Ronozyme supplementation in diets that can be beneficial for Japanese quails (Coturnix coturnix japonica). Total one hundred and sixty Japanese quails at 43 days of age were used and divided randomly into 4 replicate groups each containing 32 animals. The experimental groups as follows: control group was feed a basal diet, royal jelly group was added to the water with 500 mg/kg diet, propolis group was feed orally ...

  6. A Review on Some Parameters of Environment in Youth Intensive Raising of Japanese Quail

    Directory of Open Access Journals (Sweden)

    Lucian Ioniţă

    2012-10-01

    Full Text Available The aim of this paper is to review the state-of-art of scientific research on some environmentalparameters recommended by the literature in the intensive raising of young quails. As a result ofthe research it can be said that the temperature in the raising area of the young Japanese quailvaries between 35 º - 37.8 º C in the first week of life, after which it decreases by 3-4 ° C / week.The relative humidity in the shelter of young quails in the first week of raising must bemaintained at 80% (made with trays of water; then it should decrease at the value of 70%. Lightregime recommended for intensive young quails raising can be 24 hours light per day to 42 daysor can choose a program of light of 24 hours a day during the first 7 days of life, after which itcan be reducde up to 16 hours a day until the age of 42 days. Light intensity should be between20 lux and 45 lux for the first 7 days of life of the youth, then can be reduced by 20 to 5 lux untilthe age of 41 days. Density per area unit in the house is of 150 chicken / sqm (for ground riasing,reaching the age of 6 weeks at a density of 100 chicks / sqm or 250 chicken / sqm cage (in thecase of youth raising in batteries The number of chickens decreases to 250 for 1.5 sqm of cagearea in the second week of life and 250 chicken for 2 sqm cage area in the third week.

  7. File list: His.Emb.10.AllAg.Embryonic_trunk [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Emb.10.AllAg.Embryonic_trunk mm9 Histone Embryo Embryonic trunk SRX093317,SRX09...3316 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Emb.10.AllAg.Embryonic_trunk.bed ...

  8. File list: His.Emb.50.AllAg.Embryonic_trunk [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Emb.50.AllAg.Embryonic_trunk mm9 Histone Embryo Embryonic trunk SRX093317,SRX09...3316 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Emb.50.AllAg.Embryonic_trunk.bed ...

  9. Immunomodulation and hormonal disruption without compromised disease resistance in perfluorooctanoic acid (PFOA) exposed Japanese quail

    International Nuclear Information System (INIS)

    Smits, Judit E.G.; Nain, Sukhbir

    2013-01-01

    This study evaluated the impact of oral perfluorooctanoic acid (PFOA) on Japanese quail at concentrations found in American and Belgian workers at PFOA manufacturing facilities. Three arms of the immune system were tested; T cell, B cell, and innate immunity. After 6 weeks exposure, quail were challenged with E. coli infection to test the ultimate measure of immunotoxicity, disease resistance. The T cell response was lower in the high exposure groups. Antibody mediated, and innate immune responses were not different. Growth rate was higher, whereas thyroid hormone levels were lower in PFOA-exposed birds. Morbidity/mortality from disease challenge was not different among the control and PFOA-exposed groups, and no overt PFOA toxicity was observed pre-disease challenge. Although PFOA at ‘worst case scenario’ levels caused T cell immunosuppression, this did not translate into increased disease susceptibility, demonstrating that immunotoxicity testing must be interpreted with caution since disease resistance is the ultimate concern. -- Highlights: •Birds orally exposed to high levels of PFOA for 8 wks showed no signs of toxicity. •PFOA exposure caused immunotoxicity by suppressing the T cell mediated response. •PFOA exposure did not affect antibody mediated, or innate immunity. •PFOA exposure did not cause increased morbidity/mortality after E. coli infection. •PFOA exposed birds showed endocrinological changes that may warrant further study. -- Oral exposure of quail to the pollutant, PFOA, resulted in hormonal and immunological changes, but did not compromise disease resistance after challenge by a common avian pathogen

  10. Lumbopelvic flexibility modulates neuromuscular responses during trunk flexion-extension.

    Science.gov (United States)

    Sánchez-Zuriaga, Daniel; Artacho-Pérez, Carla; Biviá-Roig, Gemma

    2016-06-01

    Various stimuli such as the flexibility of lumbopelvic structures influence the neuromuscular responses of the trunk musculature, leading to different load sharing strategies and reflex muscle responses from the afferents of lumbopelvic mechanoreceptors. This link between flexibility and neuromuscular response has been poorly studied. The aim of this study was to investigate the relationship between lumbopelvic flexibility and neuromuscular responses of the erector spinae, hamstring and abdominal muscles during trunk flexion-extension. Lumbopelvic movement patterns were measured in 29 healthy women, who were separated into two groups according to their flexibility during trunk flexion-extension. The electromyographic responses of erector spinae, rectus abdominis and biceps femoris were also recorded. Subjects with greater lumbar flexibility had significantly less pelvic flexibility and vice versa. Subjects with greater pelvic flexibility had a higher rate of relaxation and lower levels of hamstring activation during maximal trunk flexion. The neuromuscular response patterns of the hamstrings seem partially modulated by pelvic flexibility. Not so with the lumbar erector spinae and lumbar flexibility, despite the assertions of some previous studies. The results of this study improve our knowledge of the relationships between trunk joint flexibility and neuromuscular responses, a relationship which may play a role in low back pain. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Functional and morphological variety in trunk muscles of Urodela.

    Science.gov (United States)

    Omura, Ayano; Anzai, Wataru; Endo, Hideki

    2014-03-01

    Trunk musculature in Urodela species varies by habitat. In this study, trunk musculature was examined in five species of adult salamanders representing three different habitats: aquatic species, Amphiuma tridactylum and Necturus maculosus; semi-aquatic species, Cynops pyrrhogaster; terrestrial species, Hynobius nigrescens and Ambystoma tigrinum. More terrestrial species have heavier dorsal and ventral trunk muscles than more aquatic forms. By contrast, the lateral hypaxial musculature was stronger in more aquatic species. The number of layers of lateral hypaxial musculature varied among Urodela species and did not clearly correlate with their habitats. The M. rectus abdominis was separated from the lateral hypaxial musculature in both terrestrial and semi-aquatic species. In aquatic species, M. rectus abdominis was not separated from lateral hypaxial musculature. Lateral hypaxial musculature differed in thickness among species and was relatively thinner in terrestrial species. In more terrestrial species, dorsal muscles may be used for stabilization and ventral flexing against gravity. Ventral muscle may be used in preventing dorsally concave curvature of the trunk by dorsal muscles and by weight. The lengthy trunk supported by limbs needs muscular forces along the ventral contour line in more terrestrial species. And, the locomotion on well-developed limbs seems to lead to a decrease of the lateral hypaxial musculature.

  12. Protective effects of Arctium lappa L. root extracts (AREs) on high fat diet induced quail atherosclerosis.

    Science.gov (United States)

    Wang, Zhi; Li, Ping; Wang, Chenjing; Jiang, Qixiao; Zhang, Lei; Cao, Yu; Zhong, Weizhen; Wang, Chunbo

    2016-01-08

    This study was designed to evaluate the protective effects of Arctium lappa L. root extracts (AREs) from different extraction methods (aqueous, ethanol, chloroform and flavone) on atherosclerosis. Quails (Coturnix coturnix) were subjected to high fat diet, with or without one of the four different AREs or positive control simvastatin. Blood samples were collected before treatment, after 4.5 weeks or ten weeks to assess lipid profile (Levels of total cholesterol (TC), Triacylglycerol (TG), low-density lipoprotein (LDL) and high-density lipoprotein (HDL)). After ten weeks, the serum levels of nitric oxide (NO) as well as antioxidant and pro-oxidative status (Levels of malondialdehyde (MDA), superoxide dismutase (SOD), catalase (CAT), glutathione (GSH), nicotinamide adenine dinucleotide phosphate (NADPH) and glutathione peroxidase (GSH-Px)) were measured. Furthermore, aortas were collected after ten weeks treatment, aorta lipid contents (TC, TG and LDL) were assessed, and histology was used to confirm atherosclerotic changes. The results indicated that high fat diet significantly deteriorated lipid profile and antioxidant status in quail serum, while all the extracts significantly reverted the changes similar to simvastatin. Aorta lipid profile assessment revealed similar results. Histology on aortas from quails treated for ten weeks confirmed atherosclerotic changes in high fat diet group, while the extracts significantly alleviated the atherosclerotic changes similar to simvastatin. Among the different extracts, flavones fraction exerted best protective effects. Our data suggest that the protective effects of AREs were medicated via hypolipidemic and anti-oxidant effects. Underlying molecular mechanisms are under investigation.

  13. Trace element concentrations in the fruit peels and trunks of Musa paradisiaca.

    Science.gov (United States)

    Selema, M D; Farago, M E

    1996-08-01

    Chemical analyses for the elementary compositions of the ashes of the fruit peels and trunks of the tropical plantain Musa paradisiaca have been undertaken. The elements, categorized as trace elements, generally are found to have higher mean concentrations in the fruit peels than in the trunks (except in the case of Zn). Their peel-trunk uptake ratios have been calculated and range between 1 and 4, showing normal levels of accumulations in the fruit peels over the trunks.

  14. An assistance device to help people with trunk impairment maintain posture.

    Science.gov (United States)

    Ogura, Tomoka; Itami, Taku; Yano, Ken'ichi; Mori, Ichidai; Kameda, Kazuhiro

    2017-07-01

    People with trunk impairment cannot lean forward because of the dysfunction of the trunk resulting from events such as cervical cord injury (CCI). It is therefore difficult for such people to work at a table because they may easily fall from their wheelchair, and it is also hard for them to return to their original position. This limits the activities of daily living (ADLs) of people with trunk impairment. These problems can be solved to some extent with equipment such as a wheelchair belt or a spinal orthosis that can help the person to maintain his or her posture. However, people cannot move freely with this equipment. Furthermore, if this equipment is used for a long time, there is a risk of physical pain and skin issues. In this study, we developed a device that assists the trunk of people with trunk impairment when they lean forward. This device supports people with trunk impairment so that they may take their meals at the table and prevents them from falling over their wheelchair without hindering their daily performance when they are sitting normally. The effectiveness of our proposed device was verified by experiments involving having a meal, operating a wheelchair, and colliding with a curb. Our device can help people with trunk impairment by improving their ADLs and quality of life (QOL).

  15. Assessing delay and lag in sagittal trunk control using a tracking task.

    Science.gov (United States)

    Reeves, N Peter; Luis, Abraham; Chan, Elizabeth C; Sal Y Rosas, Victor G; Tanaka, Martin L

    2018-05-17

    Slower trunk muscle responses are linked to back pain and injury. Unfortunately, clinical assessments of spine function do not objectively evaluate this important attribute, which reflects speed of trunk control. Speed of trunk control can be parsed into two components: (1) delay, the time it takes to initiate a movement, and (2) lag, the time it takes to execute a movement once initiated. The goal of this study is to demonstrate a new approach to assess delay and lag in trunk control using a simple tracking task. Ten healthy subjects performed four blocks of six trials of trunk tracking in the sagittal plane. Delay and lag were estimated by modeling trunk control for predictable and unpredictable (control mode) trunk movements in flexion and extension (control direction) at movement amplitudes of 2°, 4°, and 6° (control amplitude). The main effect of control mode, direction, and amplitude of movement were compared between trial blocks to assess secondary influencers (e.g., fatigue). Only control mode was consistent across trial blocks with predictable movements being faster than unpredictable for both delay and lag. Control direction and amplitude effects on delay and lag were consistent across the first two trial blocks and less consistent in later blocks. Given the heterogeneity in the presentation of back pain, clinical assessment of trunk control should include different control modes, directions, and amplitudes. To reduce testing time and the influence of fatigue, we recommend six trials to assess trunk control. Copyright © 2018 Elsevier Ltd. All rights reserved.

  16. A Case of an Aortic Abscess around the Elephant Trunk.

    Science.gov (United States)

    Fujii, Takeshiro; Kawasaki, Muneyasu; Katayanagi, Tomoyuki; Okuma, Shinnosuke; Masuhara, Hiroshi; Shiono, Noritsugu; Watanabe, Yoshinori

    2015-01-01

    A 52-year-old male patient with a history of total arch replacement using the elephant trunk technique for acute aortic dissection 4 years before visited our hospital with the chief complaint of persistent fever. Chest computed tomography (CT) suggested prosthetic vascular graft infection, which was treated surgically after chemotherapy. The first surgery consisted of debridement of an abscess around the vascular graft and in the aorta around the elephant trunk, and thoracic descending aorta replacement and vacuum-assisted closure (VAC) in view of the risk of bleeding from the peripheral region of the elephant trunk. One week later, omental filling was performed as the second step. This is a very rare case of aortic abscess around the elephant trunk that could successfully be managed by graft-conserving treatment.

  17. Soapwort extract supplementation alters antioxidant status of serum, liver and heart tissues in growing Japanese quails reared under chronic intermittent cold stress

    Directory of Open Access Journals (Sweden)

    Bestami Dalkilic

    2017-01-01

    Full Text Available Antioxidant effect of dietary soapwort extract supplementation was studied in growing Japanese quails suffering from chronic intermittent cold stress. For this purpose, a total of ninety 15-d-old quails were divided into three groups with three replicates. Chronic intermittent cold stress was applied every night between 22.00 to 06.00 h; starting at 14 °C for the first week, and gradually weekly lowered to 8 °C. Three groups were fed with corn-soy based standard diets supplemented with 0, 50, and 100 ppm soapwort extract for four weeks. At the end of the study, three males and three females were slaughtered to determine total antioxidant and oxidant status of serum, malondialdehyde, glutathione, glutathione peroxidase activity, superoxide dismutase of liver and heart tissues. Although the dietary soapwort extract had no effect on serum total antioxidant capacity, it significantly lowered the total oxidant status of serum in cold stressed quails. Glutathione and superoxide dismutase enzyme activity of liver and heart tissues were similar among groups. While the dietary soapwort extract had no effect on glutathione peroxidase activity of the heart tissue, it significantly increased glutathione peroxidase activity in the liver tissue. In relation to the control group, malondialdehyde concentrations in the liver and heart tissues were significantly lower in soapwort extract groups. These data suggest that dietary soapwort extract could alleviate the detrimental effects of oxidative stress in growing Japanese quails exposed to cold stress.

  18. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Science.gov (United States)

    Das, Debajyoti; Kar, Debjit

    2017-12-01

    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  19. Relationships between trunk performance, gait and postural control in persons with multiple sclerosis.

    Science.gov (United States)

    Freund, Jane E; Stetts, Deborah M; Vallabhajosula, Srikant

    2016-06-30

    Multiple sclerosis (MS) is a chronic progressive disease of the central nervous system. Compared to healthy individuals, persons with multiple sclerosis (PwMS) have increased postural sway in quiet stance, decreased gait speed and increased fall incidence. Trunk performance has been implicated in postural control, gait dysfunction, and fall prevention in older adults. However, the relationship of trunk performance to postural control and gait has not been adequately studied in PwMS. To compare trunk muscle structure and performance in PwMS to healthy age and gendered-matched controls (HC); to determine the effects of isometric trunk endurance testing on postural control in both populations; and to determine the relationship of trunk performance with postural control, gait and step activity in PwMS. Fifteen PwMS and HC completed ultrasound imaging of trunk muscles, 10 m walk test, isometric trunk endurance tests, and postural sway test. Participants wore a step activity monitor for 7 days. PwMS had worse isometric trunk endurance compared to HC. PwMS trunk flexion endurance negatively correlated to several postural control measures and positively correlated to gait speed and step activity. Clinicians should consider evaluation and interventions directed at impaired trunk endurance in PwMS.

  20. Appraisal and standardization of curvilinear velocity (VCL) cut-off values for CASA analysis of Japanese quail (Coturnix japonica) sperm.

    Science.gov (United States)

    Farooq, U; Malecki, I A; Mahmood, M; Martin, G B

    2017-06-01

    One of the basic steps in objective analysis of sperm motility is the subdivision of a motile sperm population into slow, medium and rapid categories based on their velocity. However, for CASA analysis of quail sperm, the velocity values for categorization of slow, medium and rapid sperm have not yet been standardized. To identify the cut-off values of "velocity curvilinear" (VCL) for quail sperm categorization, we captured and analysed 22,300 tracks of quail sperm using SCA ® -CASA. The median and mean VCL values were 85 and 97 μm/s. To define the VCL cut-off values, we used two methods. In the first, we identified the upper (rapid sperm) and lower (slow sperm) cut-off values using: (i) median VCL ± 25% or ± 50% or ± 75% of median VCL value; (ii) first and third quartile values of VCL data (i.e. 25% cut-off setting); and (iii) 33% and 66% of VCL data. Among these settings, sperm categories and their corresponding motility characteristics recorded using the "25%" setting (i.e. slow ≤36 ≤ medium ≤154 ≤ rapid) were found the most realistic and coherent with male ranking by fertility. In the second method, we calculated heteroscedasticity in the total VCL data using PCA and the two-step clustering method. With this approach, the mean of the high and low clusters was 165 and 51 μm/s, respectively. Together, the mean from two methods suggested that, for SCA ® -CASA categorization of quail sperm, sperm should be classed as "rapid" at VCL ≥160 μm/s and "slow" at VCL ≤45 μm/s. © 2017 Blackwell Verlag GmbH.

  1. Effect of Different Levels of Artichoke (Cynara scolymus L. Leaf Powder on the Performance and Meat Quality of Japanese Quail

    Directory of Open Access Journals (Sweden)

    Abbasi F

    2014-12-01

    Full Text Available A total of 240 Japanese quail chicks (1 d old were used in a 42-d trial to study the effects of Artichoke leaf powder and vitamin E on growth performance and meat quality. This experiment was performed as a completely randomized design with 4 replicates of 15 quails in each, using a 4×2 factorial arrangement with diet and gender as the main effects. Four dietary treatments were formulated by addition of 2 levels (1.5 and 3 percent of Artichoke leaf powder and 300 mg/Kg vitamin E to the basal diet. Results showed that supplementing the basal diet with Artichoke leaf powder and vitamin E significantly affected growth performance at 21 d of age (P. Dietary treatments significantly affected 2-thiobarbituric acid-reactive substance (TBARS and water holding capacity (WHC values of breast meat (P. The value of TBARS in breast meat was not affected by dietary levels of Artichoke leaf powder, whereas the value decreased significantly by vitamin E treatment (P. Quails receiving 1.5 percent Artichoke leaf powder and 300 mg/Kg vitamin E had significantly lower breast meat WHC than those  receiving the basal diet (P. Breast meat crude fat and WHC were affected by gender (P. Dietary 3 percent Artichoke leaf powder increased the b* values of thigh meat compared with the control. The lightness of thigh and breast meat and also redness of thigh meat were affected by gender (P. In general, the results indicated that supplementation of diet by Artichoke leaf powder did not improve growth performance of quails, but may have a potential to improve the oxidative stability and meat quality.

  2. The role of heat shock protein 70 in oxidant stress and inflammatory injury in quail spleen induced by cold stress.

    Science.gov (United States)

    Ren, Jiayi; Liu, Chunpeng; Zhao, Dan; Fu, Jing

    2018-05-15

    The aim of this study was to investigate the role of heat shock protein 70 (Hsp70) in oxidative stress and inflammatory damage in the spleen of quails which were induced by cold stress. One hundred ninety-two 15-day-old male quails were randomly divided into 12 groups and kept at 12 ± 1 °C to examine acute and chronic cold stress. We first detected the changes in activities of antioxidant enzymes in the spleen tissue under acute and chronic cold stress. The activities of glutathione peroxidase (GSH-Px) fluctuated in acute cold stress groups, while they were significantly decreased (p stress. The activities of superoxide dismutase (SOD), inducible nitric oxide synthase (iNOS), and nitric oxide (NO) content were decreased significantly (p stress groups. Malondialdehyde (MDA) content was significantly increased (p stress except the 0.5 h group of acute cold stress. Besides, histopathological analysis showed that quail's spleen tissue was inflammatory injured seriously in both the acute and chronic cold stress groups. Additionally, the inflammatory factors (cyclooxygenase-2 (COX-2), prostaglandin E synthase (PTGES), iNOS, nuclear factor-kappa B (NF-κB), and tumor necrosis factor-a (TNF-α)) and Hsp70 mRNA levels were increased in both of the acute and chronic cold stress groups compared with the control groups. These results suggest that oxidative stress and inflammatory injury could be induced by cold stress in spleen tissues of quails. Furthermore, the increased expression of Hsp70 may play a role in protecting the spleen against oxidative stress and inflammatory damage caused by cold stress.

  3. THE RELATIONSHIP BETWEEN TRUNK MUSCLES ENDURANCE AND NORMAL BMI AMONG UNIVERSITY STUDENTS WITH SEDENTARY LIFESTYLE

    Directory of Open Access Journals (Sweden)

    Karthikeyan Selvaganapathy

    2017-12-01

    Full Text Available Background: The most important trunk stabilizers are the trunk flexors and extensors. The isometric endurance of the trunk muscles is an essential element for mechanical support of the spine in all positions. The study objectives were to find out the trunk flexors and extensors endurance, its relationship with normal BMI and to find out the ratio of trunk flexors to extensors endurance. Methods: In this correlation study, 50 subjects were selected by convenience sampling method on the basis of inclusion and exclusion criteria from Asia metropolitan university, Malaysia. The trunk flexors and extensors endurance were assessed by Kraus- Weber and Sorenson test respectively. Paired 't' test and Spearman correlation test were used for data analysis. Results: There was a significant difference (p 0.01 and TEE, rs (50 = -0.162, p >0.01 but there was a significant strong positive relationship between TFE and TEE, rs (50 = 0.68, p < 0.01. The ratio of trunk flexors to extensors was 0.61. Conclusion: The trunk extensors endurance is higher than trunk flexors endurance and BMI has no relationship with trunk flexors and extensors muscle endurance. The ratio of trunk flexors to extensors endurance value is low

  4. Control of trunk motion following sudden stop perturbations during cart pushing.

    Science.gov (United States)

    Lee, Yun-Ju; Hoozemans, Marco J M; van Dieën, Jaap H

    2011-01-04

    External perturbations during pushing tasks have been suggested to be a risk factor for low-back symptoms. An experiment was designed to investigate whether self-induced and externally induced sudden stops while pushing a high inertia cart influence trunk motions, and how flexor and extensor muscles counteract these perturbations. Twelve healthy male participants pushed a 200 kg cart at shoulder height and hip height. Pushing while walking was compared to situations in which participants had to stop the cart suddenly (self-induced stop) or in which the wheels of the cart were unexpectedly blocked (externally induced stop). For the perturbed conditions, the peak values and the maximum changes from the reference condition (pushing while walking) of the external moment at L5/S1, trunk inclination and electromyographic amplitudes of trunk muscles were determined. In the self-induced stop, a voluntary trunk extension occurred. Initial responses in both stops consisted of flexor and extensor muscle cocontraction. In self-induced stops this was followed by sustained extensor activity. In the externally induced stops, an external extension moment caused a decrease in trunk inclination. The opposite directions of the internal moment and trunk motion in the externally induced stop while pushing at shoulder height may indicate insufficient active control of trunk posture. Consequently, sudden blocking of the wheels in pushing at shoulder height may put the low back at risk of mechanical injury. Copyright © 2010 Elsevier Ltd. All rights reserved.

  5. Trunk and hip biomechanics influence anterior cruciate loading mechanisms in physically active participants.

    Science.gov (United States)

    Frank, Barnett; Bell, David R; Norcross, Marc F; Blackburn, J Troy; Goerger, Benjamin M; Padua, Darin A

    2013-11-01

    Excessive trunk motion and deficits in neuromuscular control (NMC) of the lumbopelvic hip complex are risk factors for anterior cruciate ligament (ACL) injury. However, the relationship between trunk motion, NMC of the lumbopelvic hip complex, and triplanar knee loads during a sidestep cutting task has not been examined. To determine if there is an association between multiplanar trunk motion, NMC of the lumbopelvic hip complex, and triplanar knee loads with ACL injury during a sidestep cutting task. Descriptive laboratory study. The hip and knee biomechanics and trunk motion of 30 participants (15 male, 15 female) were analyzed during a sidestep cutting task using an optoelectric camera system interfaced to a force plate. Trunk and lower extremity biomechanics were calculated from the kinematic and ground-reaction force data during the first 50% of the stance time during the cutting task. Pearson product moment correlation coefficients were calculated between trunk and lower extremity biomechanics. Multiple linear regression analyses were carried out to determine the amount of variance in triplanar knee loading explained by trunk motion and hip moments. A greater internal knee varus moment (mean, 0.11 ± 0.12 N·m/kg*m) was associated with less transverse-plane trunk rotation away from the stance limb (mean, 20.25° ± 4.42°; r = -0.46, P = .011) and a greater internal hip adduction moment (mean, 0.33 ± 0.25 N·m/kg*m; r = 0.83, P < .05). A greater internal knee external rotation moment (mean, 0.11 ± 0.08 N·m/kg*m) was associated with a greater forward trunk flexion (mean, 7.62° ± 5.28°; r = 0.42, P = .020) and a greater hip internal rotation moment (mean, 0.15 ± 0.16 N·m/kg*m; r = 0.59, P = .001). Trunk rotation and hip adduction moment explained 81% (P < .05) of the variance in knee varus moment. Trunk flexion and hip internal rotation moment explained 48% (P < .05) of the variance in knee external rotation moment. Limited trunk rotation displacement

  6. Genetic analysis of partial egg production records in Japanese quail using random regression models.

    Science.gov (United States)

    Abou Khadiga, G; Mahmoud, B Y F; Farahat, G S; Emam, A M; El-Full, E A

    2017-08-01

    The main objectives of this study were to detect the most appropriate random regression model (RRM) to fit the data of monthly egg production in 2 lines (selected and control) of Japanese quail and to test the consistency of different criteria of model choice. Data from 1,200 female Japanese quails for the first 5 months of egg production from 4 consecutive generations of an egg line selected for egg production in the first month (EP1) was analyzed. Eight RRMs with different orders of Legendre polynomials were compared to determine the proper model for analysis. All criteria of model choice suggested that the adequate model included the second-order Legendre polynomials for fixed effects, and the third-order for additive genetic effects and permanent environmental effects. Predictive ability of the best model was the highest among all models (ρ = 0.987). According to the best model fitted to the data, estimates of heritability were relatively low to moderate (0.10 to 0.17) showed a descending pattern from the first to the fifth month of production. A similar pattern was observed for permanent environmental effects with greater estimates in the first (0.36) and second (0.23) months of production than heritability estimates. Genetic correlations between separate production periods were higher (0.18 to 0.93) than their phenotypic counterparts (0.15 to 0.87). The superiority of the selected line over the control was observed through significant (P egg production in earlier ages (first and second months) than later ones. A methodology based on random regression animal models can be recommended for genetic evaluation of egg production in Japanese quail. © 2017 Poultry Science Association Inc.

  7. Behavioral and cognitive evaluation of FireWorks education trunk

    Science.gov (United States)

    Linda R. Thomas; James A. Walsh; Jane Kapler Smith

    2000-01-01

    This study assessed the effectiveness of FireWorks, an educational trunk about wildland fire, in increasing student understanding, enabling students to apply classroom learning in a field setting, and improving the learning environment. Students who were in classrooms using the FireWorks educational trunk demonstrated more knowledge in both classroom and field-based...

  8. Non-leptonic kaon decays at large Nc

    Science.gov (United States)

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

    2018-03-01

    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  9. Common Arterial Trunk in a 3-Day-Old Alpaca Cria

    Directory of Open Access Journals (Sweden)

    Tsumugi Anne Kurosawa

    2016-01-01

    Full Text Available A 3-day-old alpaca cria presented for progressive weakness and dyspnea since birth. Complete bloodwork, thoracic radiographs, and endoscopic examination of the nasal passages and distal trachea revealed no significant findings. Echocardiogram and contrast study revealed a single artery overriding a large ventricular septal defect (VSD. A small atrial septal defect or patent foramen ovale was also noted. Color flow Doppler and an agitated saline contrast study revealed bidirectional but primarily right to left flow through the VSD and bidirectional shunting through the atrial defect. Differential diagnosis based on echocardiographic findings included common arterial trunk, Tetralogy of Fallot, and pulmonary atresia with a VSD. Postmortem examination revealed a large common arterial trunk with a quadricuspid valve overriding a VSD. Additionally, defect in the atrial septum was determined to be a patent foramen ovale. A single pulmonary trunk arose from the common arterial trunk and bifurcated to the left and right pulmonary artery, consistent with a Collet and Edwards’ type I common arterial trunk with aortic predominance. Although uncommon, congenital cardiac defects should be considered in animals presenting with clinical signs of hypoxemia, dyspnea, or failure to thrive.

  10. Effect of using different levels of Nigella sativa meal on the growth performance and meat quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    Tayebeh Mousapour

    2014-08-01

    Full Text Available This study was conducted to investigate the effects of dietary Nigella sativa meal (NSM on the growth performance, blood parameters, carcass characteristics, egg yolk cholesterol and meat quality in Japanese quail. For this purpose 300 one-day old Japanese quail chicks in a completely randomized design was used with five treatments in four replicates containing 15 birds each(. The experimental diets were control group (without NSM and diets containing 5, 10, 15 and 20% of NSM. Feed intake of birds fed diets with 5 and 15% of NSM were statistically higher than control group. Weight gain in birds fed with 15% of NSM was significantly higher than control group. Feed conversion ratio of birds fed diets with 20% of NSM was statistically higher than control. No significant treatment effect was observed on egg yolk cholesterol, blood parameters (including triglyceride, HDL and total cholesterol concentrations and meat quality parameters (TBA, WHC, Dripping loss, Cooking loss. And also the use of different levels of NSM had no any significant effect on internal organs weight, except gizzard. NSM significantly decreased feed costs compared to control group. So, by using NSM up to 15% in Japanese quails diets, can improve weight gain and feed conversion ratio and decrease feed and meat production costs.

  11. Immunocytochemical distribution of glial fibrillary acidic protein in the central nervous system of the Japanese quail (Coturnix coturnix japonica).

    Science.gov (United States)

    Cameron-Curry, P; Aste, N; Viglietti-Panzica, C; Panzica, G C

    1991-01-01

    In the present study we detailed the distribution of GFAP-immunopositive structures within the central nervous system of the Japanese quail. Different fixation and embedding procedures were applied. The best results were obtained on frozen cryostatic sections from freshly dissected brains subsequently fixed by a short immersion in cold acetone. Immunopositive structures were observed both with immunofluorescence, and with immunoperoxidase methods. Immunoreactive cell bodies and processes were observed within the whole central nervous system, and different cell types can be identified on the basis of their topographical location and morphology. A first class of astrocytes is composed of intensely stained unipolar cells lining the inner surface of the pia mater and the large blood vessels. A second type is represented by multipolar astrocytes of variable size, provided with an irregular cell body. The last type is represented by similar elements, showing an immunonegative cell body, that can be identified only by the presence of converging processes. These three types of cells, and several isolated processes, show a differential distribution within the quail central nervous system, both in the grey and in the white matter. Present results suggest that GFAP may represent a good marker for at least part of the astroglial population in quail.

  12. The Effect of Different Foam Concentrations on Sperm Motility in Japanese Quail

    Directory of Open Access Journals (Sweden)

    Avishek Biswas

    2010-01-01

    Full Text Available A study was conducted to determine the effect of foam extract on sperm motility in the male Japanese quail (Coturnix coturnix japonica. Adult male quails (<12 weeks of heavy body weight strain were housed in individual cages and divided into 5 groups according to the size of their cloacal glands. The data indicated that the size of the cloacal gland was positively correlated with the frequency of foam secretion and total foam production. One gram of freshly collected clean foam was mixed with 1.0 mL of normal saline and homogenized for 10 minutes. After centrifugation at 35 000 rpm, the supernatant was used as 100% foam extract. The extract was diluted to 1:40, 1:20, 1:10, and 1:4 with normal saline to produce 2.5, 5.0, 10, and 25% foam extracts, respectively. 5% foam extract enhanced sperm survival at room temperature (30°–35°C for 2 to 3 hrs, whereas higher concentrations (10% and above suppressed sperm motility. From this study, it may be concluded that foam secretion and quantity of foam are directly proportional to the size of the cloacal gland and that the foam enhances and prolongs sperm motility, in vitro at an optimum concentration of 5%.

  13. Lead pellet retention time and associated toxicity in northern bobwhite quail (Colinus virginianus).

    Science.gov (United States)

    Kerr, Richard; Holladay, Steven; Jarrett, Timothy; Selcer, Barbara; Meldrum, Blair; Williams, Susan; Tannenbaum, Lawrence; Holladay, Jeremy; Williams, Jamie; Gogal, Robert

    2010-12-01

    Birds are exposed to Pb by oral ingestion of spent Pb shot as grit. A paucity of data exists for retention and clearance of these particles in the bird gastrointestinal tract. In the current study, northern bobwhite quail (Colinus virginianus) were orally gavaged with 1, 5, or 10 Pb shot pellets, of 2-mm diameter, and radiographically followed over time. Blood Pb levels and other measures of toxicity were collected, to correlate with pellet retention. Quail dosed with either 5 or 10 pellets exhibited morbidity between weeks 1 and 2 and were removed from further study. Most of the Pb pellets were absorbed or excreted within 14 d of gavage, independent of dose. Pellet size in the ventriculus decreased over time in radiographs, suggesting dissolution caused by the acidic pH. Birds dosed with one pellet showed mean blood Pb levels that exceeded 1,300 µg/dl at week 1, further supporting dissolution in the gastrointestinal tract. Limited signs of toxicity were seen in the one-pellet birds; however, plasma δ-aminolevulinic acid dehydratase (d-ALAD) activity was persistently depressed, suggesting possible impaired hematological function. © 2010 SETAC.

  14. The influence of artificially increased trunk stiffness on the balance recovery after a trip.

    Science.gov (United States)

    van der Burg, J C E; Pijnappels, M; van Dieën, J H

    2007-07-01

    Falls occur frequently in the growing population of elderly. Since trunk control is critical for maintaining balance, the higher trunk stiffness in elderly people compared to the general population has been associated with their increased fall-risk. Theoretically, trunk stiffness may be beneficial for balance recovery in walking, i.e. after a trip. A stiff joint may provide a torque that restricts the perturbation effects and thereby reduces the probability of a fall. The aim of this study was to test whether trunk stiffness impaired or assisted balance recovery after a trip during walking. An orthopedic corset was used to simulate trunk stiffness in 11 young male adults. Subjects walked over a platform, with or without the corset on, and were occasionally tripped over a hidden obstacle. Kinematics of the tripping reaction were measured. Initial trunk accelerations were significantly attenuated by the corset, which indicates a positive effect of the stiffening corset. However, no subsequent effects on peak trunk inclination and on the peak moment arm of gravity on the trunk were found. The pattern of trunk motion allowed ample time for triggered or voluntary muscle responses to be generated, before a substantial inclination occurred. It appears that such active responses were sufficient in the young subjects tested to obtain a similar net effect with or without the increased trunk stiffness induced by the corset.

  15. The Subfossil Trunk of Chiarano (TV

    Directory of Open Access Journals (Sweden)

    Tiziana Urso

    2017-06-01

    Full Text Available This paper reports the results of the characterization of a subfossil trunk found buried in the mud of the Piavon canal, at Chiarano (TV, when dredging took place in 2008. The trunk, of imposing dimensions, lacking branches and bark, has a black, deeply cracked and strongly deteriorated outer surface with a carbonized appearance, while internally it has the typical blackish colour of the so-called drowned oak. The studies have demonstrated that it is a tree belonging to the genus Quercus, common oak or sessile oak, that may have been felled between the end of the 12 th and early 14 th century A.D.. Determination of the MWC and residual basic density indicate that the deterioration decreases from the outside inwards; the ash content is high externally and diminishes moving toward the centre. Nowadays, the Piavon is an irrigation canal, but in Venetian times it was navigable and was used for the transport of goods and timber. There were extensive woodlands of common oak and sessile oak all along the Piavon, the size and composition of which is documented in the Venetian cadastres, which also report the distances between the woodlands and the nearest water courses, proof of the importance of river transport for the timber. In particular, an 18 hectare oak woodland is recorded in the Surian cadastre (1569-70 for the villa at Chiarano. The oaks were used by the Republic of Venice mainly for the construction and maintenance of the shipping fleet. The Chiarano trunk, given its age and the area where it was found, may therefore be a trunk felled in Venetian times, perhaps destined for naval use, which was lost during its transport by floating.

  16. The role of vitamin E or clay in growing Japanese quail fed diets polluted by cadmium at various levels.

    Science.gov (United States)

    Abou-Kassem, D E; Mahrose, Kh M; Alagawany, M

    2016-03-01

    This study was conducted to verify whether vitamin (Vit) E or natural clay as feed additives has the potential to modulate the deleterious effects resulting from exposure to cadmium (Cd) in growing Japanese quail. 648 Japanese quail chicks (1 week old) were used to evaluate the effects of dietary Cd (0, 40, 80 and 120 mg/kg diet) and two levels of Vit E (0, 250 mg/kg diet) or two levels of natural clay (0 and 100 mg/kg diet) to study the influences of Cd, Vit E, clay or their different combinations on growth performance, carcass traits, some blood biochemical components and Cd residues in muscles and liver. Live BW and weight gain of quails were linearly decreased with increasing dietary Cd levels. Moreover, feed conversion was significantly worsened with increasing Cd level. Mortality percentage was linearly increased as dietary Cd level increased up to 120 mg/kg diet. Carcass percentage was linearly decreased as dietary Cd level increased. While, giblets percentage were linearly and quadratically differed as dietary Cd level increased. Cd caused significant changes in total plasma protein, albumin, globulin, A/G ratio, creatinine, urea-N and uric acid concentrations as well as ALT, AST and ALP activities. Increasing dietary Cd level was associated with its increase in the muscles and liver. Dietary supplementation with 250 mg of Vit E/kg diet or 100 mg clay/kg improved live BW, BW gain and feed conversion when compared with the un-supplemented diet. Quails fed diet contained 250 mg Vit E/kg and those fed 100 mg clay/kg had the highest percentages of carcass and dressing than those fed the un-supplemented diet. Blood plasma biochemical components studied were better when birds received 250 mg of Vit E/kg diet and those received 100 mg clay/kg. Cd residues in the muscles and liver were significantly less in the birds had 250 mg of Vit E/kg or those received 100 mg clay/kg diet than those un-supplemented with Vit E. Growth performance traits and blood plasma

  17. Effect of dietary fat type on the fatty acids composition of irradiated and frozen storage japanese quails meat

    International Nuclear Information System (INIS)

    Abd EI-Wahab, S. A.

    2009-01-01

    The effect of substitution of dietary cotton seed oil (CSO) by used restaurant oil (URO) with different percentages 25% group 2 (G2), 50% group 3 (G3) and 100% group 4 (G4) in Japanese quail diets on the fatty acids composition of their meat especially polyunsaturated fatty acids (PUFA). The effect of gamma irradiation doses (1.5, 3 and 5 kGy) at frozen storage -18 C (degree) for 2 and 4 months in comparison with unirradiated and un storage were studied. The total saturated fatty acids (SFA) in quail meat fed G4 diet (100% URO) increased significantly in comparison with SFA in G2 (25% URO) and G3 (50% URO) but there is no significant effect with G2 and G3 in comparison with G1 (100% CSO).The monounsaturated fatty acids (MUFA) and polyunsaturated fatty acids (PUFA) were not affected by G2 and G3 diet. Also, linoleic acid (C 18:2, n-6) had the same trend in those groups with range (32.75% to 33.35%). It is concluded that feeding a diet with URO 25% and 50% conserve the content of linoleic acid and the content of PUFA in quail meat. The irradiation doses and storage periods had no significant effect on the linoleic acid, MUFA and PUFA content.

  18. Is gastrointestinal plasticity in king quail (Coturnix chinensis) elicited by diet-fibre or diet-energy dilution?

    Science.gov (United States)

    Williamson, Sean A; Jones, Stephanie K Courtney; Munn, Adam J

    2014-06-01

    Phenotypic plasticity of organ size allows some animals to manage fluctuations of resource quality or availability. Here, we examined the phenotypic plasticity of the gastrointestinal tract of king quail (Coturnix chinensis) in a diet-fibre manipulation study. Quail were offered either a control low-fibre (high-quality) food (8.5% neutral-detergent fibre; NDF), or one of two experimental diets of higher fibre contents of 16% NDF (i.e. low-quality food). To examine whether phenotypic plasticity of organ size was associated with the fibre content per se, or as a consequence of diluting the diet energy contents by adding fibre, one of the high-fibre feeds was 'balanced' with additional energy to match that of the low-fibre control diet. Total empty dry mass of the gastrointestinal tract was significantly heavier among birds offered the unbalanced high-fibre diet as compared with those offered the control diet, with birds offered the fibrous but energy-balanced diet having guts of intermediate size. The heavier entire-gut mass (dry) of quail offered the unbalanced high-fibre diet was associated mainly with these birds having significantly heavier gizzards. Notably, the larger gizzard in the birds offered the unbalanced high-fibre diet was associated with marked increases in their metabolisability (digestion) of diet fibre. Our findings suggest that the available energy in the diet may be more important for eliciting phenotypic changes in the gut of these herbivorous birds rather than simple physical effects of diet fibre on feed intakes or on muscular compensation to fibrous ingesta. © 2014. Published by The Company of Biologists Ltd.

  19. Three-dimensional trunk kinematics in golf: between-club differences and relationships to clubhead speed.

    Science.gov (United States)

    Joyce, Christopher; Burnett, Angus; Cochrane, Jodie; Ball, Kevin

    2013-06-01

    The aims of this study were (i) to determine whether significant three-dimensional (3D) trunk kinematic differences existed between a driver and a five-iron during a golf swing; and (ii) to determine the anthropometric, physiological, and trunk kinematic variables associated with clubhead speed. Trunk range of motion and golf swing kinematic data were collected from 15 low-handicap male golfers (handicap = 2.5 +/- 1.9). Data were collected using a 10-camera motion capture system operating at 250 Hz. Data on clubhead speed and ball velocity were collected using a real-time launch monitor. Paired t-tests revealed nine significant (p golf swing kinematics, namely trunk and lower trunk flexion/extension and lower trunk axial rotation. Multiple regression analyses explained 33.7-66.7% of the variance in clubhead speed for the driver and five-iron, respectively, with both trunk and lower trunk variables showing associations with clubhead speed. Future studies should consider the role of the upper limbs and modifiable features of the golf club in developing clubhead speed for the driver in particular.

  20. File list: NoD.Emb.20.AllAg.Embryonic_trunk [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.Emb.20.AllAg.Embryonic_trunk mm9 No description Embryo Embryonic trunk ERX40226...7,ERX402264 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Emb.20.AllAg.Embryonic_trunk.bed ...

  1. Conventional versus frozen elephant trunk surgery for extensive disease of the thoracic aorta.

    Science.gov (United States)

    Di Eusanio, Marco; Borger, Michael; Petridis, Francesco D; Leontyev, Sergey; Pantaleo, Antonio; Moz, Monica; Mohr, Friedrich; Di Bartolomeo, Roberto

    2014-11-01

    To compare early and mid-term outcomes after repair of extensive aneurysm of the thoracic aorta using the conventional elephant trunk or frozen elephant trunk (FET) procedures. Fifty-seven patients with extensive thoracic aneurysmal disease were treated using elephant trunk (n = 36) or FET (n = 21) procedures. Patients with aortic dissection, descending thoracic aorta (DTA) diameter less than 40 mm, and thoracoabdominal aneurysms were excluded from the analysis, as were those who did not undergo antegrade selective cerebral perfusion during circulatory arrest. Short-term and mid-term outcomes were compared according to elephant trunk/FET surgical management. Preoperative and intraoperative variables were similar in the two groups, except for a higher incidence of female sex, coronary artery disease and associated procedures in elephant trunk patients. Hospital mortality (elephant trunk: 13.9% versus FET: 4.8%; P = 0.2), permanent neurologic dysfunction (elephant trunk: 5.7% versus FET: 9.5%; P = 0.4) and paraplegia (elephant trunk: 2.9% versus FET: 4.8%; P = 0.6) rates were similar in the two groups. Follow-up was 100% complete. In the elephant trunk group, 68.4% of patients did not undergo a second-stage procedure during follow-up for a variety of reasons. Of these patients, the DTA diameter was greater than 51 mm in 72.2% and two (6.7%) died due to aortic rupture while awaiting stage-two intervention. Endovascular second-stage procedures were successfully performed in all FET patients with residual DTA aneurysmal disease (n = 3), whereas nine of 11 elephant trunk patients who returned for second-stage procedures required conventional surgical replacement through a lateral thoracotomy. Kaplan-Meier estimate of 4-year survival was 75.8 ± 7.6 and 72.8 ± 10.6 in elephant trunk and FET patients, respectively (log-rank P = 0.8). In patients with extensive aneurysmal disease of thoracic aorta, elephant trunk and FET procedures

  2. Trunk muscle attributes are associated with balance and mobility in older adults: a pilot study.

    Science.gov (United States)

    Suri, Pradeep; Kiely, Dan K; Leveille, Suzanne G; Frontera, Walter R; Bean, Jonathan F

    2009-10-01

    To determine whether trunk muscle attributes are associated with balance and mobility performance among mobility-limited older adults. Cross-sectional analysis of data from a randomized clinical trial. Outpatient rehabilitation research center. Community-dwelling older adults (N = 70; mean age 75.9 years) with mobility limitations as defined by the Short Physical Performance Battery (SPPB). Independent variables included physiologic measures of trunk extension strength, trunk flexion strength, trunk extension endurance, trunk extension endurance, and leg press strength. All measures were well tolerated by the study subjects without the occurrence of any associated injuries or adverse events. The association of each physiologic measure with each outcome was examined by the use of separate multivariate models to calculate the partial variance (R(2)) of each trunk and extremity measure. Balance measured by the Berg Balance Scale and Unipedal Stance Test and mobility performance as measured by the SPPB. Trunk extension endurance (partial R(2) = .14, P = .02), and leg press strength (partial R(2) = .14, P = .003) accounted for the greatest amount of the variance in SPPB performance. Trunk extension endurance (partial R(2) = .17, P = .007), accounted for the greatest amount of the variance in BBS performance. Trunk extension strength (R(2) = .09, P = .03), accounted for the greatest amount of the variance in UST performance. The variance explained by trunk extension endurance equaled or exceeded the variance explained by limb strength across all three performance outcomes. Trunk endurance and strength can be safely measured in mobility-limited older adults and are associated with both balance and mobility performance. Trunk endurance and trunk strength are physiologic attributes worthy of targeting in the rehabilitative care of mobility-limited older adults.

  3. Effect of Hypodynamy on Structure and Alkaline Phosphatase Activity of Kidney in Japanese Quails

    Directory of Open Access Journals (Sweden)

    V. Almášiová

    2008-01-01

    Full Text Available The objective of the study was to observe the effect of experimental hypodynamy simulating weightlessness in space on the structure, ultrastructure and alkaline phosphatase activity of kidney in Japanese quail (Coturnix coturnix japonica. Two days after hatching, the quails were suspended in special shirts below the cage ceiling so their feet did not touch the floor. They could consume food and water ad libitum. Experimental animals were sacrificed after 14, 21, 28, 35, 42, 49 and 56 days of hypodynamy. Birds of the same age, hatched at the same time, and fed the same diet were used as a control. Samples of kidney were processed for light (LM and transmission electron microscopy (TEM, and alkaline phosphatase (AP analysis. Short-term (14–28 days hypodynamy caused no marked damage to the structure and ultrastructure of kidneys. However, after long-term (35–59 days hypodynamy, morphological changes were observed in some cells of the proximal and distal tubules. The dying cells in proximal tubules, observed in semi-thin sections by LM, were dark and contained a nucleus of irregular shape. Observation by TEM showed that their nucleus was dark and shrivelled and the electron-dense cytoplasm contained long, dense, rod-shaped mitochondria with thin mitochondrial cristae. Microvilli were present on the apical surface of cells and formed a brush border. Sporadic dying cells were also observed in distal tubules. Large, light vacuoles were found in the cytoplasm of cells of collecting tubules, however, the structure of renal corpuscles and medullary loops remained undisturbed. Microscopical analysis by means of a direct TUNEL reaction on days 35 to 59 of hypodynamy showed a moderate occurrence of cellular apoptosis in the proximal and distal tubules of experimental Japanese quail. The activity of AP in the brush border of the proximal tubules on days 14–29 of hypodynamy was normal in experimental animals and showed no significant differences in

  4. A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

    Science.gov (United States)

    Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

    2015-01-30

    Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Reorganized trunk muscle activity during multidirectional floor perturbations after experimental low back pain

    DEFF Research Database (Denmark)

    Larsen, Lars Henrik; Hirata, Rogerio Pessoto; Graven-Nielsen, Thomas

    2016-01-01

    Low back pain changes the trunk muscle activity after external perturbations but the relationship between pain intensities and distributions and their effect on the trunk muscle activity remains unclear. The effects of unilateral and bilateral experimental low back pain on trunk muscle activity w...

  6. Evaluation of biochemical parameters and productive performance of japanese quail in response to the replacement of soybean meal with canola meal

    Directory of Open Access Journals (Sweden)

    Ali Asghar Saki

    2017-02-01

    Full Text Available The present study was conducted to evaluation the different levels canola meal (CM replacement by soybean meal (SBM in Japanese quails diets on productive performance, egg quality trails and blood parameters including blood protein, minerals concentration, liver enzymes and thyroid hormones. In this study, 160 of Japanese quails in second laying phase from 46 to 56 weeks of age were divided in four treatments with four replicates and 10 quail in each per replicate, on a completely randomized design (CRD.Treatments consisted:T1 control (without CM, T2, T3 and T4 replacing 30, 60 and 90% of SBM with CM respectively. The results were shown no significant variation in body weight between treatments in initial and end of the experiment (p > 0.05. There was significant decrease in feed intake by increasing level of CM (p 0.05. However, the egg shell thickness showed significantly decreased with increasing levels of canola meal in the diet  (p < 0.05. According to this study results, 30% replacement of SBM by CM in the diet (contained 10% CM has no adverse effect on quail’s performance.

  7. Gemfibrozil disrupts the metabolism of circulating lipids in bobwhite quails.

    Science.gov (United States)

    Bussière-Côté, Sophie; Omlin, Teye; de Càssia Pinheiro, Eliana; Weber, Jean-Michel

    2016-01-01

    The circulating lipids of birds play essential roles for egg production and as an energy source for flight and thermogenesis. How lipid-lowering pharmaceuticals geared to prevent heart disease in humans and that are routinely released in the environment affect their metabolism is unknown. This study assesses the impact of the popular drug gemfibrozil (GEM) on the plasma phospholipids (PL), neutral lipids (NL), and nonesterified fatty acids (NEFA) of bobwhite quails (Colinus virginianus). Results show that bird lipoproteins are rapidly altered by GEM, even at environmentally-relevant doses. After 4 days of exposure, pharmacological amounts cause an 83% increase in circulating PL levels, a major decrease in average lipoprotein size measured as a 56% drop in the NL/PL ratio, and important changes in the fatty acid composition of PL and NEFA (increases in fatty acid unsaturation). The levels of PL carrying all individual fatty acids except arachidonate are strongly stimulated. The large decrease in bird lipoprotein size may reflect the effects seen in humans: lowering of LDL that can cause atherosclerosis and stimulation of HDL that promote cholesterol disposal. Lower (environmental) doses of GEM cause a reduction of %palmitate in all the plasma lipid fractions of quails, but particularly in the core triacylglycerol of lipoproteins (NL). No changes in mRNA levels of bird peroxisome proliferator-activated receptor (PPAR) could be demonstrated. The disrupting effects of GEM on circulating lipids reported here suggest that the pervasive presence of this drug in the environment could jeopardize reproduction and migratory behaviours in wild birds. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  9. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  10. A nonlinear dynamics of trunk kinematics during manual lifting tasks.

    Science.gov (United States)

    Khalaf, Tamer; Karwowski, Waldemar; Sapkota, Nabin

    2015-01-01

    Human responses at work may exhibit nonlinear properties where small changes in the initial task conditions can lead to large changes in system behavior. Therefore, it is important to study such nonlinearity to gain a better understanding of human performance under a variety of physical, perceptual, and cognitive tasks conditions. The main objective of this study was to investigate whether the human trunk kinematics data during a manual lifting task exhibits nonlinear behavior in terms of determinist chaos. Data related to kinematics of the trunk with respect to the pelvis were collected using Industrial Lumbar Motion Monitor (ILMM), and analyzed applying the nonlinear dynamical systems methodology. Nonlinear dynamics quantifiers of Lyapunov exponents and Kaplan-Yorke dimensions were calculated and analyzed under different task conditions. The study showed that human trunk kinematics during manual lifting exhibits chaotic behavior in terms of trunk sagittal angular displacement, velocity and acceleration. The findings support the importance of accounting for nonlinear dynamical properties of biomechanical responses to lifting tasks.

  11. Real chimney technique for total debranching of supra-aortic trunks.

    Science.gov (United States)

    Kato, Masaaki; Kagaya, Hideo; Kubo, Yoji; Banno, Hiroshi; Ohkubo, Nobukazu

    2015-02-01

    Side-clamping of the ascending aorta is an indispensable technique for proximal anastomosis in total debranching of supra-aortic trunks and in endovascular aneurysm repair for arch aneurysm. However, this procedure may lead to the dislodging of multiple plaques and to clamp injury of the ascending aorta. We developed a clampless technique to achieve proximal anastomosis between the ascending aorta and an artificial graft used for total debranching of supra-aortic trunks. We applied this method in six patients with arch aneurysm and a plaque-rich ascending aorta and were able to achieve total debranching of the supra-aortic trunks in all of the patients without side-clamping the ascending aorta and no procedurally related complications. This clampless anastomosis technique ("real chimney technique") in the ascending aorta is a valuable option for total debranching of supra-aortic trunks in the hybrid repair of arch aneurysms. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  12. IMMEDIATE EFFECTS OF DEEP TRUNK MUSCLE TRAINING ON SWIMMING START PERFORMANCE.

    Science.gov (United States)

    Iizuka, Satoshi; Imai, Atsushi; Koizumi, Keisuke; Okuno, Keisuke; Kaneoka, Koji

    2016-12-01

    In recent years, deep trunk muscle training has been adopted in various sports, including swimming. This is performed both in everyday training and as part of the warm-up routine before competitive races. It is suggested that trunk stabilization exercises are effective in preventing injury, and aid in improving performance. However, conclusive evidence of the same is yet to be obtained. The time of start phase of swimming is a factor that can significantly influence competition performance in a swimming race. If trunk stabilization exercises can provide instantaneous trunk stability, it is expected that they will lead to performance improvements in the start phase of swimming. The purpose of this study was to investigate the immediate effect of trunk stabilization exercises on the start phase in swimming. Intervention study. Nine elite male swimmers (mean age 20.2 ± 1.0 years; height 174.4 ± 3.5 cm; weight 68.9 ± 4.1 kg) performed the swimming start movement. The measurement variables studied included flying distance, and the time and velocity of subjects at hands' entry and on reaching five meters. Measurements were taken in trials immediately before and after the trunk stabilization exercises. A comparison between pre- and post-exercise measurements was assessed. The time to reach five meters (T 5m ) decreased significantly after trunk stabilization exercises, by 0.019 s (p = 0.02). Velocity at entry (V entry ) did not demonstrate significant change, while velocity at five meters (V 5m ) increased significantly after the exercises (p = 0.023). In addition, the speed reduction rate calculated from V entry and V 5m significantly decreased by 5.17% after the intervention (p = 0.036). Trunk stabilization exercises may help reduce the time from start to five meters in the start phase in swimming. The results support the hypothesis that these exercises may improve swimming performance. Level 3b.

  13. Physiological and Biochemical Responses in Japanese Quail (Coturnix coturnix japonica) Fed Radiation Processed Aflatoxin-Contaminated Diet

    International Nuclear Information System (INIS)

    El-Niely, H.F.G.; Abdalla, E.A.; Abd El-Azeem, A.F.

    2008-01-01

    Aflatoxins (AFs) contamination of foods and live-stock feeds is an ongoing problem. In this research, the amelioration of aflatoxicosis in Japanese quails was examined by the radiation processing of their contaminated-diets, as a physical detoxifying method. Diets contaminated with two different levels of AFB 1 (2 or 5 mg kg -1 diet) were subjected to 10, 20, or 30 kGy and fed to growing Japanese quails for 5 weeks. The physiological and biochemical responses were evaluated for irradiation ability to reduce the deleterious effects of 2 and 5 mg AFB 1 kg -1 diet. A total of 270 seven-day-old Japanese quail chicks were assigned to 2 factorial arrangements of nine treatments (level of toxin and radiation dose) each consisted of three replicates with 10 quails per pen. The significant adverse effect of AFB 1 on the food consumption, body-weight gain, food conversion ratio, mortality rate and internal organ weights, from the first week onwards, were determined. Radiation processing reduced concentration of AFB 1 in all experimental diets and significantly reduced the deleterious effects of AFB 1 on food consumption, body-weight gain, food conversion ratio, and the relative weights of most observed organs, as a function of radiation dose. Muscles, liver, kidneys and heart tissues were analyzed for aflatoxin (AF) residues. The residual level of AFB 1 was significantly higher in liver than in kidneys, muscles or heart. The level in the observed organs and the muscles was lower in those received irradiated diet at high 30 kGy. Plasma samples were tested for glucose, triglyceride, cholesterol, aspartate transaminase (AST), alanine transaminase (ALT), alkaline phosphatase (ALP), urea and creatinine. They were significantly increased in AF treated groups in comparison with those received AF-containing diet and irradiated up to 30 kGy. Birds ate contaminated diet with both level of toxin were suffered from the lower level of total proteins, albumin, globulin, phosphorus and

  14. Effect of probiotic supplementation on organic feed to alternative antibiotic growth promoter on production performance and economics analysis of quail.

    Science.gov (United States)

    Lokapirnasari, W P; Dewi, A R; Fathinah, A; Hidanah, S; Harijani, N; Soeharsono; Karimah, B; Andriani, A D

    2017-12-01

    The purpose of this study was to know the production performance and economic analysis in quail which use probiotic supplementation to alternate antibiotic growth promoter (AGP) to feed consumption, water consumption, egg production, egg mass, feed conversion, and feed efficiency. About 240 quails ( Coturnix coturnix japonica) at 14 weeks of age were completely randomized into four treatments, each treatment consisted of six replications and each replication consisted by 10 heads. The treatment was T0 (organic feed without AGP and without probiotic), T1 (organic feed + 0.001% AGP), T2 (organic feed + 0.005% probiotic in feed), and T3 (organic feed + 0.005% probiotic in drinking water). The probiotic consist of 1.2×10 5 CFU/g of Lactobacillus casei and Lactobacillus rhamnosus . The results showed that the probiotic supplementation both in feed and water give a significant impact to feed consumption, water intake, feed conversion, feed efficiency, and quail day production, but no statistical difference of egg mass. The T3 also show the most profitable business analysis, which has the best result in income, profit, break-even point, return cost ratio, benefit-cost ratio, and return on investment. It can be concluded that giving 0.005% probiotic in drinking water to get the best egg production and profit.

  15. Hip and trunk muscles activity during nordic hamstring exercise

    Science.gov (United States)

    Narouei, Shideh; Imai, Atsushi; Akuzawa, Hiroshi; Hasebe, Kiyotaka; Kaneoka, Koji

    2018-01-01

    The nordic hamstring exercise (NHE) is a dynamic lengthening hamstring exercise that requires trunk and hip muscles activation. Thigh muscles activation, specifically hamstring/quadriceps contractions has been previously examined during NHE. Trunk and hip muscles activity have not been enough studied. The aim of this study was to analyze of hip and trunk muscles activity during NHE. Surface electromyography (EMG) and kinematic data were collected during NHE. Ten healthy men with the age range of 21–36 years performed two sets of two repetitions with downward and upward motions each of NHE. EMG activity of fifteen trunk and hip muscles and knee kinematic data were collected. Muscle activity levels were calculated through repeated measure analysis of variance in downward and upward motions, through Paired t-test between downward and upward motions and gluteus maximus to erector spine activity ratio (Gmax/ES ratio) using Pearson correlation analyses were evaluated. Semitendinosus and biceps femoris muscles activity levels were the greatest in both motions and back extensors and internal oblique muscles activity were greater than other muscles (Phamstrings contractions. It could be important for early assessment of subjects with hamstring injury risk. PMID:29740557

  16. Hip and trunk muscles activity during nordic hamstring exercise.

    Science.gov (United States)

    Narouei, Shideh; Imai, Atsushi; Akuzawa, Hiroshi; Hasebe, Kiyotaka; Kaneoka, Koji

    2018-04-01

    The nordic hamstring exercise (NHE) is a dynamic lengthening hamstring exercise that requires trunk and hip muscles activation. Thigh muscles activation, specifically hamstring/quadriceps contractions has been previously examined during NHE. Trunk and hip muscles activity have not been enough studied. The aim of this study was to analyze of hip and trunk muscles activity during NHE. Surface electromyography (EMG) and kinematic data were collected during NHE. Ten healthy men with the age range of 21-36 years performed two sets of two repetitions with downward and upward motions each of NHE. EMG activity of fifteen trunk and hip muscles and knee kinematic data were collected. Muscle activity levels were calculated through repeated measure analysis of variance in downward and upward motions, through Paired t -test between downward and upward motions and gluteus maximus to erector spine activity ratio (Gmax/ES ratio) using Pearson correlation analyses were evaluated. Semitendinosus and biceps femoris muscles activity levels were the greatest in both motions and back extensors and internal oblique muscles activity were greater than other muscles ( P hamstrings contractions. It could be important for early assessment of subjects with hamstring injury risk.

  17. Genetic analyses of partial egg production in Japanese quail using multi-trait random regression models.

    Science.gov (United States)

    Karami, K; Zerehdaran, S; Barzanooni, B; Lotfi, E

    2017-12-01

    1. The aim of the present study was to estimate genetic parameters for average egg weight (EW) and egg number (EN) at different ages in Japanese quail using multi-trait random regression (MTRR) models. 2. A total of 8534 records from 900 quail, hatched between 2014 and 2015, were used in the study. Average weekly egg weights and egg numbers were measured from second until sixth week of egg production. 3. Nine random regression models were compared to identify the best order of the Legendre polynomials (LP). The most optimal model was identified by the Bayesian Information Criterion. A model with second order of LP for fixed effects, second order of LP for additive genetic effects and third order of LP for permanent environmental effects (MTRR23) was found to be the best. 4. According to the MTRR23 model, direct heritability for EW increased from 0.26 in the second week to 0.53 in the sixth week of egg production, whereas the ratio of permanent environment to phenotypic variance decreased from 0.48 to 0.1. Direct heritability for EN was low, whereas the ratio of permanent environment to phenotypic variance decreased from 0.57 to 0.15 during the production period. 5. For each trait, estimated genetic correlations among weeks of egg production were high (from 0.85 to 0.98). Genetic correlations between EW and EN were low and negative for the first two weeks, but they were low and positive for the rest of the egg production period. 6. In conclusion, random regression models can be used effectively for analysing egg production traits in Japanese quail. Response to selection for increased egg weight would be higher at older ages because of its higher heritability and such a breeding program would have no negative genetic impact on egg production.

  18. Finding the neck-trunk boundary in snakes: anteroposterior dissociation of myological characteristics in snakes and its implications for their neck and trunk body regionalization.

    Science.gov (United States)

    Tsuihiji, Takanobu; Kearney, Maureen; Rieppel, Olivier

    2012-09-01

    The neck and trunk regionalization of the presacral musculoskeletal system in snakes and other limb-reduced squamates was assessed based on observations on craniovertebral and body wall muscles. It was confirmed that myological features characterizing the neck in quadrupedal squamates (i.e., squamates with well-developed limbs) are retained in all examined snakes, contradicting the complete lack of the neck in snakes hypothesized in previous studies. However, the posterior-most origins of the craniovertebral muscles and the anterior-most bony attachments of the body wall muscles that are located at around the neck-trunk boundary in quadrupedal squamates were found to be dissociated anteroposteriorly in snakes. Together with results of a recent study that the anterior expression boundaries of Hox genes coinciding with the neck-trunk boundary in quadrupedal amniotes were dissociated anteroposteriorly in a colubrid snake, these observations support the hypothesis that structures usually associated with the neck-trunk boundary in quadrupedal squamates are displaced relative to one another in snakes. Whereas certain craniovertebral muscles are elongated in some snakes, results of optimization on an ophidian cladogram show that the most recent common ancestor of extant snakes would have had the longest craniovertebral muscle, M. rectus capitis anterior, that is elongated only by several segments compared with that of quadrupedal squamates. Therefore, even such a posteriorly displaced "cervical" characteristic plesiomorphically lies fairly anteriorly in the greatly elongated precloacal region of snakes, suggesting that the trunk, not the neck, would have contributed most to the elongation of the snake precloacal region. A similar dissociation of structures usually associated with the neck-trunk boundary in quadrupedal squamates is observed in limb-reduced squamates, suggesting that these forms and snakes may share a developmental mechanism producing modifications in the

  19. Divergent selection for shape of growth curve in Japanese quail. 4. Carcase composition and thyroid hormones

    Czech Academy of Sciences Publication Activity Database

    Hyánková, L.; Novotná, Božena; Darras, V.M.

    2008-01-01

    Roč. 49, č. 2 (2008). s. 96-102 ISSN 0007-1668 R&D Projects: GA ČR GA523/99/1262 Institutional research plan: CEZ:AV0Z50390512 Keywords : Japanese quail * Growth phases * Carcase quality Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.134, year: 2008

  20. Bioaccessibility tests accurately estimate bioavailability of lead to quail

    Science.gov (United States)

    Beyer, W. Nelson; Basta, Nicholas T; Chaney, Rufus L.; Henry, Paula F.; Mosby, David; Rattner, Barnett A.; Scheckel, Kirk G.; Sprague, Dan; Weber, John

    2016-01-01

    Hazards of soil-borne Pb to wild birds may be more accurately quantified if the bioavailability of that Pb is known. To better understand the bioavailability of Pb to birds, we measured blood Pb concentrations in Japanese quail (Coturnix japonica) fed diets containing Pb-contaminated soils. Relative bioavailabilities were expressed by comparison with blood Pb concentrations in quail fed a Pb acetate reference diet. Diets containing soil from five Pb-contaminated Superfund sites had relative bioavailabilities from 33%-63%, with a mean of about 50%. Treatment of two of the soils with phosphorus significantly reduced the bioavailability of Pb. Bioaccessibility of Pb in the test soils was then measured in six in vitro tests and regressed on bioavailability. They were: the “Relative Bioavailability Leaching Procedure” (RBALP) at pH 1.5, the same test conducted at pH 2.5, the “Ohio State University In vitro Gastrointestinal” method (OSU IVG), the “Urban Soil Bioaccessible Lead Test”, the modified “Physiologically Based Extraction Test” and the “Waterfowl Physiologically Based Extraction Test.” All regressions had positive slopes. Based on criteria of slope and coefficient of determination, the RBALP pH 2.5 and OSU IVG tests performed very well. Speciation by X-ray absorption spectroscopy demonstrated that, on average, most of the Pb in the sampled soils was sorbed to minerals (30%), bound to organic matter (24%), or present as Pb sulfate (18%). Additional Pb was associated with P (chloropyromorphite, hydroxypyromorphite and tertiary Pb phosphate), and with Pb carbonates, leadhillite (a lead sulfate carbonate hydroxide), and Pb sulfide. The formation of chloropyromorphite reduced the bioavailability of Pb and the amendment of Pb-contaminated soils with P may be a thermodynamically favored means to sequester Pb.

  1. Nutritional requirements of digestible methionine + cystine for Japanese quails in production phase Exigência nutricional de metionina + cistina digestível para codornas japonesas na fase de postura

    Directory of Open Access Journals (Sweden)

    Fernando Guilherme Perazzo Costa

    2009-12-01

    Full Text Available This experiment was carried with Japanese quails in the egg production phase with the objective of determining the requirements of digestible methionine + cystine (M+C for higher production and egg quality. A total of 240 Japanese quails were distributed in a randomized complete block design. The basal diet was supplemented with different DL-methionine levels, corresponding to digestible methionine + cystine levels of 0.55, 0.61, 0.67, 0.73 and 0.79%. The characteristics analyzed were feed intake (g/quail/day, egg production (%, egg weight (g, egg mass (g/quail/day, feed conversion (dozen eggs/egg mass and kg feed/dozen eggs, egg shell (% and g, albumen (% and g, yolk (% and g and specific gravity (g/cm³. The digestible M+C level for Japanese quails was 0.696% in the diet, corresponding to a daily intake of 186.7 mg/quail.Um experimento com codornas japonesas na fase de produção de ovos foi desenvolvido com o objetivo de determinar a exigência de metionina + cistina digestível para maior produção e melhor qualidade dos ovos. Foram utilizadas 240 aves distribuídas em delineamento em blocos inteiramente casualizados, alimentadas com uma ração basal suplementada com DL metionina, de forma a se obterem 0,55; 0,61; 0,67; 0,73 e 0,79% de metionina + cistina digestível. As características de desempenho analisadas foram consumo de ração (g/ave/dia, produção de ovos (%, peso (g e massa de ovo (g/ave/dia, conversão alimentar (g de ração/g de ovos e kg de ração/dúzia de ovos, casca de ovo (% e g, albúmen (% e g, gema (% e g e gravidade específica (g/cm³. O nível de metionina + cistina digestível para codornas japonesas é de 0,696%, que corresponde a consumo diário de 186,7 mg/ave.

  2. Dietary Supplementation of Chromium Can Alleviate Negative Impacts of Heat Stress on Performance, Carcass Yield, and Some Blood Hematology and Chemistry Indices of Growing Japanese Quail.

    Science.gov (United States)

    El-Kholy, Mohamed Soliman; El-Hindawy, Mohamed Mohamed; Alagawany, Mahmoud; Abd El-Hack, Mohamed Ezzat; El-Sayed, Sabry Abd El-Gawad Abd El-Halim

    2017-09-01

    The main objective of this work was to investigate the impact of dietary chromium supplementation on growth indices, carcass yield, and some hematological and biochemical blood parameters of growing Japanese quails subjected to heat stress. A total of 360 unsexed 2-week-old Japanese quail chicks were used in a 2 × 3 factorial arrangement that had two ambient temperatures (23 ± 2 and 33 ± 2 °C) and three dietary chromium (0.00, 500, and 1000 μg Cr/kg diet as chromium picolinate). For induction of heat stress, the room temperature was set at 33 ± 2 °C from 2 to 6 weeks of age. Results showed that body weight, body weight gain, and feed intake were decreased for birds subjected to heat stress condition during 2 to 4 and 2 to 6 weeks of age. Feed conversion was not significantly (P > 0.05) affected by high ambient temperature throughout the experiment. Carcass, dressing, liver, and heart percentages were not influenced by the ambient temperature or dietary chromium or their combinations. Significant temperature × chromium combinations were observed for hemoglobin value (P = 0.025) and packed cell volume (P = 0.001). Cholesterol and glucose in plasma were increased (P = 0.004 or 0.022) in quails subjected to heat stress condition. Plasma measurements of total proteins, albumin, globulin, lipids, glucose, and A/G ratio of quail chicks were not influenced (P > 0.05) by chromium, while cholesterol was increased with increasing chromium level (P = 0.033). High ambient temperature or dietary chromium levels or their interactions did not (P > 0.05) affect plasma levels of aspartate transaminase (AST), alanine transaminase (ALT), triiodothyronine (T3), thyroxin (T4), or T3/T4 ratio of growing quails. From these observations, it can be concluded that dietary chromium supplementation of growing Japanese quail subjected to heat stress condition could beneficially affect growth performance and carcasses, as well as modulate the hematological

  3. Quail egg safety and trade on beaches of Salvador (BA: a study from a child labor perspective

    Directory of Open Access Journals (Sweden)

    Permínio Oliveira Vidal Júnior

    2013-08-01

    Full Text Available OBJECTIVE: This study aimed to describe the trade and microbiological quality of boiled quail eggs on the waterfront of Salvador , Bahia, Brazil, from the child labor perspective. METHODS: This cross-sectional study administered semi-structured questionnaires to 40 underage vendors and performed the microbiological assessment of 40 quail egg samples as follows: mesophilic aerobic microorganism count, coagulase-positive staphylococcus count, estimation of the most probable number of total and thermotolerant coliforms/Escherichia coli, and testing for Salmonella spp.. The results were compared with the standards provided by the Resolution RDC nº 12/2001, National Sanitary Surveillance Agency. RESULTS: The vendors were mostly female (57.5% students (95.0% aged 8 to 17 years. The most common reason for working was supplementation of the family income (57.5%. The mean gross income was R$38.31/day. Most of them presented inadequate personal hygiene but they recognized that foods could cause diseases. Many (47.5% vendors reported washing their hands up to twice daily. Mean mesophilic aerobic microorganism and coagulase-positive staphylococcus counts were 2.43 and 2.01 log colony-forming unit/g, respectively, and the estimated thermotolerant coliform contamination was 0.98 log most probable number/g. Escherichia coli was found in 15.0% of the samples and none contained Salmonella spp. Most (55.0% samples were noncompliant with the legislation. CONCLUSION: The results evidenced the presence of minors selling quail eggs on beaches of Salvador and suggest risk to consumers' health because of the detected contamination and vendors' ignorance of principles of hygiene.

  4. Grounded running in quails: simulations indicate benefits of observed fixed aperture angle between legs before touch-down.

    Science.gov (United States)

    Andrada, Emanuel; Rode, Christian; Blickhan, Reinhard

    2013-10-21

    Many birds use grounded running (running without aerial phases) in a wide range of speeds. Contrary to walking and running, numerical investigations of this gait based on the BSLIP (bipedal spring loaded inverted pendulum) template are rare. To obtain template related parameters of quails (e.g. leg stiffness) we used x-ray cinematography combined with ground reaction force measurements of quail grounded running. Interestingly, with speed the quails did not adjust the swing leg's angle of attack with respect to the ground but adapted the angle between legs (which we termed aperture angle), and fixed it about 30ms before touchdown. In simulations with the BSLIP we compared this swing leg alignment policy with the fixed angle of attack with respect to the ground typically used in the literature. We found symmetric periodic grounded running in a simply connected subset comprising one third of the investigated parameter space. The fixed aperture angle strategy revealed improved local stability and surprising tolerance with respect to large perturbations. Starting with the periodic solutions, after step-down step-up or step-up step-down perturbations of 10% leg rest length, in the vast majority of cases the bipedal SLIP could accomplish at least 50 steps to fall. The fixed angle of attack strategy was not feasible. We propose that, in small animals in particular, grounded running may be a common gait that allows highly compliant systems to exploit energy storage without the necessity of quick changes in the locomotor program when facing perturbations. © 2013 Elsevier Ltd. All rights reserved.

  5. Muscle function and fatigability of trunk flexors in males and females.

    Science.gov (United States)

    Deering, Rita E; Senefeld, Jonathon W; Pashibin, Tatyana; Neumann, Donald A; Hunter, Sandra K

    2017-01-01

    Optimal function of the abdominal muscles is necessary for several life functions including lifting and carrying tasks. Sex differences in strength and fatigability are established for many limb muscles and back extensor muscles, but it is unknown if sex differences exist for the abdominal muscles despite their functional importance. Eighteen females (24.3 ± 4.8 years) and 15 males (24.1 ± 6.6 years) performed (1) isometric trunk flexion maximal voluntary contractions (MVCs) in a range of trunk positions to establish a torque-angle curve and (2) submaximal (50% MVC), intermittent isometric contraction (6 s on, 4 s off) until task failure to determine fatigability of the trunk flexor muscles. Dual X-ray absorptiometry quantified body fat and lean mass. Physical activity levels were quantified with a questionnaire. Torque-angle curves, electromyography (EMG), MVC torque, and torque steadiness were compared with repeated measures ANOVA with sex as a between-subjects factor. For the torque-angle curve, MVC torque was reduced as the trunk angle increased toward flexion ( p    0.05). Time-to-task failure for the submaximal fatigability task in upright sitting was similar between males and females (12.4 ± 7 vs 10.5 ± 6 min). Time-to-task failure was positively associated with strength ( r  = 0.473, p  = 0.005) and self-reported physical activity ( r  = 0.456, p  = 0.030). Lean mass in the trunk was positively associated with trunk flexor strength ( r  = 0.378, p  = 0.011) and self-reported physical activity ( r  = 0.486, p  = 0.007). Finally, torque steadiness [coefficient of variation of torque (CV)] during submaximal isometric contractions decreased with contraction intensity and was similar for males and females across all intensities. Unlike many limb muscle groups, males and females had similar fatigability and torque steadiness of the trunk flexor muscles during isometric contractions. Stronger individuals

  6. Effect of immobilized lipase supplementation of diets on the performance of the Japanese quails

    International Nuclear Information System (INIS)

    Abu-Taleb, A.M.; Ezzat, I.E.; Saleh, M.

    2004-01-01

    In the present study, lipase was immobilized onto two different supports, agarose and gelatin. Some physico-chemical properties of the free and immobilized lipase such as optimum temperature, optimum ph and storage stability were studied. Storage of the enzymes for 2 months showed that the free enzyme lost its activity, while the immobilized on the gelatin showed better resistance towards ph and temperature variations than that immobilized onto agarose. Four experiments were conducted to test the effect of the immobilized lipase supplementation on the productive performance of the Japanese quails. During the first 3 weeks, the addition of lipase to poultry diets caused an increase in the body weight gain of birds than the enzyme-free diet. An obvious improvement in quail day egg production during the laying period was observed with the groups fed on a diet supplemented with 3000 and 2000 I U of immobilized lipase per kilogram feed. Blood cholesterol was not affected with lipase addition, while total lipids were significantly increased. Significant reduction was also observed in thyroid hormones (T 3 and T 4 ) as compared with the control group

  7. Evaluation of a quail embryo model for the detection of botulinum toxin type A activity

    Science.gov (United States)

    The quail embryo was evaluated for use as a bioassay to detect biologically active botulinum toxin serotype A (BoNT/A). Day 15 of incubation embryos were injected with decreasing dosages of BoNT/A from 250 to 0.5 ng of toxin. At 1 day post-injection, embryos receiving 20 ng of BoNT or higher had m...

  8. Influence of a mobile robot on the spatial behaviour of quail chicks

    Energy Technology Data Exchange (ETDEWEB)

    De Margerie, E; Lumineau, S; Houdelier, C; Richard Yris, M-A, E-mail: emmanuel.demargerie@univ-rennes1.fr [CNRS UMR 6552 Ethologie Animale et Humaine, Universite Rennes 1, Rennes (France)

    2011-09-15

    Quail chicks encountered an autonomous mobile robot during their early development. The robot incorporated a heat source that stimulated following of chicks. The spatial behaviour of grown-up chicks was tested in an exploration test and a detour test. Chicks that grew with the mobile robot exhibited better spatial abilities than chicks grown with a static heat source. We discuss these results in the perspective of animal-robot interaction and of the role of early spatial experience on the behavioural development. (communication)

  9. Influence of a mobile robot on the spatial behaviour of quail chicks

    International Nuclear Information System (INIS)

    De Margerie, E; Lumineau, S; Houdelier, C; Richard Yris, M-A

    2011-01-01

    Quail chicks encountered an autonomous mobile robot during their early development. The robot incorporated a heat source that stimulated following of chicks. The spatial behaviour of grown-up chicks was tested in an exploration test and a detour test. Chicks that grew with the mobile robot exhibited better spatial abilities than chicks grown with a static heat source. We discuss these results in the perspective of animal-robot interaction and of the role of early spatial experience on the behavioural development. (communication)

  10. Identification of New World Quails Susceptible to Infection with Avian Leukosis Virus Subgroup J

    Czech Academy of Sciences Publication Activity Database

    Plachý, Jiří; Reinišová, Markéta; Kučerová, Dana; Šenigl, Filip; Stepanets, Volodymyr; Hron, Tomáš; Trejbalová, Kateřina; Elleder, Daniel; Hejnar, Jiří

    2017-01-01

    Roč. 91, č. 3 (2017), č. článku e02002. ISSN 0022-538X R&D Projects: GA ČR GA13-30983S; GA MŠk LO1419 Institutional support: RVO:68378050 Keywords : ALV-J * antiretroviral resistance * Na+/H+ exchanger * New World quail * retroviral receptor Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Virology Impact factor: 4.663, year: 2016

  11. Trunk muscle recruitment patterns in simulated precrash events.

    Science.gov (United States)

    Ólafsdóttir, Jóna Marín; Fice, Jason B; Mang, Daniel W H; Brolin, Karin; Davidsson, Johan; Blouin, Jean-Sébastien; Siegmund, Gunter P

    2018-02-28

    To quantify trunk muscle activation levels during whole body accelerations that simulate precrash events in multiple directions and to identify recruitment patterns for the development of active human body models. Four subjects (1 female, 3 males) were accelerated at 0.55 g (net Δv = 4.0 m/s) in 8 directions while seated on a sled-mounted car seat to simulate a precrash pulse. Electromyographic (EMG) activity in 4 trunk muscles was measured using wire electrodes inserted into the left rectus abdominis, internal oblique, iliocostalis, and multifidus muscles at the L2-L3 level. Muscle activity evoked by the perturbations was normalized by each muscle's isometric maximum voluntary contraction (MVC) activity. Spatial tuning curves were plotted at 150, 300, and 600 ms after acceleration onset. EMG activity remained below 40% MVC for the three time points for most directions. At the 150- and 300 ms time points, the highest EMG amplitudes were observed during perturbations to the left (-90°) and left rearward (-135°). EMG activity diminished by 600 ms for the anterior muscles, but not for the posterior muscles. These preliminary results suggest that trunk muscle activity may be directionally tuned at the acceleration level tested here. Although data from more subjects are needed, these preliminary data support the development of modeled trunk muscle recruitment strategies in active human body models that predict occupant responses in precrash scenarios.

  12. Anatomical variability of the trunk wood and root tissues of ...

    African Journals Online (AJOL)

    The aim of this study was to investigate the anatomical structure of the trunk wood and the roots of A. nitida and R. racemosa, two mangrove trees from Gabon. The anatomical differences between the trunks and the roots were used to understand their bio-remediating differences through heavy metals. It was found that the ...

  13. GC-MS ANALYSIS OF THE FATTY ACID METHYL ESTER IN JAPANESE QUAIL FAT

    Directory of Open Access Journals (Sweden)

    Ion Dragalin

    2015-12-01

    Full Text Available The accumulated as production waste fat from Faraon quail breeds has been investigated for the first time by using GC-MS technique, preventively converting it via methanolysis to fatty acid methyl esters. The test results, regarding the content of unsaturated fatty acids having a favorable to human body cis-configuration (77.8%, confirm their nutritional value and the possibility of using this fat in cosmetic, pharmaceutical and food industries.

  14. The influence of artificially increased trunk stiffness on the balance recovery after a trip

    NARCIS (Netherlands)

    van der Burg, J.C.E.; Pijnappels, M.A.G.M.; van Dieen, J.H.

    2007-01-01

    Falls occur frequently in the growing population of elderly. Since trunk control is critical for maintaining balance, the higher trunk stiffness in elderly people compared to the general population has been associated with their increased fall-risk. Theoretically, trunk stiffness may be beneficial

  15. Studies on oil palm trunks as sources of infection in the field.

    Science.gov (United States)

    Flood, J; Keenan, L; Wayne, S; Hasan, Y

    2005-01-01

    Diseases of oil palm caused by Ganoderma boninense are of major economic importance in much of South-East Asia. This paper describes results from an ongoing field trial concerning the spread of the pathogen from artificially inoculated trunks used to simulate spread from windrowed trunks. Three planting distances for bait seedlings revealed that the closer the seedling was planted to the source of inoculum the sooner it succumbed to the disease. However, infection only occurred when the trunks were mounded (covered with soil), and seedlings planted around uncovered trunks (at any distance) have showed no symptoms of disease to date. Isolates are being collected from infected plants and molecular analysis is being undertaken to give more information on the spread of the pathogen.

  16. Diagnosis of celiac trunk compression stenosis in ischemic gastric and duodenal ulcer

    International Nuclear Information System (INIS)

    Potashov, L.V.; Morozov, V.P.; Chekhuta, S.M.; Rodionov, K.K.

    1986-01-01

    Chronic gastric and duodenal ulcers may result from ischemia determined by celiac trunk compression stenosis (CTCS). In such cases angiography is necessary to specify diagnosis, to bring to light the causes of ulceration and to define therapeutic tactics. An analysis of angiograms of 75 patients with gastric and duodenal mucosa ulcers in CTCS and its characteristics have presented. The opening and proximal part of the celiac trunk are more frequently subjected to compression. The length of a narrow part of the celiac trunk is on an average of 6.62±0.31 mm. Enlargement in the diameter of the gastroduodenal artery was noted. Simultaneous narrowing of the celaic trunk and the upper mesenteric artery was found in 18 patients

  17. Validation of the DLW method in Japanese quail at different water fluxes using laser and IRMS

    NARCIS (Netherlands)

    van Trigt, R; Kerstel, E.R.T.; Neubert, R.E.M.; Meijer, H.A.J.; Mclean, M.; Visser, G.H.

    2002-01-01

    In Japanese quail (Coturnix c. japonica; n = 9), the doubly labeled water (DLW) method (H-2, O-18) for estimation Of CO2 production (1/day) was validated. To evaluate its sensitivity to water efflux levels (r(H2Oe); g/day) and to assumptions of fractional evaporative water loss (x; dimensionless),

  18. Comparison of learning ability and memory retention in altricial (Bengalese finch, Lonchura striata var. domestica) and precocial (blue-breasted quail, Coturnix chinensis) birds using a color discrimination task.

    Science.gov (United States)

    Ueno, Aki; Suzuki, Kaoru

    2014-02-01

    The present study sought to assess the potential application of avian models with different developmental modes to studies on cognition and neuroscience. Six altricial Bengalese finches (Lonchura striata var. domestica), and eight precocial blue-breasted quails (Coturnix chinensis) were presented with color discrimination tasks to compare their respective faculties for learning and memory retention within the context of the two developmental modes. Tasks consisted of presenting birds with discriminative cues in the form of colored feeder lids, and birds were considered to have learned a task when 80% of their attempts at selecting the correctly colored lid in two consecutive blocks of 10 trials were successful. All of the finches successfully performed the required experimental tasks, whereas only half of the quails were able to execute the same tasks. In the learning test, finches required significantly fewer trials than quails to learn the task (finches: 13.5 ± 9.14 trials, quails: 45.8 ± 4.35 trials, P memory retention tests, which were conducted 45 days after the learning test, finches retained the ability to discriminate between colors correctly (95.0 ± 4.47%), whereas quails did not retain any memory of the experimental procedure and so could not be tested. These results suggested that altricial and precocial birds both possess the faculty for learning and retaining discrimination-type tasks, but that altricial birds perform better than precocial birds in both faculties. The present findings imply that developmental mode is an important consideration for assessing the suitability of bird species for particular experiments. © 2013 Japanese Society of Animal Science.

  19. Dynamic trunk stabilization: a conceptual back injury prevention program for volleyball athletes.

    Science.gov (United States)

    Smith, Chad E; Nyland, John; Caudill, Paul; Brosky, Joseph; Caborn, David N M

    2008-11-01

    The sport of volleyball creates considerable dynamic trunk stability demands. Back injury occurs all too frequently in volleyball, particularly among female athletes. The purpose of this clinical commentary is to review functional anatomy, muscle coactivation strategies, assessment of trunk muscle performance, and the characteristics of effective exercises for the trunk or core. From this information, a conceptual progressive 3-phase volleyball-specific training program is presented to improve dynamic trunk stability and to potentially reduce the incidence of back injury among volleyball athletes. Phase 1 addresses low-velocity motor control, kinesthetic awareness, and endurance, with the clinician providing cues to teach achievement of biomechanically neutral spine alignment. Phase 2 focuses on progressively higher velocity dynamic multiplanar endurance, coordination, and strength-power challenges integrating upper and lower extremity movements, while maintaining neutral spine alignment. Phase 3 integrates volleyball-specific skill simulations by breaking down composite movement patterns into their component parts, with differing dynamic trunk stability requirements, while maintaining neutral spine alignment. Prospective research is needed to validate the efficacy of this program.

  20. Screen time viewing behaviors and isometric trunk muscle strength in youth

    DEFF Research Database (Denmark)

    Grøntved, Anders; Ried-Larsen, Mathias; Froberg, Karsten

    2013-01-01

    The objective of this study was to examine the association of screen time viewing behavior with isometric trunk muscle strength in youth.......The objective of this study was to examine the association of screen time viewing behavior with isometric trunk muscle strength in youth....

  1. Neocosmospora perseae sp. nov., causing trunk cankers on avocado in Italy

    NARCIS (Netherlands)

    Guarnaccia, Vladimiro; Sandoval-Denis, Marcelo; Aiello, Dalia; Polizzi, Giancarlo; Crous, P.W.

    2018-01-01

    Trunk and branch cankers are among the most important diseases compromising avocado production worldwide. A novel species, Neocosmospora perseae sp. nov. is described isolated from trunk lesions on Persea americana in the main avocado producing area of Sicily, Italy. The new species is characterised

  2. Trunk muscle activation in a person with clinically complete thoracic spinal cord injury.

    Science.gov (United States)

    Bjerkefors, Anna; Carpenter, Mark G; Cresswell, Andrew G; Thorstensson, Alf

    2009-04-01

    The aim of this study was to assess if, and how, upper body muscles are activated in a person with high thoracic spinal cord injury, clinically classified as complete, during maximal voluntary contractions and in response to balance perturbations. Data from one person with spinal cord injury (T3 level) and one able-bodied person were recorded with electromyography from 4 abdominal muscles using indwelling fine-wire electrodes and from erector spinae and 3 upper trunk muscles with surface electrodes. Balance perturbations were carried out as forward or backward support surface translations. The person with spinal cord injury was able to activate all trunk muscles, even those below the injury level, both in voluntary efforts and in reaction to balance perturbations. Trunk movements were qualitatively similar in both participants, but the pattern and timing of muscle responses differed: upper trunk muscle involvement and occurrence of co-activation of ventral and dorsal muscles were more frequent in the person with spinal cord injury. These findings prompt further investigation into trunk muscle function in paraplegics, and highlight the importance of including motor tests for trunk muscles in persons with thoracic spinal cord injury, in relation to injury classification, prognosis and rehabilitation.

  3. Trunk- and head-centred spatial coordinates do not affect free-viewing perceptual asymmetries.

    Science.gov (United States)

    Nicholls, Michael E R; Mattingley, Jason B; Bradshaw, John L; Krins, Phillip W

    2003-11-01

    Turning the trunk or head to the left can reduce the severity of leftward neglect. This study sought to determine whether turning the trunk or head to the right would reduce pseudoneglect: A phenomenon where normal participants underestimate the rightward features of a stimulus. Participants made luminance judgements of two mirror-reversed greyscales stimuli. A preference for selecting the stimulus dark on the left was found. The effect of trunk-centred coordinates was examined in Expt. 1 by facing the head toward the display and turning the trunk to the left, right or toward the display. Head-centred coordinates were examined in Expt. 2 by directing the eyes toward the display and then turning the head and trunk. No effect of rotation was observed. It was concluded that the leftward bias for the greyscales task could be based on an object-centred attentional bias or left-to-right eye scanning habits.

  4. Effect of using garlic or curcumin or parsley on the growth performance, meat and egg quality of Japanese quail

    International Nuclear Information System (INIS)

    El-Faramawy, A.A.; Fahmy, M.O.; Wakwak, M.M.

    2006-01-01

    Two grams of powdered garlic or curcumin or parsley were added separately to each kg of the diet of unsexed Japanese quail aged one day old in an attempt to evaluate growth performance, serum cholesterol, triiodothyronine hormone, small intestine thickness and caecal microbial count to improve meat quality and egg production. The quails were hold in equal 4 groups; each group contained three replicates of 30 birds. Birds were watered and fed ad libitum for 7 weeks then 69 chicks from each group (6 males and 17 females for each replicate) were transferred into laying cages for another 6 weeks while 3 birds from each replicate were slaughtered for serum cholesterol, triiodothyronine, small intestine thickness, microbial count and carcass fatty acid determination. The data revealed that addition of each of the tested herb supplements caused significant increase in body weight, while there was non-significant changes in serum cholesterol, T3, small intestine thickness and total bacterial count. In addition, there was significant increase in unsaturated fatty acids and significant decrease in saturated fatty acids of carcass. The three additives caused remarkable increases in egg production and hatch ability %, besides augmenting the fertility % and number of ovarian follicles. It may be concluded that addition of 2g garlic or curcumin or parsley powder to each kg of the diet of Japanese quail favored consumer expectation in relation to meat quality and egg production and prolonged feed preservation

  5. Comprehensive Identification of Sexual Dimorphism-Associated Differentially Expressed Genes in Two-Way Factorial Designed RNA-Seq Data on Japanese Quail (Coturnix coturnix japonica.

    Directory of Open Access Journals (Sweden)

    Kelsey Caetano-Anolles

    Full Text Available Japanese quail (Coturnix coturnix japonica reach sexual maturity earlier, breed rapidly and successfully, and cost less and require less space than other birds raised commercially. Given the value of this species for food production and experimental use, more studies are necessary to determine chromosomal regions and genes associated with gender and breed-differentiation. This study employed Trinity and edgeR for transcriptome analysis of next-generation RNA-seq data, which included 4 tissues obtained from 3 different breeding lines of Japanese quail (random bred control, heavy weight, low weight. Differentially expressed genes shared between female and male tissue contrast groups were analyzed to identify genes related to sexual dimorphism as well as potential novel candidate genes for molecular sexing. Several of the genes identified in the present study as significant sex-related genes have been previously found in avian gene expression analyses (NIPBL, UBAP2, and other genes found differentially expressed in this study and not previously associated with sex-related differences may be considered potential candidates for molecular sexing (TERA, MYP0, PPR17, CASQ2. Additionally, other genes likely associated with neuronal and brain development (CHKA, NYAP, as well as body development and size differentiation (ANKRD26, GRP87 in quail were identified. Expression of homeobox protein regulating genes (HXC4, ISL1 shared between our two sex-related contrast groups (Female Brain vs. Male Brain and Ovary vs. Testis indicates that these genes may regulate sex-specific anatomical development. Results reveal genetic features of the quail breed and could allow for more effective molecular sexing as well as selective breeding for traits important in commercial production.

  6. Effects of chicory inulin on serum metabolites of uric acid, lipids, glucose, and abdominal fat deposition in quails induced by purine-rich diets.

    Science.gov (United States)

    Lin, Zhijian; Zhang, Bing; Liu, Xiaoqing; Jin, Rui; Zhu, Wenjing

    2014-11-01

    Inulin, a group of dietary fibers, is reported to improve the metabolic disorders. In the present study, we investigated the effects of chicory inulin on serum metabolites of uric acid (UA), lipids, glucose, and abdominal fat deposition in quail model induced by a purine-rich diet. In this study, 60 male French quails were randomly allocated to five groups: CON (control group), MOD (model group), BEN (benzbromarone-treated group), CHI-H (high-dosage chicory inulin-treated group), and CHI-L (low-dosage chicory inulin-treated group). The serum UA level was significantly increased in the model group from days 7 to 28, as well as triglyceride (TG) and free fatty acid (FFA) increased later in the experimental period. The abdominal fat ratio was increased on day 28. Benzbromarone can decrease UA levels on days 14 and 28. The high and low dosage of chicory inulin also decreased serum UA levels on days 7, 14, and 28. The abdominal fat ratio, activity, and protein of acetyl-CoA carboxylase (ACC) were decreased in chicory inulin-treated groups. The activities of xanthine oxidase (XOD) and fatty acid synthase (FAS) were increased in the model group and decreased in the benzbromarone and chicory inulin groups. This study evaluated a quail model of induced hyperuricemia with other metabolic disorders caused by a high-purine diet. The results indicated that a purine-rich diet might contribute to the development of hyperuricemia, hypertriglyceridemia, and abdominal obesity. Chicory inulin decreased serum UA, TG, and abdominal fat deposition in a quail model of hyperuricemia by altering the ACC protein expression and FAS and XOD activities.

  7. Bovine meat and Bone Meal as an Economically Viable Alternative in Quail Feeding in the Final Phase

    Directory of Open Access Journals (Sweden)

    CC Pizzolante

    Full Text Available ABSTRACT Bovine meat and bone meal (MBM has been used as a low-cost protein source in corn- and soybean meal-based poultry diets. However, to date, no studies investigating the effect of the dietary inclusion of MBM on the performance of Japanese quails and on egg production costs were found in literature. In this study, 600 Japanese quails in lay were distributed in a completely randomized experimental design consisting of six treatments (replacement levels of soybean meal by MBM:0, 1, 2, 3, 4, and 5% with five replicates of 20 birds each to investigate if MBM is a viable alternative to maintain or to improve the live and economic performances of these birds. Treatments consisted of a control diet, based on corn and soybean meal, with no inclusion of MBM, and diets formulated with increasing levels (1, 2, 3, 4, and 5% of MBM inclusion at the expense of soybean meal. The studied parameters were evaluated in four periods of 28 days each. Live performance parameters (egg weight, g; average egg production, %; egg weight, g; feed intake, g; feed conversion ratio per egg mass, kg/kg and per dozen eggs, dz/kg; and livability, %; egg quality parameters (proportion of egg components, yolk, albumen, eggshell %; egg specific weight, g/cm3; and economic parameter (bio-economic nutritional index were determined. Only egg weight, egg specific weight, and eggshell percentage were affected (p<0.05 by the treatments. Our results show that inclusion of bovine meat and bone meal can be added to the diet of Japanese quails in lay, causing no performance losses and promoting feed cost savings up to 5.24%.

  8. Functional analysis of SH3 domain containing ring finger 2 during the myogenic differentiation of quail myoblast cells

    Directory of Open Access Journals (Sweden)

    Si Won Kim

    2017-08-01

    Full Text Available Objective Owing to the public availability of complete genome sequences, including avian species, massive bioinformatics analyses may be conducted for computational gene prediction and the identification of gene regulatory networks through various informatics tools. However, to evaluate the biofunctional activity of a predicted target gene, in vivo and in vitro functional genomic analyses should be a prerequisite. Methods Due to a lack of quail genomic sequence information, we first identified the partial genomic structure and sequences of the quail SH3 domain containing ring finger 2 (SH3RF2 gene. Subsequently, SH3RF2 was knocked out using clustered regularly interspaced short palindromic repeat/Cas9 technology and single cell-derived SH3RF2 mutant sublines were established to study the biofunctional activity of SH3RF2 in quail myoblast (QM7 cells during muscle differentiation. Results Through a T7 endonuclease I assay and genotyping analysis, we established an SH3RF2 knockout (KO QM7#4 subline with 61 and 155 nucleotide deletion mutations in SH3RF2. After the induction of myotube differentiation, the expression profiles were analyzed and compared between regular QM7 and SH3RF2 KO QM7#4 cells by global RNA sequencing and bioinformatics analysis. Conclusion We did not detect any statistically significant role of SH3RF2 during myotube differentiation in QM7 myoblast cells. However, additional experiments are necessary to examine the biofunctional activity of SH3RF2 in cell proliferation and muscle growth.

  9. Surgical treatment of celiomesenteric trunk aneurysm-7 case report.

    Science.gov (United States)

    Wang, Chunxi; Cai, Xiangjun; Liang, Faqi; Chu, Futao; Chen, Gang; Duan, Zhiquan

    2014-01-01

    The celiomesenteric trunk is a rare anomaly characterized by a common origin of the celiac axis and superior mesenteric artery from the aorta, which accounts for less than 1% of all celiac artery anomalies, so the aneurysm occurred in such trunk is even rarer. There have been few reports on how to diagnose and deal with such malformed celiomesenteric trunk aneurysms till now. This paper tries to summarize the experience of how to expose and excise such kind of aneurysm according to the seven cases' data. The clinic data were collected retrospectively. There were seven cases with celiomesenteric trunk aneurysm from February 2000 to February 2013, including 5 males and 2 females aged 35~62. The operations were done including aneurysm resection and vascular reconstruction under general anesthesia. The operated patients were followed-up at the sixth month and each year post operation. The vascular stomas were detected or examined by Color Doppler Sonography, spiral Computed Tomography angiography (SCTA). The seven operated patients were cured and discharged from hospital, and they were followed up for 3~10 years (mean time 5 years), with four patients being followed up longer than 5 years. No sign of intestinal ischemia or hepatic ischemia or splenic ischemia was found, and no image of anastomosis stricture or stenosis was found during the follow-up. Five patients are alive now while two patients were dead, with one dying of large area myocardial infarction unexpectedly at 6 years post operation and the other dying of cerebral infarction abruptly at 4 years post operation. It is an effective and safe method to treat the celiomesenteric trunk aneurysm by using by-pass operation with artificial blood vessels, originating from inferior kidney aorta to visceral arteries including hepatic artery, splenic artery and superior mesenteric artery. Its short-term and middle-term effects are relatively better.

  10. Experiment K-313: Rat and quail ontogenesis

    Science.gov (United States)

    Keefe, J. R.

    1981-01-01

    The potential effects of spaceflight on the processes of mammalian fertilizaton, implantation and embryonic development are investigated. Five female and two male rats were placed together on Day 2 of the flight. By R+17, it was determined that both flight and synchronous females were not carrying normal pregnancies and three of the flight animals were laparotomized. The uterus and ovaries were processed for microscopic analyses. The two remaining flight females were allowed to recover from the exploratory operation, rebred with flight males and delivered normal litters. As a control for potential transplacental effects that might be interpreted as direct spaceflight effects, a series of fertilized Japanese quail (Coturnix japonica) eggs was flown on Cosmos 1129. Although all of the eggs were adversely impacted by an inflight failure of the incubator humidifier on flight Day 13, several embryos were able to progress to a developmental stage equivalent to that of a control 10-12 Day embryo.

  11. Anticipation of direction and time of perturbation modulates the onset latency of trunk muscle responses during sitting perturbations.

    Science.gov (United States)

    Milosevic, Matija; Shinya, Masahiro; Masani, Kei; Patel, Kramay; McConville, Kristiina M V; Nakazawa, Kimitaka; Popovic, Milos R

    2016-02-01

    Trunk muscles are responsible for maintaining trunk stability during sitting. However, the effects of anticipation of perturbation on trunk muscle responses are not well understood. The objectives of this study were to identify the responses of trunk muscles to sudden support surface translations and quantify the effects of anticipation of direction and time of perturbation on the trunk neuromuscular responses. Twelve able-bodied individuals participated in the study. Participants were seated on a kneeling chair and support surface translations were applied in the forward and backward directions with and without direction and time of perturbation cues. The trunk started moving on average approximately 40ms after the perturbation. During unanticipated perturbations, average latencies of the trunk muscle contractions were in the range between 103.4 and 117.4ms. When participants anticipated the perturbations, trunk muscle latencies were reduced by 16.8±10.0ms and the time it took the trunk to reach maximum velocity was also reduced, suggesting a biomechanical advantage caused by faster muscle responses. These results suggested that trunk muscles have medium latency responses and use reflexive mechanisms. Moreover, anticipation of perturbation decreased trunk muscles latencies, suggesting that the central nervous system modulated readiness of the trunk based on anticipatory information. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Ultrasound-guided drainage of subcutaneous abscesses on the trunk is feasible

    DEFF Research Database (Denmark)

    Kjær, Søren; Rud, Bo; Bay-Nielsen, Morten

    2013-01-01

    Subcutaneous trunk abscesses are frequent, and current treatment options generally involve incision. By contrast, the standard care for breast abcesses is ultrasound-guided drainage. The aim of this study was to evaluate the feasibility of ultrasound-guided drainage combined with antibiotics...... in the treatment of subcutaneous abscesses on the trunk....

  13. Number and size of nucleoli in the spermatocytes of chicken and Japanese quail.

    Science.gov (United States)

    Andraszek, Katarzyna; Gryzińska, Magdalena; Knaga, Sebastian; Wójcik, Ewa; Smalec, Elzbieta

    2012-01-01

    Nucleoli are the product of nucleolus organizing region activity (NOR) of specific chromosomes. Their basic function is to synthetise ribosomal RNA precursors and promote the maturation and assemblage of preribosomal RNP molecules. Information on rRNA-coding gene activity can be provided by the analysis of the number and size of nucleoli in the prophase of the first meiotic division. The morphology and ultrastructure of a nucleolus depends, among others, on the species and cell growth cycle as well as the physiological and pathological state of an organism. The purpose of this research was to determine the number and size of nucleoli in the spermatocytes of the domestic chicken and the Japanese quail. Diverse numbers and sizes of nucleoli in the cells of the analysed birds were observed. 1-4 nucleoli were identified in chicken cells (1.91 +/- 0.63 on average) and 1-2 in quail cells (1.13 +/- 0.33 on average). For the total of 957 nucleoli observed in Gallus cells, 329 were classified as large and 628 as small. In Coturnix cells, 563 nucleoli were identified (66 large and 497 small ones). An analysis of the numbers and sizes of nucleoli can be performed at the cytogenetic level and serve as an alternative source of information on rRNA encoding gene and nucleolus organising region (NOR) activities.

  14. Effects of replacing maize meal with rumen filtrate-fermented cassava meal on growth and egg production performance in Japanese quails (Cortunix japonica

    Directory of Open Access Journals (Sweden)

    Francisco Kanyinji

    2014-09-01

    Full Text Available This study was conducted to evaluate the effects of replacing maize in quail diets with graded levels of rumen filtrate-fermented cassava meal (FCM on growth and egg production performances. Cassava meal (CM was mixed with dried manure of layer at 75 g/kg CM, which was mixed with freshly collected rumen filtrate (at 1 L/5 kg CM, and finally fermented in sealed bags for 14 days. It was then sun-dried and added in grower or finisher diets at 0, 50, 75 and 100%. Then, 84 three weeks-old Japanese quails (Cortunix japonica were divided into four equal groups; the birds were randomly assigned to 0, 50, 75 and 100% FCM grower/layers diets, and were reared until 56 days of age. Daily feed consumption, weekly body weights, weight gains, feed conversion ratios (FCR, hen-day, and egg weights were monitored. The quails fed with 75% FCM were found to be superior (p0.05 effect on feed intake, body weight, and weight gain, as compared to those of fed control diets. Thus, replacing maize with FCM had no deleterious effects on growth performance, but depressed hen-day. However, better growth performance was obtained when maize was replaced at 75% FCM.

  15. An analysis of trunk kinematics and gait parameters in people with stroke

    Directory of Open Access Journals (Sweden)

    Adnil W. Titus

    2018-03-01

    Conclusion: This pilot study found significant asymmetry in trunk motion between the affected and unaffected sides that varied across the gait cycle. This suggests the trunk may need to be targeted in clinical gait retraining post-stroke.

  16. Richness and epiphytic mosses cover variation on ironwood trees (Parrotia persica Pojark trunks

    Directory of Open Access Journals (Sweden)

    Seyedeh Rahimeh Yavarynik

    2016-06-01

    Full Text Available This research was conducted to determination and assess changes in richness and cover of epiphytic mosses on ironwood trees(Parrotia persica Pojark trunks along trunk elevation and slope aspect gradients, in lowland and protected forest of Natural Resource College of Tarbiat Modares University (Parts of western limit of Noor forest reserved. To do this, a number of 20 individual of ironwood trees with a diamerter higher than 40 cm were selected randomly in the study area. A rectangle with 40*30 cm in two geographical directions (Northern and Southern, in 4 height classes (from 0 to 160cm on the trunks was sampled and related characteristics were recorded. Results of floristic study showed that presence of 17 epiphytic mosses species and the endemic species Palamocladium euchloron among the species with highest presence and Brachytheciaceae family with 7 species were the most important taxa and family in the forest. Richness and cover percentage of epiphytic mosses had the highest averages in northern and lower parts of the trees trunk, this could be due to higher moisture in northern direction and lower parts of the trunk. Result of the study, well clarified the changes of distribution and abundance of the most important forest elements in relationship changes of geographical situation of Parrotia persica trunks.

  17. Trunk Dynamics Are Impaired in Ballet Dancers with Back Pain but Improve with Imagery.

    Science.gov (United States)

    Gildea, Jan E; VAN DEN Hoorn, Wolbert; Hides, Julie A; Hodges, Paul W

    2015-08-01

    Trunk control is essential in ballet and may be compromised in dancers with a history of low back pain (LBP) by associated changes in motor control. This study aimed to compare trunk mechanical properties between professional ballet dancers with and without a history of LBP. As a secondary aim, we assessed whether asking dancers to use motor imagery to respond in a "fluid" manner could change the mechanical properties of the trunk and whether this was possible for both groups. Trunk mechanical properties of stiffness and damping were estimated with a linear second-order system, from trunk movement in response to perturbations, in professional ballet dancers with (n = 22) and without (n = 8) a history of LBP. The second-order model adequately described trunk movement in response to the perturbations. Trials were performed with and without motor imagery to respond in a fluid manner to the perturbation. Dancers with a history of LBP had lower damping than dancers without LBP during the standard condition (P = 0.002) but had greater damping during the "fluid" condition (P 0.99). Stiffness was not different between the dancers with and those without a history of LBP (P = 0.252) but was less during the fluid condition than the standard condition (P < 0.001). Although dancers with a history of LBP have less trunk damping than those without LBP, they have the capacity to modulate the trunk's mechanical properties to match that of pain-free dancers by increasing damping with motor imagery. These observations have potential relevance for LBP recurrence and rehabilitation.

  18. Stability and Control of Human Trunk Movement During Walking.

    Science.gov (United States)

    Wu, Q.; Sepehri, N.; Thornton-Trump, A. B.; Alexander, M.

    1998-01-01

    A mathematical model has been developed to study the control mechanisms of human trunk movement during walking. The trunk is modeled as a base-excited inverted pendulum with two-degrees of rotational freedom. The base point, corresponding to the bony landmark of the sacrum, can move in three-dimensional space in a general way. Since the stability of upright posture is essential for human walking, a controller has been designed such that the stability of the pendulum about the upright position is guaranteed. The control laws are developed based on Lyapunov's stability theory and include feedforward and linear feedback components. It is found that the feedforward component plays a critical role in keeping postural stability, and the linear feedback component, (resulting from viscoelastic function of the musculoskeletal system) can effectively duplicate the pattern of trunk movement. The mathematical model is validated by comparing the simulation results with those based on gait measurements performed in the Biomechanics Laboratory at the University of Manitoba.

  19. Evolution of the head-trunk interface in tetrapod vertebrates

    Science.gov (United States)

    Sefton, Elizabeth M; Bhullar, Bhart-Anjan S; Mohaddes, Zahra; Hanken, James

    2016-01-01

    Vertebrate neck musculature spans the transition zone between head and trunk. The extent to which the cucullaris muscle is a cranial muscle allied with the gill levators of anamniotes or is instead a trunk muscle is an ongoing debate. Novel computed tomography datasets reveal broad conservation of the cucullaris in gnathostomes, including coelacanth and caecilian, two sarcopterygians previously thought to lack it. In chicken, lateral plate mesoderm (LPM) adjacent to occipital somites is a recently identified embryonic source of cervical musculature. We fate-map this mesoderm in the axolotl (Ambystoma mexicanum), which retains external gills, and demonstrate its contribution to posterior gill-levator muscles and the cucullaris. Accordingly, LPM adjacent to the occipital somites should be regarded as posterior cranial mesoderm. The axial position of the head-trunk border in axolotl is congruent between LPM and somitic mesoderm, unlike in chicken and possibly other amniotes. DOI: http://dx.doi.org/10.7554/eLife.09972.001 PMID:27090084

  20. Kisspeptin-10 Enhanced Egg Production in Quails Associated with the Increase of Triglyceride Synthesis in Liver

    Directory of Open Access Journals (Sweden)

    J. Wu

    2013-08-01

    Full Text Available Our previous results showed that kisspeptin-10 (Kp-10 injections via intraperitoneal (i.p. once daily for three weeks notably promoted the egg laying rate in quails. In order to investigate the mechanism behind the effects of Kp-10 on enhancing the egg laying rate in birds, this study focused on the alternations of lipids synthesis in liver after Kp-10 injections. 75 female quails (22 d of age were allocated to three groups randomly, and subjected to 0 (control, Con, 10 nmol (low dosage, L and 100 nmol (high dosage, H Kp-10 injections via i.p. once daily for three weeks, respectively. At d 52, quails were sacrificed and sampled for further analyses. Serum E2 concentration was increased by Kp-10 injections, and reached statistical significance in H group. Serum triglyceride (TG concentrations were increased by 46.7% in L group and 36.8% in H group, respectively, but did not reach statistical significance, and TG contents in liver were significantly elevated by Kp-10 injections in a dose-dependent manner. Serum total cholesterol (Tch concentrations significantly decreased in H group, while in H group the hepatic Tch content was markedly increased. The level of non-esterified fatty acid (NEFA, apolipoprotein A1 and B (apoA1 and apoB were not altered by Kp-10 injections. The genes expression of sterol regulatory element binding protein-1 (SREBP-1, fatty acid synthetase (FAS, apolipoprotein VLDL-II (apoVLDL-II, cholesterol 7α-hydroxylase (CYP7A1 and vitellogenin II (VTG-II were significantly up-regulated by high but not low dosage of Kp-10 injection compared to the control group. However, the expression of SREBP-2, acetyl-CoA carboxylase (ACCα, malic enzyme (ME, stearoyl-CoA (Δ9 desaturase 1 (SCD1, apolipoprotein A1 (apoA1, fatty acid binding protein 2 (FABP2, 3-hydroxyl-3-methyl glutaryl-coenzyme A reductases (HMGCR, estrogen receptor α, β (ERα and β mRNA were not affected by Kp-10 treatment. In line with hepatic mRNA abundance, hepatic SREBP

  1. A comparison of economy and sagittal plane trunk movements among back-, back/front- and head-loading.

    Science.gov (United States)

    Hudson, Sean; Cooke, Carlton; Davies, Simeon; West, Sacha; Gamieldien, Raeeq; Low, Chris; Lloyd, Ray

    2018-05-14

    It has been suggested that freedom of movement in the trunk could influence load carriage economy. This study aimed to compare the economy and sagittal plane trunk movements associated with three load carriage methods that constrain posture differently. Eighteen females walked at 3 km.h -1 with loads of 0, 3, 6, 9, 12, 15 and 20 kg carried on the back, back/front and head. Load carriage economy was assessed using the Extra Load Index (ELI). Change in sagittal plane trunk forward lean and trunk angle excursion from unloaded to loaded walking were assessed. Results show no difference in economy between methods (p = 0.483), despite differences in the change in trunk forward lean (p = 0.001) and trunk angle excursion (p = 0.021) from unloaded to loaded walking. We conclude that economy is not different among the three methods of load carriage, despite significant differences in sagittal plane trunk movements.

  2. Depletion of primordial germ cells (PGCs) by X-irradiation to extraembryonic region of chicken embryos and expression of xenotransplanted quail PGCs

    International Nuclear Information System (INIS)

    Atsumi, Y.; Yazawa, S.; Usui, F.; Nakamura, Y.; Yamamoto, Y.; Tagami, T.; Hiramatsu, K.; Kagami, H.; Ono, T.

    2009-01-01

    The generation of germline chimeras by the transfer of primordial germ cells (PGCs) requires incorporation of the PGCs of the donor into the gonadal tissue of the recipient embryo. We investigated the utility of soft x-irradiation with application of a lead (12 x 3 x 0.25 mm, - 0.1 g) shield to the embryo proper for the production of chicken-quail germline chimeras. Chicken embryos shielded during irradiation for 120s (- 7.2 Gy) at stages 13 to 17 showed a hatchability of 35% (106/301), whereas the hatchability of unshielded embryos was 26% (27/105). The relative population of gonadal PGCs at stage 30 for embryos irradiated at stage 13 with or without shielding was 13 and 5%, respectively, of the value for nonirradiated controls. Chicken embryos irradiated at stages 13 or 14 with or without shielding and transfused with quail embryonic blood containing PGCs each exhibited - 130 relative population of donor PGCs in the left gonad at stage 30. Xenotransplanted hatchlings exhibited donor-derived PGCs as detected by Southern hybridization and PCR. Exposure of chicken embryos to - 7.2 Gy of x-radiation at stage 13 with the application of a lead shield to the embryo proper is thus a feasible approach to depletion of endogenous germ cells and the production of chicken-quail germline chimeras

  3. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  4. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  5. Inhibition of lipolysis in the novel transgenic quail model overexpressing G0/G1 switch gene 2 in the adipose tissue during feed restriction.

    Directory of Open Access Journals (Sweden)

    Sangsu Shin

    Full Text Available In addition to the issue of obesity in humans, the production of low-fat meat from domestic animals is important in the agricultural industry to satisfy consumer demand. Understanding the regulation of lipolysis in adipose tissue could advance our knowledge to potentially solve both issues. Although the G0/G1 switch gene 2 (G0S2 was recently identified as an inhibitor of adipose triglyceride lipase (ATGL in vitro, its role in vivo has not been fully clarified. This study was conducted to investigate the role of G0S2 gene in vivo by using two independent transgenic quail lines during different energy conditions. Unexpectedly, G0S2 overexpression had a negligible effect on plasma NEFA concentration, fat cell size and fat pad weight under ad libitum feeding condition when adipose lipolytic activity is minimal. A two-week feed restriction in non-transgenic quail expectedly caused increased plasma NEFA concentration and dramatically reduced fat cell size and fat pad weight. Contrary, G0S2 overexpression under a feed restriction resulted in a significantly less elevation of plasma NEFA concentration and smaller reductions in fat pad weights and fat cell size compared to non-transgenic quail, demonstrating inhibition of lipolysis and resistance to loss of fat by G0S2. Excessive G0S2 inhibits lipolysis in vivo during active lipolytic conditions, such as food restriction and fasting, suggesting G0S2 as a potential target for treatment of obesity. In addition, transgenic quail are novel models for studying lipid metabolism and mechanisms of obesity.

  6. Screen time viewing behaviors and isometric trunk muscle strength in youth.

    Science.gov (United States)

    Grøntved, Anders; Ried-Larsen, Mathias; Froberg, Karsten; Wedderkopp, Niels; Brage, Søren; Kristensen, Peter Lund; Andersen, Lars Bo; Møller, Niels Christian

    2013-10-01

    The objective of this study was to examine the association of screen time viewing behavior with isometric trunk muscle strength in youth. A cross-sectional study was carried out including 606 adolescents (14-16 yr old) participating in the Danish European Youth Heart Study, a population-based study with assessments conducted in either 1997/1998 or 2003/2004. Maximal voluntary contractions during isometric back extension and abdominal flexion were determined using a strain gauge dynamometer, and cardiorespiratory fitness (CRF) was obtained using a maximal cycle ergometer test. TV viewing time, computer use, and other lifestyle behaviors were obtained by self-report. Analyses of association of screen use behaviors with isometric trunk muscle strength were carried out using multivariable adjusted linear regression. The mean (SD) isometric strength was 0.87 (0.16) N·kg-1. TV viewing, computer use, and total screen time use were inversely associated with isometric trunk muscle strength in analyses adjusted for lifestyle and sociodemographic factors. After further adjustment for CRF and waist circumference, associations remained significant for computer use and total screen time, but TV viewing was only marginally associated with muscle strength after these additional adjustments (-0.05 SD (95% confidence interval, -0.11 to 0.005) difference in strength per 1 h·d-1 difference in TV viewing time, P = 0.08). Each 1 h·d-1 difference in total screen time use was associated with -0.09 SD (95% confidence interval, -0.14 to -0.04) lower isometric trunk muscle strength in the fully adjusted model (P = 0.001). There were no indications that the association of screen time use with isometric trunk muscle strength was attenuated among highly fit individuals (P = 0.91 for CRF by screen time interaction). Screen time use was inversely associated with isometric trunk muscle strength independent of CRF and other confounding factors.

  7. Validity of trunk extensor and flexor torque measurements using isokinetic dynamometry.

    Science.gov (United States)

    Guilhem, Gaël; Giroux, Caroline; Couturier, Antoine; Maffiuletti, Nicola A

    2014-12-01

    This study aimed to evaluate the validity and test-retest reliability of trunk muscle strength testing performed with a latest-generation isokinetic dynamometer. Eccentric, isometric, and concentric peak torque of the trunk flexor and extensor muscles was measured in 15 healthy subjects. Muscle cross sectional area (CSA) and surface electromyographic (EMG) activity were respectively correlated to peak torque and submaximal isometric torque for erector spinae and rectus abdominis muscles. Reliability of peak torque measurements was determined during test and retest sessions. Significant correlations were consistently observed between muscle CSA and peak torque for all contraction types (r=0.74-0.85; Ptorque (r ⩾ 0.99; Ptorque between test and retest ranged from -3.7% to 3.7% with no significant mean directional bias. Overall, our findings establish the validity of torque measurements using the tested trunk module. Also considering the excellent test-retest reliability of peak torque measurements, we conclude that this latest-generation isokinetic dynamometer could be used with confidence to evaluate trunk muscle function for clinical or athletic purposes. Copyright © 2014 Elsevier Ltd. All rights reserved.

  8. Development and evaluation of a passive trunk support system for Duchenne muscular dystrophy patients.

    Science.gov (United States)

    Mahmood, Mohammad Nauzef; Peeters, Laura H C; Paalman, Micha; Verkerke, Gijsbertus J; Kingma, Idsart; van Dieën, Jaap H

    2018-03-14

    Patients with Duchenne muscular dystrophy gradually lose the ability to use different muscles of their body. Consequently, they lose the ability to stabilize their trunk against gravity. This hinders them to effectively perform different daily activities. In this paper, we describe the design, realization and evaluation of a trunk orthosis for these patients that should allow them to move their trunk and maintain stability. This study aimed to primarily assess the effectiveness of the trunk support system in terms of unloading of trunk muscles, so only healthy participants were recruited for this phase of the study. Measurements were done on 10 healthy participants (23.4±2.07 [M±SD] years old, average body weight 68.42±24.22 [M±SD] kg). The experiment comprised maintaining a constant trunk posture in three different device conditions (control without orthosis and two conditions with different configurations of the orthosis), at four different flexion angles (10°, 20°, 30°, 40°) for each device condition and for two load conditions (with and without stretching the arms). Electromyography (EMG) signals from the trunk muscles were measured to estimate activation levels of the trunk muscles (iliocostalis, longissimus, external oblique and rectus abdominis) and a motion capture system was used to record the movement of the participants during the experiment. Wearing the orthosis caused reductions in longissimus and iliocostalis activity. The average muscle activity level was 5%-10% of maximum voluntary contraction in the unsupported conditions for those particular muscles. This level was reduced to 3%-9% of maximal voluntary contraction for the supported conditions. No effect on external oblique and rectus abdominis activity was observed. Moreover, no pain or discomfort was reported by any of the participants during the experiment. The results from the current experiment also suggests the necessity of lumber stabilizing systems while using trunk orthosis. The

  9. ELISA indireto para detecção de IgG antivírus da doença de Newcastle em soro de codorna Indirect ELISA for the detection of IgG specific to Newcastle disease virus in quail serum

    Directory of Open Access Journals (Sweden)

    D.D. Oliveira

    2007-10-01

    Full Text Available An indirect ELISA for the detection of japanese quail IgG specific to Newcastle disease virus (NDV was developed. The secondary anti-quail IgG was produced in Balb/c mice, by inoculating Freund's complete adjuvant emulsified japanese quail-IgG extract. The purification of IgG was achieved using the caprilic acid method. The ELISA was compared to the haemagglutination-inhibition (HI test for antibodies to NDV. ELISA cut-off point was established through TG-ROC analysis. Total correlation was observed between the ELISA and the HI, being the ELISA efficient in the identification of positive and negative sera, with high sensitivity and specificity (100%. These results validate the use of the indirect ELISA as an alternative for the detection of NDV-specific IgG in japanese quail sera, with the advantage of high sensitivity and automation.

  10. Duplication of Inferior Gluteal Artery and Course of Superior Gluteal Artery Through the Lumbosacral Trunk

    Directory of Open Access Journals (Sweden)

    Satheesha Nayak B

    2017-07-01

    Full Text Available Internal iliac artery (IIA shows great deal of variations in its branching pattern. The knowledge of its variant branches is required for successful surgical, orthopedic, plastic surgery and radiological procedures. We observed variations of some of the branches of right IIA in an adult male cadaver. The iliolumbar artery originated from the main trunk of the IIA. After this, IIA divided into anterior and posterior divisions. The posterior division gave lateral sacral and superior gluteal arteries. Superior gluteal artery pierced the lumbosacral trunk before leaving the pelvis. The anterior division further divided into anterior and posterior trunks. Anterior trunk gave rise to superior vesical, inferior vesical, middle rectal and obturator arteries. The posterior trunk gave two inferior gluteal arteries and an internal pudendal artery.

  11. Relevance of the Physicochemical Properties of Calcined Quail Eggshell (CaO as a Catalyst for Biodiesel Production

    Directory of Open Access Journals (Sweden)

    Leandro Marques Correia

    2017-01-01

    Full Text Available The CaO solid derived from natural quail eggshell was calcined and employed as catalyst to produce biodiesel via transesterification of sunflower oil. The natural quail eggshell was calcined at 900°C for 3 h, in order to modify the calcium carbonate present in its structure in CaO, the activity phase of the catalyst. Both precursor and catalyst were characterized using Hammett indicators method, X-ray fluorescence (XRF, X-ray diffraction (XRD, thermogravimetric analysis (TG/DTG, CO2 temperature-programmed desorption (CO2-TPD, X-ray photoelectronic spectroscopy (XPS, Fourier infrared spectroscopy (FTIR, scanning electron microscopy (SEM, N2 adsorption-desorption at −196°C, and distribution particle size. The maximum biodiesel production was of 99.00 ± 0.02 wt.% obtained in the following transesterification reaction conditions: XMR (sunflower oil/methanol molar ratio of 1 : 10.5 mol : mol, XCAT (catalyst loading of 2 wt.%, XTIME (reaction time of 2 h, stirring rate of 1000 rpm, and temperature of 60°C.

  12. The improvement of suspension training for trunk muscle power in Sanda athletes

    Directory of Open Access Journals (Sweden)

    Xiujie Ma

    2017-12-01

    Full Text Available The aim of this study was to investigate whether both suspension training (ST and traditional training (TT can improve Sanda athlete's strength quality of trunk muscles and to explore the effect of suspension training on Sanda athletes' trunk muscle power production. Twelve elite Sanda athletes from the Competitive Sports School of Shanghai University of Sport were randomly assigned to experimental group (EG and control group (CG. EG and CG were regularly trained with suspension training and traditional strength training for 40 minutes three times per week. The total duration of training was 10 weeks. The measurements including peak torque (PT, PT/body weight (BW, and rate of force development (RFD were used to assess trunk muscles strength. The results showed that there were significant differences between the two groups' performance when it was tested at the higher velocity of dynamometer (test of muscle power, but less significant differences when the two groups performance was tested at the lower velocity of dynamometer (test of maximum strength. The conclusion of this study is that compared with traditional training methods, suspension training can improve back and trunk flexion muscles strength more effectively. In particular, suspension training can improve the explosive power of trunk extension and flexion muscles.

  13. Effect of shed rooftype and babassu pie on the productive characteristics of meat quails

    Directory of Open Access Journals (Sweden)

    Jordane de Oliveira Borges

    2017-08-01

    Full Text Available We aimed to evaluate the effects of shed roof(SR typeand the inclusion of babassu pie (BP in rations on the productive characteristics ofmeat quailsfrom days 14 to 28 and days14 to 40. We studied 896 meatquails. The experimental design was completely randomized with a 4x4 factorial arrangement, using four types of shedroofs (fiber cement, ceramic, straw, and painted fiber cement and four rations (with 0, 5, 10, and 15% inclusion of babassu pie. The performance variables evaluated from 14 to 28 and 14 to 40 days included food intake (FI, g/bird, mean weight gain (WG, g/bird, food conversion (FC, g/g, mean live weight on day 28 (MW28, g/bird, mean live weight on day 40 (MW40, g/bird, and energy efficiency (EF; g Mcal. After slautherthe birds on day 40, we measured the carcass weight (CW and the carcass yield (CY, %, obtained for the breast (BY, legs (LGY, and wings (WINGY. We also obtained the relative weight of the heart (HRW, liver (LRW, gizzard (GRW, and intestine (IRW. To compare the economic efficiency between the experimental rations, we analyzed the cost of ration per kg of carcass (CC and determined the gross margin (GM. Between day 14 and day 28, we found that the use of SR influenced the FI28, WG28, and the MW28 of the quails (p 0.05, but it linearly improved WG28, FC28, MW28, and EF28. Between days 14 and 40, we found that SR influenced the WG40, FC40, MW40, and EF40 of the quails (p < 0.05 and that a BP increased the FI40, WG40, and MW40 in a quadratic manner. SR and BP did not affect the CW, BY, WINGY, LGY, HRW, LRW,or IRW. However, BP influenced MGRW, which increased linearly with the inclusion of BP. We concluded that a ceramic roof provides better environmental conditions than do other shed roofs. The inclusion of BP improved the performance characteristics, and it was technically feasible to include up to 15% BP in the rations of meat quails. Based on the current cost analysis, however, the inclusion of BP is economically

  14. Improving Earth Science Metadata: Modernizing ncISO

    Science.gov (United States)

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

    2016-12-01

    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  15. Incidence, species and antimicrobial resistance of naturally occurring Campylobacter isolates from quail carcasses sampled in a commercial processing facility

    Science.gov (United States)

    Most of the published information about the presence of Campylobacter on processed poultry is from studies with chickens and turkeys; therefore there is a paucity of published material about the presence of Campylobacter on commercially processed quail (Coturnix coturnix). The objective of this stud...

  16. Elephant trunk in a small-calibre true lumen for chronic aortic dissection: cause of haemolytic anaemia?

    Science.gov (United States)

    Araki, Haruna; Kitamura, Tadashi; Horai, Tetsuya; Shibata, Ko; Miyaji, Kagami

    2014-12-01

    The elephant trunk technique for aortic dissection is useful for reducing false lumen pressure; however, a folded vascular prosthesis inside the aorta can cause haemolysis. The purpose of this study was to investigate whether an elephant trunk in a small-calibre lumen can cause haemolysis. Inpatient and outpatient records were retrospectively reviewed. Two cases of haemolytic anaemia after aortic surgery using the elephant trunk technique were identified from 2011 to 2013. A 64-year-old man, who underwent graft replacement of the ascending aorta for acute Stanford type A aortic dissection, presented with enlargement of the chronic dissection of the descending aorta and moderate aortic regurgitation. A two-stage surgery was scheduled. Total arch replacement with an elephant trunk in the true lumen and concomitant aortic valve replacement were performed. Postoperatively, he developed severe haemolytic anaemia because of the folded elephant trunk. The anaemia improved after the second surgery, including graft replacement of the descending aorta. Similarly, a 61-year-old man, who underwent total arch replacement for acute Stanford type A aortic dissection, presented with enlargement of the chronic dissection of the descending aorta. Graft replacement of the descending aorta with an elephant trunk inserted into the true lumen was performed. The patient postoperatively developed haemolytic anaemia because of the folded elephant trunk, which improved after additional stent grafting into the elephant trunk. A folded elephant trunk in a small-calibre lumen can cause haemolysis. Therefore, inserting an elephant trunk in a small-calibre true lumen during surgery for chronic aortic dissection should be avoided. © The Author 2014. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.

  17. Performance of japanese quails fed feeds containing different corn and limestone particle sizes

    OpenAIRE

    Berto,DA; Garcia,EA; Móri,C; Faitarone,ABG; Pelícia,K; Molino,AB

    2007-01-01

    This study aimed at evaluating performance and egg quality of Japanese quails fed feeds containing different corn and limestone particle sizes. A total number of 648 birds in the peak of production was distributed in a random complete block experimental design, using a 2x3 factorial arrangement (2 corn particle sizes and 3 limestone particle sizes). Birds were designated to one of two blocks, with six replicates of 18 birds each. Mean geometric diameter (MGD) values used were 0.617mm and 0.72...

  18. Explorations of the extended ncKP hierarchy

    International Nuclear Information System (INIS)

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert

    2004-01-01

    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  19. Steps for arm and trunk actions of overhead forehand stroke used in badminton games across skill levels.

    Science.gov (United States)

    Wang, Jianyu; Liu, Wenhao; Moffit, Jeffrey

    2009-08-01

    The purpose of this study was to examine arm and trunk actions in overhead forehand strokes used in badminton games across skill levels. The participants were 80 students (40 boys, 40 girls) who were randomly selected from video recordings of 300 students ages 16 to 19 years. The videotaped performances of overhead forehand strokes were coded based on three steps of arm action (elbow flexion, elbow and humeral flexion, and upward backswing) and three steps of trunk action (no trunk action, forward-backward movement, and trunk rotation). Students across the four skill levels exhibited different patterns of arm and trunk actions. Students at advanced levels used more mature arm and trunk actions.

  20. Fabrication of hydrophobic compressed oil palm trunk surface by sol-gel process

    Science.gov (United States)

    Muzakir, Syafiqah; Salim, Nurjannah; Huda Abu Bakar, Nurul; Roslan, Rasidi; Sin, Lim Wan; Hashim, Rokiah

    2018-04-01

    Improvement of the robustness of hydrophobic surfaces is crucial to achieving commercial applications of these surfaces in such various areas as self-cleaning, water repellency and corrosion resistance. Compressed oil palm trunk (OPT) panel is one of potential product which can be used as panelling and indoor furniture application. By adding hydrophobic properties to compressed oil palm trunk panel might increase the application of compressed oil palm trunk especially for outdoor application. In this study, fabrication is using the sol-gel technique. Sol-gel was prepared by adding ethanol with Hexadecyl Trimethyl Ammonium Bromide (CTAB) solution with Tetraethyl Orthosilicate (TEOS) with surface modification of chlorotrimethylsilane (CTMS). The surface with hydrophobic coating was undergone surface analysis with contact angle machine with the aid of software SCA 20 and the determined of the morphology of surface with scanning electron microscope (SEM). The produced compressed oil palm trunk surfaces exhibited promising hydrophobic properties with a contact angle of 104° and the relatively better mechanical robustness.

  1. Autoradiographic study on the distribution of mercury and its transfer to the egg in the laying quail

    Energy Technology Data Exchange (ETDEWEB)

    Nishimura, M; Urakawa, N; Ikeda, M

    1971-01-01

    Autoradiographic and tracer techniques were employed to investigate the distribution and movement of radiomercury in the form of /sup 203/Hg-nitrate, and its transfer to eggs in laying quails. After injection, the radiomercury tended to concentrate in the kidneys and ova, plateauing about 12 hours after injection. Within the egg, the mercury concentrated in the yolk.

  2. RADIOIODINATION OF OCHRATOXIN TO STUDY THE ROLE OF YEAST IN COUNTERACTING ITS EFFECT ON JAPANESE QUAIL

    International Nuclear Information System (INIS)

    ABU TALEB, A.M.; EL-BARKOUKY, E.E.; AYYOUB, S.M.; EL-KOLALY, M.T.

    2007-01-01

    The radioiodination of ochratoxin using iodogen as an oxidizing agent was studied. The factors affecting the radioiodination yield, such as reaction time, concentration of substrate and oxidizing agent, pH, stability of iodogen coated tubes have been investigated. Separation and purification of the labelled product using thin layer chromatography and gel chromatography on sephadex G-25 column were described.A total number of 80 quail chicks at eight weeks age were divided into two groups 40 birds each. The first group (control) feed basal diet and the second group was supplemented with 0.5% active dried yeast (Saccharomyces cerevisiae) in basal diet. All groups were given orally labelled ochratoxin. After 6, 12, 24 and 48 hours from oral feeding, the quails (5 birds from every group) were slaughtered and blood samples were collected when slaughtering. The organs; liver, heart, spleen lung, proventriculus, gizzard, intestine content, kidney, testis, ovary, oviduct, breast and thigh, were removed and weighed individually and their weights related to body weight have been calculated. Also, manure and eggs were collected. The radioactivity levels in the second group that supplemented yeast in diet was lower than the first group (control) except manure

  3. Interactions between aromatase (estrogen synthase) and dopamine in the control of male sexual behavior in quail.

    Science.gov (United States)

    Balthazart, Jacques; Baillien, Michelle; Ball, Gregory F

    2002-05-01

    In male quail, like in other vertebrates including rodents, testosterone acting especially through its estrogenic metabolites is necessary for the activation of male sexual behavior. Also, the administration of dopamine agonists and antagonists profoundly influences male sexual behavior. How the steroid-sensitive neural network and dopamine interact physiologically, remains largely unknown. It is often implicitly assumed that testosterone or its metabolite estradiol, stimulates male sexual behavior via the modification of dopaminergic transmission. We have now identified in quail two possible ways in which dopamine could potentially affect sexual behavior by modulating the aromatization of testosterone into an estrogen. One is a long-acting mechanism that presumably involves the modification of dopaminergic transmission followed by the alteration of the genomic expression of aromatase. The other is a more rapid mechanism that does not appear to be dopamine receptor-mediated and may involve a direct interaction of dopamine with aromatase (possibly via substrate competition). We review here the experimental data supporting the existence of these controls of aromatase activity by dopamine and discuss the possible contribution of these controls to the activation of male sexual behavior.

  4. Effect of Adding Different Vegetable Oils to Quail Diets On Some Blood Parameters and Immune System

    International Nuclear Information System (INIS)

    Abu Taleb, A.M.; Wakwak, M.; Sabek, E.M.; Elaroussi, M.A.; El-Gendy, H.M.; Hammad, M.R.

    2007-01-01

    A total number of 1400 one-day old Japanese quail birds were used in this study, the birds were divided into seven equal groups, six treated while the 7 t h served as the control. The diet of the six treated groups was supplemented with 8 % of either one of the following tested oils: soybean (SBO), sunflower (SFO), corn (CO), cottonseed (CSO), olive (OO) or palm (PO). At the end of the 4 t hand 8 t h weeks of age blood samples were collected for blood picture, proteins and cortisol determination. Antibody titer against sheep red blood cells (SRBCs) and NewCastle disease virus (NDV) were determined at 7 and 8 weeks of age respectively. The results showed significant increase in relative lymphoid organ weights, RBCs, WBCs, Hb and PCV, total protein, globulin and cortisol hormone in treated groups compared to the control. The immunological parameters showed a significant increase in (HA) and (HI) against (SRBCs) and (NDV), respectively, in all treated groups compared to the control group. The present results confirm the beneficial effects of dietary oil supplementation to quail birds and in particular olive oil.

  5. Evidence of expanded host range and mammalian-associated genetic changes in a duck H9N2 influenza virus following adaptation in quail and chickens.

    Directory of Open Access Journals (Sweden)

    Md Jaber Hossain

    Full Text Available H9N2 avian influenza viruses continue to circulate worldwide; in Asia, H9N2 viruses have caused disease outbreaks and established lineages in land-based poultry. Some H9N2 strains are considered potentially pandemic because they have infected humans causing mild respiratory disease. In addition, some of these H9N2 strains replicate efficiently in mice without prior adaptation suggesting that H9N2 strains are expanding their host range. In order to understand the molecular basis of the interspecies transmission of H9N2 viruses, we adapted in the laboratory a wildtype duck H9N2 virus, influenza A/duck/Hong Kong/702/79 (WT702 virus, in quail and chickens through serial lung passages. We carried out comparative analysis of the replication and transmission in quail and chickens of WT702 and the viruses obtained after 23 serial passages in quail (QA23 followed by 10 serial passages in chickens (QA23CkA10. Although the WT702 virus can replicate and transmit in quail, it replicates poorly and does not transmit in chickens. In contrast, the QA23CkA10 virus was very efficient at replicating and transmitting in quail and chickens. Nucleotide sequence analysis of the QA23 and QA23CkA10 viruses compared to the WT702 virus indicated several nucleotide substitutions resulting in amino acid changes within the surface and internal proteins. In addition, a 21-amino acid deletion was found in the stalk of the NA protein of the QA23 virus and was maintained without further modification in the QA23CkA10 adapted virus. More importantly, both the QA23 and the QA23CkA10 viruses, unlike the WT702 virus, were able to readily infect mice, produce a large-plaque phenotype, showed faster replication kinetics in tissue culture, and resulted in the quick selection of the K627 amino acid mammalian-associated signature in PB2. These results are in agreement with the notion that adaptation of H9 viruses to land-based birds can lead to strains with expanded host range.

  6. Effects of dietary combination of chromium and biotin on egg production, serum metabolites, and egg yolk mineral and cholesterol concentrations in heat-distressed laying quails.

    Science.gov (United States)

    Sahin, K; Onderci, M; Sahin, N; Gursu, M F; Vijaya, J; Kucuk, O

    2004-11-01

    Chromium picolinate is used in the poultry diet because of its antistress effects in addition to the fact that the requirement for it is increased during stress. This study was conducted to determine if the negative effects of high ambient temperature (34 degrees C) on egg production, egg quality, antioxidant status, and cholesterol and mineral content of egg yolk could be alleviated by combination of chromium picolinate and biotin (0.6/2.0; Diachrome, as formulated by Nutrition 21 Inc.), in laying Japanese quails (Coturnix coturnix japanica). Quails (n= 240; 50 d old) were divided into 8 groups, 30 birds per group. The quails were fed either a basal diet or the basal diet supplemented with 2, 4, or 8 mg of Diachrome/kg diet. Birds were kept at 22 degrees C and 53% relative humidity (RH). At 14 wk of age, the thermoneutral (TN) group remained in the same temperature as at the beginning of experiment, whereas the heat stress (HS) group was kept in an environment-controlled room (34 degrees C and 41% RH) for 3 wk. Heat exposure decreased performance when the basal diet was fed (p = 0.001). Diachrome supplementation at 4 and 8 mg/kg diet, increased feed intake (p = 0.05), egg production (p = 0.05), feed efficiency (p = 0.01), egg weight (p = 0.05), and Haugh unit (p = 0.01) in quails reared under heat stress conditions. Heat exposure increased concentrations of serum malondialdehyde (MDA) (p = 0.001), glucose, and cholesterol (p = 0.01), which were elevated by supplemental Diachrome (p < or = 0.05). Egg yolk Cr, Zn, and Fe (p = 0.01) concentrations increased linearly, whereas MDA and cholesterol concentrations decreased (p = 0.05) as dietary Diachrome supplementation increased in HS groups. Similar effects of supplementation on serum levels of glucose and cholesterol (p = 0.05) and egg yolk concentrations of cholesterol (p = 0.05) and Cr (p = 0.01) were observed in TN groups. No significant differences in other values were observed in the TN groups. Results of the

  7. Inter-joint coordination between hips and trunk during downswings: Effects on the clubhead speed.

    Science.gov (United States)

    Choi, Ahnryul; Lee, In-Kwang; Choi, Mun-Taek; Mun, Joung Hwan

    2016-10-01

    Understanding of the inter-joint coordination between rotational movement of each hip and trunk in golf would provide basic knowledge regarding how the neuromuscular system organises the related joints to perform a successful swing motion. In this study, we evaluated the inter-joint coordination characteristics between rotational movement of the hips and trunk during golf downswings. Twenty-one right-handed male professional golfers were recruited for this study. Infrared cameras were installed to capture the swing motion. The axial rotation angle, angular velocity and inter-joint coordination were calculated by the Euler angle, numerical difference method and continuous relative phase, respectively. A more typical inter-joint coordination demonstrated in the leading hip/trunk than trailing hip/trunk. Three coordination characteristics of the leading hip/trunk reported a significant relationship with clubhead speed at impact (r joint coordination strategies have the great potential to use a biomechanical guideline to improve the golf swing performance of unskilled golfers.

  8. The Effect of Calcium and Available Phosphorus Levels on Performance, Egg Quality and Bone Characteristics of Japanese Quails at End of the Egg-Production Phase

    Directory of Open Access Journals (Sweden)

    CLN Ribeiro

    Full Text Available ABSTRACT Calcium (Ca and available phosphorus (avP requirements for egg production are different between the beginning and the end of the egg-production cycle. The objective of this study was to estimate the Ca and avP requirements of Japanese quails at end of the production phase. In total, 256 Japanese quails with 48 weeks of age were randomly distributed in 2 x 2 factorial arrangement consisting of two Ca levels (29 and 38 g/kg and two avP levels (1.5 and 3.0 g/kg, totaling four treatments with eight replicates of eight hens each. The variables evaluated were feed intake (FI; egg production (EP; marketable egg production (MEP; egg weight (EW; egg mass (EM; feed conversion ratio per egg mass (FCRM; feed conversion ratio per dozen eggs (FCRD; livability (L; yolk weight (YW, albumen weight (AW, eggshell weight (SW; yolk percentage (YP, albumen percentage (AP, eggshell percentage (SP, specific egg weight (SEW; bone calcium percentage (BCa, bone phosphorus percentage (BP, bone ash weight (Bash and bone ash percentage (PBash. There was no interaction between Ca and avP levels for any of the evaluated parameters, except for SEW. Quail performance was not influenced by the treatments, except for MEP. Bone characteristics were not influenced by the tested dietary Ca and avP levels. However, SW and SP increased and AP decreased as dietary Ca level increased. The dietary supplementation of 38 g Ca/kg and 3.0 g avP/kg may increase marketable egg production and the egg quality of Japanese quails at end of the production cycle.

  9. [Intravascular Hemolysis Caused by Stenosis of an Elephant Trunk;Report of a Case].

    Science.gov (United States)

    Takamaru, Rikako; Kawahito, Koji; Aizawa, Kei; Misawa, Yoshio

    2017-07-01

    Symptomatic intravascular hemolysis after prosthetic aortic graft replacement is rare. It is primarily attributed to mechanical injury of red blood cells caused by stenosis of the vascular graft. A 50-year-old man presented with hemolytic anemia, 5 years after total arch replacement with an elephant trunk for type A aortic dissection. The hemolysis was caused by graft stenosis of the elephant trunk. Endovascular treatment for the stenotic elephant trunk was successfully performed. The postoperative course was uneventful, and the hemolysis was resolved immediately after operation.

  10. Is the basic trunk control recovery different between stroke patients with right and left hemiparesis?

    Science.gov (United States)

    Pappalardo, A; Ciancio, M R; Patti, F

    2014-01-01

    Basic trunk movement control is often impaired after stroke and its recovery is a "miliary stone" in rehabilitation. In this prospective, observational, parallel-group study, we investigated whether there are differences in terms of post-stroke recovery of basic trunk control between patients with left or with right hemiparesis. We recruited 94 patients with loss of postural trunk control due to stroke. Patients were divided into Group A (48 patients with left hemiparesis) and Group B (46 patients with right hemiparesis). We administered the Trunk Control Test (TCT) and the 13 motor items included on the Functional Independence Measure. Evaluation was performed at admission (To) and discharge (T1). TCT increased respectively from 46.7 ± 23.3 to 62.6 ± 19.5 (mean ± standard deviation-SD, p hemiparesis could affect the degree of recovery of basic trunk control after stroke. Patients with right hemiparesis benefit more than those with left hemiparesis. Improvement of basic trunk control was not responsible for an advantage on functional independence.

  11. Effects of dietary symbiotic supplementation on growth performance and duodenum histology of Japanese quail (Coturnix coturnix Japonica reared in different flooring systems

    Directory of Open Access Journals (Sweden)

    Isa Coskun

    Full Text Available ABSTRACT The objective of this study was to determine the effect of dietary symbiotic supplementation on the growth performance and duodenum histological parameters of quail reared in different flooring systems. A total of 160 mixed-sex healthy quail (47±0.32 g aged 14 days were used in a 2 × 2 factorial experimental design with four replicates, each including five males and five females. Two flooring systems (wire floor as control and wood shavings bedding and two dietary treatments (symbiotic supplementation and no supplementation were tested. Birds were transferred to four-tier cages for the trial. Each kilogram of the commercial diet included 224 g crude protein and 3,080 kcal metabolizable energy. The experiment lasted 21 days. Daily weight gain and gastrointestinal tract weight were statistically higher in the wood shavings and wood shavings + symbiotic-supplemented groups than in control group. Villi length was higher in the wood shavings + symbiotic and symbiotic-supplemented groups than in control and wood shavings groups. The wood shavings groups had longer villi than control group. Villi width was higher in wood shaving + symbiotic-supplemented groups compared with the other treatment groups. The litter system of wood shavings and symbiotic supplementation provide better growth performance to quail by developing their duodenum histomorphological parameters and digestive tract.

  12. Removal of oil palm trunk lignin in ammonium hydroxide pretreatment

    Science.gov (United States)

    Az-Zahraa, Balqis; Zakaria, Sarani; Daud, Muhammad F. B.; Jaafar, Sharifah Nabihah Syed

    2018-04-01

    Alkaline pretreatment using ammonium hydroxide, NH4OH serves as one of a process to remove lignin from lignocellulosic biomass such as oil palm trunk fiber. In this study, the effect of NH4OH pretreatment on removal of oil palm trunk lignin was investigated. The oil palm trunk fiber was dissolved in NH4OH with different concentrations (6, 8 and 10 %), different duration (3, 5 and 7 h) and temperatures (60, 80 and 100 °C). The samples were analyzed by using UV-Vis to estimate the concentration of extracted lignin. The result indicates that the optimum conditions to gain maximum extracted lignin were 8% NH4OH, 100 °C and 5 h with concentration of 64 mgL-1 while the lowest was at 6% NH4OH, 100 °C and 5 h with concentration of 62.5 mgL-1.

  13. Energy cost of running instability evaluated with wearable trunk accelerometry.

    Science.gov (United States)

    Schütte, Kurt H; Sackey, Saint; Venter, Rachel; Vanwanseele, Benedicte

    2018-02-01

    Maintaining stability under dynamic conditions is an inherent challenge to bipedal running. This challenge may impose an energetic cost (Ec) thus hampering endurance running performance, yet the underlying mechanisms are not clear. Wireless triaxial trunk accelerometry is a simple tool that could be used to unobtrusively evaluate these mechanisms. Here, we test a cost of instability hypothesis by examining the contribution of trunk accelerometry-based measures (triaxial root mean square, step and stride regularity, and sample entropy) to interindividual variance in Ec (J/m) during treadmill running. Accelerometry and indirect calorimetry data were collected concurrently from 30 recreational runners (16 men; 14 women) running at their highest steady-state running speed (80.65 ± 5.99% V̇o 2max ). After reducing dimensionality with factor analysis, the effect of dynamic stability features on Ec was evaluated using hierarchical multiple regression analysis. Three accelerometry-based measures could explain an additional 10.4% of interindividual variance in Ec after controlling for body mass, attributed to anteroposterior stride regularity (5.2%), anteroposterior root mean square ratio (3.2%), and mediolateral sample entropy (2.0%). Our results lend support to a cost of instability hypothesis, with trunk acceleration waveform signals that are 1) more consistent between strides anteroposterioly, 2) larger in amplitude variability anteroposterioly, and 3) more complex mediolaterally and are energetically advantageous to endurance running performance. This study shows that wearable trunk accelerometry is a useful tool for understanding the Ec of running and that running stability is important for economy in recreational runners. NEW & NOTEWORTHY This study evaluates and more directly lends support to a cost of instability hypothesis between runners. Moreover, this hypothesis was tested using a minimalist setup including a single triaxial trunk mounted accelerometer

  14. Effect of boiled oil as dietary supplements for Japanese Quail on serum protein fractions and intestinal and hepatic cells

    International Nuclear Information System (INIS)

    Faramawy, A.A.; Soliman, S.M.; Fahmy, Y.M.O.

    2006-01-01

    This study was designed to examine the levels of serum protein fractions and testosterone, in addition to histopathological changes of small intestine and liver of Japanese quail following feeding with diets containing different concentrations of boiled oil (BO). Male Japanese quails (n=120), arranged into four groups each of three replicates, were supplemented with BO at 1%, 2% and 4% at the expense of 4% cotton seed oil (CSO). At the end of the experiment (10 weeks), three birds from each replicate were slaughtered and serum, small intestine and liver were collected for the determination of total testosterone, total protein, albumin and globulin fractions and fat studying the histology of small intestine and liver. The data revealed that feeding with BO led to decrease of total proteins and β-globulins in addition to cellular damages of small intestine and liver. This effect was increased with increasing the BO concentration in the diet

  15. The effect of reverse triiodothyronine (rT3) treatment on the plasma levels of iodothyronines in growing Japanese quails

    International Nuclear Information System (INIS)

    Niezgoda, J.; Wronska-Fortuna, D.; Sechman, A.; Bobek, S.; Sowa, J.

    1994-01-01

    It has been established that 3.3',5-triiodothyronine (T 3 ) acts hipermetabolically, whereas 3'3.5'-triiodothyronine (reverse T 3 , rT 3 ) acts hypometabolically. The normal ratio of T 3 to rT 3 in domestic flows fluctuates around 10. Since the excess of T 3 may promote catabolic processes and lower weight gain, the aim of this experiment was to find the optimal ratio of T 3 :rT 3 in blood plasma which corresponds with the greatest weight gain in Japanese quail. Reverse T 3 was given in drinking water (1 μg rT 3 /ml) for 3, 10, 20 or 30 days. It has been found that T 3 /rT 3 ratio of about 5, after 20 days of rT 3 administration, stimulated the weight gain of Japanese quail of both sexes from 7 to 44% with more pronounced effect in female birds. (author). 26 refs, 4 figs, 1 tab

  16. Comparison of Two- and Three-Dimensional Methods for Analysis of Trunk Kinematic Variables in the Golf Swing.

    Science.gov (United States)

    Smith, Aimée C; Roberts, Jonathan R; Wallace, Eric S; Kong, Pui; Forrester, Stephanie E

    2016-02-01

    Two-dimensional methods have been used to compute trunk kinematic variables (flexion/extension, lateral bend, axial rotation) and X-factor (difference in axial rotation between trunk and pelvis) during the golf swing. Recent X-factor studies advocated three-dimensional (3D) analysis due to the errors associated with two-dimensional (2D) methods, but this has not been investigated for all trunk kinematic variables. The purpose of this study was to compare trunk kinematic variables and X-factor calculated by 2D and 3D methods to examine how different approaches influenced their profiles during the swing. Trunk kinematic variables and X-factor were calculated for golfers from vectors projected onto the global laboratory planes and from 3D segment angles. Trunk kinematic variable profiles were similar in shape; however, there were statistically significant differences in trunk flexion (-6.5 ± 3.6°) at top of backswing and trunk right-side lateral bend (8.7 ± 2.9°) at impact. Differences between 2D and 3D X-factor (approximately 16°) could largely be explained by projection errors introduced to the 2D analysis through flexion and lateral bend of the trunk and pelvis segments. The results support the need to use a 3D method for kinematic data calculation to accurately analyze the golf swing.

  17. Distribution of nanomole quantities of 235U in young and adult Japanese quail and in the F1 generation. Comparison with 153Gd

    International Nuclear Information System (INIS)

    Robinson, G.A.

    1988-01-01

    Enriched uranium, 93.16% for 235 U, served as a tracer of uranium deposition in an avian species, the Japanese quail. A second label, 153 Gd, provided for monitoring of procedures and for estimation of the 235 U content of live eggs. Depositions of 235 U were greater than for 153 Gd in all tissues except the yolk sac and the liver. Skeletal levels for 235 U were age- and sex-dependent. Feathers contained only 0.11% of the 235 U tracer in contrast to 50% of the endogenous uranium. The results show that 235 U provides for tracing uranium metabolism in small animals, since in quail the tracer increased the uranium burden of the body by only 1-8%. (author)

  18. Muscle Power during Standing and Seated Trunk Rotations with Different Weights

    Directory of Open Access Journals (Sweden)

    Erika Zemková

    2017-10-01

    Full Text Available This study compares peak and mean power during standing and seated trunk rotations with different weights. Twenty seven fit men completed four trials of trunk rotations in both standing and seated positions with a bar weight of 5.5, 10.5, 15.5, and 20 kg placed on the shoulders. The FiTRO Torso Premium was used to monitor basic biomechanical parameters throughout the movement. Results showed significantly higher peak power during standing than seated trunk rotations at weights of 20 kg (274.4±63.5 vs. 206.4±54.6 W, p=0.004, 15.5 kg (371.2±93.9 vs. 313.5±72.3 W, p=0.007, and 10.5 kg (336.9±77.8 vs. 286.3±66.0 W, p=0.009 but not at 5.5 kg (191.6±46.2 vs. 166.0±37.0 W, p=0.061. Similarly, mean power in the acceleration phase of trunk rotations was significantly higher when performed in standing than seated position at weights of 20 kg (143.2±32.1 vs. 101.9±23.7 W, p=0.008, 15.5 kg (185.1±42.3 vs. 150.4±36.5 W, p=0.019, and 10.5 kg (169.8±40.7 vs. 139.7±31.6 W, p=0.024 but not at 5.5 kg (107.4±29.4 vs. 86.5±21.1 W, p=0.111. Furthermore, peak and mean power during standing trunk rotations significantly correlated with values achieved in the seated position at the weight of 5.5 kg (r=0.684, p=0.027; r=0.676, p=0.033 but not at 10.5 kg (r=0.589, p=0.089; r=0.552, p=0.143, 15.5 kg (r=0.493, p=0.243; r=0.436, p=0.298, and 20 kg (r=0.357, p=0.361; r=0.333, p=0.417. In conclusion, power production is greater during standing as compared to seated trunk rotations, with more pronounced differences at higher weights. This fact has to be taken into account when training and testing the trunk rotational power.

  19. CONTENT OF GLYCOGEN IN LIVER AND KETOBODIES IN BLOOD OF JAPANESE QUAILS (COTURNIX COTURNIX JAPONICA DURING STARVATION ENVISAGED IN THE METHODS OF BALANCE EXPERIMENTS

    Directory of Open Access Journals (Sweden)

    Petar Batsalov

    2006-12-01

    Full Text Available The biochemical indexes “glycogen in liver” and “ketones in blood” of 0-72 hours feed deprived (according to methods for balanced experiments Japanese quails with and without energy additives were determined. There were 2 groups of birds- 1-st without energy supplement, 2-nd- fed with 1 g. glucose per os (as 25% solution – twice in 24 hours. The levels of liver glycogen in all the food-deprived quails were signifi cantly lower from -6910 (12-th hour of starving-to 4960mg/kg (72 hour of starving compared to the levels of the same index in fed birds (11990 mg/kg tissue. In the birds receiving energy additive they were higher compared to those deprived of the additive throughout the experimental period. The content of ketones in blood of the control birds was 0.015 mmol/l. The same index increased to 0.027 mmol/l in the feed and energy additive deprived group after the 36 hour of starving, but in the group became energy support, the contents of ketones were lower for the whole period of starving. The energy additive (1g glucose/24 hours helped the maintenance of the energy metabolism during continuous food depriving of the experimental quails.

  20. Replacing soybean oil with increasing levels of soybean acid oil in diets of coturnix quails (Coturnix coturnix coturnix) and the effects on egg quality.

    Science.gov (United States)

    Roll, Aline A P; Forgiarini, Juliana; Xavier, Eduardo G; Lopes, Débora C N; Roll, Victor F B; Rutz, Fernando

    2018-01-01

    The effects of increasing levels of soybean acid oil in diets of quails on the quality of eggs were evaluated over a period of 56 days. A completely randomized design with five treatment levels of soybean acid oil (0, 2, 4, 6, and 8%) as a replacer for soybean oil and eight replicates of two quails each were used. A total of 240 fresh eggs were used for quality analysis, and 400 eggs were stored at 23ºC over a period of 0, 7, 14, 21, and 28 days for analysis of shelf-life. Polynomial regression and ANOVA with repeated measurements and Tukey´s tests were used. Soybean acid oil linearly increased the intensity of red (a* = -5.26 + 0.14 x, R2 = 0.89, P = 0.01) and yellow (b* = 42.32 + 0.44 x, R2 = 0.88 P = 0.01). All other variables of egg quality were not affected by the treatments, with the exception of sensory attributes, such as odor and aftertaste, which were more pronounced with soybean acid oil. In conclusion, soybean acid oil affects the intensity of yellow and red color of the yolk. Trained assessors detected differences in odor and aftertaste of eggs when soybean acid oil was included in the quail diet.

  1. The effect of diet and host genotype on ceca microbiota of Japanese quail fed a cholesterol enriched diet

    Directory of Open Access Journals (Sweden)

    Shasha eLiu

    2015-10-01

    Full Text Available Two Japanese quail strains, respectively atherosclerosis-susceptible (SUS and –resistant (RES, have been shown to be good models to study cholesterol metabolism and transportation associated with atherosclerosis. Our objective was to examine possible difference in cecal microbiota between these strains when fed a control diet and a cholesterol enriched diet, to determine how host genotype and diet could affect the cecal microbiome that may play a part in cholesterol metabolism. A factorial study with both strains and two diets (control, cholesterol was carried out. Cecal content was collected from 12 week old quail that have been on their respective diets for 6 weeks. DNA was extracted from the samples and the variable region 3 to 5 of the bacterial 16S rRNA gene was amplified. The amplicon libraries were subjected to pyrosequencing. Principal Component Analysis (PCA of β-diversity showed four distinct microbiota communities that can be assigned to the 4 treatment groups (RES/control, RES/cholesterol, SUS/control, SUS/cholesterol. At the Phylum level, the 4 treatment groups has distinct Firmicutes community characteristics but no significant difference in Bacteroidetes. Eubacterium dolichum was rare in RES/control but became overabundant in RES/cholesterol. An unclassified species of Lactobacillaceae was found in abundance in SUS/control but the same species was rare in RES/cholesterol. On the other hand, two Lactobacillus species were only found in RES/control and an unclassified Lachnospiraceae species was abundant in RES/cholesterol but rare in SUS/control. The abundance of 4 species of Lachnospiraceae, 3 species of Ruminococcaceae and one species of Coprobacillaceae was positively correlated with plasma Total Cholesterol, plasma LDL, and LDL/HDL ratio. Our study of cecal microbiota in these quail has demonstrated that selection for susceptibility/resistance to diet induced atherosclerosis has also affected the quail’s cecal environment

  2. Plasticity and alterations of trunk motor cortex following spinal cord injury and non-stepping robot and treadmill training.

    Science.gov (United States)

    Oza, Chintan S; Giszter, Simon F

    2014-06-01

    Spinal cord injury (SCI) induces significant reorganization in the sensorimotor cortex. Trunk motor control is crucial for postural stability and propulsion after low thoracic SCI and several rehabilitative strategies are aimed at trunk stability and control. However little is known about the effect of SCI and rehabilitation training on trunk motor representations and their plasticity in the cortex. Here, we used intracortical microstimulation to examine the motor cortex representations of the trunk in relation to other representations in three groups of chronic adult complete low thoracic SCI rats: chronic untrained, treadmill trained (but 'non-stepping') and robot assisted treadmill trained (but 'non-stepping') and compared with a group of normal rats. Our results demonstrate extensive and significant reorganization of the trunk motor cortex after chronic adult SCI which includes (1) expansion and rostral displacement of trunk motor representations in the cortex, with the greatest significant increase observed for rostral (to injury) trunk, and slight but significant increase of motor representation for caudal (to injury) trunk at low thoracic levels in all spinalized rats; (2) significant changes in coactivation and the synergy representation (or map overlap) between different trunk muscles and between trunk and forelimb. No significant differences were observed between the groups of transected rats for the majority of the comparisons. However, (3) the treadmill and robot-treadmill trained groups of rats showed a further small but significant rostral migration of the trunk representations, beyond the shift caused by transection alone. We conclude that SCI induces a significant reorganization of the trunk motor cortex, which is not qualitatively altered by non-stepping treadmill training or non-stepping robot assisted treadmill training, but is shifted further from normal topography by the training. This shift may potentially make subsequent rehabilitation with

  3. Non PCR-amplified Transcripts and AFLP fragments as reduced representations of the quail genome for 454 Titanium sequencing

    Directory of Open Access Journals (Sweden)

    Leterrier Christine

    2010-07-01

    Full Text Available Abstract Background SNP (Single Nucleotide Polymorphism discovery is now routinely performed using high-throughput sequencing of reduced representation libraries. Our objective was to adapt 454 GS FLX based sequencing methodologies in order to obtain the largest possible dataset from two reduced representations libraries, produced by AFLP (Amplified Fragment Length Polymorphism for genomic DNA, and EST (Expressed Sequence Tag for the transcribed fraction of the genome. Findings The expressed fraction was obtained by preparing cDNA libraries without PCR amplification from quail embryo and brain. To optimize the information content for SNP analyses, libraries were prepared from individuals selected in three quail lines and each individual in the AFLP library was tagged. Sequencing runs produced 399,189 sequence reads from cDNA and 373,484 from genomic fragments, covering close to 250 Mb of sequence in total. Conclusions Both methods used to obtain reduced representations for high-throughput sequencing were successful after several improvements. The protocols may be used for several sequencing applications, such as de novo sequencing, tagged PCR fragments or long fragment sequencing of cDNA.

  4. Application of Ground-Penetrating Radar for Detecting Internal Anomalies in Tree Trunks with Irregular Contours.

    Science.gov (United States)

    Li, Weilin; Wen, Jian; Xiao, Zhongliang; Xu, Shengxia

    2018-02-22

    To assess the health conditions of tree trunks, it is necessary to estimate the layers and anomalies of their internal structure. The main objective of this paper is to investigate the internal part of tree trunks considering their irregular contour. In this respect, we used ground penetrating radar (GPR) for non-invasive detection of defects and deteriorations in living trees trunks. The Hilbert transform algorithm and the reflection amplitudes were used to estimate the relative dielectric constant. The point cloud data technique was applied as well to extract the irregular contours of trunks. The feasibility and accuracy of the methods were examined through numerical simulations, laboratory and field measurements. The results demonstrated that the applied methodology allowed for accurate characterizations of the internal inhomogeneity. Furthermore, the point cloud technique resolved the trunk well by providing high-precision coordinate information. This study also demonstrated that cross-section tomography provided images with high resolution and accuracy. These integrated techniques thus proved to be promising for observing tree trunks and other cylindrical objects. The applied approaches offer a great promise for future 3D reconstruction of tomographic images with radar wave.

  5. WOOD ANATOMY OF ROOT, TRUNK AND BRANCH FROM BARBATIMÃO (Stryphnodendron adstringens (Mart Coville

    Directory of Open Access Journals (Sweden)

    Selma Lopes Goulart

    2015-06-01

    Full Text Available This study aimed to analyze the wood of root, trunk and branch from barbatimão (Stryphnodendron adstringens in the cerrado area, in Lavras (Minas Gerais State, Southeastern Brazil. Trunk and branch wood samples were removed at 0, 25, 50, 75 and 100% of the trunk and branch total height. Root wood samples were removed at 40 cm depth soil. Qualitatively the barbatimão wood has distinct growth layers for the trunk and branch; at the root they are poorly defined. Diffuse porosity. Simple perforation plates. Inter-vascular and vessel-ray. Bordered, alternate and with garnishes. Vasicentric paratracheal parenchyma. Uniseriate rays predominant, presenting multiseriate rays. The rays are heterocellular, where the ray body is formed by procumbent cells and margins with square and upright cells. It was observed that homogeneous rays are formed only by procumbent cells. Crystals are present at the axial and radial parenchyma cells, and in the fibers. Quantitatively the relevant features to the wood were: higher vessel frequency in branch wood; thicker wall fibers in the root wood and larger rays in the trunk.

  6. Old oil palm trunk: A promising source of sugars for bioethanol production

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, H.; Ohara, S. [Department of Global Agricultural Sciences, University of Tokyo, 1-1-1, Yayoi, Bunkyo 113-8657 (Japan); Forestry and Forest Products Research Institute, 1 Matsunosato, Tsukuba, Ibaraki 305-8687 (Japan); Tanaka, R.; Yamamoto, K. [Forestry and Forest Products Research Institute, 1 Matsunosato, Tsukuba, Ibaraki 305-8687 (Japan); Sulaiman, O.; Hashim, R.; Hamid, Z.A.A.; Yahya, M.K.A. [School of Industrial Technology, Universiti Sains Malaysia, 11800, Penang (Malaysia); Kosugi, A.; Arai, T.; Murata, Y.; Nirasawa, S. [Japan International Research Center for Agricultural Sciences, 1-1, Owashi, Tsukuba, Ibaraki 305-8686 (Japan); Mohd Yusof, Mohd Nor; Ibrahim, Wan Asma [Forest Research Institute Malaysia (FRIM), Kepong, 52109 Selangor (Malaysia); Mori, Y. [Department of Global Agricultural Sciences, University of Tokyo, 1-1-1, Yayoi, Bunkyo 113-8657 (Japan); Japan International Research Center for Agricultural Sciences, 1-1, Owashi, Tsukuba, Ibaraki 305-8686 (Japan)

    2010-11-15

    Oil palm trees are replanted at an interval of approximately 25 years because of decreased oil productivity of old trees. Consequently the felled trunks are the enormous amount of biomass resources in the palm oil producing countries such as Malaysia and Indonesia. In this report, we found that the felled oil palm trunk contains large quantity of sap, which accounts for approximately 70% of the whole trunk weight, and that sugars existing in the sap increased remarkably during storage after logging. Total sugar in the sap increased from 83 mg ml{sup -1} to 153 mg ml{sup -1}, the concentration comparable to that of sugar cane juice, after 30 days of storage, followed by the gradual decrease. The sugars contained in the sap were glucose, sucrose, fructose and galactose, all of which are fermentable by ordinary industrial yeast strains. The results indicate that old oil palm trunk becomes a promising source of sugars by proper aging after logging and, thus, its sap can be a good feedstock for bioethanol. (author)

  7. Anatomical variations of hepatic arterial system, coeliac trunk and renal arteries: an analysis with multidetector CT angiography.

    Science.gov (United States)

    Ugurel, M S; Battal, B; Bozlar, U; Nural, M S; Tasar, M; Ors, F; Saglam, M; Karademir, I

    2010-08-01

    The purpose of our investigation was to determine the anatomical variations in the coeliac trunk-hepatic arterial system and the renal arteries in patients who underwent multidetector CT (MDCT) angiography of the abdominal aorta for various reasons. A total of 100 patients were analysed retrospectively. The coeliac trunk, hepatic arterial system and renal arteries were analysed individually and anatomical variations were recorded. Statistical analysis of the relationship between hepatocoeliac variations and renal artery variations was performed using a chi(2) test. There was a coeliac trunk trifurcation in 89% and bifurcation in 8% of the cases. Coeliac trunk was absent in 1%, a hepatosplenomesenteric trunk was seen in 1% and a splenomesenteric trunk was present in 1%. Hepatic artery variation was present in 48% of patients. Coeliac trunk and/or hepatic arterial variation was present in 23 (39.7%) of the 58 patients with normal renal arteries, and in 27 (64.3%) of the 42 patients with accessory renal arteries. There was a statistically significant correlation between renal artery variations and coeliac trunk-hepatic arterial system variations (p = 0.015). MDCT angiography permits a correct and detailed evaluation of hepatic and renal vascular anatomy. The prevalence of variations in the coeliac trunk and/or hepatic arteries is increased in people with accessory renal arteries. For that reason, when undertaking angiographic examinations directed towards any single organ, the possibility of variations in the vascular structure of other organs should be kept in mind.

  8. The effects of Pilates breathing trainings on trunk muscle activation in healthy female subjects: a prospective study.

    Science.gov (United States)

    Kim, Sung-Tae; Lee, Joon-Hee

    2017-02-01

    [Purpose] To investigate the effects of Pilates breathing on trunk muscle activation. [Subjects and Methods] Twenty-eight healthy female adults were selected for this study. Participants' trunk muscle activations were measured while they performed curl-ups, chest-head lifts, and lifting tasks. Pilates breathing trainings were performed for 60 minutes per each session, 3 times per week for 2 weeks. Post-training muscle activations were measured by the same methods used for the pre-training muscle activations. [Results] All trunk muscles measured in this study had increased activities after Pilates breathing trainings. All activities of the transversus abdominis/internal abdominal oblique, and multifidus significantly increased. [Conclusion] Pilates breathing increased activities of the trunk stabilizer muscles. Activation of the trunk muscle indicates that practicing Pilates breathing while performing lifting tasks will reduce the risk of trunk injuries.

  9. Duplicated facial nerve trunk with a first branchial cleft cyst.

    Science.gov (United States)

    Hinson, Drew; Poteet, Perry; Bower, Charles

    2014-03-01

    First branchial cleft anomalies are rare and their various anatomical relationships to the facial nerve have been described. We encountered a 15-year-old female with a type II first branchial cleft cyst presenting as a right neck mass that we found during surgical excision to transverse two main facial nerve trunks. To our knowledge, this is the first reported case of a first branchial cleft anomaly in conjunction with a duplicated facial nerve trunk. © 2013 The American Laryngological, Rhinological and Otological Society, Inc.

  10. Chondroid lipoma of the trunk: MRI appearance and pathologic correlation

    Energy Technology Data Exchange (ETDEWEB)

    Boets, An; Mieghem, Isabelle M.Van; Breuseghem, Iwan Van [Catholic University Leuven Radiology, University Hospitals, Leuven (Belgium); Sciot, Raf [Catholic University Leuven, Pathology, University Hospitals, Leuven (Belgium)

    2004-11-01

    Chondroid lipoma is a rare tumour of adipose tissue, bearing a strikingly close pathologic resemblance to myxoid liposarcoma and extraskeletal myxoid chondrosarcoma. Unlike these malignant tumours, chondroid lipoma has a non-aggressive behaviour and does not require radical treatment. Although repeatedly reported in the proximal extremities and limb girdles, this rare entity may less frequently be observed in the trunk. We describe the imaging findings of a chondroid lipoma in the trunk and provide a discussion on the radiologic-pathologic correlation and differential diagnosis. (orig.)

  11. The central role of trunk control in the gross motor function of children with cerebral palsy

    DEFF Research Database (Denmark)

    Curtis, Derek John; Butler, Penny; Saavedra, Sandy

    2015-01-01

    . The participants were tested using the Gross Motor Function Measure (GMFM), the Pediatric Evaluation of Disability Inventory (PEDI), and the Segmental Assessment of Trunk Control (SATCo). Results Linear regression analysis showed a positive relationship between the segmental level of trunk control and age......, with both gross motor function and mobility. Segmental trunk control measured using the SATCo could explain between 38% and 40% of variation in GMFM and between 32% and 37% of variation in PEDI. Interpretation This study suggests a strong association between segmental trunk postural control and gross motor...

  12. The Effects of Hyperthyroidism and Hypothyroidism Over the Egg Quality in Japanese Quails (Coturnix coturnix Japonica)

    OpenAIRE

    ÖZCAN, Mukaddes; ÇÖTELİOĞLU, Ülker

    1998-01-01

    In this study, the influence of hyperthyroidism and hypothyroidism on the egg quality in 5 week-female Japanese quails was investigated. Hyperthyroidsm and hypothyroidism were achieved by mixing 0.4 mg/100 g. levatrocsyn-sodium and % 0.2 g. propylthiouracil (PTU) in to the food during the 5 weeks period, respectively. It was found that egg weight, albumen weight, shell weight and shell thickness values in both trial groups reduced (P

  13. Effect of photoperiod on body weight gain, and daily energy intake and energy expenditure in Japanese quail (Coturnix c. Japonica)

    NARCIS (Netherlands)

    Boon, P; Visser, GH; Daan, S

    2000-01-01

    Effect of photoperiod and food duration on body weight gain, energy intake, energy expenditure, and sexual development were investigated in two strains of Japanese quail (Coturnix c. japonica), bred for meat (broilers) or egg production (layers), from 7 to 71 days of age. In a first experiment

  14. In ovo exposure quail assay for risk assessment of endocrine disrupting chemicals.

    Science.gov (United States)

    Kamata, Ryo; Takahashi, Shinji; Shimizu, Akira; Morita, Masatoshi; Shiraishi, Fujio

    2006-12-01

    Although there are in vivo assays using various organisms for the risk assessment of chemicals with endocrine disrupting properties, effective experimental methods for avian species are still under debate. We have developed an in ovo exposure assay using Japanese quail eggs, aimed at assessing disrupting effects on avian reproductive development and function. Hybrid eggs from Brazilian Brown male and White Egg female quails, which can be genetically sexed by their plumage color after hatching, were prepared, and test materials dissolved in olive oil were injected into the air-chamber on day 10 of incubation. After sexual maturation of hatched chicks, we observed egg production by females and the egg quality and male-typical reproductive behavior, and then examined reproductive system morphology and serum steroid concentrations in both sexes. Treatment with a synthetic estrogen, diethylstilbestrol (DES, 0.5-50 ng/g egg), dose-dependently reduced the eggshell thickness and strength of eggs. A few females treated with 5 ng/g DES per egg produced soft-shelled/ unmarked eggs, and all laying females treated with 50 ng/g egg produced eggs completely lacking shells. DES also induced shortening of the left oviduct and abnormal development of the right oviduct in a dose-dependent manner, while testis weight was reduced symmetrically. In addition, 2,2',4',6'-tetrachlorobiphenyl-4-ol (10-1,000 ng/g egg), which previously showed relatively high estrogenic activity in vitro, caused dose-dependent shortening of the left oviduct and reduction in testis weight. The methods for evaluating endocrine disrupting effects and preparing experimental birds proposed in the present study are expected to facilitate assays for avian reproductive toxicology.

  15. Salmonella spp. in meat-type quails (Coturnix coturnix coturnix in the State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    OC de Freitas Neto

    2013-09-01

    Full Text Available In the present study Salmonella spp. was surveyed in four flocks of meat-type quails reared in a farm that also had processing plant on site, located in the region of Bastos, state of São Paulo, Brazil. Meconium samples of one-day-old quail chicks were collected from transport cardboard boxes. Cecal content was collected on days 7, 14, 21, 28 and 35 of rearing. At 36 days of age, birds were slaughtered in the farm's processing plant, where two samples of water from the scalding and the chilling tanks and four carcasses per flock were collected. All samples were examined for Salmonella spp. using traditional bacteriological methods. Salmonella spp. was present in meconium samples of three flocks and in cecal feces of the four flocks. This bacterium was also isolated in the chiller water and in the carcasses of three of the evaluated flocks and in the scalding water of one flock. In this study, S. enterica subspecies enterica 4, 5, 12; S. Corvalis; S. Give; S. Lexington; S. Minnesota; S. Schwarzengrund; S. Rissen and S. Typhimurium were the eight serovars identified.

  16. Dispersal of estradiol-17 beta from the site of injection in the pectoral muscles of Japanese quail

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, G.A.

    1985-09-01

    Exogenous estrogens, if given in sufficient quantity, stimulate vitellogenesis in the males of vitellogenic species. In the present study, ethanolic solutions of estradiol-17 beta (E2), labeled with 16-alpha-( SVI)iodoestradiol (( SVI)E2) or sodium iodide (Na SVI), were injected into the pectoral muscles of male Japanese quail. The rate of dispersal of the estradiol from the site of injection was measured in vivo during 4 days. The curves of radioactivity appeared to be diphasic. The dose percentages forming the second phase of these curves and the half-time for the second phase were: for 16 mumol E2 (( SVI)E2 label)/100 g body weight, 84.6% and 27.6 hr; for 6 pmol ( SVI)E2/100 g, 20.0% and 17.2 hr; for 16 mumol E2 (Na SVI label)/100 g, 6.7% and 99.0 hr, and for Na SVI, 6.1% and 83.1 hr. Thus, in male quail the estradiol-induced stimulation of vitellogenesis apparently resulted from a continuing hormonal pressure on the liver during the period of study and not from a rapid flow of E2 to the liver shortly after injection.

  17. Density and Ultrasonic Characterization of Oil Palm Trunk Infected by Ganoderma Boninense Disease

    Science.gov (United States)

    Najmie, M. M. K.; Khalid, K.; Sidek, A. A.; Jusoh, M. A.

    2011-01-01

    Oil palm trunks infected by Ganoderma boninense disease have been studied using density and ultrasonic characterizations. The ultrasonic characterizations have been performed using a commercial ultrasonic instrument at the frequency of 54 kHz. The measurements have been done in 3 zones: inner zone, central zone and peripheral zone. It was found that the stem density of the oil palm infected by Ganoderma boninense disease was reduced by 50% in comparison to the original healthy trunk. From this effect the velocity of the ultrasonic wave propagated through the Longitudinal, Radial, and Tangential directions is lower for the trunk infected by Ganoderma boninense disease compared to a healthy trunk. For the 10 cm thickness of samples, the ultrasonic velocity for all transit directions was in range of 260 - 750 ms-1 for the infected sample, whereas for healthy samples was in the range of 460 - 900 ms-1. These results are very useful for the detection of the area which has been affected by the disease.

  18. Trunk-rotation flexibility in collegiate softball players with or without a history of shoulder or elbow injury.

    Science.gov (United States)

    Aragon, Veronica J; Oyama, Sakiko; Oliaro, Scott M; Padua, Darin A; Myers, Joseph B

    2012-01-01

    Throwing is a whole-body motion that requires the transfer of momentum from the lower extremity to the upper extremity via the trunk. No research to date examines the association between a history of shoulder or elbow injury and trunk flexibility in overhead athletes. To determine if injury history and trunk-rotation flexibility are associated and to compare trunk-rotation flexibility measured using 3 clinical tests: half-kneeling rotation test with the bar in the back, half-kneeling rotation test with the bar in the front, and seated rotation test in softball position players with or without a history of shoulder or elbow injury. Cross-sectional design. University softball facilities. Sixty-five female National Collegiate Athletic Association Division I softball position players. Trunk-rotation flexibility was measured with 3 clinical tests. Recent injury history was obtained using a questionnaire and verified by the certified athletic trainer. Binomial regression models were used to determine if injury history was associated with flexibility categories (high, normal, or limited tertiles) for each of the 6 (3 tests × 2 directions) trunk-rotation flexibility measures. Trunk-rotation flexibility measures from 3 clinical tests were compared between participants with and without a history of shoulder or elbow injury using analysis-of-variance models. When measured using the half-kneeling rotation test with the bar in the back and the seated rotation test, injury history and forward trunk-rotation flexibility were associated. However, no mean group differences were seen in trunk-rotation flexibility between participants with and without a history of shoulder or elbow injury. Limited forward trunk-rotation flexibility may be a risk factor for shoulder or elbow injuries. However, further study is needed to confirm the study finding.

  19. Toxicity of Pb-contaminated soil to Japanese quail (Coturnix japonica) and the use of the blood-dietary Pb slope in risk assessment

    Science.gov (United States)

    Beyer, W. Nelson; Chen, Yu; Henry, Paula; May, Thomas; Mosby, David; Rattner, Barnett A.; Shearn-Bochsler, Valerie I.; Sprague, Daniel; Weber, John

    2014-01-01

    This study relates tissue concentrations and toxic effects of Pb in Japanese quail (Coturnix japonica) to the dietary exposure of soil-borne Pb associated with mining and smelting. From 0% to 12% contaminated soil, by weight, was added to 5 experimental diets (0.12 to 382 mg Pb/kg, dry wt) and fed to the quail for 6 weeks. Benchmark doses associated with a 50% reduction in delta-aminolevulinic acid dehydratase activity were 0.62 mg Pb/kg in the blood, dry wt, and 27 mg Pb/kg in the diet. Benchmark doses associated with a 20% increase in the concentration of erythrocyte protoporphyrin were 2.7 mg Pb/kg in the blood and 152 mg Pb/kg in the diet. The quail showed no other signs of toxicity (histopathological lesions, alterations in plasma–testosterone concentration, and body and organ weights). The relation of the blood Pb concentration to the soil Pb concentration was linear, with a slope of 0.013 mg Pb/kg of blood (dry wt) divided by mg Pb/kg of diet. We suggest that this slope is potentially useful in ecological risk assessments on birds in the same way that the intake slope factor is an important parameter in risk assessments of children exposed to Pb. The slope may also be used in a tissue-residue approach as an additional line of evidence in ecological risk assessment, supplementary to an estimate of hazard based on dietary toxicity reference values.

  20. The right intercostobronchial trunk: anatomical study in respect of posterior intercostal artery origin and its clinical application.

    Science.gov (United States)

    Kocbek, Lidija; Rakuša, Mateja

    2018-01-01

    The right bronchial artery usually arises from the descending thoracic aorta as a common trunk with the right intercostal artery and forms the right intercostobronchial trunk. Both, the third right posterior intercostal artery and the right intercostobronchial trunk, are described as the most constant vessels. The focus of the study was to determine the characteristics of the right intercostobronchial trunk regarding the origins of the posterior intercostal arteries from the thoracic aorta. Posterior intercostal arteries and the right bronchial arteries were dissected in 43 human cadavers, preserved after Thiel's embalming method with intraarterial infusion of red colored latex. Postmortem examination gave valued information on the right intercostobronchial trunk present in 58% of cases. The right intercostobronchial trunk was mapped and new classification regarding the origin of the posterior intercostal arteries from the thoracic aorta suggested type A, B and C, the latter ones into subtypes 1 and 2. Type A was proportional to the origin level of the PIA and its corresponding intercostal space. Size of outer diameter at the origin did not indicate the right bronchial artery branch. In subtype 2 of type B the proximal posterior intercostal artery diameter that gave off right bronchial artery was thicker than distal one. The right bronchial artery originates from the second to the fifth posterior intercostal artery forming the right intercostobronchial trunk. Various origin and types of origin, diameter and course of the right intercostobronchial trunk described and analyzed in the study offer valuable information on the procedures involving the right intercostobronchial trunk.

  1. Contributions of individual muscles to the sagittal- and frontal-plane angular accelerations of the trunk in walking.

    Science.gov (United States)

    Klemetti, Rudolf; Steele, Katherine M; Moilanen, Petro; Avela, Janne; Timonen, Jussi

    2014-07-18

    This study was conducted to analyze the unimpaired control of the trunk during walking. Studying the unimpaired control of the trunk reveals characteristics of good control. These characteristics can be pursued in the rehabilitation of impaired control. Impaired control of the trunk during walking is associated with aging and many movement disorders. This is a concern as it is considered to increase fall risk. Muscles that contribute to the trunk control in normal walking may also contribute to it under perturbation circumstances, attempting to prevent an impending fall. Knowledge of such muscles can be used to rehabilitate impaired control of the trunk. Here, angular accelerations of the trunk induced by individual muscles, in the sagittal and frontal planes, were calculated using 3D muscle-driven simulations of seven young healthy subjects walking at free speed. Analysis of the simulations demonstrated that the abdominal and back muscles displayed large contributions throughout the gait cycle both in the sagittal and frontal planes. Proximal lower-limb muscles contributed more than distal muscles in the sagittal plane, while both proximal and distal muscles showed large contributions in the frontal plane. Along with the stance-limb muscles, the swing-limb muscles also exhibited considerable contribution. The gluteus medius was found to be an important individual frontal-plane control muscle; enhancing its function in pathologies could ameliorate gait by attenuating trunk sway. In addition, since gravity appreciably accelerated the trunk in the frontal plane, it may engender excessive trunk sway in pathologies. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Study on the effect of dry extract of Tribulus terrestris on the forage consumption rate in japanese quail (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Dimo PENKOV

    2016-02-01

    Full Text Available An investigation of Vemo Herb® additive on the forage consumption rate in Japanese quail (Pharaoh breed has been conducted. The experiment was carried out for 10 weeks with 52 female and 16 male sexually matured Japanese quails (Coturnix coturnix japonica distributed in four groups: control group (without additive, first experimental group - 4 mg*kg-1 of live weight for 10 weeks; second experimental group - 10 mg*kg-1 of live weight during the first five weeks of the study (after that the product was no more supplemented and third experimental group - 10 mg*kg-1 of live weight during the whole study period. It was observed, a tendency of decreasing of the forage consumption rate for the whole experimental period (no statistical significance for all the experimental groups compared to the control group, but some of the weekly differences are significant.

  3. An overview on STEP-NC compliant controller development

    Science.gov (United States)

    Othman, M. A.; Minhat, M.; Jamaludin, Z.

    2017-10-01

    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  4. Progression of trunk imbalance in adolescent idiopathic scoliosis with a thoracolumbar/lumbar curve: is it predictable at the initial visit?

    Science.gov (United States)

    Hwang, Chang Ju; Lee, Choon Sung; Lee, Dong-Ho; Cho, Jae Hwan

    2017-11-01

    OBJECTIVE Progression of trunk imbalance is an important finding during follow-up of patients with adolescent idiopathic scoliosis (AIS). Nevertheless, no factors that predict progression of trunk imbalance have been identified. The purpose of this study was to identify parameters that predict progression of trunk imbalance in cases of AIS with a structural thoracolumbar/lumbar (TL/L) curve. METHODS This study included 105 patients with AIS and a structural TL/L curve who were followed up at an outpatient clinic. Patients with trunk imbalance (trunk shift ≥ 20 mm) at the initial visit were excluded. All patients were followed up for more than 2 years. Patients were divided into the following groups according to progression of trunk imbalance: 1) Group P, trunk shift ≥ 20 mm at the final visit and degree of progression ≥ 10 mm; and 2) Group NP, trunk shift imbalance with progression ≥ 10 mm at the final visit (Group P). Multivariate logistic regression analysis identified a lower Risser grade (p = 0.002) and a greater initial AVR (p = 0.020) as predictors of progressive trunk imbalance. A change in LEV tilt during follow-up was associated with trunk imbalance (p = 0.001). CONCLUSIONS Risser grade and AVR measured at the initial visit may predict progression of trunk imbalance. Surgeons should consider the risk of progressive trunk imbalance if patients show skeletal immaturity and a greater AVR at the initial visit.

  5. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  6. Fermented soybean meal exhibits probiotic properties when included in Japanese quail diet in replacement of soybean meal.

    Science.gov (United States)

    Jazi, V; Ashayerizadeh, A; Toghyani, M; Shabani, A; Tellez, G; Toghyani, M

    2018-03-15

    This study was conducted to investigate and compare the effect of dietary probiotic mixture (PM) and organic acid (OA) mixture with fermented soybean meal (FSBM) on performance, crop, and ceca microbiota, small intestine morphology, and serum lipid profile in Japanese quails. A total of 800 day-old Japanese quails was randomly allotted to 5 treatments with 8 replicate pens of 20 birds each, for 35 days. The experimental diets consisted of a control corn-soybean meal diet and 4 test diets: 1) control diet + 0.1% PM; 2) control diet + 0.2% OA mixture; 3) control diet + the combination of both PM and OA; and 4) an additives-free diet in which the soybean meal in the control diet was replaced with FSBM. The results indicated that in starter and the entire rearing periods, FSBM, PM, and PM+OA diets had significantly lower FCR compared to control or OA diets (P < 0.05). Birds in the FSBM group gained higher weight than control and OA birds (P < 0.05; 1 to 35 d). At d 21 and 35, birds fed the control diet showed significantly lower numbers of lactic acid bacteria in the crop, while coliforms were higher in the cecal content compared to the other diets (P < 0.05). At d 21, the villus height and villus height to crypt depth ratio in the duodenum and jejunum of birds fed PM, PM+OA, and FSBM diets were greater than in other treatments (P < 0.05). The serum concentrations of cholesterol and low-density lipoprotein cholesterol of birds fed PM, PM+OA, and FSBM diets were significantly lower than birds in control and AO groups (P < 0.05). The results obtained herein suggest that FSBM exhibits probiotic properties and, when used in substitution of SBM in Japanese quail diet, can improve growth performance, balance of desirable gastrointestinal microbiota in crop and ceca, small intestinal morphology, and serum lipid profile-likewise, a probiotic supplement.

  7. Effect of gamma radiation on mutability in male gametes of Japanese quail (Coturnix coturnix japonica)

    Energy Technology Data Exchange (ETDEWEB)

    Baumgartner, J [Vyskumny Ustav Chovu a Slachtenia Hydiny, Laboratorim Genetiky, Ivanka pri Dunaji (Czechoslovakia)

    1978-01-01

    An analysis of the mutability of developmental stages of male gametes of the japanese quail (Coturnix coturnix japonica), after irradiation with /sup 60/Co exposures (5.16; 15.48; and 30.96)x10/sup -2/C kg/sup -1/, i.e. 200, 600 and 1200 R, at an exposure rate of 8.59x10/sup -5/C kg/sup -1/s/sup -1/, i.e. O.33 R s/sup -1/, has shown that the rate of overall induced dominant lethality as well as the rate of mutation were highest in spermatocytes of the second order at all exposures. Starting from an exposure of 200 R the following values were found for lethal interference per 1 gamete for 1 R: spermatozoa 2.0x10/sup -3/, spermatides 1.95x10/sup -3/, spermatocytes II 6.1x10/sup -3/, spermatocytes I 4.06x10/sup -3/, spermatogonia in the process of differentiation 6.8x10/sup -3/. When analysing overall embryonic lethality, according to early and late lethality, dominant lethal mutations mainly manifested themsel--ves in the oviductal and germinal developmental periods, so that these periods can be considered as sensitive indices of genetic changes. The spermatogenic epithelium of the japanese quail was found to be greatly radioresistant since not even an exposure to 1200 R caused complete and permanent sterility.

  8. Altered Gravity Simulated by Parabolic Flight and Water Immersion Leads to Decreased Trunk Motion.

    Directory of Open Access Journals (Sweden)

    Peiliang Wang

    Full Text Available Gravity is one of the important environmental factors that influence the physiologies and behaviors of animals and humans, and changes in gravity elicit a variety of physiological and behavioral alterations that include impaired movement coordination, vertigo, spatial disorientation, and perceptual illusions. To elucidate the effects of gravity on human physiology and behavior, we examined changes in wrist and trunk activities and heart rate during parabolic flight and the activity of wrist and trunk in water immersion experiments. Data from 195 person-time parabolas performed by eight subjects revealed that the trunk motion counts decreased by approximately half during ascending legs (hypergravity, relative to the data acquired before the parabolic flights. In contrast, the wrist activity remained unchanged. The results from the water immersion experiments demonstrated that in the underwater condition, both the wrist and trunk activities were significantly decreased but the latter decreased to a much lower level. Together, these data suggest that gravitational alterations can result in differential influences on the motions of the wrist and the trunk. These findings might be important for understanding the degeneration of skeleton and muscular system and performance of astronauts in microgravity.

  9. Body weight support during robot-assisted walking: influence on the trunk and pelvis kinematics.

    Science.gov (United States)

    Swinnen, Eva; Baeyens, Jean-Pierre; Hens, Gerrit; Knaepen, Kristel; Beckwée, David; Michielsen, Marc; Clijsen, Ron; Kerckhofs, Eric

    2015-01-01

    Efficacy studies concerning robot assisted gait rehabilitation showed limited clinical benefits. A changed kinematic pattern might be responsible for this. Little is known about the kinematics of the trunk and pelvis during robot assisted treadmill walking (RATW). The aim of this study was to assess the trunk and pelvis kinematics of healthy subjects during RATW, with different amounts of body weight support (BWS) compared to regular treadmill walking (TW). Eighteen healthy participants walked on a treadmill, while kinematics were registered by an electromagnetic tracking device. Hereafter, the kinematics of pelvis and trunk were registered during RATW (guidance force 30%) with 0%, 30% and 50% BWS. Compared to TW, RATW showed a decrease in the following trunk movements: axial rotation, anteroposterior flexion, lateral and anteroposterior translation. Besides, a decrease in lateral tilting and all translation of the pelvis was found when comparing RATW with TW. Furthermore, the anteroposterior tilting of the pelvis increased during RATW. In general, there was a decrease in trunk and pelvis movement amplitude during RATW compared with regular TW. Though, it is not known if these changes are responsible for the limited efficacy of robot assisted gait rehabilitation. Further research is indicated.

  10. Altered Gravity Simulated by Parabolic Flight and Water Immersion Leads to Decreased Trunk Motion

    Science.gov (United States)

    Tian, Yu; Li, Fan; Zhang, Shaoyao; Zhang, Lin; Guo, Yaoyu; Liu, Weibo; Wang, Chunhui; Chen, Shanguang; Guo, Jinhu

    2015-01-01

    Gravity is one of the important environmental factors that influence the physiologies and behaviors of animals and humans, and changes in gravity elicit a variety of physiological and behavioral alterations that include impaired movement coordination, vertigo, spatial disorientation, and perceptual illusions. To elucidate the effects of gravity on human physiology and behavior, we examined changes in wrist and trunk activities and heart rate during parabolic flight and the activity of wrist and trunk in water immersion experiments. Data from 195 person-time parabolas performed by eight subjects revealed that the trunk motion counts decreased by approximately half during ascending legs (hypergravity), relative to the data acquired before the parabolic flights. In contrast, the wrist activity remained unchanged. The results from the water immersion experiments demonstrated that in the underwater condition, both the wrist and trunk activities were significantly decreased but the latter decreased to a much lower level. Together, these data suggest that gravitational alterations can result in differential influences on the motions of the wrist and the trunk. These findings might be important for understanding the degeneration of skeleton and muscular system and performance of astronauts in microgravity. PMID:26208253

  11. Neuromuscular Impairments Are Associated With Impaired Head and Trunk Stability During Gait in Parkinson Fallers.

    Science.gov (United States)

    Cole, Michael H; Naughton, Geraldine A; Silburn, Peter A

    2017-01-01

    Background The trunk plays a critical role in attenuating movement-related forces that threaten to challenge the body's postural control system. For people with Parkinson's disease (PD), disease progression often leads to dopamine-resistant axial symptoms, which impair trunk control and increase falls risk. Objective This prospective study aimed to evaluate the relationship between impaired trunk muscle function, segmental coordination, and future falls in people with PD. Methods Seventy-nine PD patients and 82 age-matched controls completed clinical assessments and questionnaires to establish their medical history, symptom severity, balance confidence, and falls history. Gait characteristics and trunk muscle activity were assessed using 3-dimensional motion analysis and surface electromyography. The incidence, cause, and consequence of any falls experienced over the next 12 months were recorded and indicated that 48 PD and 29 control participants fell at least once during this time. Results PD fallers had greater peak and baseline lumbar multifidus (LMF) and thoracic erector spinae (TES) activations than control fallers and nonfallers. Analysis of covariance indicated that the higher LMF activity was attributable to the stooped posture adopted by PD fallers, but TES activity was independent of medication use, symptom severity, and trunk orientation. Furthermore, greater LMF and TES baseline activity contributed to increasing lateral head, trunk, and pelvis movements in PD fallers but not nonfallers or controls. Conclusions The results provide evidence of neuromuscular deficits for PD fallers that are independent of medications, symptom severity, and posture and contribute to impaired head, trunk, and pelvis control associated with falls in this population. © The Author(s) 2016.

  12. Quantity and quality benefits of in-service invasive cleaning of trunk mains

    Directory of Open Access Journals (Sweden)

    I. Sunny

    2017-07-01

    Full Text Available Trunk mains are high risk critical infrastructure where poor performance can impact on large numbers of customers. Both quantity (e.g. hydraulic capacity and quality (e.g. discolouration of trunk main performance are affected by asset deterioration in the form of particle accumulation at the pipe wall. Trunk main cleaning techniques are therefore desirable to remove such material. However, little is quantified regarding the efficacy of different maintenance interventions or longer-term changes following such cleaning. This paper presents an assessment of quantity and quality performance of a trunk main system pre, post and for 12 months following cleaning using pigging with ice slurry. Hydraulic calibration showed a 7 times roughness height reduction after ice slurry pigging, evidencing substantially improved hydraulic capacity and reduced headloss. Turbidity response due to carefully imposed shear stress increase remained significant after the cleaning intervention, showing that relatively loose material had not been fully removed from the pipe wall. Overall the results demonstrate that cleaning by pigging with ice slurry can be beneficial for quantity performance, but care and further assessment may be necessary to realise the full quality benefits.

  13. Quantity and quality benefits of in-service invasive cleaning of trunk mains

    Science.gov (United States)

    Sunny, Iftekhar; Husband, Stewart; Drake, Nick; Mckenzie, Kevan; Boxall, Joby

    2017-07-01

    Trunk mains are high risk critical infrastructure where poor performance can impact on large numbers of customers. Both quantity (e.g. hydraulic capacity) and quality (e.g. discolouration) of trunk main performance are affected by asset deterioration in the form of particle accumulation at the pipe wall. Trunk main cleaning techniques are therefore desirable to remove such material. However, little is quantified regarding the efficacy of different maintenance interventions or longer-term changes following such cleaning. This paper presents an assessment of quantity and quality performance of a trunk main system pre, post and for 12 months following cleaning using pigging with ice slurry. Hydraulic calibration showed a 7 times roughness height reduction after ice slurry pigging, evidencing substantially improved hydraulic capacity and reduced headloss. Turbidity response due to carefully imposed shear stress increase remained significant after the cleaning intervention, showing that relatively loose material had not been fully removed from the pipe wall. Overall the results demonstrate that cleaning by pigging with ice slurry can be beneficial for quantity performance, but care and further assessment may be necessary to realise the full quality benefits.

  14. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

    Science.gov (United States)

    2013-04-24

    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  15. Increased pathogenicity and shedding in chickens of a wild bird-origin low pathogenicity avian influenza virus of the H7N3 subtype following multiple in vivo passages in quail and turkey.

    Science.gov (United States)

    Cilloni, Filippo; Toffan, Anna; Giannecchini, Simone; Clausi, Valeria; Azzi, Alberta; Capua, Ilaria; Terregino, Calogero

    2010-03-01

    In order to investigate viral adaptation mechanisms to poultry, we performed serial in vivo passages of a wild bird low pathogenicity avian influenza isolate of the H7N3 subtype (A/mallard/Italy/33/01) in three different domestic species (chicken, turkey, and Japanese quail). The virus under study was administered via natural routes at the dose of 10(6) egg infective dose50/ 0.1 ml to chickens, turkeys, and quails in order to investigate the clinical susceptibility and the shedding levels after infection. Multiple in vivo passages of the virus were performed by serially infecting groups of five naive birds of each species, with samples collected from a previously infected group. Quails and turkeys were susceptible to infection for 10 serial passages, whereas chickens were susceptible to two cycles of infection only. Infection of chicken with the quail- and turkey-adapted viruses showed an increased pathogenicity and/or shedding, causing more severe clinical signs and/or higher levels of viral excretion compared to the original strain. The data obtained herein suggest that infection of selected avian species may facilitate the adaptation of avian influenza viruses originating from the wild bird reservoir to chicken. This is the first time turkey has been shown to act as a species in which a virus from the wild reservoir can increase its replication activity in other domestic species.

  16. Optimal graft diameter and location reduce postoperative complications after total arch replacement with long elephant trunk for arch aneurysm.

    Science.gov (United States)

    Kondoh, Haruhiko; Funatsu, Toshihiro; Toda, Koich; Kainuma, Satoshi; Kuki, Satoru; Taniguchi, Kazuhiro

    2011-08-01

    Total arch replacement with an elephant trunk is a standard treatment for arch aneurysm, but serious complications, such as paraplegia and peripheral embolization caused by flapping of the elephant trunk, remain. Moreover, dilation of the descending aorta and retrograde flow into the peri-graft space at the distal elephant trunk are frequent problems. We hypothesized that optimal graft diameter and location would reduce complications after total arch replacement with a long elephant trunk by achieving complete thrombosis and minimal dilation of the descending aorta around the elephant trunk. We treated 65 patients with arch aneurysm by total arch replacement with a long elephant trunk anastomosed at the base of the innominate artery. The graft diameter was undersized (10%-20% of the distal aorta's diameter). Elephant trunk length was determined by preoperative computed tomography to locate the distal end at Th6 to Th8. Thrombosis around the elephant trunk, diameter of the descending aorta, and distance between the descending aorta and the graft near the distal end of the elephant trunk were evaluated using computed tomography. The distal end of the elephant trunk was located at Th 8 ± 1. There were no operative deaths, 3 patients (5%) died in the hospital, and 3 patients (5%) experienced spinal cord injury, including 1 in whom permanent paraplegia developed. Computed tomography revealed complete thrombosis around the elephant trunk in 58 patients (89%). The descending aorta did not dilate further, and distance between the descending aorta and the graft progressively decreased. Optimal graft diameter and location minimized postoperative complications, with complete thrombosis and no dilation of the descending aorta around the long elephant trunk in most patients. Copyright © 2011 The American Association for Thoracic Surgery. Published by Mosby, Inc. All rights reserved.

  17. Software module for geometric product modeling and NC tool path generation

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2003-01-01

    The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

  18. Replacing soybean oil with increasing levels of soybean acid oil in diets of coturnix quails (Coturnix coturnix coturnix and the effects on egg quality

    Directory of Open Access Journals (Sweden)

    ALINE A.P. ROLL

    2017-10-01

    Full Text Available ABSTRACT The effects of increasing levels of soybean acid oil in diets of quails on the quality of eggs were evaluated over a period of 56 days. A completely randomized design with five treatment levels of soybean acid oil (0, 2, 4, 6, and 8% as a replacer for soybean oil and eight replicates of two quails each were used. A total of 240 fresh eggs were used for quality analysis, and 400 eggs were stored at 23ºC over a period of 0, 7, 14, 21, and 28 days for analysis of shelf-life. Polynomial regression and ANOVA with repeated measurements and Tukey´s tests were used. Soybean acid oil linearly increased the intensity of red (a* = -5.26 + 0.14 x, R2 = 0.89, P = 0.01 and yellow (b* = 42.32 + 0.44 x, R2 = 0.88 P = 0.01. All other variables of egg quality were not affected by the treatments, with the exception of sensory attributes, such as odor and aftertaste, which were more pronounced with soybean acid oil. In conclusion, soybean acid oil affects the intensity of yellow and red color of the yolk. Trained assessors detected differences in odor and aftertaste of eggs when soybean acid oil was included in the quail diet.

  19. Decreased Respiratory Muscle Function Is Associated with Impaired Trunk Balance among Chronic Stroke Patients: A Cross-sectional Study.

    Science.gov (United States)

    Lee, Kyeongbong; Cho, Ji-Eun; Hwang, Dal-Yeon; Lee, WanHee

    2018-06-01

    The abdominal muscles play a role in trunk balance. Abdominal muscle thickness is asymmetrical in stroke survivors, who also have decreased respiratory muscle function. We compared the thickness of the abdominal muscles between the affected and less affected sides in stroke survivors. In addition, the relationship between respiratory muscle function and trunk balance was evaluated. Chronic stroke patients (18 men, 15 women; mean age, 58.94 ± 12.30 years; Mini-Mental Status Examination score ≥ 24) who could sit without assist were enrolled. Abdominal muscle thickness during rest and contraction was measured with ultrasonography, and the thickening ratio was calculated. Respiratory muscle function assessment included maximum respiratory pressure, peak flow, and air volume. Trunk function was evaluated using the Trunk Impairment Scale, and trunk balance was estimated based on the center of pressure velocity and path length within the limit of stability in sitting posture. Abdominal muscles were significantly thinner on the affected side, and the thickening ratio was lower in the affected side (P respiratory muscle function was significantly correlated with higher level of trunk function and balance in stroke patients (P respiratory muscle function has positive correlation with trunk function and balance. We propose that respiratory muscle training should be included as part of trunk balance training in chronic stroke patients.

  20. Reliability of a new method for measuring coronal trunk imbalance, the axis-line-angle technique.

    Science.gov (United States)

    Zhang, Rui-Fang; Liu, Kun; Wang, Xue; Liu, Qian; He, Jia-Wei; Wang, Xiang-Yang; Yan, Zhi-Han

    2015-12-01

    Accurate determination of the extent of trunk imbalance in the coronal plane plays a key role in an evaluation of patients with trunk imbalance, such as patients with adolescent idiopathic scoliosis. An established, widely used practice in evaluating trunk imbalance is to drop a plumb line from the C7 vertebra to a key reference axis, the central sacral vertical line (CSVL) in full-spine standing anterioposterior radiographs, and measuring the distance between them, the C7-CSVL. However, measuring the CSVL is subject to intraobserver differences, is error-prone, and is of poor reliability. Therefore, the development of a different way to measure trunk imbalance is needed. This study aimed to describe a new method to measure coronal trunk imbalance, the axis-line-angle technique (ALAT), which measures the angle at the intersection between the C7 plumb line and an axis line drawn from the vertebral centroid of the C7 to the middle of the superior border of the symphysis pubis, and to compare the reliability of the ALAT with that of the C7-CSVL. A prospective study at a university hospital was used. The patient sample consisted of sixty-nine consecutively enrolled men and women patients, aged 10-18 years, who had trunk imbalance defined as C7-CSVL longer than 20 mm on computed full-spine standing anterioposterior radiographs. Data were analyzed to determine the correlation between C7-CSVL and ALAT measurements and to determine intraobserver and interobserver reliabilities. Using a picture archiving and communication system, three radiologists independently evaluated trunk imbalance on the 69 computed radiographs by measuring the C7-CSVL and by measuring the angle determined by the ALAT. Data were analyzed to determine the correlations between the two measures of trunk imbalance, and to determine intraobserver and interobserver reliabilities of each of them. Overall results from the measurements by the C7-CSVL and the ALAT were significantly moderately correlated

  1. Trunk position modulates anterior cruciate ligament forces and strains during a single-leg squat

    NARCIS (Netherlands)

    Kulas, Anthony S.; Hortobagyi, Tibor; DeVita, Paul

    Background: Although the squat exercise and its variations are commonly prescribed for anterior cruciate ligament rehabilitation, whether trunk position affects these ligament forces and strains during the squat is unclear. Our purpose was to evaluate the effects of trunk position on anterior

  2. Researchers and stakeholders shape advances in management of tree and vine trunk-disease complexes

    Science.gov (United States)

    The grapevine trunk-disease complex limits grape production and vineyard longevity worldwide. Every vineyard in California eventually is infected by one or more trunk diseases. The causal fungi, which are taxonomically unrelated Ascomycetes, infect and then degrade the permanent woody structure of t...

  3. MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction

    Science.gov (United States)

    Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing

    2018-03-01

    Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.

  4. Reconstructed frontal and coronal cuts in computed tomography of the trunk

    International Nuclear Information System (INIS)

    Fochem, K.; Klumair, J.

    1982-01-01

    A comparison between the original coronally cuts and the reconstructed coronal cuts yielded basic information on the loss of quality by computed reconstruction of images. As for the trunk, only comparisons between the conventional linear tomography and computed frontal of trunk cuts are possible. A few examples will demonstrate that despite a considerable loss of quality, computed frontal cuts will supply additional information in certain cases. It is also shown that the reconstructed frontal cuts cannot replace conventional tomography. (orig.) [de

  5. An Unusual Case of Stent Migration After Celiac Trunk Endovascular Revascularization

    Energy Technology Data Exchange (ETDEWEB)

    Negri, Silvia; Ferraro, Stefania; Piffaretti, Gabriele, E-mail: gabriele.piffaretti@uninsubria.it; Rivolta, Nicola; Bossi, Matteo [University of Insubria School of Medicine, Vascular Surgery, Department of Surgical Sciences, Circolo University Hospital (Italy); Carrafiello, Gianpaolo [University of Insubria School of Medicine, Interventional Radiology, Department of Radiology, Circolo University Hospital (Italy); Castelli, Patrizio [University of Insubria School of Medicine, Vascular Surgery, Department of Surgical Sciences, Circolo University Hospital (Italy)

    2012-08-15

    A 61-year-old woman underwent celiac trunk stenting to treat abdominal angina. Three months later, she was readmitted for recurrent symptoms. Computed tomography control revealed the migration of the stent into the splenic artery. No sign of vessel injury or end-organ ischemia was detected. Repeat stenting of the celiac trunk was performed; the postoperative course was uneventful. 12 months later, the patient was asymptomatic with the second stent in its correct position, and she was asymptomatic for mesenteric ischemia.

  6. An Unusual Case of Stent Migration After Celiac Trunk Endovascular Revascularization

    International Nuclear Information System (INIS)

    Negri, Silvia; Ferraro, Stefania; Piffaretti, Gabriele; Rivolta, Nicola; Bossi, Matteo; Carrafiello, Gianpaolo; Castelli, Patrizio

    2012-01-01

    A 61-year-old woman underwent celiac trunk stenting to treat abdominal angina. Three months later, she was readmitted for recurrent symptoms. Computed tomography control revealed the migration of the stent into the splenic artery. No sign of vessel injury or end-organ ischemia was detected. Repeat stenting of the celiac trunk was performed; the postoperative course was uneventful. 12 months later, the patient was asymptomatic with the second stent in its correct position, and she was asymptomatic for mesenteric ischemia.

  7. Tree fern trunks facilitate seedling regeneration in a productive lowland temperate rain forest.

    Science.gov (United States)

    Gaxiola, Aurora; Burrows, Larry E; Coomes, David A

    2008-03-01

    Seedling regeneration on forest floors is often impaired by competition with established plants. In some lowland temperate rain forests, tree fern trunks provide safe sites on which tree species establish, and grow large enough to take root in the ground and persist. Here we explore the competitive and facilitative effects of two tree fern species, Cyathea smithii and Dicksonia squarrosa, on the epiphytic regeneration of tree species in nutrient-rich alluvial forests in New Zealand. The difficulties that seedlings have in establishing on vertical tree fern trunks were indicated by the following observations. First, seedling abundance was greatest on the oldest sections of tree fern trunks, near the base, suggesting that trunks gradually recruited more and more seedlings over time, but many sections of trunk were devoid of seedlings, indicating the difficulty of establishment on a vertical surface. Second, most seedlings were from small-seeded species, presumably because smaller seeds can easily lodge on tree fern trunks. Deer browsing damage was observed on 73% of epiphytic seedlings growing within 2 m of the ground, whereas few seedlings above that height were browsed. This suggests that tree ferns provide refugia from introduced deer, and may slow the decline in population size of deer-preferred species. We reasoned that tree ferns would compete with epiphytic seedlings for light, because below the tree fern canopy photosynthetically active radiation (PAR) was about 1% of above-canopy PAR. Frond removal almost tripled %PAR on the forest floor, leading to a significant increase in the height growth rate (HGR) of seedlings planted on the forest floor, but having no effects on the HGRs of epiphytic seedlings. Our study shows evidence of direct facilitative interactions by tree ferns during seedling establishment in plant communities associated with nutrient-rich soils.

  8. Effect of Gene and Physical Activity Interaction on Trunk Fat Percentage Among the Newfoundland Population

    Directory of Open Access Journals (Sweden)

    Anthony Payne

    2014-01-01

    Full Text Available Objective To explore the effect of FTO gene and physical activity interaction on trunk fat percentage. Design and Methods Subjects are 3,004 individuals from Newfoundland and Labrador whose trunk fat percentage and physical activity were recorded, and who were genotyped for 11 single-nucleotide polymorphisms (SNPs in the FTO gene. Subjects were stratified by gender. Multiple tests and multiple regressions were used to analyze the effects of physical activity, variants of FTO , age, and their interactions on trunk fat percentage. Dietary information and other environmental factors were not considered. Results Higher levels of physical activity tend to reduce trunk fat percentage in all individuals. Furthermore, in males, rs9939609 and rs1421085 were significant (α = 0.05 in explaining central body fat, but no SNPs were significant in females. For highly active males, trunk fat percentage varied significantly between variants of rs9939609 and rs1421085, but there is no significant effect among individuals with low activity. The other SNPs examined were not significant in explaining trunk fat percentage. Conclusions Homozygous male carriers of non-obesity risk alleles at rs9939609 and rs1421085 will have significant reduction in central body fat from physical activity in contrast to homozygous males of the obesity-risk alleles. The additive effect of these SNPs is found in males with high physical activity only.

  9. The Effect of Different Dietary Purslane Seed (Portulaca Oleracea L. Levels on Carcass, Blood Lipid Profile and Antioxidant Activity in Quails

    Directory of Open Access Journals (Sweden)

    Yusuf Konca

    2016-01-01

    Full Text Available This study was carried out to determine the effect of dietary purslane seed (Portulaca oleracea L. diets on the carcass, serum lipid profile and antioxidant activity in quails. A total of 140 one-day-old quail chicks allocated into 4 treatment groups with 5 replicates. The treatment groups as follows: (1 Control (C, without purslane seed addition, (2 2.5% purslane seed addition to the control diet, (3 5% purslane seed addition to the control diet, (4 10% purslane seed addition to the control diet. The treatments did not affect the slaughter weight, carcass, and carcass part yields (p>0.05 of the birds in the treatment groups. However, the total intestinal weights of the birds in the 2.5% purslane supplemented group were lower than those of the other groups (p0.05. The dietary inclusion of 10% purslane seed caused an increase to MDA level compared to C and 2.5% purslane seed supplemented groups (p

  10. Increasing trunk flexion transforms human leg function into that of birds despite different leg morphology.

    Science.gov (United States)

    Aminiaghdam, Soran; Rode, Christian; Müller, Roy; Blickhan, Reinhard

    2017-02-01

    Pronograde trunk orientation in small birds causes prominent intra-limb asymmetries in the leg function. As yet, it is not clear whether these asymmetries induced by the trunk reflect general constraints on the leg function regardless of the specific leg architecture or size of the species. To address this, we instructed 12 human volunteers to walk at a self-selected velocity with four postures: regular erect, or with 30 deg, 50 deg and maximal trunk flexion. In addition, we simulated the axial leg force (along the line connecting hip and centre of pressure) using two simple models: spring and damper in series, and parallel spring and damper. As trunk flexion increases, lower limb joints become more flexed during stance. Similar to birds, the associated posterior shift of the hip relative to the centre of mass leads to a shorter leg at toe-off than at touchdown, and to a flatter angle of attack and a steeper leg angle at toe-off. Furthermore, walking with maximal trunk flexion induces right-skewed vertical and horizontal ground reaction force profiles comparable to those in birds. Interestingly, the spring and damper in series model provides a superior prediction of the axial leg force across trunk-flexed gaits compared with the parallel spring and damper model; in regular erect gait, the damper does not substantially improve the reproduction of the human axial leg force. In conclusion, mimicking the pronograde locomotion of birds by bending the trunk forward in humans causes a leg function similar to that of birds despite the different morphology of the segmented legs. © 2017. Published by The Company of Biologists Ltd.

  11. The Elephant Trunk Technique: A New Complication

    OpenAIRE

    Neri, Eugenio; Toscano, Thomas; Frati, Giacomo; Sassi, Carlo

    2001-01-01

    We describe a complication that occurred during the 2nd stage of an “elephant trunk” aortic replacement. The patient was a 58-year-old woman who had undergone graft replacement of the ascending aorta and aortic arch with the elephant trunk technique for an acute, Stanford type-A aortic dissection.

  12. Walking with robot assistance: the influence of body weight support on the trunk and pelvis kinematics.

    Science.gov (United States)

    Swinnen, Eva; Baeyens, Jean-Pierre; Knaepen, Kristel; Michielsen, Marc; Hens, Gerrit; Clijsen, Ron; Goossens, Maggie; Buyl, Ronald; Meeusen, Romain; Kerckhofs, Eric

    2015-05-01

    The goal was to assess in healthy participants the three-dimensional kinematics of the pelvis and the trunk during robot-assisted treadmill walking (RATW) at 0%, 30% and 50% body weight support (BWS), compared with treadmill walking (TW). 18 healthy participants walked (2 kmph) on a treadmill with and without robot assistance (Lokomat; 60% guidance force; 0%, 30% and 50% BWS). After an acclimatisation period (four minutes), trunk and pelvis kinematics were registered in each condition (Polhemus Liberty [240 Hz]). The results were analysed using a repeated measures analysis of variance with Bonferroni correction, with the level of suspension as within-subject factor. During RATW with BWS, there were significantly (1) smaller antero-posterior and lateral translations of the trunk and the pelvis; (2) smaller antero-posterior flexion and axial rotation of the trunk; (3) larger lateral flexion of the trunk; and (4) larger antero-posterior tilting of the pelvis compared with TW. There are significant differences in trunk and pelvis kinematics in healthy persons during TW with and without robot assistance. These data are relevant in gait rehabilitation, relating to normal balance regulation. Additional research is recommended to further assess the influence of robot assistance on human gait. The trunk and pelvis moves in a different way during walking with robot assistance. The data suggest that the change in movement is due to the robot device and the harness of the suspension system more than due to the level of suspension itself.

  13. Subjects with hip osteoarthritis show distinctive patterns of trunk movements during gait-a body-fixed-sensor based analysis

    NARCIS (Netherlands)

    Reininga, Inge H. F.; Stevens, Martin; Wagenmakers, Robert; Bulstra, Sjoerd K.; Groothoff, Johan W.; Zijlstra, Wiebren

    2012-01-01

    Background: Compensatory trunk movements during gait, such as a Duchenne limp, are observed frequently in subjects with osteoarthritis of the hip, yet angular trunk movements are seldom included in clinical gait assessments. Hence, the objective of this study was to quantify compensatory trunk

  14. Growth characteristics of fibroblasts isolated from the trunk and distal aspect of the limb of horses and ponies.

    Science.gov (United States)

    Miller, C B; Wilson, D A; Keegan, K G; Kreeger, J M; Adelstein, E H; Ganjam, V K

    2000-01-01

    To determine if there is a difference in in vitro growth of fibroblasts isolated from the trunk and distal aspect of the limb of horses and ponies. To determine the effects of a corticosteroid and monokine on in vitro growth of fibroblasts isolated from the trunk and distal aspect of the limb of horses and ponies. Growth of fibroblasts from tissues harvested from the trunk and limb were compared from horse and pony samples grown in control media and control media with triamcinolone or monokine added. Dermal and subcutaneous tissue from 22 horses and 17 ponies of various ages and breeds. Fibroblast growth was assessed by tritiated thymidine uptake using standard cell culture techniques. The effect of a monokine or triamcinolone plus control media were compared with control media for fibroblast growth. Fibroblast growth from tissues isolated from the horse limb was significantly less than growth from the horse trunk and the limb and trunk of ponies. Monokine was more effective than triamcinolone in suppressing fibroblast growth from tissues isolated from the trunk and limb in both horses and ponies. There are growth differences in fibroblasts isolated from the limb of horses compared with those isolated from the trunk and from the limb and trunk of ponies. The difference in fibroblast growth from tissues isolated from the trunk and limb of horses and ponies may provide evidence for the difference reported in the healing characteristics of limb wounds in horses and ponies. Influencing fibroblast growth may provide a key to controlling the development of exuberant granulation tissue in horses and ponies.

  15. Divergent selection for shape of growth curve in Japanese quail. 3. Onset of sexual maturity and basic characteristics of early lay

    Czech Academy of Sciences Publication Activity Database

    Hyánková, L.; Novotná, Božena

    2007-01-01

    Roč. 48, č. 5 (2007), s. 551-558 ISSN 0007-1668 R&D Projects: GA ČR(CZ) GA523/99/1262 Institutional research plan: CEZ:AV0Z50390512 Keywords : embryonicdevelopment * postnatal development * Japanese quail Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.071, year: 2007

  16. Methane emissions from bald cypress tree trunks in a bottomland forest

    Science.gov (United States)

    Schile, L. M.; Pitz, S.; Megonigal, P.

    2013-12-01

    Studies on natural methane emissions predominantly have occurred on wetland soils with herbaceous plant species. Less attention, however, has been placed on the role of woody wetland plant species in the methane cycle. Recent studies on methane emissions from tree trunks document that they are a significant source of emissions that previously has been not accounted for. In this study, we examine methane emissions from trunks of mature bald cypress (Taxodium distichum), which is a dominant tree species in bottomland hardwood forests of the Southeastern United States. To date, little is known about soil methane emissions in these systems, and published tree emissions have been limited to a single study conducted on bald cypress knees. In May 2013, we established a plot in a monospecific bald cypress stand planted approximately 70 years ago on the Chesapeake Bay in Maryland and are monitoring methane emissions on 12 tree trunks, soil chambers, and pore-water over the course of a year. Custom-made 30 cm tall open face rectangular tree chambers were constructed out of white acrylic sheets and secured on each tree at a midpoint of 45 cm above the soil surface. Chambers were lined with neoprene along the tree surface and sealed with an epoxy. On three trees that varied in trunk diameter, chambers were placed at average heights of 95, 145, 195, and 345 cm from the soil surface in order to calculate a decay curve of methane emissions. Once a month, chambers were sealed with lids and head-space samples were collected over the course of an hour. Methane flux was calculated and compared to emissions from soil chambers. Average cypress trunk methane fluxes ranged from 17.7 μmole m-2 hr-1 in May to 49.5 and 116.5 μmole m-2 hr-1 in June and July, respectively. Soil fluxes averaged 28.5 μmole m-2 hr-1 in May and June, and decreased to 13.7 μmole m-2 hr-1 in July. Methane emissions decreased exponentially up the tree trunk, with fluxes of 2 μmole m-2 hr-1 and less calculated

  17. Development of STEP-NC Adaptor for Advanced Web Manufacturing System

    Science.gov (United States)

    Ajay Konapala, Mr.; Koona, Ramji, Dr.

    2017-08-01

    Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.

  18. Adsorption of Cu, As, Pb and Zn by Banana Trunk

    International Nuclear Information System (INIS)

    Nurzulaifa Shaheera Erne Mohd Yasim; Zitty Sarah Ismail; Suhanom Mohd Zaki; Mohd Fahmi Abd Azis

    2016-01-01

    The purpose of this study is to investigate the effectiveness of banana trunk as an adsorbent in removal of heavy metals in aqueous solution. Functional groups of adsorbent were determined using Fourier Transform Infrared spectroscopy (FTIR). Batch experiments were conducted to determine the adsorption percentage of heavy metals (Cu, As, Pb and Zn). The optimum adsorption using banana trunk was based on pH difference, contact time and dosage. Adsorption percentage was found to be proportional to pH, contact time and dosage. Maximum adsorption percentage of Cu, As, Pb and Zn at pH 6, 100 minutes and 8 gram of dosage are 95.80 %, 75.40 %, 99.36 % and 97.24 %, respectively. Langmuir and Freundlich isotherms were used to determine the equilibrium state for heavy metals ion adsorption experiments. All equilibrium heavy metals were well explained by the Freundlich isotherm model with R"2= 0.9441, R"2= 0.8671, R"2= 0.9489 and R"2= 0.9375 for Cu, As, Pb and Zn respectively. It is concluded that banana trunk has considerable potential for the removal of heavy metals from aqueous solution. (author)

  19. Real time noninvasive assessment of external trunk geometry during surgical correction of adolescent idiopathic scoliosis

    Directory of Open Access Journals (Sweden)

    Mac-Thiong Jean-Marc

    2009-02-01

    Full Text Available Abstract Background The correction of trunk deformity is crucial in scoliosis surgery, especially for the patient's self-image. However, direct visualization of external scoliotic trunk deformity during surgical correction is difficult due to the covering draping sheets. Methods An optoelectronic camera system with 10 passive markers is used to track the trunk geometry of 5 scoliotic patients during corrective surgery. The position of 10 anatomical landmarks and 5 trunk indices computed from the position of the passive markers are compared during and after instrumentation of the spine. Results Internal validation of the accuracy of tracking was evaluated at 0.41 +/- 0.05 mm RMS. Intra operative tracking during surgical maneuvers shows improvement of the shoulder balance during and after correction of the spine. Improvement of the overall patient balance is observed. At last, a minor increase of the spinal length can be noticed. Conclusion Tracking of the external geometry of the trunk during surgical correction is useful to monitor changes occurring under the sterile draping sheets. Moreover, this technique can used be used to reach the optimal configuration on the operating frame before proceeding to surgery. The current tracking technique was able to detect significant changes in trunk geometry caused by posterior instrumentation of the spine despite significant correction of the spinal curvature. It could therefore become relevant for computer-assisted guidance of surgical maneuvers when performing posterior instrumentation of the scoliotic spine, provide important insights during positioning of patients.

  20. A new variant of aberrant left brachiocephalic trunk in mam: case report and literature review.

    Science.gov (United States)

    Szpinda, Michał

    2005-02-01

    Importance is placed on aberrant arteries in the radiological and surgical literature. A normal left brachiocephalic trunk is characteristic for the right aortic arch. However, an aberrant left brachiocephalic trunk arising as the last branch of the aortic arch on the left side has not yet been described in the literature. Described here is a new variant of the retro-oesophageal aberrant left brachiocephalic trunk, occasionally observed in a patient during diagnostic investigation or surgical treatment for steno-obstructive involvement of the carotid district. The triple anomaly of the left aortic arch consisted of: 1. the presence of a hypoplastic left brachiocephalic trunk behind the oesophagus, 2. the absence of a brachiocephalic trunk on the right side and 3. separate origins of the arteries on the right side, with the right common artery preceding the right subclavian artery. In front of the trachea an 8-mm prosthetic PTFE was implanted from the proximal segment of the right subclavian artery to the junction of the left common carotid and left subclavian arteries. The author demonstrates the inadequacy of auxiliary investigations to detect aberrant arteries, which may only be identified precisely intra-operatively.

  1. Comparative metabolism and fate of fenvalerate in Japanese quail (Coturnix coturnix japonica) and rats (Rattus norwegicus)

    International Nuclear Information System (INIS)

    Mumtaz, M.M.; Menzer, R.E.

    1986-01-01

    Adult Japanese quail were administered 100 mg/kg chlorophenyl-labeled [ 14 C]fenvalerate, α-cyano-3-phenoxybenzyl 2-(4-chlorophenyl)isovalerate, for study of its distribution, elimination, and metabolism. Ninety percent of the administered dose was eliminated in the excreta within the first 24 h. In addition to fenvalerate, the following metabolites were present: benzeneacetic acid, 4-chloro-α-(1-methylethyl)-,cyano(3-phenoxy-4-hydroxyphenyl)methyl ester [4'-OH-fenvalerate]; benzeneacetic acid, 4-chloro-α-(1-methylethyl)-,(aminocarbonyl)(3-phenoxyphenyl)methyl ester [CONH 2 -fenvalerate]; 4-chloro-α-(1-methylethyl)benzeneacetic acid[Cl-V acid]; 4-chloro-α-(2-hydroxy-1-methylethyl)benzeneacetic acid[4-OH-Cl-V acid]. In time course studies radiocarbon peaked at 3 h (9μg/g) in the liver and gradually declined, while in the blood it peaked within 2 h and fell quickly to an equilibrium value of 1.5 μg/mL blood. In liver microsomal and isolated heptatocyte preparations of Japanese quail and rat, the following metabolites were identified: Cl-V acid, 4-OH-Cl-V acid, 4'-OH-fenvalerate, CONH 2 -fenvalerate. Oxidation was found to be the predominant route of degradation either pre- or post-hydrolysis of the parent compound. Rapid excretion, lesser absorption, and faster metabolism probably explain the lower toxicity of fenvalerate to birds compared to rats

  2. Inherent and antigen-induced airway hyperreactivity in NC mice

    OpenAIRE

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

    1999-01-01

    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  3. Incorporation of radioactive zinc into the eggs of Japanese quails (coturnix coturnix Japonica)

    International Nuclear Information System (INIS)

    Matsusaka, Naonori; Nishimura, Yoshikazu; Nakamura, Isao; Yuyama, Akira

    1975-01-01

    The incorporation of 65 Zn into eggs was investigated after single or daily intraperitoneal administration to laying Japanese quails. After a single intraperitoneal administration, 65 Zn appeared first in the 2nd egg yolks and reached the highest level in the 3rd and 4th ones, followed by a gradual decrease. The cumulative amount of 65 Zn in the egg yolks over a period of 3 weeks accounted for about 40% of dose. After daily intraperitoneal administration, the 6th-9th egg's yolks contained the highest radioactivity of the eggs examined. Whole-body retention patterns were also observed in both of the experiments. (auth.)

  4. The effects of testosterone on immune function in quail selected for divergent plasma corticosterone response.

    Science.gov (United States)

    Roberts, Mark L; Buchanan, Katherine L; Evans, Matthew R; Marin, Raul H; Satterlee, Daniel G

    2009-10-01

    The immunocompetence handicap hypothesis (ICHH) suggests that the male sex hormone testosterone has a dual effect; it controls the development and expression of male sexually selected signals, and it suppresses the immune system. Therefore only high quality males are able to fully express secondary sexual traits because only they can tolerate the immunosuppressive qualities of testosterone. A modified version of the ICHH suggests that testosterone causes immunosuppression indirectly by increasing the stress hormone corticosterone (CORT). Lines of Japanese quail (Coturnix japonica) selected for divergent responses in levels of plasma CORT were used to test these hypotheses. Within each CORT response line (as well as in a control stock) we manipulated levels of testosterone in castrated quail by treatment with zero (sham), low or high testosterone implants, before testing the birds' humoral immunity and phytohaemagglutinin (PHA)-induced immune response, as well as body condition. The PHA-induced response was not significantly affected by CORT selected line, testosterone treatment or their interaction. There was, however, a significant effect of CORT line on humoral immunity in that the control birds exhibited the greatest antibody production, but there was no significant effect of testosterone manipulation on humoral immunity. The males in the sham implant treatment group had significantly greater mass than the males in the high testosterone group, suggesting a negative effect of high testosterone on general body condition. We discuss these results in the context of current hypotheses in the field of sexual selection.

  5. Performance of japanese quail chickens injected with monosodium glutamate in the early post hatch period

    International Nuclear Information System (INIS)

    Fahmy, M.O.; Ezzat, I.E. and others

    2002-01-01

    Neo hatched Japanese quails chicks were divided equally into three groups (G1, G2 and G3) and injected once subcutaneously with monosodium glutamate (MSG) at 0,2 or 4 mg/g body weight for G1, G2 and G3 respectively. The obtained results clear that, 1-At-marketing stage, body weight increased by about 4% and 6%, feed conversion ratio reduced by 8.7% and 5.7% in-groups G2 and G3 respectively. 2-MSG had no significant effect on male and female serum T4 as well as male serum T3. The injection with 2-mg MSG per gram body weight increased female serum T3 significantly. 3-MSG increased significantly fat % DM in the male and female quails. This treatment in was positively correlated with the amount of injected MSG. Ash % DM and protein % DM were decreased significantly in both injected males and females and the reduction was dose dependent. 5-in males, weights of heart, spleen and testes besides weights and lengths of gastrointestinal tract regions were not significantly affected by MSG administration. 6-in females, the injection with MSG (2 mg/g body weight) significantly reduced the weight as percent body weight, moreover, the administration of MSG had no significant effect on the weights or the lengths of the remain parameters of the females gastrointestinal tract regions, ovary, oviduct, heart and spleen

  6. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  7. Effects of trunk stability on isometric knee extension muscle strength measurement while sitting.

    Science.gov (United States)

    Hirano, Masahiro; Gomi, Masahiro; Katoh, Munenori

    2016-09-01

    [Purpose] This study aimed to investigate the effect of trunk stability on isometric knee extension muscle strength measurement while sitting by performing simultaneous measurements with a handheld dynamometer (HHD) and an isokinetic dynamometer (IKD) in the same seated condition. [Subjects and Methods] The subjects were 30 healthy volunteers. Isometric knee extension muscle strength was simultaneously measured with a HHD and an IKD by using an IKD-specific chair. The measurement was performed twice. Measurement instrument variables and the number of measurements were examined by using the analysis of variance and correlation tests. [Results] The measurement instrument variables and the number of measurements were not significantly different. The correlation coefficients between the HHD and IKD measurements were ≥0.96. [Conclusion] Isometric knee extension muscle strength measurement using the HHD in the sitting position resulted in a lower value than that using the IKD, presumably because of the effect of trunk stability on the measurement. In the same seated posture with trunk stability, no significant difference in measurement values was observed between the HHD and IKD. The present findings suggest that trunk stability while seated during isometric knee extension muscle strength measurement influenced the HHD measurement.

  8. On the influence of storage duration on rheological properties of liquid egg products and response of eggs to impact loading - Japanese quail eggs

    Czech Academy of Sciences Publication Activity Database

    Kumbár, V.; Trnka, Jan; Nedomová, Š.; Buchar, J.

    2015-01-01

    Roč. 166, May (2015), s. 86-94 ISSN 0260-8774 Institutional support: RVO:61388998 Keywords : egg quality * japanese quail * haugh units * storage duration * non-Newtonian fluid * non-destructive impact * surface displacement Subject RIV: BI - Acoustics Impact factor: 3.199, year: 2015

  9. Validity of the Microsoft Kinect for providing lateral trunk lean feedback during gait retraining.

    Science.gov (United States)

    Clark, Ross A; Pua, Yong-Hao; Bryant, Adam L; Hunt, Michael A

    2013-09-01

    Gait retraining programs are prescribed to assist in the rehabilitation process of many clinical conditions. Using lateral trunk lean modification as the model, the aim of this study was to assess the concurrent validity of kinematic data recorded using a marker-based 3D motion analysis (3DMA) system and a low-cost alternative, the Microsoft Kinect™ (Kinect), during a gait retraining session. Twenty healthy adults were trained to modify their gait to obtain a lateral trunk lean angle of 10°. Real-time biofeedback of the lateral trunk lean angle was provided on a computer screen in front of the subject using data extracted from the Kinect skeletal tracking algorithm. Marker coordinate data were concurrently recorded using the 3DMA system, and the similarity and equivalency of the trunk lean angle data from each system were compared. The lateral trunk lean angle data obtained from the Kinect system without any form of calibration resulted in errors of a high (>2°) magnitude (mean error=3.2±2.2°). Performing global and individualized calibration significantly (Psystem for gait retraining. Given that this system is low-cost, portable and does not require any sensors to be attached to the body, it could provide numerous advantages when compared to laboratory-based gait retraining systems. Copyright © 2013 Elsevier B.V. All rights reserved.

  10. 78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-09-04

    ...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

  11. Structural evolution and diversity of the caterpillar trunk

    DEFF Research Database (Denmark)

    Dupont, Steen Thorleif

    cuticle thickness, the degree of myrmecopily and the underlying mechanism of lycaenid-ant associations (MS4). In two major manuscripts (MS1-2), comparative descriptions are provided of the larval trunk in, respectively the Micropterigidae and the lowest-grade leaf-mining caterpillars. Available knowledge...

  12. Comparing routine neurorehabilitation program with trunk exercises based on Bobath concept in multiple sclerosis: pilot study.

    Science.gov (United States)

    Keser, Ilke; Kirdi, Nuray; Meric, Aydin; Kurne, Asli Tuncer; Karabudak, Rana

    2013-01-01

    This study compared trunk exercises based on the Bobath concept with routine neurorehabilitation approaches in multiple sclerosis (MS). Bobath and routine neurorehabilitation exercises groups were evaluated. MS cases were divided into two groups. Both groups joined a 3 d/wk rehabilitation program for 8 wk. The experimental group performed trunk exercises based on the Bobath concept, and the control group performed routine neurorehabilitation exercises. Additionally, both groups performed balance and coordination exercises. All patients were evaluated with the Trunk Impairment Scale (TIS), Berg Balance Scale (BBS), International Cooperative Ataxia Rating Scale (ICARS), and Multiple Sclerosis Functional Composite (MSFC) before and after the physiotherapy program. In group analysis, TIS, BBS, ICARS, and MSFC scores and strength of abdominal muscles were significantly different after treatment in both groups (p 0.05). Although trunk exercises based on the Bobath concept are rarely applied in MS rehabilitation, the results of this study show that they are as effective as routine neurorehabilitation exercises. Therefore, trunk exercises based on the Bobath concept can be beneficial in MS rehabilitation programs.

  13. Renaut bodies in nerves of the trunk of the African elephant, Loxodonta africana.

    Science.gov (United States)

    Witter, Kirsti; Egger, Gunter F; Boeck, Peter

    2007-05-01

    Renaut bodies are loosely textured, cell-sparse structures in the subperineurial space of peripheral nerves, frequently found at sites of nerve entrapment. The trunk of the elephant is a mobile, richly innervated organ, which serves for food gathering, object grasping and as a tactile organ. These functions of the trunk lead to distortion and mechanical compression of its nerves, which can therefore be expected to contain numerous Renaut bodies. Samples of the trunk wall of an adult African elephant (Loxodonta africana) were examined histologically using conventional staining methods, immunohistochemistry, and lectin histochemistry. Architecture of nerve plexuses and occurrence of Renaut bodies in the elephant trunk were compared with those in tissues surrounding the nasal vestibule of the pig. Prominent nerve plexuses were found in all layers of the elephant trunk. Almost all (81%) nerve profiles contained Renaut bodies, a basophilic, discrete subperineurial layer resembling cushions around the nerve core. In contrast, Renaut bodies were seen in only 15% of nerve profiles in the porcine nasal vestibule. Within Renaut bodies, fusiform fibroblasts and round, ruff-like cells were placed into a matrix of acidic glycosaminoglycans with delicate collagen and very few reticular fibers. The turgor of this matrix is thought to protect nerves against compression and shearing strain. Renaut bodies are readily stained with alcian blue (pH 2.5) favorably in combination with immunohistochemical markers of nerve fibers. They should be regarded as a physiological response to repeated mechanical insults and are distinct from pathological alterations. alterations. (c) 2007 Wiley-Liss, Inc.

  14. Effect of Performance Speed on Trunk Movement Control During the Curl-Up Exercise

    Directory of Open Access Journals (Sweden)

    Barbado David

    2015-06-01

    Full Text Available Trunk exercise speed has significant effects on neuro-mechanical demands; however, the influence of a variety of exercise speeds on motor control of the trunk displacement remains unknown. The aim of this study was to assess the effect of performance speed on trunk motion control during the curl-up exercise by analyzing the kinematic variance about the sagittal trajectory. Seventeen subjects volunteered to perform curl-ups at different cadences controlled by a metronome. Standard deviation (SD and range (RG of shoulder girdle medial-lateral displacement (SGML and detrended fluctuation analysis (DFA of SGML were calculated to examine linear variability and long range autocorrelation of medial-lateral upper trunk displacements, respectively. In addition, SD, RG and DFA of centre of pressure medial-lateral displacement (COPML were performed to analyze the behavior of the motor system while controlling trunk displacement. Although SD and RG of COPML increased as speed increased, the curl-up cadence did not have significant effects on SD and RG of SGML. These results suggest that although high speed curl-ups challenged participants’ ability to carry out medial-lateral adjustments, an increase of performance speed did not modify the linear variability about the sagittal trajectory. Regarding DFA, the scaling exponent α of SGML and COPML was higher for the fastest movements, mainly in long term fluctuations. Therefore, to maintain the target trajectory, participants used different strategies depending on performance speed. This is to say, there were less trajectory changes when participants performed the fastest exercises.

  15. Trunk Strength Characteristics of Elite Alpine Skiers - A Comparison with Physically Active Controls

    Directory of Open Access Journals (Sweden)

    Hildebrandt Carolin

    2017-06-01

    Full Text Available Core muscle imbalances and weak trunk strength are relevant for injury prevention and performance. Information regarding core strength requirements and ideal flexion/extension ratios in alpine skiing is limited. We aimed to compare trunk strength capacities in elite alpine skiers with those of a matched control group. The concentric maximal trunk flexion and extension of 109 elite skiers and 47 active controls were measured at 150°/s in a ballistic mode using the CON-TREX® TP 1000 test system. The relative flexion peak torque was higher in male ski racers (p = 0.003; 2.44 ± 0.30 Nm/kg than in the controls (2.32 ± 0.42 Nm/kg. The relative peak torque for extension was 4.53 ± 0.65 Nm/kg in ski racers and 4.11 ± 0.52 Nm/kg in the controls (p = 0.001. Female athletes were significantly stronger in both, relative flexion force (p = 0.006; skiers 2.05 ± 0.22 Nm/kg; controls 1.74 ± 0.28 Nm/kg and relative extension force (p = 0.001; skiers 3.55 ± 0.53 Nm/kg; controls 3.14 ± 0.48 Nm/kg. No significant differences were found in the ratios of flexion to extension forces in females and males. Ski racers are engaged in extensive strength training for both leg and trunk muscles, which explains the higher peak values. Both groups indicated a low ratio from 0.54-0.59, which represents high trunk extensor muscles strength relative to flexor muscles.

  16. Quantification of trunk and android lean mass using dual energy x-ray absorptiometry compared to magnetic resonance imaging after spinal cord injury.

    Science.gov (United States)

    Rankin, Kathleen C; O'Brien, Laura C; Gorgey, Ashraf S

    2018-02-20

    To determine whether dual energy x-ray absorptiometry (DXA) compared to magnetic resonance imaging (MRI) may accurately quantify trunk lean mass (LM) after chronic spinal cord injury (SCI) and to investigate the relationships between trunk LM, visceral adiposity, trunk fat mass and basal metabolic rate (BMR). Cross-sectional design and correlational analysis. Research setting in a medical center. Twenty-two men with motor complete paraplegia (n = 14; T4-T11) and tetraplegia (n = 8; C5-C7) were recruited as part of a clinical trial. Not applicable. Trunk and android LM were measured using DXA. The volume of six trunk muscle groups were then measured using MRI to quantify trunk LM-MRI. Subcutaneous and visceral adipose tissue (VAT) cross-sectional areas were also measured using MRI. After overnight fast, BMR was evaluated using indirect calorimetry. Trunk LM-DXA (24 ± 3.3 kg) and android LM-DXA (3.6 ± 0.7 kg) overestimated (P android LM-DXA + 0.126; r 2 =0.26, SEE= 0.21 kg, P = 0.018. Percentage trunk LM-MRI was inversely related to VAT (r=-0.79, P android LM-DXA overestimated trunk LM-MRI. Percentage trunk LM-MRI, but not LM-DXA, was inversely related to trunk central adiposity. The findings highlight the importance of exercising trunk LM to attenuate cardio-metabolic disorders after SCI.

  17. A reliability of the prototype trunk training system for sitting balance.

    Science.gov (United States)

    Jeong, Juri; Park, Dae-Sung; Lee, Hyelim; Eun, Seondeok

    2014-11-01

    [Purpose] Cerebral palsy is a disorder that affects balance in the sitting position. Cerebral palsy patients need trunk muscle strengthening and balance training. In order to improve trunk control sensory-motor control training is carried out on an unstable surface. We have developed a Trunk Training System (TTS) that can provide visual feedback using a tilt sensor for balance training in the sitting position. Before using the TTS for training children with cerebral palsy experiments were conducted with healthy adult subjects and the TTS to gather basic data for its improvement. [Subjects] The subjects were 11 healthy men (n=3) and women (n=8). [Methods] Subjects trained at two levels (5°, 10°), in four different directions (anterior, posterior, left, right), three times each. TTS outcome indices (stability index, performance time) were measured. [Results] The stability index and performance time showed high correlation (-0.6reliability (0.9<α). [Conclusion] The TTS may be used to evaluate the range of motion and execution capabilities of sitting balance. Additional experiments will be needed to investigate the validity of the TTS measurements.

  18. Effects of truncal motor imagery practice on trunk performance, functional balance, and daily activities in acute stroke

    Directory of Open Access Journals (Sweden)

    Priyanka Shah

    2016-01-01

    Full Text Available Background: Motor imagery is beneficial to treat upper and lower limbs motor impairments in stroke patients, but the effects of imagery in the trunk recovery have not been reported. Hence, the aim is to test the effects of truncal motor imagery practice on trunk performance, functional balance, and daily activities in acute stroke patients. Methods: This pilot randomized clinical trial was conducted in acute stroke unit. Acute stroke patients with hemodynamic stability, aged between 30 and 70 years, first time stroke, and scoring <20 on trunk impairment scale (TIS were included in the study. Patients in the experimental group practiced trunk motor imagery in addition to physical training. Control group was given conventional physical therapy. The treatment intensity was 90 min/day, 6 days a week for 3 weeks duration. Trunk control test, TIS, brunel balance assessment (BBA, and Barthel index (BI were considered as the outcome measures. Results: Among 23 patients included in the study, 12 and 11 patients, respectively, in the control and experimental groups completed the intervention. Repeated measures ANOVA, i.e., timeFNx01 group factor analysis and effect size showed statistically significant improvements (P = 0.001 in the scores of TIS (1.64, BBA (1.83, and BI (0.67. Conclusion: Motor imagery of trunk in addition to the physical practice showed benefits in improving trunk performance, functional balance, and daily living in acute stroke.

  19. Back muscle response to sudden trunk loading can be modified by training among healthcare workers

    DEFF Research Database (Denmark)

    Pedersen, Mogens Theisen; Essendrop, Morten; Skotte, Jørgen H.

    2007-01-01

    Study Design. Experimental study of the effect of physical training on the reaction to sudden back loading. Objective. To investigate the effect and sustainability of "on the job training" on the reaction to sudden back loading among employees at a geriatric ward. Summary of Background Data...... of the trunk (stopping time). Data on the possibilities of a training-induced improvement in the reflex response among workers exposed to sudden trunk loading on the job are, however, nonexistent, and there is no evidence of long-term benefits, i.e., the sustainability of a positive training effect. Methods....... Available data suggest that a delayed muscle reflex response to sudden trunk loading may increase the risk of low back injuries. We have previously shown that training may alter the response to sudden trunk loading in healthy subjects and decrease the time elapsed until stopping of the forward movement...

  20. Effect of different levels of alpha tocopherol on performance traits, serum antioxidant enzymes, and trace elements in Japanese quail ( Coturnix coturnix japonica under low ambient temperature

    Directory of Open Access Journals (Sweden)

    Assar Ali Shah

    Full Text Available ABSTRACT This study was designed to find the effect of vitamin E supplementation on growth, serum antioxidant enzymes, and some trace elements in Japanese quail (Coturnix coturnix japonica under low ambient temperature. A total of 180 day-old Japanese quails were randomly divided into four groups and provided with 0 (group A, 50 (group B, 100 (group C, and 150 IU/kg (group D vitamin E (dl-α-tocopherol acetate under an average temperature of 9±0.5 °C for an experimental period of 42 days. The result showed that feed intake per day, body weight, weight gain per day, and feed conversion ratio did not differ significantly between the groups. Serum concentrations of superoxide and glutathione peroxidase were significantly high in birds supplemented with 150 mg/kg of vitamin E. The concentration of aspartate aminotransferase was not significantly affected between the control and treated groups; however, alanine transaminase concentration significantly reduced in group D. Zinc concentration in the blood increased significantly in group D, with no significant effect on copper and manganese between the control and treated groups. Vitamin E at the level of 150 IU/kg of feed improves the blood antioxidant status and zinc concentration, with no effect on the performance traits of quail reared under low ambient temperature.

  1. Effect of nanosilicon dioxide on growth performance, egg quality, liver histopathology and concentration of calcium, phosphorus and silicon in egg, liver and bone in laying quails

    Science.gov (United States)

    Faryadi, Samira; Sheikhahmadi, Ardashir

    2017-11-01

    This experiment was conducted to evaluate the effects of different levels of nanosilicon dioxide (nSiO2) on performance, egg quality, liver histopathology and concentration of calcium (Ca), phosphorus and silicon (Si) in egg, liver and bone in laying quails. The experiment was administered using 60 laying quails at 16-26 weeks of age with five treatments [0 (control), 500, 1000, 2000 and 4000 mg nSiO2 per kg of diet] and four replicates in a completely randomized design. During the experiment, the amount of feed intake was recorded weekly and performance parameters were measured. During the last 3 days of the experiment, all of the eggs in each replicate were collected and egg quality parameters were measured. At the end of 26 weeks of age, the birds were sacrificed and blood samples were collected. Liver samples from each treatment were fixed in 10% buffered formalin for histopathological assessment. The right thigh bone and a portion of liver were inserted in plastic bags and stored at - 20. The results showed that nSiO2 supplementation significantly affected egg weight and egg mass ( P 0.05) by dietary treatments. In conclusion, the results indicated that dietary supplementation of nSiO2 could improve bone density and performance without any adverse effect on the health of laying quails.

  2. Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology

    Directory of Open Access Journals (Sweden)

    Lesley Joan Collins

    2011-12-01

    Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.

  3. Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology

    Science.gov (United States)

    Collins, Lesley Joan

    2011-01-01

    ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390

  4. Differences in feedforward trunk muscle activity in subgroups of patients with mechanical low back pain.

    Science.gov (United States)

    Silfies, Sheri P; Mehta, Rupal; Smith, Sue S; Karduna, Andrew R

    2009-07-01

    To investigate alterations in trunk muscle timing patterns in subgroups of patients with mechanical low back pain (MLBP). Our hypothesis was that subjects with MLBP would demonstrate delayed muscle onset and have fewer muscles functioning in a feedforward manner than the control group. We further hypothesized that we would find differences between subgroups of our patients with MLBP, grouped according to diagnosis (segmental instability and noninstability). Case-control. Laboratory. Forty-three patients with chronic MLBP (25 instability, 18 noninstability) and 39 asymptomatic controls. Not applicable. Surface electromyography was used to measure onset time of 10 trunk muscles during a self-perturbation task. Trunk muscle onset latency relative to the anterior deltoid was calculated and the number of muscles functioning in feedforward determined. Activation timing patterns (Pfeedforward (P=.02; eta=.30; 1-beta=.83) were statistically different between patients with MLBP and controls. The control group activated the external oblique, lumbar multifidus, and erector spinae muscles in a feedforward manner. The heterogeneous MLBP group did not activate the trunk musculature in feedforward, but responded with significantly delayed activations. MLBP subgroups demonstrated significantly different timing patterns. The noninstability MLBP subgroup activated trunk extensors in a feedforward manner, similar to the control group, but significantly earlier than the instability subgroup. Lack of feedforward activation of selected trunk musculature in patients with MLBP may result in a period of inefficient muscular stabilization. Activation timing was more impaired in the instability than the noninstability MLBP subgroup. Training specifically for recruitment timing may be an important component of the rehabilitation program.

  5. Preliminary Trials on Treatment of Esca-Infected Grapevines with Trunk Injection of Fungicides

    Directory of Open Access Journals (Sweden)

    T. Dula

    2007-04-01

    Full Text Available An increase in trunk diseases (due to esca, Agrobacterium, rugose wood virus, leaf roll viruses, phytoplasma etc. leading to young vines death is a very serious worry in vineyards in Hungary, as it is in other countries. In response to a demand expressed by grapevine growers, a method was tested for the direct treatment of pathogens in wood tissue. An experiment based on trunk injection was carried out in an esca infected vineyard. The various fungicides (propiconazole, difenoconazole, thiabendazole; propiconazole+ thiabendazole were injected into the trunk before the beginning of the xylem sap flow at high pressure. As a result the number of symptomatic plants was decreased, and the vigour of the plants was not impaired by the fungicide ingredients. The combination difenoconazole+ thiabendazole showed the best result.

  6. A correlational study of scoliosis and trunk balance in adult patients with mandibular deviation.

    Directory of Open Access Journals (Sweden)

    Shuncheng Zhou

    Full Text Available Previous studies have confirmed that patients with mandibular deviation often have abnormal morphology of their cervical vertebrae. However, the relationship between mandibular deviation, scoliosis, and trunk balance has not been studied. Currently, mandibular deviation is usually treated as a single pathology, which leads to poor clinical efficiency. We investigated the relationship of spine coronal morphology and trunk balance in adult patients with mandibular deviation, and compared the finding to those in healthy volunteers. 35 adult patients with skeletal mandibular deviation and 10 healthy volunteers underwent anterior X-ray films of the head and posteroanterior X-ray films of the spine. Landmarks and lines were drawn and measured on these films. The axis distance method was used to measure the degree of scoliosis and the balance angle method was used to measure trunk balance. The relationship of mandibular deviation, spine coronal morphology and trunk balance was evaluated with the Pearson correlation method. The spine coronal morphology of patients with mandibular deviation demonstrated an "S" type curve, while a straight line parallel with the gravity line was found in the control group (significant difference, p1°, while the control group had a normal trunk balance (imbalance angle <1°. There was a significant difference between the two groups (p<0.01. The degree of scoliosis and shoulder imbalance correlated with the degree of mandibular deviation, and presented a linear trend. The direction of mandibular deviation was the same as that of the lateral bending of thoracolumbar vertebrae, which was opposite to the direction of lateral bending of cervical vertebrae. Our study shows the degree of mandibular deviation has a high correlation with the degree of scoliosis and trunk imbalance, all the three deformities should be clinically evaluated in the management of mandibular deviation.

  7. Morfologia e morfometria do oviduto de codornas Nothura maculosa Morphology and morphometry of Nothura maculosa quail oviduct

    Directory of Open Access Journals (Sweden)

    Carime Moraes

    2007-02-01

    Full Text Available Este estudo teve por finalidade descrever o oviduto de codornas. Foram utilizadas 20 codornas na fase reprodutiva. Avaliaram-se os comprimentos do infundíbulo, do magno, do istmo, do útero, da vagina e o número de pregas no magno e no istmo. Para o estudo histológico, coletaram-se fragmentos do oviduto, os quais foram fixados em Bouin, destinados à rotina histológica e corados pela técnica de Hematoxilina-Eosina. O infundíbulo apresentou pregas longitudinais e oblíquas, revestidas por epitélio pseudo estratificado cilíndrico ciliado não-secretor, cranialmente, e secretor, caudalmente. O magno é o componente mais longo (15,2cm, com mucosa revestida por epitélio pseudo estratificado cilíndrico ciliado com células caliciformes. O istmo é um segmento curto, com pregas reduzidas, compostas por estruturas histológicas semelhantes ao magno. O útero é uma região de parede pregueada, com glândulas tubulares enoveladas. A vagina é um estreito tubo com musculatura espessa. O oviduto da codorna apresentou sua morfologia semelhante ao dos galiniformes, como a galinha e a perua.This study was aimed at describing the quail oviduct. Twenty quails in the reproductive phase were used. Lengths of the infundibulum, magnum, isthmus, uterus, vagina, and the number of folds of magnum and isthmus were evaluated. For the histological study, fragments of the oviduct were collected, fixed in Bouin, destined to the histological routine and stained by Hematoxilin-Eosine technique. The infundibulum presented longitudinal and oblique folds, covered with ciliated, columnar pseudostratified epithelium, nonglandular cranially, and glandular, caudally. The magnum is the longest component (15.2cm, with mucous membrane covered with ciliated, columnar pseudostratified epithelium with goblet cells. The isthmus is a short segment with reduced folds, composed by histological structures similar to the magnum. The uterus is an area of folded wall, with reeled

  8. Energia metabolizável de ingredientes determinada com codornas japonesas (Coturnix coturnix japonica Metabolizable energy of feedstuffs determined in japanese quails (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    José Humberto Vilar da Silva

    2003-12-01

    Full Text Available O experimento um foi realizado para determinar a energia metabolizável aparente (EMA e corrigida pelo balanço de nitrogênio (EMAn de nove alimentos utilizando codornas japonesas em crescimento. No experimento dois, objetivou-se comparar formulações de rações utilizando EMAn do milho e do farelo de soja determinada para frangos de corte e poedeiras, com aquelas determinadas com codornas com 22 a 27 dias de idade e 65 dias de idade. No experimento um, foram utilizadas 400 codornas em crescimento recebendo uma dieta basal (DB e nove misturas compostas por 70% da DB + 30% dos alimentos testes, totalizando dez tratamentos, cada um com quatro repetições de dez aves. No experimento dois, 160 codornas européias em postura receberam três tratamentos durante três períodos de 15 dias de duração, com doze repetições de cinco aves. Os valores de EMA e EMAn (kcal/kg determinados para os alimentos de origem vegetal foram, respectivamente, 3.340 e 3.354 para o milho moído, 2.718 e 2.456 para o farelo de soja, 3.453 e 3.084 para a soja integral extrusada, 1.624 e 1.593 para o farelo de trigo, 4.558 e 3.992 para o farelo de glúten de milho, 3.329 e 3.378 para a farinha de mandioca e 1.238 e 1.223 para a farinha integral da vagem de algaroba e para os alimentos de origem animal, respectivamente, de 2874 e 2453 para a farinha de peixe e 3090 e 2791 para a farinha de vísceras. A EMAn do milho e do farelo de soja estimada com codornas não melhorou o consumo, produção, peso e conversão por massa de ovos, validando o uso da energia desses ingredientes determinada com frangos de corte e poedeiras para compor rações para codornas.The experiment one was carried out to determine apparent metabolizable energy (AME and nitrogen-corrected ME (AMEn of nine feedstuffs in Japanese quails. The objective of the experiment two was to compare diets formulated with AMEn of corn and soybean meal, usually fed to broilers and laying hens, with diets formulated

  9. Effect of short-term exercise program on trunk muscles performance in women basketball players

    Directory of Open Access Journals (Sweden)

    Tina Grapar Žargi

    2018-01-01

    Full Text Available Background: Several studies showed that the addition of trunk muscle or core stability exercises in the sport training programs is an effective prevention of spinal and other musculoskeletal injuries. Methods: Twelve female basketball players performed supervised five-week exercise program focused on strengthening the trunk muscles. The program was performed three times per week during pre-season. Sorensen test, Fitnessgram Dynamic Curl-Up test, Prone Plank test and Side Bridge test were used to evaluate trunk muscles performance prior to and immediately after the exercise program completion and again after a three-month follow up period. Results: The results of Sorensen test and Prone Plank test significantly improved immediately after the program, but values returned to baseline at follow-up. In contrast, the results of Fitnessgram Dynamic Curl-Up test and Side Bridge test improved significantly with exercise program and remained significantly higher also at follow-up. Conclusions: Exercise program with emphasis on strengthening the trunk and core muscles can improve muscle performance, however, the results deteriorate shortly after program termination. In order to achieve long-term results, trunk and core muscle exercises have to be performed on regular basis, hence they must be incorporated into general strengthening programs of basketball players.

  10. Experimental study of steam bubble velocities and dimensions in the draught trunk of the AST-500 reactor simulator

    International Nuclear Information System (INIS)

    Shanin, V.K.; Drobkov, V.P.; Kulakov, I.V.; Khalmeh, M.V.

    1988-01-01

    Local characteristics for two-phase steam water flow in the vertical channel with 0.45 m diameter and 2 m length, which is the draught trunk of the AST-500 reactor simulator, are investigated. Steam bubble velocities and dimensions were determined by the time-of-flight method using the twinned conductometric transducers. The data obtained testify to the existance of unstable circulation flows in the trunk peripheral region. These flows effect considerably the steam phase motion in the trunk middle part. At the same time the circulation flows to a lesser degree affect steam bubble motion in the trunk low peripheral part and to the lesser degree affect the steam phase in the axial zone near the outlet from the heating section. So the data obtained confirm the conclusion, made earlier, about steam-water flow acceleration in the draught trunk central part

  11. Trunk muscle activation and associated lumbar spine joint shear forces under different levels of external forward force applied to the trunk

    NARCIS (Netherlands)

    Kingma, I.; Staudenmann, D.; van Dieen, J.H.

    2007-01-01

    High anterior intervertebral shear loads could cause low back injuries and therefore the neuromuscular system may actively counteract these forces. This study investigated whether, under constant moment loading relative to L3L4, an increased externally applied forward force on the trunk results in a

  12. Immediate Effects of Different Trunk Exercise Programs on Jump Performance.

    Science.gov (United States)

    Imai, A; Kaneoka, K; Okubo, Y; Shiraki, H

    2016-03-01

    The aim of this study was to investigate the immediate effects of trunk stabilization exercise (SE) and conventional trunk exercise (CE) programs on jump performance. 13 adolescent male soccer players performed 2 kinds of jump testing before and immediate after 3 experimental conditions: SE, CE, and non-exercise (NE). The SE program consisted of the elbow-toe, hand-knee, and back bridge, and the CE program consisted of the sit-up, sit-up with trunk rotation and back extension. Testing of a countermovement jump (CMJ) and rebound jump (RJ) were performed to assess jump performance. Jump height of the CMJ and RJ-index, contact time, and jump height of the RJ were analyzed. The RJ index was improved significantly only after SE (p=0.017). However, contact time and jump height did not improve significantly in the SE condition. Moreover, no significant interaction or main effects of time or group were observed in the CMJ. Consequently, this study showed the different immediate effect on the RJ between the SE and CE, and suggested the possibility that the SE used in this study is useful as a warm-up program to improve the explosive movements. © Georg Thieme Verlag KG Stuttgart · New York.

  13. Hippotherapy effects on trunk, pelvic, and hip motion during ambulation in children with neurological impairments.

    Science.gov (United States)

    Encheff, Jenna L; Armstrong, Charles; Masterson, Michelle; Fox, Christine; Gribble, Phillip

    2012-01-01

    This study investigated the effects of a 10-week hippotherapy program on trunk, pelvis, and hip joint positioning during the stance phase of gait. Eleven children (6 boys and 5 girls; 7.9 ± 2.7 years) with neurological disorders and impaired ambulation participated. Joint range of motion data were collected via 3-dimensional computerized gait analysis before and after the program. Paired t tests were performed on kinematic data for each joint. Significant improvements (P ≤ .008) and large effect sizes (ESs) for sagittal plane hip positions at initial contact and toe-off were found. No differences in pelvic or trunk positioning were determined, although sagittal plane pelvic positioning displayed a trend toward improvement with large ESs. Several trunk variables displayed moderate ESs with a trend toward more upright positioning. Improvements in pelvic and hip joint positioning and more normalized vertical trunk position may indicate increased postural control during gait after 10 sessions of hippotherapy.

  14. EFFECTIVENESS OF TRUNK TRAINING EXERCISES VERSUS SWISS BALL EXERCISES FOR IMPROVING SITTING BALANCE AND GAIT PARAMETERS IN ACUTE STROKE SUBJECTS

    Directory of Open Access Journals (Sweden)

    Kothalanka Viswaja

    2015-12-01

    Full Text Available Background: The aim of this study is to evaluate the effectiveness of trunk training and Swiss ball exercises in acute stroke subjects. Trunk is often neglected part in the stroke rehabilitation, trunk training exercises and Swiss ball exercises result in better recruitment of trunk muscles thus improving sitting balance and gait parameters in acute stroke subjects. However literature evidences for trunk training exercises and Swiss ball exercises in improving sitting balance and gait are scarce in acute stroke population. Methods: A total of 60 subjects who met the inclusion criteria were recruited from department of physiotherapy, G.S.L general hospital and were randomly allocated into 2 groups with 30 subjects in each group. Initially all of them were screened for balance and gait using trunk impairment scale and by assessing gait parameters, after that they were given a 30min of trunk training and Swiss ball exercises for 5 days a week for 4 weeks. Both the groups received conventional physiotherapy for 4 weeks. Results: Post intervention there was no significant difference between the two groups. There was improvement post treatment in trunk training group (P0.5. Conclusion: The results had shown that both groups noted significant difference. But when comparing between these two groups there is no statistical significance noted. So this study concluded that there is no significant difference between trunk training exercises and Swiss ball exercises on sitting balance and gait parameters in subjects with stroke.

  15. Reducing Trunk Compensation in Stroke Survivors: A Randomized Crossover Trial Comparing Visual and Force Feedback Modalities.

    Science.gov (United States)

    Valdés, Bulmaro Adolfo; Schneider, Andrea Nicole; Van der Loos, H F Machiel

    2017-10-01

    To investigate whether the compensatory trunk movements of stroke survivors observed during reaching tasks can be decreased by force and visual feedback, and to examine whether one of these feedback modalities is more efficacious than the other in reducing this compensatory tendency. Randomized crossover trial. University research laboratory. Community-dwelling older adults (N=15; 5 women; mean age, 64±11y) with hemiplegia from nontraumatic hemorrhagic or ischemic stroke (>3mo poststroke), recruited from stroke recovery groups, the research group's website, and the community. In a single session, participants received augmented feedback about their trunk compensation during a bimanual reaching task. Visual feedback (60 trials) was delivered through a computer monitor, and force feedback (60 trials) was delivered through 2 robotic devices. Primary outcome measure included change in anterior trunk displacement measured by motion tracking camera. Secondary outcomes included trunk rotation, index of curvature (measure of straightness of hands' path toward target), root mean square error of hands' movement (differences between hand position on every iteration of the program), completion time for each trial, and posttest questionnaire to evaluate users' experience and system's usability. Both visual (-45.6% [45.8 SD] change from baseline, P=.004) and force (-41.1% [46.1 SD], P=.004) feedback were effective in reducing trunk compensation. Scores on secondary outcome measures did not improve with either feedback modality. Neither feedback condition was superior. Visual and force feedback show promise as 2 modalities that could be used to decrease trunk compensation in stroke survivors during reaching tasks. It remains to be established which one of these 2 feedback modalities is more efficacious than the other as a cue to reduce compensatory trunk movement. Copyright © 2017 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

  16. How does knee pain affect trunk and knee motion during badminton forehand lunges?

    Science.gov (United States)

    Huang, Ming-Tung; Lee, Hsing-Hsan; Lin, Cheng-Feng; Tsai, Yi-Ju; Liao, Jen-Chieh

    2014-01-01

    Badminton requires extensive lower extremity movement and a precise coordination of the upper extremity and trunk movements. Accordingly, this study investigated motions of the trunk and the knee, control of dynamic stability and muscle activation patterns of individuals with and without knee pain. Seventeen participants with chronic knee pain and 17 healthy participants participated in the study and performed forehand forward and backward diagonal lunges. This study showed that those with knee pain exhibited smaller knee motions in frontal and horizontal planes during forward lunge but greater knee motions in sagittal plane during backward lunge. By contrast, in both tasks, the injured group showed a smaller value on the activation level of the paraspinal muscles in pre-impact phase, hip-shoulder separation angle, trunk forward inclination range and peak centre of mass (COM) velocity. Badminton players with knee pain adopt a more conservative movement pattern of the knee to minimise recurrence of knee pain. The healthy group exhibit better weight-shifting ability due to a greater control of the trunk and knee muscles. Training programmes for badminton players with knee pain should be designed to improve both the neuromuscular control and muscle strength of the core muscles and the knee extensor with focus on the backward lunge motion.

  17. [Muscular trunk stability in professional and amateur volleyball players].

    Science.gov (United States)

    Miltner, O; Siebert, C; Tschaepe, R; Maus, U; Kieffer, O

    2010-03-01

    The aim of this study was to analyse the efficiency of muscular activity in the trunk stabilisation of professional volleyball players compared to a group of amateur hobby players. The results were compared amongst the groups as well as with a reference group consisting of asymptomatic individuals. The question to be answered was whether or not professional volleyball players possess a characteristic strength profile in their trunk musculature and if differences exist with regard to the individuals' competitive playing level. In this comparative study 12 professional volleyball players (German Bundesliga) and 18 non-professional volleyball players were analysed with regard to their isometric strength profile in all three planes. The reference group was provided by the Proxomed company, which had previously analysed healthy untrained individuals (n = 1045) of various age groups. A sports-specific profile for the musculature of volleyball players revealed a significant reduction in the flexion and rotation strength as well as a well-developed lateral flexion strength (highly significant when compared to the reference group). With reference to the level played, better strength values in flexion and lateral flexion were found among the professional athletes. Professional volleyball players present with a characteristic trunk musculature strength profile. A detailed analysis of the muscle strength of the spine as part of a sports medicine work-up could prove helpful in preventing injuries and overuse problems in professional and hobby volleyball players.

  18. Effect of dietary supplementation of fermented fish silage on serum biochemical parameters of broiler Japanese quails (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Laxman Kumar Babu

    2017-04-01

    Full Text Available Aim: The objective of this study was to evaluate the effect of feeding fermented fish silage (FFS on serum biochemical parameters of Japanese quails (Coturnix coturnix japonica. Materials and Methods: A total of 192, 7-day-old broiler Japanese quail chicks of either sex, were randomly distributed into four dietary treatments with four replicates in each group having 12 chicks in each replicate pen. The dietary treatments were T1 - Control diet, T2 - Diet containing 5% FFS, T3 - Diet containing 10% FFS, and T4 - Diet containing 15% FFS. Group body weight and feed consumption were recorded at weekly intervals. Feed conversion ratio (FCR was derived by dividing the feed consumed with the weekly body weight gain. At the end of the experiment, 8 birds from each treatment were selected randomly and sacrificed by cervical dislocation to study the carcass traits expressed as % pre-slaughter live weight. At 5 weeks of age, about 2 ml of blood was taken from the jugular vein of each selected bird, and serum samples were separated after centrifugation. Total protein, albumin/globulin (A/G ratio, calcium, phosphorus, triglyceride, total cholesterol, high density lipoprotein-cholesterol (HDL-C, very low density lipoprotein-cholesterol (VLDL-C, low density lipoprotein-cholesterol (LDL-C, alanine aminotransferase (ALT, and aspartate aminotransferase (AST were estimated in the serum. Results: The cumulative body weight gains from 1 to 5 weeks of age did not vary significantly between control and 5% FFS group. However, a linear decrease in body weight gain was observed by increasing the levels of FFS beyond 5% in the diet. The cumulative feed consumption was significantly higher in case of birds under control group during 1-5 weeks of age as compared to birds fed FFS based diet (5%, 10%, and 15%. No statistical difference in cumulative feed conversion ratio could be noticed during 1-5 weeks of age. The eviscerated yield decreased and giblet weight increased due

  19. Effect of Ankle Mobility and Segment Ratios on Trunk Lean in the Barbell Back Squat

    DEFF Research Database (Denmark)

    Fuglsang, Emil I; Telling, Anders S; Sørensen, Henrik

    2017-01-01

    , injuries are common, and people with a history of lower back pain are especially vulnerable. Past studies have shown that higher trunk angles (less forward lean) generate less stress on the lower back; thus, it seems appropriate to investigate the factors presumed to influence the trunk angle. Therefore...

  20. Distribution of orally administered and chronically fed /sup 95m/Tc in Japanese quail tissues and eggs

    International Nuclear Information System (INIS)

    Thomas, J.M.; Cadwell, L.L.; Garland, T.R.; Cataldo, D.A.

    1984-10-01

    Previous coefficients for transfer of technetium from feed to poultry have utilized default values. These investigations examined the uptake and distribution of /sup 95m/Tc in male and female Japanese quail following their ingestion of Tc incorporated into alfalfa during growth. Approximately 8% of the daily ingested Tc was transferred to eggs. Biological half-time was one to two days. After 10 days of feeding, 80% of the Tc was in yolk, 20% in albumin, and less than 1% in shell and associated membranes. The Tc levels in albumin reached a maximum between three and five days, compared to six to seven days for yolk. Laying female quail contained 27% of the daily-ingested Tc compared to 5% for males. However, approximately 23% of the daily female Tc intake was contained in the developing ova and reproductive organs. The highest Tc concentrations were in oocytes of laying hens, followed by the fully formed unlaid egg and the ovaries. The uterine shelled egg contained five times the amount of Tc present in other edible tissues combined. For males, the gizzard contained about 53% of the Tc in other edible tissues, followed by muscle (25%), liver (19%), and heart (3%). The transfer coefficient (pCi/kg edible tissue per pCi/day) for plant-incorporated /sup 95m/Tc was about 0.35 day/kg for both sexes. 17 references, 4 tables

  1. Enterococci Isolated from Japanese Quails Exposed to Microgravity Conditions and Stability of their Properties

    Directory of Open Access Journals (Sweden)

    Andrea Lauková

    2009-01-01

    Full Text Available Enterococci isolated from the crop and caecum of Japanese quails exposed to 7 day conditions of microgravity were re-vitalized after their dry-freezing long storage. Originally, the strains were isolated from Japanese quails after their landing from flight onboard the orbital station Mir during the experiment in August 1990. Because taxonomy as well as the studies concerning the bacteriocins, especially those produced by enterococci, have been continually developed for years, the aim of this study was to confirm species identification, stability of the properties of enterococci as well as to test new properties after their long storage. Genotyping allotted the strains to the species E. faecium. Lactic acid production was detected in similar amounts in the strains before and after their long-storage in dry-frozen form. The strains were vancomycinsensitive and kanamycin-resistant before as well as after their long-time storage. Variability in sensitivity to different antibiotics was found among the strains tested even before and after longtime storage. Each of the strains possessed at least one structural enterocin gene. The structural genes for enterocin A, P, B, L50B were detected in E. faecium EP7. E. faecium EP2, EEP4 have the genes for ent A, B, L50B. The gene for ent P was detected only in the strain EP7. The most often detected was ent A gene followed by ent genes B, L50B. All strains inhibited growth of at least 4 out of 15 indicators. The stability of the enterococcal properties determined before as well as after their dry-freezing was not influenced during their long-term storage; moreover, new properties were determined.

  2. The baryon vector current in the combined chiral and 1/Nc expansions

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Mendieta, Ruben; Goity, Jose L [JLAB

    2014-12-01

    The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.

  3. 33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

  4. Effects of Muscle Fatigue, Creep, and Musculoskeletal Pain on Neuromuscular Responses to Unexpected Perturbation of the Trunk: A Systematic Review.

    Science.gov (United States)

    Abboud, Jacques; Lardon, Arnaud; Boivin, Frédéric; Dugas, Claude; Descarreaux, Martin

    2016-01-01

    Introduction: Trunk neuromuscular responses have been shown to adapt under the influence of muscle fatigue, as well as spinal tissue creep or even with the presence of low back pain (LBP). Despite a large number of studies exploring how these external perturbations affect the spinal stability, characteristics of such adaptations remains unclear. Aim: The purpose of this systematic review was to assess the quality of evidence of studies investigating trunk neuromuscular responses to unexpected trunk perturbation. More specifically, the targeted neuromuscular responses were trunk muscle activity reflex and trunk kinematics under the influence of muscle fatigue, spinal creep, and musculoskeletal pain. Methods: A research of the literature was conducted in Pubmed, Embase, and Sport-Discus databases using terms related to trunk neuromuscular reflex responses, measured by electromyography (baseline activity, reflex latency, and reflex amplitude) and/or trunk kinematic, in context of unexpected external perturbation. Moreover, independent variables must be either trunk muscle fatigue or spinal tissue creep or LBP. All included articles were scored for their electromyography methodology based on the "Surface Electromyography for the Non-Invasive Assessment of Muscles (SENIAM)" and the "International Society of Electrophysiology and Kinesiology (ISEK)" recommendations whereas overall quality of articles was scored using a specific quality checklist modified from the Quality Index. Meta-analysis was performed on reflex latency variable. Results: A final set of 29 articles underwent quality assessments. The mean quality score was 79%. No effect of muscle fatigue on erector spinae reflex latency following an unexpected perturbation, nor any other distinctive effects was found for back muscle fatigue and reflex parameters. As for spinal tissue creep effects, no alteration was found for any of the trunk reflex variables. Finally, the meta-analysis revealed an increased erector

  5. Effect of Core Stability Training on Trunk Function, Standing Balance, and Mobility in Stroke Patients.

    Science.gov (United States)

    Haruyama, Koshiro; Kawakami, Michiyuki; Otsuka, Tomoyoshi

    2017-03-01

    Trunk function is important for standing balance, mobility, and functional outcome after stroke, but few studies have evaluated the effects of exercises aimed at improving core stability in stroke patients. To investigate the effectiveness of core stability training on trunk function, standing balance, and mobility in stroke patients. An assessor-blinded, randomized controlled trial was undertaken in a stroke rehabilitation ward, with 32 participants randomly assigned to an experimental group or a control group (n = 16 each). The experimental group received 400 minutes of core stability training in place of conventional programs within total training time, while the control group received only conventional programs. Primary outcome measures were evaluated using the Trunk Impairment Scale (TIS), which reflects trunk function. Secondary outcome measures were evaluated by pelvic tilt active range of motion in the sagittal plane, the Balance Evaluation Systems Test-brief version (Brief-BESTest), Functional Reach test, Timed Up-and-Go test (TUG), and Functional Ambulation Categories (FAC). A general linear repeated-measures model was used to analyze the results. A treatment effect was found for the experimental group on the dynamic balance subscale and total score of the TIS ( P = .002 and P Core stability training has beneficial effects on trunk function, standing balance, and mobility in stroke patients. Our findings might provide support for introducing core stability training in stroke rehabilitation.

  6. Biomechanical compensations of the trunk and lower extremities during stepping tasks after unilateral transtibial amputation.

    Science.gov (United States)

    Murray, Amanda M; Gaffney, Brecca M; Davidson, Bradley S; Christiansen, Cory L

    2017-11-01

    Lower extremity movement compensations following transtibial amputation are well-documented and are likely influenced by trunk posture and movement. However, the biomechanical compensations of the trunk and lower extremities, especially during high-demand tasks such as step ascent and descent, remain unclear. Kinematic and kinetic data were collected during step ascent and descent tasks for three groups of individuals: diabetic/transtibial amputation, diabetic, and healthy. An ANCOVA was used to compare peak trunk, hip and knee joint angles and moments in the sagittal and frontal planes between groups. Paired t-tests were used to compare peak joint angles and moments between amputated and intact limbs of the diabetic/transtibial amputation group. During step ascent and descent, the transtibial amputation group exhibited greater trunk forward flexion and lateral flexion compared to the other two groups (Pbiomechanical compensations of the trunk and lower extremities in individuals with dysvascular transtibial amputation, by identifying low back, hip, and knee joint moment patterns unique to transtibial amputation during stepping tasks. In addition, the results suggest that some movement compensations may be confounded by the presence of diabetes and precede limb amputation. The increased and asymmetrical loading patterns identified may predispose individuals with transtibial amputation to the development of secondary pain conditions, such as low back pain or osteoarthritis. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. In ovo Technology and newcastle disease resistance in Japanese Quail

    International Nuclear Information System (INIS)

    Ezzat, I.E.; Abu-Taleb, A.M.; Ali, I.E.; Shabana, M.K.

    2001-01-01

    A total number of 1600 fertile eggs from japanese quail birds were used in this study. The eggs were divided into eight groups then incubated. NDV and vite were administered to the groups of eggs in Ovo injection at day 14 from incubation. Hatchability, body weight, egg production and mortality were recorded weekly for each group. Five blood samples were collected weekly from each group to measure total serum proteins, albumin, globulin, T3, T4 and HI titre. The results of this work revealed an increase in total serum proteins, globulin, and a decrease in t3, T4 and albumin values of the in ove vaccinating groups. Also HI titre recorded higher values due to ovo vaccination alone or combined with vit. E. It was noticed that the group injected by inactive vaccine plus vit. E registered high increases in hatchability, body weight and egg production beside a decrease in mortality

  8. EMG activity of hip and trunk muscles during deep-water running.

    Science.gov (United States)

    Kaneda, Koichi; Sato, Daisuke; Wakabayashi, Hitoshi; Nomura, Takeo

    2009-12-01

    The present study used synchronized motion analysis to investigate the activity of hip and trunk muscles during deep-water running (DWR) relative to land walking (LW) and water walking (WW). Nine healthy men performed each exercise at self-determined slow, moderate, and fast paces, and surface electromyography was used to investigate activity of the adductor longus, gluteus maxima, gluteus medius, rectus abdominis, oblique externus abdominis, and erector spinae. The following kinematic parameters were calculated: the duration of one cycle, range of motion (ROM) of the hip joint, and absolute angles of the pelvis and trunk with respect to the vertical axis in the sagittal plane. The percentages of maximal voluntary contraction (%MVC) of each muscle were higher during DWR than during LW and WW. The %MVC of the erector spinae during WW increased concomitant with the pace increment. The hip joint ROMs were larger in DWR than in LW and WW. Forward inclinations of the trunk were apparent for DWR and fast-paced WW. The pelvis was inclined forward in DWR and WW. In conclusion, the higher-level activities during DWR are affected by greater hip joint motion and body inclinations with an unstable floating situation.

  9. Effects of weight loss and exercise on trunk muscle composition in older women

    Directory of Open Access Journals (Sweden)

    Ryan AS

    2014-03-01

    Full Text Available Alice S Ryan, Aruna Selina Harduarsingh-Permaul Baltimore Veterans Affairs Medical Center; Gerontology and Geriatric Medicine, School of Medicine, University of Maryland; Baltimore Geriatric Research Education and Clinical Center (GRECC, and Research and Development Service, VA Maryland Health Care System, Baltimore, MD, USA Background: Aging and obesity increase the risk for mobility limitations in women. Although trunk muscle composition is important to physical function, the implication of ectopic fat in the trunk muscles with respect to physical fitness and its potential for modification by lifestyle changes is unknown. Methods: The effects of a 6-month period of either weight loss (WL alone or of aerobic exercise (AEX plus WL (AEX+WL, on trunk body composition, as measured by dual-energy X-ray absorptiometry (DXA (to measure trunk fat and lean mass and computed tomography (CT (to measure the erector spinae, psoas, lateral abdominal, rectus abdominis muscle, and intramuscular fat, and the intramuscular adipose tissue [IMAT] areas was determined in 65 overweight and obese postmenopausal women (aged 50-76 years. Results: The area of the erector spinae, psoas, and rectus abdominis muscles declined with age in the women (P<0.05. Both the spinal and abdominal muscle areas were related to the maximal oxygen uptake (VO2max (P<0.05. Body weight decreased by 8% after both AEX+WL and WL (P<0.001. The VO2max increased by 11% after AEX+WL (P<0.001 but did not change with WL alone (group effect, P<0.001. The DXA-measured trunk fat mass decreased by 16% after AEX+WL (P<0.001 and by 12% after WL (P<0.001. When both groups were combined, the IMAT decreased in all four muscle groups - by 6% in the erector spinae (P<0.01, by 9% in the psoas (P<0.01, by 11% in the lateral abdominals (P<0.001, and by 6% in the rectus abdominis (P<0.05. The loss of fat mass was related to the loss of IMAT of the erector spinae and the lateral abdominals. Conclusions: A lifestyle

  10. Mycotic Aneurysm of the Celiac Trunk: From Early CT Sign to Rupture

    International Nuclear Information System (INIS)

    Serafino, Gianpiero; Vroegindeweij, Dammis; Boks, Simone; Harst, Erwin van der

    2005-01-01

    We present a case of the rapid development and rupture of a mycotic celiac trunk aneurysm. Initiallyon multislice computed tomography (ms-CT) there was a normal celiac trunk with minimal haziness of the surrounding fat. Only 2 weeks later the patient went into hypovolemic shock due to a ruptured celiac aneurysm. Although aneurysms of the visceral arteries are rare, they are of major clinical importance as they carry a life-threatening risk of rupture. This case illustrates the use of ms-CT in detecting and evaluating visceral aneurysms, in order to prevent emergency operation

  11. The Effects of Vibration and Muscle Fatigue on Trunk Sensorimotor Control in Low Back Pain Patients.

    Directory of Open Access Journals (Sweden)

    Jean-Alexandre Boucher

    Full Text Available Changes in sensorimotor function and increased trunk muscle fatigability have been identified in patients with chronic low back pain (cLBP. This study assessed the control of trunk force production in conditions with and without local erector spinae muscle vibration and evaluated the influence of muscle fatigue on trunk sensorimotor control.Twenty non-specific cLBP patients and 20 healthy participants were asked to perform submaximal isometric trunk extension torque with and without local vibration stimulation, before and after a trunk extensor muscle fatigue protocol. Constant error (CE, variable error (VE as well as absolute error (AE in peak torque were computed and compared across conditions. Trunk extensor muscle activation during isometric contractions and during the fatigue protocol was measured using surface electromyography (sEMG.Force reproduction accuracy of the trunk was significantly lower in the patient group (CE = 9.81 ± 2.23 Nm; AE = 18.16 ± 3.97 Nm than in healthy participants (CE = 4.44 ± 1.68 Nm; AE = 12.23 ± 2.44 Nm. Local erector spinae vibration induced a significant reduction in CE (4.33 ± 2.14 Nm and AE (13.71 ± 3.45 Nm mean scores in the patient group. Healthy participants conversely showed a significant increase in CE (8.17 ± 2.10 Nm and AE (16.29 ± 2.82 Nm mean scores under vibration conditions. The fatigue protocol induced erector spinae muscle fatigue as illustrated by a significant decrease in sEMG median time-frequency slopes. Following the fatigue protocol, patients with cLBP showed significant decrease in sEMG root mean square activity at L4-5 level and responded in similar manner with and without vibration stimulation in regard to CE mean scores.Patients with cLBP have a less accurate force reproduction sense than healthy participants. Local muscle vibration led to significant trunk neuromuscular control improvements in the cLBP patients before and after a muscle fatigue protocol. Muscle vibration

  12. The Effects of Vibration and Muscle Fatigue on Trunk Sensorimotor Control in Low Back Pain Patients

    Science.gov (United States)

    Abboud, Jacques; Nougarou, François; Normand, Martin C.

    2015-01-01

    Introduction Changes in sensorimotor function and increased trunk muscle fatigability have been identified in patients with chronic low back pain (cLBP). This study assessed the control of trunk force production in conditions with and without local erector spinae muscle vibration and evaluated the influence of muscle fatigue on trunk sensorimotor control. Methods Twenty non-specific cLBP patients and 20 healthy participants were asked to perform submaximal isometric trunk extension torque with and without local vibration stimulation, before and after a trunk extensor muscle fatigue protocol. Constant error (CE), variable error (VE) as well as absolute error (AE) in peak torque were computed and compared across conditions. Trunk extensor muscle activation during isometric contractions and during the fatigue protocol was measured using surface electromyography (sEMG). Results Force reproduction accuracy of the trunk was significantly lower in the patient group (CE = 9.81 ± 2.23 Nm; AE = 18.16 ± 3.97 Nm) than in healthy participants (CE = 4.44 ± 1.68 Nm; AE = 12.23 ± 2.44 Nm). Local erector spinae vibration induced a significant reduction in CE (4.33 ± 2.14 Nm) and AE (13.71 ± 3.45 Nm) mean scores in the patient group. Healthy participants conversely showed a significant increase in CE (8.17 ± 2.10 Nm) and AE (16.29 ± 2.82 Nm) mean scores under vibration conditions. The fatigue protocol induced erector spinae muscle fatigue as illustrated by a significant decrease in sEMG median time-frequency slopes. Following the fatigue protocol, patients with cLBP showed significant decrease in sEMG root mean square activity at L4-5 level and responded in similar manner with and without vibration stimulation in regard to CE mean scores. Conclusions Patients with cLBP have a less accurate force reproduction sense than healthy participants. Local muscle vibration led to significant trunk neuromuscular control improvements in the cLBP patients before and after a muscle

  13. Sulphur and oxygen sequestration of n-C 37 and n-C 38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

    Science.gov (United States)

    Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.

    1997-06-01

    Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.

  14. Sulphur and oxygen sequestration of n-C37 and n-C38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

    Science.gov (United States)

    Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.

    1997-01-01

    Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.

  15. Evaluating Primary Dendrite Trunk Diameters in Directionally Solidified Al-Si Alloys

    Science.gov (United States)

    Grugel, R. N.; Tewari, S. N.; Poirier, D. R.

    2014-01-01

    The primary dendrite trunk diameters of Al-Si alloys that were directionally solidified over a range of processing conditions have been measured. These data are analyzed with a model based primarily on an assessment of secondary dendrite arm dissolution in the mushy zone. Good fit with the experimental data is seen and it is suggested that the primary dendrite trunk diameter is a useful metric that correlates well with the actual solidification processing parameters. These results are placed in context with the limited results from the aluminium - 7 wt. % silicon samples directionally solidified aboard the International Space Station as part of the MICAST project.

  16. Effects of epidermal growth factor on neural crest cells in tissue culture

    International Nuclear Information System (INIS)

    Erickson, C.A.; Turley, E.A.

    1987-01-01

    Epidermal growth factor (EGF) stimulates the release of hyaluronic acid (HA) and chondroitin sulfate proteoglycan (CSPG) from quail trunk neural crest cultures in a dose-dependent fashion. It also promotes the expression of cell-associated heparan sulfate proteoglycan (HSPG) as detected by immunofluorescence and immunoprecipitation of the 3 H-labeled proteoglycan. Furthermore, EGF stimulates [ 3 H]thymidine incorporation into total cell DNA. These results raise the possibility that EGF or an analogous growth factor is involved in regulation of neural crest cell morphogenesis

  17. The effects of virtual reality game training on trunk to pelvis coupling in a child with cerebral palsy

    Directory of Open Access Journals (Sweden)

    Barton Gabor J

    2013-02-01

    Full Text Available Abstract Background Good control of trunk and pelvic movements is necessary for well controlled leg movements required to perform activities of daily living. The nature of movement coupling between the trunk and pelvis varies and depends on the type of activity. Children with cerebral palsy often have reduced ability to modulate coupling between the trunk and pelvis but movement patterns of the pelvis can be improved by training. The aim of this study was to examine how pelvis to trunk coupling changed while playing a computer game driven by pelvic rotations. Methods One boy with cerebral palsy diplegia played the Goblin Post Office game on the CAREN virtual rehabilitation system for six weeks. He navigated a flying dragon in a virtual cave towards randomly appearing targets by rotating the pelvis around a vertical axis. Motion of the pelvis and trunk was captured in real-time by a Vicon 612 optoelectronic system tracking two clusters of three markers attached to the sacrum and thoracic spine. Results Convex hull areas calculated from angle-angle plots of pelvic and trunk rotations showed that coupling increased over game training (F1,11 = 7.482, p = 0.019. Reaching to targets far from the midline required tighter coupling than reaching near targets (F1,12 = 10.619, p = 0.007. Conclusions Increasing coupling appears to be an initial compensation mechanism using the better controlled trunk to drive rotation of the pelvis. Co-contractions causing increased coupling are expected to reduce over longer exposure to training. The control scheme of the training game can be set to facilitate de-coupling of pelvic movements from the trunk. Using large ranges of pelvic rotation required more coupling suggesting that training of selective pelvic movements is likely to be more effective close to a neutral pelvic posture.

  18. The effects of virtual reality game training on trunk to pelvis coupling in a child with cerebral palsy.

    Science.gov (United States)

    Barton, Gabor J; Hawken, Malcolm B; Foster, Richard J; Holmes, Gill; Butler, Penny B

    2013-02-07

    Good control of trunk and pelvic movements is necessary for well controlled leg movements required to perform activities of daily living. The nature of movement coupling between the trunk and pelvis varies and depends on the type of activity. Children with cerebral palsy often have reduced ability to modulate coupling between the trunk and pelvis but movement patterns of the pelvis can be improved by training. The aim of this study was to examine how pelvis to trunk coupling changed while playing a computer game driven by pelvic rotations. One boy with cerebral palsy diplegia played the Goblin Post Office game on the CAREN virtual rehabilitation system for six weeks. He navigated a flying dragon in a virtual cave towards randomly appearing targets by rotating the pelvis around a vertical axis. Motion of the pelvis and trunk was captured in real-time by a Vicon 612 optoelectronic system tracking two clusters of three markers attached to the sacrum and thoracic spine. Convex hull areas calculated from angle-angle plots of pelvic and trunk rotations showed that coupling increased over game training (F1,11 = 7.482, p = 0.019). Reaching to targets far from the midline required tighter coupling than reaching near targets (F1,12 = 10.619, p = 0.007). Increasing coupling appears to be an initial compensation mechanism using the better controlled trunk to drive rotation of the pelvis. Co-contractions causing increased coupling are expected to reduce over longer exposure to training. The control scheme of the training game can be set to facilitate de-coupling of pelvic movements from the trunk. Using large ranges of pelvic rotation required more coupling suggesting that training of selective pelvic movements is likely to be more effective close to a neutral pelvic posture.

  19. Study of Normal Branching Pattern of the Coeliac Trunk and its Variations Using CT Angiography.

    Science.gov (United States)

    Selvaraj, Lakshana; Sundaramurthi, Indumathi

    2015-09-01

    Blood vessel anomalies are always interesting from embryological view and of considerable significance from a clinical or a surgical standpoint. Vascular anomalies are usually asymptomatic; they may cause problems in patients undergoing diagnostic angiography or any operative procedure. The length and course of the coeliac artery are variable and its branches frequently arise separately from the main trunk. Several other branches may additionally arise from the coeliac trunk, for example, inferior phrenic arteries, the dorsal pancreatic artery, and the middle colic artery. The present study was undertaken to analyse the vertebral level of origin of coeliac artery, its branching pattern and the associated variations using computed tomographic angiography in 75 subjects. The results obtained were analysed and classified based on Adachi's and Lipshutz's classification method. The results were also compared with various other studies cited in the literature. The level of origin was found to be at the inter-vertebral disc between T12 and L1 in a majority of the cases (70.6%). It was also found that the coeliac trunk trifurcates in majority of the cases i.e. 90.6%. Trifurcation was of two types, classical and non-classical, the classical trunk being the commonest type. Variations included bifurcation of the trunk (8%) with Left gastric artery arising directly from the aorta, in a few cases (1.3%) Common hepatic artery arose as a separate trunk from the aorta. A comprehensive knowledge of this arterial anatomy and variations will be very useful when planning abdominal surgeries and image-guided interventions. The success of procedures such as liver transplantation, intestinal anastomosis, intra-arterial chemotherapy, chemo-embolization, and radio-embolization requires a detailed knowledge of the coeliac artery and its anatomical variants, which are extremely common, to avoid iatrogenic injuries and to prevent complications.

  20. Degree of thoracic kyphosis and peak torque of trunk flexors and extensors among healthy women.

    Science.gov (United States)

    Granito, Renata Neves; Aveiro, Mariana Chaves; Rennó, Ana Claudia Muniz; Oishi, Jorge; Driusso, Patricia

    2014-01-01

    The aim of this study was to analyze the effects of aging on the degree of thoracic kyphosis and peak torque of the trunk flexor and extensor muscles among women without a densitometric diagnosis of osteoporosis. Thirty women were selected to make up three groups: young women (n = 10; 24.60 ± 2.27 years of age); adults (n = 10; 43.50 ± 2.88); and elderly women (n = 10; 62.40 ± 2.67). Bone mineral density (BMD), degree of thoracic kyphosis and peak torque of the trunk flexors and extensors were evaluated. Differences between the groups were evaluated using the Kruskal-Wallis ANOVA and Mann-Whitney U tests. Pearson's correlation coefficient was used to assess correlations between the variables. The significance level was taken to be 5% (p ≤ 0.05). The elderly group presented a greater degree of thoracic kyphosis (p = 0.009) and lower peak torque of the trunk flexors and extensors than the young group. The adult group presented lower peak torque of the trunk than the young group. A negative correlation was observed between age and peak torque of the trunk flexors and extensors (p ≤ 0.001), and a positive correlation between age and the degree of thoracic kyphosis (r = 0.58; p ≤ 0.001). The elderly group presented higher values for the eccentric/concentric ratio of the peak torque for flexors (p = 0.03) and extensors (p = 0.02). This study suggests that physiological aging may be associated with a greater degree of thoracic kyphosis and lower muscle strength of the trunk flexors and extensors. Moreover, the elderly women showed a relative capacity for preservation of eccentric strength.

  1. Degree of thoracic kyphosis and peak torque of trunk flexors and extensors among healthy women,

    Directory of Open Access Journals (Sweden)

    Renata Neves Granito

    2014-06-01

    Full Text Available OBJECTIVE: The aim of this study was to analyze the effects of aging on the degree of thoracic kyphosis and peak torque of the trunk flexor and extensor muscles among women without a densitometric diagnosis of osteoporosis.METHODS: Thirty women were selected to make up three groups: young women (n = 10; 24.60 ± 2.27 years of age; adults (n = 10; 43.50 ± 2.88; and elderly women (n= 10; 62.40 ± 2.67. Bone mineral density (BMD, degree of thoracic kyphosis and peak torque of the trunk flexors and extensors were evaluated. Differences between the groups were evaluated using the Kruskal-Wallis ANOVA and Mann-Whitney U tests. Pearson's correlation coefficient was used to assess correlations between the variables. The significance level was taken to be 5% (p < 0.05.RESULTS: The elderly group presented a greater degree of thoracic kyphosis (p = 0.009 and lower peak torque of the trunk flexors and extensors than the young group. The adult group presented lower peak torque of the trunk than the young group. A negative correlation was observed between age and peak torque of the trunk flexors and extensors (p < 0.001, and a positive correlation between age and the degree of thoracic kyphosis (r = 0.58; p < 0.001. The elderly group presented higher values for the eccentric/concentric ratio of the peak torque for flexors (p = 0.03 and extensors (p = 0.02.CONCLUSION: This study suggests that physiological aging may be associated with a greater degree of thoracic kyphosis and lower muscle strength of the trunk flexors and extensors. Moreover, the elderly women showed a relative capacity for preservation of eccentric strength.

  2. Anatomical variability of the trunk wood and root tissues of ...

    African Journals Online (AJOL)

    Any interspecies variability was found between their trunk vessels diameter. However, a significant ... are discharged in the sea, releasing like this toxic organic ...... Water. Discharge on nutrient contamination of mangrove soils and plants.

  3. Spinal mobility and trunk muscle strength in elite hockey players.

    Science.gov (United States)

    Lindgren, S; Twomey, L

    1988-01-01

    Elite hockey players of both sexes from the Australian Institute of Sport were assessed for lumbar spine mobility, trunk flexion and back extensor muscle strength, hamstring flexibility and postural characteristics over a two year period. All the athletes were more mobile in rotation than the 'normal' West Australian population, and demonstrated flexible hamstrings and powerful back extensor muscles; trunk flexion was less strong initially, but improved after intervention in the form of a specific exercise programme, over the measurement period. A questionnaire disclosed that low back pain is a common complaint of hockey players, but rarely required intensive physical and medical treatment. The term 'hockey player's back' has been coined in recognition of the long flat thoracolumbar spine frequently noted in these subjects. Copyright © 1988 Australian Physiotherapy Association. Published by . All rights reserved.

  4. Proposal and validation of a clinical trunk control test in individuals with spinal cord injury.

    Science.gov (United States)

    Quinzaños, J; Villa, A R; Flores, A A; Pérez, R

    2014-06-01

    One of the problems that arise in spinal cord injury (SCI) is alteration in trunk control. Despite the need for standardized scales, these do not exist for evaluating trunk control in SCI. To propose and validate a trunk control test in individuals with SCI. National Institute of Rehabilitation, Mexico. The test was developed and later evaluated for reliability and criteria, content, and construct validity. We carried out 531 tests on 177 patients and found high inter- and intra-rater reliability. In terms of criterion validity, analysis of variance demonstrated a statistically significant difference in the test score of patients with adequate or inadequate trunk control according to the assessment of a group of experts. A receiver operating characteristic curve was plotted for optimizing the instrument's cutoff point, which was determined at 13 points, with a sensitivity of 98% and a specificity of 92.2%. With regard to construct validity, the correlation between the proposed test and the spinal cord independence measure (SCIM) was 0.873 (P=0.001) and that with the evolution time was 0.437 (P=0.001). For testing the hypothesis with qualitative variables, the Kruskal-Wallis test was performed, which resulted in a statistically significant difference between the scores in the proposed scale of each group defined by these variables. It was proven experimentally that the proposed trunk control test is valid and reliable. Furthermore, the test can be used for all patients with SCI despite the type and level of injury.

  5. Test-retest reliability of trunk accelerometric gait analysis

    DEFF Research Database (Denmark)

    Henriksen, Marius; Lund, Hans; Moe-Nilssen, R

    2004-01-01

    The purpose of this study was to determine the test-retest reliability of a trunk accelerometric gait analysis in healthy subjects. Accelerations were measured during walking using a triaxial accelerometer mounted on the lumbar spine of the subjects. Six men and 14 women (mean age 35.2; range 18...... a definite potential in clinical gait analysis....

  6. Use of trunk stabilization and locomotor training in an adult with cerebellar ataxia: a single system design.

    Science.gov (United States)

    Freund, Jane E; Stetts, Deborah M

    2010-10-01

    The purpose of this study is to describe the effects of trunk stabilization training and locomotor training (LT) using body-weight support on a treadmill (BWST) and overground walking on balance, gait, self-reported function, and trunk muscle performance in an adult with severe ataxia secondary to brain injury. There are no studies on the effectiveness of these combined interventions in persons with ataxia. The subject was a 23-year-old male who had a traumatic brain injury 13 months prior. An A-B-A withdrawal single-system design was used. Outcome measures were Berg Balance Test (BBT), timed unsupported stance, Functional Ambulation Category (FAC), 10-meter walk test (10-MWT), Outpatient Physical Therapy Improvement in Movement Assessment Log (OPTIMAL), transverse abdominis (TrA) thickness, and isometric trunk endurance tests. Performance on the BBT, timed unsupported stance, FAC, 10-MWT, and OPTIMAL each improved after 10 weeks of intervention. In additions, TrA symmetry at rest improved as did right side-bridge endurance time. LT, using BWST and overground walking, and trunk stabilization training may be effective in improving balance, gait, function, and trunk performance in individuals with severe ataxia. Further research with additional subjects is indicated.

  7. RESEARCH REGARDING SOME PHYSICAL QUALITY VALUES OF JAPANESE QUAIL EGGS OBTAINED AT THE MIDDLE OF THE LAYING STAGE

    Directory of Open Access Journals (Sweden)

    ANCA TEUŞAN

    2009-10-01

    Full Text Available The Japanese quail is one of the smallest bird subspecies which has been tamed by man, being industrially raised in our days in many states over the world. This avian subspecies produces over 300 eggs, and though there are about 6 races and different varieties, there are very little data in the scientific literature regarding the quality values for eggs of Japanese quail hatching eggs collected from hens at the end of the laying – physical values (pH value of the eggs components, albumen index, yolk index The present paper wants to bring a series of data regarding some of these indicators. The pH values was determined with an portable pH-oximeter, and to establish the other two quality indexes we used a device fitted with callipers taking into account: height of the dense egg white (albumen, minimum and maximum diameter of the dense and fluid egg white, height and the diameter of the yolk. The albumen pH recorded values of 8.90, and the yolk pH values of 6.07. The statistical mean for the 130 values of albumen index taken in study was 0.048. The mean value of yolk index was 0.399. The obtained results are normal for the period of quail’s life.

  8. Effects of altered sagittal trunk orientation on kinetic pattern in able-bodied walking on uneven ground

    Directory of Open Access Journals (Sweden)

    Soran Aminiaghdam

    2017-07-01

    Full Text Available Studies of disturbed human locomotion often focus on the dynamics of the gait when either posture, movement or surface is perturbed. Yet, the interaction effects of variation of trunk posture and ground level on kinetic behaviour of able-bodied gait have not been explored. For 12 participants we investigated the kinetic behaviour, as well as velocity and contact time, across four steps including an unperturbed step on level ground, pre-perturbation, perturbation (10-cm drop and post-perturbation steps while walking with normal speed with four postures: regular erect, with 30°, 50° and maximal sagittal trunk flexion (70°. Two-way repeated measures ANOVAs detected significant interactions of posture×step for the second peak of the vertical ground reaction force (GRF, propulsive impulse, contact time and velocity. An increased trunk flexion was associated with a systematic decrease of the second GRF peak during all steps and with a decreased contact time and an increased velocity across steps, except for the perturbation step. Pre-adaptations were more pronounced in the approach step to the drop in regular erect gait. With increased trunk flexion, walking on uneven ground exhibited reduced changes in GRF kinetic parameters relative to upright walking. It seems that in trunk-flexed gaits the trunk is used in a compensatory way during the step-down to accommodate changes in ground level by adjusting its angle leading to lower variations in centre of mass height. Exploitation of this mechanism resembles the ability of small birds in adjusting their zig-zag-like configured legs to cope with changes in ground level.

  9. Adjustment of equations to predict the metabolizable energy of corn for meat type quails

    Directory of Open Access Journals (Sweden)

    Tiago Junior Pasquetti

    2015-08-01

    Full Text Available The metabolizable energy (ME determination for foods used in quail diets, through metabolism assays, takes time, infrastructure and financial resources, which makes the development of prediction equations based on proximal composition of foods to estimate the ME values of particular interest. The objective of this study was to adjust the prediction equations of metabolizable energy (ME of corn for quail. The chemical compositions of 12 maize varieties were determined and a metabolism assay was carried out in order to determine the apparent metabolizable energy (AME and nitrogen-corrected apparent metabolizable energy (AMEn of these corn varieties. The values of chemical composition, AME and AMEn, converted to dry matter, were used to adjust the prediction equations. The initial adjustment of simple and multiple linear regression of the AME and AMEn was performed using the values of crude protein (CP, ether extract (EE, neutral (NDF and acid (ADF detergent fiber, mineral matter (MM, calcium (Ca and phosphorus (P as regressors (full model. To adjust the prediction equations the statistical procedure of simple and multiple linear regression was used, with the technique of indirect elimination (Backward. There was adjustment of 10 prediction equations, in which five were for AME and another five for AMEn, the R² values of which ranged from 0.20 to 0.75 and from 0.21 to 0.78, respectively. For all adjusted equations, negative correlations for MM were observed, which may be related to its dilutive effect of the gross energy contained in corn. In conclusion, the equations that showed better adjustment were AME= 5605.46 - 385.074CP + 111.648EE + 48.1133NDF + 303.924ADF - 929.931MM (R²= 0.75 and AMEn= 5878.16 - 403.937CP + 81.9618EE + 41.8954NDF + 303.506FDA - 901.621MM (R²= 0.78.

  10. Soja integral processada em dietas para codornas japonesas em postura Processed whole soybean in diets for laying Japanese quails

    Directory of Open Access Journals (Sweden)

    Sergio Luiz de Toledo Barreto

    2010-09-01

    Full Text Available Objetivou-se avaliar o desempenho de codornas japonesas na fase de postura alimentadas com dietas contendo soja integral processada. Utilizaram-se 320 codornas japonesas fêmeas com 29 semanas de idade e peso inicial de 186,1 ± 4,0 g, distribuídas em delineamento inteiramente casualizado, com oito repetições, cada uma com dez aves por unidade experimental. As dietas foram isocalóricas e isonutritivas para proteína bruta, lisina digestível, metionina + cistina digestível, cálcio, fósforo disponível e sódio. Assim, foram avaliadas uma dieta controle, à base de milho e farelo de soja, e outras três, com substituição parcial do farelo de soja por soja integral tostada, extrusada ou micronizada, de modo que a soja integral forneceu 50% da proteína bruta proporcionada pelo farelo de soja na dieta controle. Não foram observadas diferenças na produção e na massa de ovos, na conversão alimentar, na viabilidade das aves, na porcentagem de ovos comercializáveis, no peso específico dos ovos, na porcentagem de gema e de albúmen nem na porcentagem de casca dos ovos. A substituição de farelo de soja por soja integral tostada ocasionou redução no consumo de ração. Não foram observadas diferenças nos parâmetros estudados quando o farelo de soja foi substituído por soja integral extrusada. A substituição de farelo de soja por soja integral micronizada reduziu a variação de peso corporal das codornas, resultando em perda de peso das aves. O farelo de soja pode ser substituído, em 50% da proteína, por soja integral tostada ou extrusada em dietas para codornas japonesas em postura. Entretanto, a substituição do farelo de soja por soja integral micronizada, em 50% da proteína, é desaconselhável, pois piora o desempenho, ocasionando principalmente perda de peso das aves.This work aimed at evaluating the performance of Japanese quails fed diets with processed whole soybean during the laying phase. It was used 320 Japanese

  11. Trunk Reservation in Multi-service Networks with BPP Traffic

    DEFF Research Database (Denmark)

    Zheng, H.; Zhang, Qi; Iversen, Villy Bæk

    2006-01-01

    In this paper we develop approximate models for trunk reservation in multi-service systems with BPP (Binomial-Poisson-Pascal) multi-rate traffic streams. The approximation is a generalization of previous work by Tran-Gia & Hubner who assumed Poisson arrival processes. It is based on a generalized...

  12. Noise in NC-AFM measurements with significant tip–sample interaction

    Directory of Open Access Journals (Sweden)

    Jannis Lübbe

    2016-12-01

    Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.

  13. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

  14. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

  15. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

  16. ORF Sequence: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

  17. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

  18. Changes in Trunk and Head Stability in Children with Cerebral Palsy after Hippotherapy: A Pilot Study

    Science.gov (United States)

    Shurtleff, Tim L.; Engsberg, Jack R.

    2010-01-01

    Hippotherapy (HPOT) is a therapy that uses horse movement. This pilot investigation objectively evaluated the efficacy of HPOT in improving head/trunk stability in children with cerebral palsy (CP). The participants were six children with spastic diplegia and six children without disability. Head and trunk stability was challenged by using a…

  19. Activation of vitellogenin II gene expression by steroid hormones in the old Japanese quail.

    Science.gov (United States)

    Gupta, S; Upadhyay, R; Kanungo, M S

    1998-11-01

    Alterations in the basal transcription rates of eukaryotic genes are believed to involve the binding of trans-acting factor(s) with specific DNA sequences in the promoter. We show here two interrelated events for the VTGII gene of the old, non-egg laying Japanese quail: alterations in the structure of the chromatin encompassing the gene, and binding of trans-acting factors to the promoter of the gene. Estradiol/progesterone alone or together cause alterations in the conformation of the chromatin of the promoter region of the gene. This may allow free access of nuclear protein(s) to the cis-acting elements, ERE, PRE and NF1, in the promoter of the gene and cause activation of transcription.

  20. Analysis of right anterolateral impacts: the effect of trunk flexion on the cervical muscle whiplash response

    Directory of Open Access Journals (Sweden)

    Narayan Yogesh

    2006-05-01

    Full Text Available Abstract Background The cervical muscles are considered a potential site of whiplash injury, and there is a need to understand the cervical muscle response under non-conventional whiplash impact scenarios, including variable body position and impact direction. There is no data, however, on the effect of occupant position on the muscle response to frontal impacts. Therefore, the objective of the study was to measure cervical muscle response to graded right anterolateral impacts. Methods Twenty volunteers were subjected to right anterolateral impacts of 4.3, 7.8, 10.6, and 12.8 m/s2 acceleration with their trunk flexed forward 45 degrees and laterally flexed right or left by 45 degrees. Bilateral EMG of the sternocleidomastoids, trapezii, and splenii capitis and acceleration of the sled, torso, and head were measured. Results and discussion With either direction of trunk flexion at impact, the trapezius EMGs increased with increasing acceleration (p Conclusion When the subject sits with trunk flexed out of neutral posture at the time of anterolateral impact, the cervical muscle response is dramatically reduced compared to frontal impacts with the trunk in neutral posture. In the absence of bodily impact, the flexed trunk posture appears to produce a biomechanical response that would decrease the likelihood of cervical muscle injury in low velocity impacts.