WorldWideScience

Sample records for quail trunk nc

  1. Skeletogenic fate of zebrafish cranial and trunk neural crest.

    Directory of Open Access Journals (Sweden)

    Erika Kague

    Full Text Available The neural crest (NC is a major contributor to the vertebrate craniofacial skeleton, detailed in model organisms through embryological and genetic approaches, most notably in chick and mouse. Despite many similarities between these rather distant species, there are also distinct differences in the contribution of the NC, particularly to the calvariae of the skull. Lack of information about other vertebrate groups precludes an understanding of the evolutionary significance of these differences. Study of zebrafish craniofacial development has contributed substantially to understanding of cartilage and bone formation in teleosts, but there is currently little information on NC contribution to the zebrafish skeleton. Here, we employ a two-transgene system based on Cre recombinase to genetically label NC in the zebrafish. We demonstrate NC contribution to cells in the cranial ganglia and peripheral nervous system known to be NC-derived, as well as to a subset of myocardial cells. The indelible labeling also enables us to determine NC contribution to late-forming bones, including the calvariae. We confirm suspected NC origin of cartilage and bones of the viscerocranium, including cartilages such as the hyosymplectic and its replacement bones (hymandibula and symplectic and membranous bones such as the opercle. The cleithrum develops at the border of NC and mesoderm, and as an ancestral component of the pectoral girdle was predicted to be a hybrid bone composed of both NC and mesoderm tissues. However, we find no evidence of a NC contribution to the cleithrum. Similarly, in the vault of the skull, the parietal bones and the caudal portion of the frontal bones show no evidence of NC contribution. We also determine a NC origin for caudal fin lepidotrichia; the presumption is that these are derived from trunk NC, demonstrating that these cells have the ability to form bone during normal vertebrate development.

  2. Quail and other short-lived birds.

    Science.gov (United States)

    Ottinger, M A

    2001-04-01

    Japanese quail are small galliforms that are migratory and generally live 2 to 3years in the wild. Although there is evidence for other environmental cues, they primarily respond to long daylength for regulation of reproduction. In contrast to the Common Tern, a long-lived sea bird that shows little evidence of reproductive aging, Japanese quail follow a well-defined process of aging with evidence of declining function in reproductive, metabolic, and sensory systems. Our studies focus on neuroendocrine changes associated with reproductive aging in the Japanese quail, with emphasis on the male in order to study both endocrine and behavioral components of reproduction and the process of reproductive aging.

  3. Trunk Stability, Trunk Strength and Sport Performance Level in Judo.

    Directory of Open Access Journals (Sweden)

    David Barbado

    Full Text Available Although trunk muscle function has been suggested to be a determinant of judo performance, its contribution to high-level performance in this sport has been poorly studied. Therefore, several tests were used to assess the differences in trunk muscle function between 11 international and 14 national level judo practitioners (judokas. Trunk strength and endurance were assessed using isokinetic tests and core stability was assessed using two protocols: 1 sudden loading, to assess trunk responses to unexpected external perturbations; 2 stable and unstable sitting, to assess the participants' ability to control trunk balance. No differences between groups were found for trunk flexor isokinetic strength, trunk responses against lateral and posterior loading and trunk control while sitting. However, international level judokas showed significantly higher trunk extensor isokinetic strength (p <0.05 and lower trunk angular displacement after anterior trunk loading (p <0.05 than national level judokas. Few and low (r < 0.512 significant correlations were found between strength, endurance and stability parameters, which suggests that trunk strength and endurance are not limiting factors for trunk stability in competitive judokas. These results support the importance of trunk extensor strength and trunk stability against forward perturbations in elite judo performance.

  4. Genetic variation and bottleneck in Japanese quail (Coturnix ...

    African Journals Online (AJOL)

    User

    2011-05-16

    May 16, 2011 ... The genetic structure of four strains of Japanese quail (Pharach, Panda, Tuxedo and Golden) was ... valuable laboratory species because of its small body ..... quail and cross-species amplification in chicken and guinea fowl.

  5. Comparison of trunk kinematics in trunk training exercises and throwing.

    Science.gov (United States)

    Stodden, David F; Campbell, Brian M; Moyer, Todd M

    2008-01-01

    Strength and conditioning professionals, as well as coaches, have emphasized the importance of training the trunk and the benefits it may have on sport performance and reducing the potential for injury. However, no data on the efficacy of trunk training support such claims. The purpose of this study was to examine the maximum differential trunk rotation and maximum angular velocities of the pelvis and upper torso of participants while they performed 4 trunk exercises (seated band rotations, cross-overs, medicine ball throws, and twisters) and compare these trunk exercise kinematics with the trunk kinematics demonstrated in actual throwing performance. Nine NCAA Division I baseball players participated in this study. Each participant's trunk kinematics was analyzed while he performed 5 repetitions of each exercise in both dominant and nondominant rotational directions. Results indicated maximum differentiated rotation in all 4 trunk exercises was similar to maximum differentiated rotation (approximately 50-60 degrees) demonstrated in throwing performance. Maximum angular velocities of the pelvis and upper torso in the trunk exercises were appreciably slower (approximately 50% or less) than the angular velocities demonstrated during throwing performance. Incorporating trunk training exercises that demonstrate sufficient trunk ranges of motion and velocities into a strength and conditioning program may help to increase ball velocity and/or decrease the risk injury.

  6. Japanese quail performance under different stocking densities

    International Nuclear Information System (INIS)

    Fahmy, M.O.; EL-Faramawy, A.A.

    2004-01-01

    This experiment was conducted with Japanese quails at the poultry production farm (Poultry Research Unite, Nuclear Research Center, AEA, Inshas, Egypt) to determine the effects of stocking density on the growth, carcass composition, feed conversion, feed efficiency, corticosterone level, immune response and profit potential. A total of 924 Japanese quail chicks were brooded at 2 weeks of age in batteries at 44, 88 and 176 birds / m2 each of 3 replicates. Chicks brooded at 44 and 88 bird / m2 were grew significantly (P<0.05) during the experimental period more than those brooded at 176 bird/m2. Increasing birds density was associated with significant (P<0.05) increase in serum corticosterone level, carcass protein percent, live body weight per m2 and monetary returns. Carcass fat percent and immune response were reduced sharply with increasing quail stocking density. On the other hand, feed conversion was reduced, while feed efficiency was improved (P<0.05) by increasing quail stocking density

  7. [Composition of chicken and quail eggs].

    Science.gov (United States)

    Closa, S J; Marchesich, C; Cabrera, M; Morales, J C

    1999-06-01

    Qualified food composition data on lipids composition are needed to evaluate intakes as a risk factor in the development of heart disease. Proximal composition, cholesterol and fatty acid content of chicken and quail eggs, usually consumed or traded, were analysed. Proximal composition were determined using AOAC (1984) specific techniques; lipids were extracted by a Folch's modified technique and cholesterol and fatty acids were determined by gas chromatography. Results corroborate the stability of eggs composition. Cholesterol content of quail eggs is similar to chicken eggs, but it is almost the half content of data registered in Handbook 8. Differences may be attributed to the analytical methodology used to obtain them. This study provides data obtained with up-date analytical techniques and accessory information useful for food composition tables.

  8. Detection of Genetic Relationship in the Tree of Life of Some Quail Through Molecular Markers Analyses

    Directory of Open Access Journals (Sweden)

    Lamiaa Elsayed Mokhtar Deef

    2017-08-01

    Full Text Available ABSTRACT Quail is an important and interesting group of galliform birds. The Common quail (Coturnix coturnix; the Japanese quail (Coturnix japonica; the Panda quail (Coturnix japonica; the Dotted white quail (Coturnix japonica and the Bobwhite quail (Colinus virginianus were used in this study. PCR-RFLP and SDS-proteins were performed to reveal the genetic characterization and genetic relationship of the studied quails. Analysis of fragments generated by digestion of PCR product with restriction enzyme NlaIII recorded highly polymorphic restriction profiles. There is a wide intraspecific COI, SEMA3E and TLX genes variability among the studied quails. Protein bands varied from10 to 18 between quails with minimum number of bands were in the Dotted white quail (10 bands and the maximum were in the Japanese quail (18 bands as measured by SDS-polyacrylamide gel electrophoresis. The Dotted white quail revealed the lowest similarity to the Bobwhite with a coefficient of 0.18 while The similarity coefficients between the Common quail and each one of the other quails were 0.67, 0.62, 0.45 and 0.42 for the Japanese, Panda, Dotted white and the Bobwhite quails, respectively. The results indicate that, PCR-RFLP and protein analyses are good techniques to evaluate genetic characterization and genetic relationship of these quails.

  9. Nutritional potassium requirement for laying Japanese quails

    Directory of Open Access Journals (Sweden)

    Fernando Guilherme Perazzo Costa

    2011-12-01

    Full Text Available The objective of this study was to evaluate the potassium requirement for laying Japanese quails. Two hundred and forty quails were distributed in a randomized block design, with five treatments and six replicates, with eight birds each. The treatments consisted of a basal diet deficient in potassium (K (2.50 g/kg, supplemented with potassium carbonate, to replace the inert, to reach levels of 2.50, 3.50, 4.50, 5.50 and 6.50 (g/kg of K in the diet. There was a quadratic effect of K levels on feed intake, egg production, egg mass and feed conversion per egg mass and per egg dozen, estimating the requirements of 4.26, 4.41, 4.38, 4.43 and 4.48 (g/kg of K diet, respectively. There was no significant effect on the levels of K in the diet on egg weight, albumen weight, percentage of yolk or shell and yolk color. However, yolk and shell weights reduced and the albumen percentage increased linearly with increasing levels of K in the diet. Despite the reduction of shell weight, the increased levels of K did not influence the specific gravity and shell thickness. The use of 4.41 g/kg of potassium is recommended in the diet for laying Japanese quails.

  10. Immunotoxicity of trenbolone acetate in Japanese quail

    Science.gov (United States)

    Quinn, M.J.; McKernan, M.; Lavoie, E.T.; Ottinger, M.A.

    2007-01-01

    Trenbolone acetate is a synthetic androgen that is currently used as a growth promoter in many meat-exporting countries. Despite industry laboratories classifying trenbolone as nonteratogenic, data showed that embryonic exposure to this androgenic chemical altered development of the immune system in Japanese quail. Trenbolone is lipophilic, persistent, and released into the environment in manure used as soil fertilizer. This is the first study to date to assess this chemical's immunotoxic effects in an avian species. A one-time injection of trenbolone into yolks was administered to mimic maternal deposition, and subsequent effects on the development and function of the immune system were determined in chicks and adults. Development of the bursa of Fabricius, an organ responsible for development of the humoral arm of the immune system, was disrupted, as indicated by lower masse, and smaller and fewer follicles at day 1 of hatch. Morphological differences in the bursas persisted in adults, although no differences in either two measures of immune function were observed. Total numbers of circulating leukocytes were reduced and heterophil-lymphocyte ratios were elevated in chicks but not adults. This study shows that trenbolone acetate is teratogenic and immunotoxic in Japanese quail, and provides evidence that the quail immune system may be fairly resilient to embryonic endocrine-disrupting chemical-induced alterations following no further exposure posthatch.

  11. The development of ovary in quail's embryo | Rong | African Journal ...

    African Journals Online (AJOL)

    The experiment was conducted to study the development of ovary in quails' embryos which were incubated for 4 to 17 days and incubated out for 1 day. The quails' embryos or gonads were cut out and HE staining was carried out. The results showed that when embryo was hatched for 4 days, lots of primordial germ cells ...

  12. Performance and carcass characteristics of Japanese quail as ...

    African Journals Online (AJOL)

    The effect of sex and the supplementation of the prebiotic, mannan oligosaccharides (MOS), the acidifier, calcium propionate (CPr) or their combination in the feed of Japanese quail (Coturnix japonica) on their performance and carcass quality was examined in this experimentation. Three hundred, 1-day old Japanese quail ...

  13. Age determination in juvenile bobwhite quail

    Science.gov (United States)

    Petrides, G.A.; Nestler, R.B.

    1943-01-01

    Following methods described by Louis Bureau (1911, 1913) in France,tabulations were made (1) of the ages at which captivity-reared bob-white quail (Colinus virginianus) dropped their juvenal remiges, and (2) the rates at which post-juvenal replxcement primaries grew. These were arranged so as to permit the determination of age in healthv birds from one to five months of age. The degree of individual variation was much greater than that found by Bureau, however. and limits accuracy in age determination after the 10th week..... The post-juvenal wing molt began on the birds' 28th day and ended when the quail were 146 to 154 days old.The post-juvenal body molt was found to take place largely between the 70th and 100th days. The juvenal rectrices were renewed from the 62nd to the 122nd days, the new feathers being as long as their longest coverts when the birds were 116 days old. The color of the tarsi varied from pink, at 32 days of age, to straw color at 60 days, and yellow-gray from 83 to 180 days. At six months, the color of the beak was identical with that of adults.....Unlike several other game bird species, the flexibility of the lower jaw was not an accurate index to age in bob-whites older than 11 weeks. Rigor mortis and freezing were found to hinder the testing of this criterion.

  14. Pb Speciation Data to Estimate Lead Bioavailability to Quail

    Data.gov (United States)

    U.S. Environmental Protection Agency — Linear combination fitting data for lead speciation of soil samples evaluated through an in-vivo/in-vitro correlation for quail exposure. This dataset is associated...

  15. Effect of Led Lighting Colors for Laying Japanese Quails

    Directory of Open Access Journals (Sweden)

    KC Nunes

    Full Text Available ABSTRACT Time of exposure and light intensity rearing house may affect the performance and egg quality of laying quails. This research aimed at evaluating the live performance, egg quality, biometry of the reproductive system, and the gastrointestinal tract of Japanese quails (Coturnix coturnix japonica exposed to artificial light-emitting diodes (LED of different colors in comparison with fluorescent lamps. A total of 240 Japanese quails were distributed in completely randomized experimental design with four treatments (fluorescent lamp, and green, red, or blue LED lamps with six replicates of 10 birds each. Average egg weight and eggshell thickness were different (p0.05. The oviduct of 64-d-old hens exposed to green LED lighting was shorter (p<0.05 than those exposed to the fluorescent lamp. Red LED can be used to replace the fluorescent lamps, as they promote the same live performance, egg quality, and morphological development of the reproductive tract of laying Japanese quails.

  16. Profile Triglycerides Japanese Quail (Coturnix coturnix japonica After Giving Turmeric (Curcuma longa Powder

    Directory of Open Access Journals (Sweden)

    Sukarman Hadi jaya Putra

    2014-12-01

    Full Text Available The purpose of this study was to determine the triglyceride profile of Japanese quail (Coturnix coturnix japonica after being given the parameters of turmeric (Curcuma longa powder; feed intake, profiles of liver triglycerides, profiles of serum triglycerides and profiles of meat triglycerides. This study uses an experimental method with A Completely Randomized Design Pattern. Test animals used were 45 female Japanese quails were divided into 3 groups, namely; P0: quail were not given turmeric powder, P1: quail were given turmeric powder a dose of 54 mg/quail/day, P3: quail were given turmeric powder a dose of 108 mg/quail/day. Each group with 5 replications. Each repeat consists of 3 Japanese quails. Provision of treatment every day for 30 days starting from the age of 14 days. Data were analyzed using analysis of variance (ANOVA followed by Duncan's test with 95% confidence interval (α = 0.05 level. Analysis of the data used is software Minitab software 16. Results showed that the levels of turmeric powder are given in Japanese quail significant (P˂0.05 on liver triglyceride levels, serum and Japanese quail meat but had no significant effect (P˃0.05 on consumption feed. The results showed that the optimal dose of turmeric powder to lower triglyceride levels of Japanese quail is 108 mg/quail/day as evidenced by the highest decrease in liver triglyceride profiles, profiles of serum triglycerides and triglyceride profiles of Japanese quail meat compared with other treatments.

  17. Coronavirus–associated enteritis in a quail farm

    Directory of Open Access Journals (Sweden)

    Antonio Camarda

    2010-01-01

    Full Text Available An enteric syndrome observed in semi-intensively reared quails is described. The affected birds showed depression, severe diarrhoea and dehydration. The mortality occurred particularly in young birds. At necropsy, the prominent lesion was catarrhal enteritis. Laboratory investigations demonstrated the presence of coronavirus in the gut of dead animals. No additional pathogens were detected. To our knowledge, this is the first evidence for the presence of CoVs in quail with enteritis.

  18. Short barb: a feather structure mutation in Japanese quail.

    Science.gov (United States)

    Fulton, J E; Roberts, C W; Nichols, C R; Cheng, K M

    1982-12-01

    A type of feather structure abnormality in Japanese quail resulting in shortened barbs on contour feathers was found to be controlled by a single autosomal recessive gene, sh (short barb). The mutation was first identified in a full-sib family from the University of British Columbia wild type line. Unlike other feather structure mutations in Japanese quail reported previously in literature, the short barb mutation is not associated with poor reproduction.

  19. Trunk proprioception adaptations to creep deformation.

    Science.gov (United States)

    Abboud, Jacques; Rousseau, Benjamin; Descarreaux, Martin

    2018-01-01

    This study aimed at identifying the short-term effect of creep deformation on the trunk repositioning sense. Twenty healthy participants performed two different trunk-repositioning tasks (20° and 30° trunk extension) before and after a prolonged static full trunk flexion of 20 min in order to induce spinal tissue creep. Trunk repositioning error variables, trunk movement time and erector spinae muscle activity were computed and compared between the pre- and post-creep conditions. During the pre-creep condition, significant increases in trunk repositioning errors, as well as trunk movement time, were observed in 30° trunk extension in comparison to 20°. During the post-creep condition, trunk repositioning errors variables were significantly increased only when performing a 20° trunk extension. Erector spinae muscle activity increased in the post-creep condition, while it remained unchanged between trunk repositioning tasks. Trunk repositioning sense seems to be altered in the presence of creep deformation, especially in a small range of motion. Reduction of proprioception acuity may increase the risk of spinal instability, which is closely related to the risk of low back pain or injury.

  20. Genetic parameters of growth, body, and egg traits in Japanese quails

    African Journals Online (AJOL)

    SARAH

    2014-07-31

    Jul 31, 2014 ... egg traits as well as genetic and phenotypic relationships between these traits in Japanese quails reared in the ... Japanese quail is the smallest avian species farmed .... 2 = cross classified “family” variance component.

  1. Experiment K-313: Rat and quail ontogenesis

    Science.gov (United States)

    Keefe, J. R.

    1981-01-01

    The potential effects of spaceflight on the processes of mammalian fertilizaton, implantation and embryonic development are investigated. Five female and two male rats were placed together on Day 2 of the flight. By R+17, it was determined that both flight and synchronous females were not carrying normal pregnancies and three of the flight animals were laparotomized. The uterus and ovaries were processed for microscopic analyses. The two remaining flight females were allowed to recover from the exploratory operation, rebred with flight males and delivered normal litters. As a control for potential transplacental effects that might be interpreted as direct spaceflight effects, a series of fertilized Japanese quail (Coturnix japonica) eggs was flown on Cosmos 1129. Although all of the eggs were adversely impacted by an inflight failure of the incubator humidifier on flight Day 13, several embryos were able to progress to a developmental stage equivalent to that of a control 10-12 Day embryo.

  2. Factors influencing methionine toxicity in young bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1981-01-01

    Young Bobwhite quail (Colinus virginianus) were fed low and adequate protein purified diets with and without excess methionine to evaluate factors affecting methionine toxicity. Growth of quail fed an adequate protein (27%) diet, without supplemental glycine, was depressed by 1.75% and 2.25% excess methionine. Supplemental glycine (.3%) alleviated growth depression caused by 2.25% excess methionine. Quail fed 1.75% and 2.25% excess methionine developed signs of toxicity characterized by weakness, a lowered, outstretched neck when moving, and ataxia. In addition, quail would fall on their sides when disturbed and spin with their heads retracted. These conditions were transient in nature. Growth of quail fed a low protein (18.9%) diet was depressed by 1% and 1.5% excess methionine and DL-homocystine. Quail fed 1% and 1.5% excess methionine in this diet also developed signs of toxicity, the incidence of which was greater and the duration longer than occurred with quail fed adequate protein. Supplementing a low protein (20.15%) diet with .3% or .6% glycine or threonine or a combination of these amino acids did not alleviate growth depression caused by 1.5% excess methionine; however, 2% and 3% supplemental glycine were somewhat effective. Supplements of glycine (2%, 3%) and threonine (1%) completely reversed growth depression from 1% excess methionine but did not influence growth of controls, indicating that both amino acids counteract methionine toxicity. Both glycine and threonine alone improved growth by about the same extent in diets with 1% or 1.5% excess methionine; however, these amino acids alleviated less than 30% of the growth depression resulting from 1.5% excess methionine. The effectiveness of glycine in alleviating methionine toxicity in a low protein diet was decreased, and hemoglobin levels were depressed with 1.5% excess methionine compared to less amounts.

  3. Pairing Behavior of the Monogamous King Quail, Coturnix chinensis.

    Directory of Open Access Journals (Sweden)

    Elizabeth Adkins-Regan

    Full Text Available Animals with socially monogamous mating systems are valuable for discovering proximate mechanisms of prosocial behavior and close social relationships. Especially powerful are comparisons between related species that differ in monogamous tendency. Birds are the most socially monogamous vertebrates. Thus far most research on mechanisms of pairing has used zebra finches, which do not have a relative with a different mating system, however. The goal of the experiments reported here was to develop a new comparative avian system by studying the pairing behavior of a reportedly strongly monogamous quail, the king quail (Coturnix chinensis, a species in the same clade as the less monogamous Japanese quail (Coturnix japonica, the subject of much prior research. In Experiment 1 male-female pairs of king quail housed together were initially avoidant or aggressive but most rapidly progressed to allopreening and huddling. A separation-reunion paradigm reliably elicited both of these behaviors in males that had cohabited for one week. In Experiment 2 the allopreening and huddling behavior of males in cohabiting pairs was highly selective, and a majority of the males were aggressive toward a familiar female that was not the cohabitation partner. In Experiment 3 males were separated from their female cohabitation partners for 9-10 weeks and then given two-choice tests. All but one male spent more time near an unfamiliar female, which may have reflected aggression and shows recognition of and memory for the past pairing experience. Thus king quail show robust, selective and easy to measure pairing behavior that can be reliably elicited with simple separation-reunion testing procedures. Copulation is rarely seen during tests. The behavior of king quail is a striking contrast to that of Japanese quail, providing a new comparative system for discovering mechanisms of behavior related to close social relationships and monogamy.

  4. Pairing Behavior of the Monogamous King Quail, Coturnix chinensis.

    Science.gov (United States)

    Adkins-Regan, Elizabeth

    2016-01-01

    Animals with socially monogamous mating systems are valuable for discovering proximate mechanisms of prosocial behavior and close social relationships. Especially powerful are comparisons between related species that differ in monogamous tendency. Birds are the most socially monogamous vertebrates. Thus far most research on mechanisms of pairing has used zebra finches, which do not have a relative with a different mating system, however. The goal of the experiments reported here was to develop a new comparative avian system by studying the pairing behavior of a reportedly strongly monogamous quail, the king quail (Coturnix chinensis), a species in the same clade as the less monogamous Japanese quail (Coturnix japonica), the subject of much prior research. In Experiment 1 male-female pairs of king quail housed together were initially avoidant or aggressive but most rapidly progressed to allopreening and huddling. A separation-reunion paradigm reliably elicited both of these behaviors in males that had cohabited for one week. In Experiment 2 the allopreening and huddling behavior of males in cohabiting pairs was highly selective, and a majority of the males were aggressive toward a familiar female that was not the cohabitation partner. In Experiment 3 males were separated from their female cohabitation partners for 9-10 weeks and then given two-choice tests. All but one male spent more time near an unfamiliar female, which may have reflected aggression and shows recognition of and memory for the past pairing experience. Thus king quail show robust, selective and easy to measure pairing behavior that can be reliably elicited with simple separation-reunion testing procedures. Copulation is rarely seen during tests. The behavior of king quail is a striking contrast to that of Japanese quail, providing a new comparative system for discovering mechanisms of behavior related to close social relationships and monogamy.

  5. Effect of various probiotics on growth performance of Japanese quails

    Directory of Open Access Journals (Sweden)

    P. R. Sirsat

    Full Text Available An experiment was conducted to study the effect of various probiotics on the performance of Japanese Quails. One hundred Japanese quail chicks were weighed individually and they were uniformly distributed equally to four dietary treatments consisting 25 birds in each. The starter and finisher diets were containing ME 2800 and 2600 Kcal/kg and protein 25 and 23 % respectively. The group T0(Controll fed standard quail diet and T1,T2 and T3 were fed probiotic Saccharomyces cerevisiae, Lactobacillus sporogenes and Saccharomyces boulardii @ 0.05 % in diet. The study was conducted for six weeks in the same managemental condition. Weekly live body weight and feed consumption were recorded. The group supplemented with Saccharomyces cerevisiae resulted in significantly higher growth rate and showed higher weight gain. The average feed efficiency and nitrogen retention were significantly higher in group supplemented with Saccharomyces cerevisiae. The cost of production /100gm of meat was found to be Rs.7.10, 6.84, 7.55 and 8.37 respectively in T0 to T3 groups. Thus, the study indicated that supplementation of Saccharomyces cerevisiae in the diet of Japanese quails was effective in improving performance of the quails. [Vet World 2009; 2(8.000: 321-322

  6. Microwave sensing of tree trunks

    Science.gov (United States)

    Jezova, Jana; Mertens, Laurence; Lambot, Sebastien

    2015-04-01

    The main subject of this research is the observation of the inner part of living tree trunks using ground-penetrating radar (GPR). Trees are everyday part of human life and therefore it is important to pay attention to the tree conditions. The most obvious consequence of the poor tree condition is dead or injury caused by falling tree. The trunk internal structure is divided into three main parts: heartwood, sapwood and bark, which make this medium highly anisotropic and heterogeneous. Furthermore, the properties of the wood are not only specie-dependent but also depend on genetic and on environmental conditions. In urban areas the main problem for the stability of the trees relies in the apparition of decays provoked by fungi, insect or birds. This results in cavities or decreasing of the support capacity of the tree. GPR has proved itself to be a very powerful electromagnetic tool for non-destructive detection of buried objects. Since the beginning of the 20th century it has been used in several different areas (archaeology, landmine detection, civil engineering, ...). GPR uses the principle of the scattering of the electromagnetic waves that are radiated from a transmitting antenna. Then the waves propagate through the medium and are reflected from the object and then they are received by a receiving antenna. The velocity of the scattered signal is determined primarily by the permittivity of the material. The optimal functionality of the GPR was investigated using the numerical simulation tool gprMax2D. This tool is based on a Finite-Difference Time-Domain (FDTD) numerical model. Subsequently, the GPR functionality was tested using the laboratory model of a decayed tree trunk. Afterwards, the results and lessons learnt in the simplified tests will be used in the processing of the real data and will help to achieve deeper understanding of them. The laboratory model of the tree trunk was made by plastic or carton pipes and filled by sand. Space inside the model

  7. Leader Cells Define Directionality of Trunk, but Not Cranial, Neural Crest Cell Migration

    Directory of Open Access Journals (Sweden)

    Jo Richardson

    2016-05-01

    Full Text Available Collective cell migration is fundamental for life and a hallmark of cancer. Neural crest (NC cells migrate collectively, but the mechanisms governing this process remain controversial. Previous analyses in Xenopus indicate that cranial NC (CNC cells are a homogeneous population relying on cell-cell interactions for directional migration, while chick embryo analyses suggest a heterogeneous population with leader cells instructing directionality. Our data in chick and zebrafish embryos show that CNC cells do not require leader cells for migration and all cells present similar migratory capacities. In contrast, laser ablation of trunk NC (TNC cells shows that leader cells direct movement and cell-cell contacts are required for migration. Moreover, leader and follower identities are acquired before the initiation of migration and remain fixed thereafter. Thus, two distinct mechanisms establish the directionality of CNC cells and TNC cells. This implies the existence of multiple molecular mechanisms for collective cell migration.

  8. Comparative reproductive and physiological responses of northern bobwhite and scaled quail to water deprivation

    Science.gov (United States)

    Giuliano, W.M.; Patino, R.; Lutz, R.S.

    1998-01-01

    We compared reproductive and physiological responses of captive female northern bobwhite (Colinus virginianus) and scaled quail (Callipepla squamata) under control and water deprivation conditions. Scaled quail required less food and water to reproduce successfully under control conditions than northern bobwhite. Additionally, in scaled quail, serum osmolality levels and kidney mass were unaffected by water deprivation, whereas in northern bobwhite, serum osmolality levels increased and kidney mass declined. This finding indicates that scaled quail may have osmoregulatory abilities superior to those of northern bobwhite. Under control conditions, northern bobwhite gained more body mass and produced more but smaller eggs than scaled quail. Under water deprivation conditions, northern bobwhite lost more body mass but had more laying hens with a higher rate of egg production than scaled quail. Our data suggest that northern bobwhite allocated more resources to reproduction than to body maintenance, while scaled quail apparently forego reproduction in favor of body maintenance during water deprivation conditions.

  9. COELIAC TRUNK BRANCHING PATTERN AND VARIATION

    Directory of Open Access Journals (Sweden)

    Jude Jose Thomson

    2017-01-01

    Full Text Available BACKGROUND Anatomical variations involving the visceral arteries are common. However, variations in coeliac trunk are usually asymptomatic, they may become important in patients undergoing diagnostic angiography for gastrointestinal bleeding or prior to an operative procedure. This study was useful for knowing the possible morphological variations before an upper abdominal surgery. MATERIALS AND METHODS This was a descriptive study done by cadaveric dissection, conducted on thirty cadavers. The coeliac trunk being examined for its origin, branching pattern, distribution, and variations. Results were statistically analysed and compared with the previous studies. RESULTS In our study, 60% of the coeliac trunk shows variations and 40% have normal branching pattern. A complete absence of coeliac trunk was observed in one case. In the present study the Right inferior phrenic artery arising from coeliac trunk in 2 cases (6.6% and left inferior phrenic artery arising from coeliac trunk in 3 cases (9.9%. Both inferior phrenic arteries are arising from coeliac trunk in 2 cases (6.6%. The common hepatomesenteric trunk and gastro splenic trunk was found in 1 case (3.3%. Hepatosplenic trunk was found in 2 cases (6.6%. In another 2 cases (6.6% gastric and hepatic artery originate from coeliac trunk but splenic artery has a separate origin from abdominal aorta. An absent trunk was also found in 1 case (3.3%. In 5 cases (16.7% showed trifurcation with variation in the branching pattern. CONCLUSION The branching pattern and extreme degree variability in coeliac trunk as brought out in the observations of the present study make it obvious that the present study almost falls in description with previous studies.

  10. QUAIL: A Quantitative Security Analyzer for Imperative Code

    DEFF Research Database (Denmark)

    Biondi, Fabrizio; Wasowski, Andrzej; Traonouez, Louis-Marie

    2013-01-01

    Quantitative security analysis evaluates and compares how effectively a system protects its secret data. We introduce QUAIL, the first tool able to perform an arbitrary-precision quantitative analysis of the security of a system depending on private information. QUAIL builds a Markov Chain model...... of the system’s behavior as observed by an attacker, and computes the correlation between the system’s observable output and the behavior depending on the private information, obtaining the expected amount of bits of the secret that the attacker will infer by observing the system. QUAIL is able to evaluate...... the safety of randomized protocols depending on secret data, allowing to verify a security protocol’s effectiveness. We experiment with a few examples and show that QUAIL’s security analysis is more accurate and revealing than results of other tools...

  11. Eyeworm infections of Oxyspirura petrowi, Skrjabin, 1929 (Spirurida: Thelaziidae), in species of quail from Texas, New Mexico and Arizona, USA.

    Science.gov (United States)

    Dunham, N R; Kendall, R J

    2017-07-01

    Northern bobwhite (Colinus virginianus) and Scaled quail (Callipepla squamata) have been declining steadily throughout much of their historical range over the past few decades. Even the Rolling Plains of Texas, historically rich with wild quail and one of the last remaining quail strongholds, has been suffering a population decline, most notably since 2010. Gambel's quail (Callipepla gambelii) have also been experiencing their own decline throughout their respective range, but not as significant as that of other species of quail. Eyeworms (Oxyspirura petrowi) in quail have been recognized for years but not thoroughly studied until recently. New research reveals that O. petrowi infection can cause inflammation, oedema, and cellular damage to the eye of the quail host. The objective of this research was to better understand the prevalence of the eyeworm infection in different quail species, expand on known distribution, and determine if there is a relationship between location and species infected with eyeworms. Northern bobwhite, Scaled quail and Gambel's quail were hunter-donated from one county within Texas, New Mexico and Arizona, and examined for the prevalence, mean abundance and mean intensity of eyeworm infection from November 2013 to February 2014. Quail from every location were found to have individuals with a varying degree of eyeworm infection. This is the first study to document eyeworm infection in Gambel's quail and in quail in New Mexico and Arizona, and reports the highest eyeworm infection found in Northern bobwhite and Scaled quail.

  12. Spontaneous, Experimentally Induced, and Transmissible AA Amyloidosis in Japanese Quail ( Coturnix japonica).

    Science.gov (United States)

    Nakayama, Yumi; Kamiie, Junichi; Watanabe, Gen; Suzuki, Kazuhiko; Murakami, Tomoaki

    2017-11-01

    The authors describe a spontaneous case of amyloid A (AA) amyloidosis in an adult female Japanese quail ( Coturnix japonica). The bird developed AA amyloidosis secondary to chronic peritonitis caused by a Gram-negative bacillus infection. Mild amyloid deposition was also identified in the intestinal tract of apparently healthy adult individuals, suggesting that quail may develop intestinal amyloidosis with age. Based on these observations, it was hypothesized that quail can develop AA amyloidosis following inflammatory stimulation with lipopolysaccharide (LPS). Therefore, adult quail were repeatedly injected with LPS and the development of AA amyloidosis was confirmed. The amyloid deposition in this model increased when quail amyloid was intravenously injected as an amyloid-enhancing factor. The experiments were repeated with young quail, but amyloid deposits were not observed following LPS injections. However, AA amyloidosis did develop when quail amyloid was injected in addition to LPS. These results indicated that adult quail develop AA amyloidosis after inflammatory stimulation with LPS. Furthermore, quail AA amyloidosis was shown to have transmissibility regardless of age. Interestingly, the authors found that administration of chicken amyloid fibrils also induced AA amyloidosis in young quail. This is the first report of cross-species transmission of avian AA amyloidosis.

  13. Histomorphometric study of brachiocephalic artery of Japanese quail.

    Science.gov (United States)

    Shariati, Sarah; Rahmanifar, Farhad; Tamadon, Amin

    2015-01-01

    Brachiocephalic arteries in quails are large arteries which are arising separately from the aortic arch. The aim of the present study was to determine the histomorphometric aspects of brachiocephalic arteries in the Japanese quail. The different layers of the brachiocephalic artery were studied quantitatively in 10, 20 and 60 days-old Japanese quail; (n = 6) and both sexes. Luminal diameter, thickness of the intima, media and adventitia, the percentage of the intima, media and adventitia, as compared with the total wall thickness were determined. It was found that luminal diameter and whole artery thickness increased by age (p < 0.05). In addition, the tunica media was the thickest layer, then tunica intima and at last tunica adventitia (p < 0.05). The muscularity of the right brachiocephalic artery was more than that of the left one (p < 0.05). Histomorphometric study of brachiocephalic arteries of Japanese quails showed that increasing of age causes increase of internal and external diameters of the artery and this increase in females was more than males.

  14. Behaviour of Japanese Quail Eggs Under Mechanical Compression

    Czech Academy of Sciences Publication Activity Database

    Buchar, J.; Nedomová, Š.; Trnka, Jan; Strnková, J.

    2015-01-01

    Roč. 18, č. 5 (2015), s. 1110-1118 ISSN 1094-2912 Institutional support: RVO:61388998 Keywords : quail egg * compression * rupture force Subject RIV: GM - Food Processing Impact factor: 1.586, year: 2015 http://www.tandfonline.com/doi/abs/10.1080/10942912.2013.862634#.VNI0aC7z_PM

  15. Molecular study for the sex identification in Japanese quails ...

    African Journals Online (AJOL)

    use

    2011-12-14

    Dec 14, 2011 ... The aim of this study was to determine the sex of. Japanese quail (Coturnix japonica) by DNA analysis. Chromo ... M, 100 bp DNA ladder (Fermentas, Germany); lane 1, negative control. (without DNA) .... low cost and reduced risk of contamination, and preven- .... Improving the reliability of molecular sexing.

  16. Growth and carcass characteristics of Japanese quails ( Coturnix ...

    African Journals Online (AJOL)

    The values of other primal cuts were statistically similar (P>0.05). Therefore, it is concluded that substituting synthetic vitamin mineral premixes with natural vitamin mineral premixes in diets is possible with no adverse effects on performance and carcass characteristics of growing Japanese quail. Key words: Proprietary ...

  17. Genetic parameters for quail body weights using a random ...

    African Journals Online (AJOL)

    A model including fixed and random linear regressions is described for analyzing body weights at different ages. In this study, (co)variance components, heritabilities for quail weekly weights and genetic correlations among these weights were estimated using a random regression model by DFREML under DXMRR option.

  18. Fertility and hatchability of Japanese quail eggs under semi arid ...

    African Journals Online (AJOL)

    Some factors affecting the fertility and hatchability of Japanese quail eggs were studied at the Poultry Unit of the University of Maiduguri Livestock Teaching and Research Farm. A total of 1850 eggs were used for the study and data collected were subjected to Analysis of Variance. The mean values of fertility, hatchability of ...

  19. Genetic variation and bottleneck in Japanese quail ( Coturnix ...

    African Journals Online (AJOL)

    The genetic structure of four strains of Japanese quail (Pharach, Panda, Tuxedo and Golden) was investigated by 12 microsatellite markers in Iran. Whole blood samples were collected from 200 individuals belonging to four strains and genomic DNA was extracted by salting out procedure. The 12 microsatellite markers ...

  20. improving the hygienic quality of quail carcasses by gamma irradiation

    International Nuclear Information System (INIS)

    Nasr, E.H.A.

    2002-01-01

    this investigation aimed to use gamma irradiation doses as compared to chemical preservative sodium tripolyphosphate (stpp) for increasing the shelf-life and improving the hygienic quality of quail carcasses during cold and frozen storage. one hundred quail carcasses were examined for the presence of salmonella. the examination illustrated that 70 carcasses from all examined carcasses were positive for salmonella. therefore, the contaminated quail carcasses were gamma irradiated at 2,4,6 and 8 kGy doses and soaking in 3% stpp and the effect of these treatments on the organoleptic, microbiological aspects and chemical properties during cold (4±1 o C) and frozen storage (-18 o C) of samples under investigation were evaluated .the results indicated that, the chemical composition of samples did not alter by gamma irradiation and soaking in STPP treatments. furthermore, treatments had no deleterious effects on the organoleptic properties of quail samples. irradiation of samples at doses of 2,4,6 and 8 kGy or soaking in STPP greatly reduced its microbial count and prolonged its shelf- life for 12,15,21,24 and 9 days at 4±1 o C, respectively against only 6 days for control samples

  1. Molecular study for the sex identification in Japanese quails ...

    African Journals Online (AJOL)

    In many birds' species such as Japanese quail, sex determination in young and many adult birds is very difficult. Nowadays, sex identification of animals throughout their lives is possible by molecular genetic techniques such as polymerase chain reaction (PCR). The aim of this study was to determine the sex of Japanese ...

  2. Genetic evaluation of European quails by random regression models

    Directory of Open Access Journals (Sweden)

    Flaviana Miranda Gonçalves

    2012-09-01

    Full Text Available The objective of this study was to compare different random regression models, defined from different classes of heterogeneity of variance combined with different Legendre polynomial orders for the estimate of (covariance of quails. The data came from 28,076 observations of 4,507 female meat quails of the LF1 lineage. Quail body weights were determined at birth and 1, 14, 21, 28, 35 and 42 days of age. Six different classes of residual variance were fitted to Legendre polynomial functions (orders ranging from 2 to 6 to determine which model had the best fit to describe the (covariance structures as a function of time. According to the evaluated criteria (AIC, BIC and LRT, the model with six classes of residual variances and of sixth-order Legendre polynomial was the best fit. The estimated additive genetic variance increased from birth to 28 days of age, and dropped slightly from 35 to 42 days. The heritability estimates decreased along the growth curve and changed from 0.51 (1 day to 0.16 (42 days. Animal genetic and permanent environmental correlation estimates between weights and age classes were always high and positive, except for birth weight. The sixth order Legendre polynomial, along with the residual variance divided into six classes was the best fit for the growth rate curve of meat quails; therefore, they should be considered for breeding evaluation processes by random regression models.

  3. Estimation of genetic parameters for carcass traits in Japanese quail ...

    African Journals Online (AJOL)

    The aim of this study was to estimate genetic parameters of some carcass characteristics in the Japanese quail. For this aim, carcass weight (Cw), breast weight (Bw), leg weight (Lw), abdominal fat weight (AFw), carcass yield (CP), breast percentage (BP), leg percentage (LP) and abdominal fat percentage (AFP) were ...

  4. TRUNK LEAN DURING A SINGLE-LEG SQUAT IS ASSOCIATED WITH TRUNK LEAN DURING PITCHING.

    Science.gov (United States)

    Plummer, Hillary A; Oliver, Gretchen D; Powers, Christopher M; Michener, Lori A

    2018-02-01

    Impaired trunk motion during pitching may be a risk factor for upper extremity injuries. Specifically, increased forces about the shoulder and elbow have been observed in pitchers with excessive contralateral trunk lean during pitching. Because of the difficulty in identifying abnormal trunk motions during a high-speed task such as pitching, a clinical screening test is needed to identify pitchers who have impaired trunk motion during pitching. The purpose of this study was to determine the relationship between the degree of lateral trunk lean during the single-leg squat and amount of trunk lean during pitching and if trunk lean during pitching can be predicted from lean during the single-leg squat. Controlled Laboratory Study; Cross-sectional. Seventy-three young baseball pitchers (11.4 ± 1.7 years; 156.3 ± 11.9 cm; 50.5 ± 8.8 kg) participated. An electromagnetic tracking system was used to obtain trunk kinematic data during a single-leg squat task (lead leg) and at maximum shoulder external rotation of a fastball pitch. Pearson correlation coefficients for trunk lean during the single-leg squat and pitching were calculated. A linear regression analysis was performed to determine if trunk lean during pitching can be predicted from lean during the single-leg squat. There was a positive correlation between trunk lean during the single-leg squat and trunk lean during pitching (r = 0.53; plean during the single-leg squat predicted the amount of lateral trunk lean during pitching (R 2 = 0.28; p lean during an SLS and pitching. Trunk lean during the single-leg squat explained 28% of the variance in trunk lean during pitching. Diagnosis, level 3.

  5. Influence of protein level and supplemental methionine in practical rations for young endangered masked bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1982-01-01

    A study was conducted to examine the protein requirement of young endangered masked Bobwhite quail (Colinus virginianus ridgwayi). Five practical starting rations containing 24 to 32% protein were fed alone and supplemented with methionine for 5 weeks. Supplemental methionine significantly improved growth of quail fed diets containing 24 and 26% protein. Increasing the protein level improved growth of quail fed unsupplemented diets but did not do so when diets contained supplemental methionine. A methionine-supplemented ration containing 24% protein appeared adequate for supporting rapid growth of masked Bobwhite quail.

  6. Studies on the riboflavin, niacin, pantothenic acid and choline requirements of young bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1974-01-01

    Four experiments were conducted to examine the riboflavin, niacin, pantothenic acid and choline requirements of young Bobwhite quail. Quail fed purified diets deficient in either riboflavin, niacin, pantothenic acid or choline grew poorly and high mortality occurred by 5 weeks of age. Under the conditions of these experiments, it was found that: (1) young quail require approximately 3.8 mg. riboflavin/kg. diet for satisfactory growth and survival; (2) no more than 31 mg. niacin/kg. diet are required for normal growth and survival of young quail; (3) the requirement for pantothenic acid is higher than has previously been reported, quail in these studies requiring 12.6 mg. pantothenic acid/kg. feed for growth and survival; and (4) the requirement for choline for reducing mortality is approximately 1000 mg./kg., while the amount necessary for normal growth of young quail is no greater than 1500 mg./kg. when the diet contains ample amounts of methionine. Quail fed a niacin-deficient diet developed stiff, shortened feathers and an erythema about the head; those receiving a riboflavin-deficient ration developed enlarged hocks and bowed legs, as did quail fed diets low or devoid of choline. Aside from slow growth, poor feathering was the only other indication that a deficient diet was being fed when quail were placed on a basal ration without pantothenic acid for five weeks.

  7. Association of Tyrosinase (TYR and Tyrosinase-related Protein 1 (TYRP1 with Melanic Plumage Color in Korean Quails (

    Directory of Open Access Journals (Sweden)

    Ying Xu

    2013-11-01

    Full Text Available TYR (Tyrosinase and TYRP1 (Tyrosinase-related protein 1 play crucial roles in determining the coat color of birds. In this paper, we aimed to characterize the relationship of TYR and TYRP1 genes with plumage colors in Korean quails. The SNPs were searched by cDNA sequencing and PCR-SSCP in three plumage color Korean quails (maroon, white and black plumage. Two SNPs (367T→C and 1153C→T were found in the coding region of TYRP1 gene, but had no significant association with plumage phenotype in Korean quails. The expression of TYR was higher in black plumage quails than that in maroon plumage quails. In contrast, the expression of TYRP1 was lower in black plumage quails than that in maroon plumage quails. This study suggested that the melanic plumage color in Korean quails may be associated with either increased production of TYR or decreased production of TYRP1.

  8. Trunk imbalance in adolescent idiopathic scoliosis.

    Science.gov (United States)

    Fortin, Carole; Grunstein, Erin; Labelle, Hubert; Parent, Stefan; Ehrmann Feldman, Debbie

    2016-06-01

    Trunk imbalance (ie, frontal trunk shift measured with a plumb line from C7 to S1) is part of the clinical evaluation in adolescent idiopathic scoliosis (AIS), but its prevalence and relationship with scoliosis, back pain, and health-related factors are not well documented. The principal objectives are to document trunk imbalance prevalence and to explore the association between trunk imbalance and the following factors: Cobb angle, type of scoliosis, back pain, function, mental health, and self-image. The secondary objective is to determine back pain prevalence and the relationship between back pain and each of the following: Cobb angle, function, mental health, and self-image. This is a cross-sectional study in a scoliosis clinic of a tertiary university hospital center. The sample includes youth with AIS (N=55). The outcome measures were trunk imbalance prevalence and magnitude, and back pain prevalence and intensity using the Numeric Pain Rating Scale (NPRS) and the Scoliosis Research Society-22 (SRS-22) pain score, and the function, self-image, and mental health domains of the SRS-22. Trunk imbalance and back pain were assessed in 55 patients with AIS (Cobb angle: 10-60°). Patients completed the SRS-22 questionnaire and the NPRS. Correlations were done between trunk imbalance and scoliosis (Cobb angle, type of scoliosis), back pain (NPRS and SRS-22 pain score), and health-related factors using Pearson correlation coefficients (r) and logistic regression models. Trunk imbalance prevalence is 85% and back pain prevalence is 73%. We found fair to moderate significant positive correlation between trunk imbalance and Cobb angle (r=0.32-0.66, pself-image, or type of scoliosis. Lower self-reported pain significantly correlated with lower Cobb angles (r=0.29, p=.03), higher function (r=0.55, p=.000), higher self-image (r=0.44, p=.001), and better mental health (r=0.48, p=.000). There was a trend for trunk imbalance to be related with lower pain in logistic regression

  9. Evaluation of quail and chicken embryos for the detection of botulinum toxin serotypes A, B, E and F activity

    Science.gov (United States)

    Comparison of quail (Coturnix japonica) and chicken (Gallus domesticus) embryos for the detection of BoNT/A activity was conducted using equal dosages of toxin/g of embryo (quail at 7 g and chickens at 48 g). Quail embryos were injected at 0, 0.5 to 50 ng adn chicken embryos at 0, 3.4 to 342 ng and...

  10. Vegetation attached to the elephant trunk.

    Science.gov (United States)

    Tanaka, Akiko; Sakamoto, Toshihito; Okada, Kenji; Okita, Yutaka

    2013-09-01

    The elephant trunk technique is used as a standard method in the approach to staged repair of extensive thoracic aneurysms. Here, we present a rare case of a graft infection, in which vegetation was attached to the distal end of the elephant trunk. A 36-year old male who had undergone total arch replacement with elephant trunk installation for type A aortic dissection was readmitted for high-grade fever. At the time of admission, Osler's nodules were present and brain magnetic resonance imaging showed multiple small emboli and haemorrhages. Transoesophageal echocardiography could not locate any sign of infection within the cardiac chambers, but disclosed vegetation attached to the elephant trunk. He underwent successful emergent graft replacement of the lesion, and no recurrence of the infection has been observed.

  11. INCLUSION OF GUAVA WASTES IN THE DIET OF EUROPEAN QUAILS

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Lemos Camelo

    2015-07-01

    Full Text Available This experiment was conducted to analyze the performance and carcass characteristics of European quail fed agroindustry residue of guava in substitution of corn. 140 birds were used, distributed in a completely randomized design. The treatments consisted of a control diet and four diets with levels of guava waste inclusion (2.5, 5.0, 7.5 and 10.0% to a diet based on corn and soybean meal. There were no significant differences (P> 0.05 for the variables: weight gain, feed intake, feed conversion, feed efficiency, weight and carcass yield and prime cuts (breast, drumstick and thigh wings, back , neck, head, feet and foodstuffs organs (heart, liver and gizzard. The guava waste can be used as alternative ingredient in the diets of European quail in the period of 16-38 days of age, up to the level of 10% inclusion without depressing the performance and yield of poultry carcasses.

  12. COMPARISON OF SLAUGHTER VALUE IN PHARAOH QUAIL OF DIFFERENT AGES

    Directory of Open Access Journals (Sweden)

    Anna WILKANOWSKA

    2011-07-01

    Full Text Available The effect of age of Pharaoh quails on dressing percentage, carcass composition, and sensory and physicochemical properties of their meat was determined. Compared to 42-day-old birds, Pharaoh quail aged 33 days had lower body weight (169.1 vs 139.4 g, carcass weight (111.7 vs 88.8 g and dressing percentage (66.1 vs 63.7%. The carcasses of 42-day-old birds contained more breast muscles (30.9%, leg muscles (18.3%, skin with subcutaneous fat (6.5% and remainders of the carcass (31.0% compared to birds at 33 days of age (30.8; 16.7; 6.2 and 30.0%, respectively. Older birds showed higher values of pH15, redness (a* and yellowness (b* and lower values of sensory meat properties except aroma intensity.

  13. COMPARATIVE EFFICACY OF DETOMIDINE AND DETOMIDINE - KETAMINE COCKTAIL IN QUAILS

    Directory of Open Access Journals (Sweden)

    U. F. Durrani, M. Ashraf and A. Khalid¹

    2005-10-01

    Full Text Available Twenty adult healthy quails (Coturnix coturnix were divided into two equal groups. One group was administered detomidine (2.4 mg/kg, I/M and other group was administered detomidine-ketamine cocktail (1.2 mg/kg + 30 mg/kg, I/M. Detomidine slowly and smoothly induced a light sedation accompanied by superficial analgesia, hypoventilation, hypothermia and bradycardia in all birds. Detomidine-ketamine cocktail rapidly and smoothly induced a deep anaesthesia accompanied by deep analgesia, hypoventilation, hypothermia and bradycardia and complete loss of all reflexes in all birds. In both groups, recovery from sedation and anaesthesia was smooth and of short duration. From this study it was concluded that for minor and least painful procedures in quails detomidine can be used alone, while for major and painful surgical procedures detomidine-ketamine combination should be preferred.

  14. COMPARATIVE EFFICACY OF DETOMIDINE AND DETOMIDINE - KETAMINE COCKTAIL IN QUAILS

    OpenAIRE

    U. F. Durrani, M. Ashraf and A. Khalid¹

    2005-01-01

    Twenty adult healthy quails (Coturnix coturnix) were divided into two equal groups. One group was administered detomidine (2.4 mg/kg, I/M) and other group was administered detomidine-ketamine cocktail (1.2 mg/kg + 30 mg/kg, I/M). Detomidine slowly and smoothly induced a light sedation accompanied by superficial analgesia, hypoventilation, hypothermia and bradycardia in all birds. Detomidine-ketamine cocktail rapidly and smoothly induced a deep anaesthesia accompanied by deep analgesia, hypove...

  15. Spatial orientation in Japanese quails (Coturnix coturnix japonica.

    Directory of Open Access Journals (Sweden)

    Tim Ruploh

    Full Text Available Finding a given location can be based on a variety of strategies, for example on the estimation of spatial relations between landmarks, called spatial orientation. In galliform birds, spatial orientation has been demonstrated convincingly in very young domestic chicks. We wanted to know whether adult Japanese quails (Coturnix coturnix japonica without food deprivation are also able to use spatial orientation. The quails had to learn the relation of a food location with four conspicuous landmarks which were placed in the corners of a square shaped arena. They were trained to find mealworms in three adjacent food cups in a circle of 20 such cups. The rewarded feeders were located during training between the same two landmarks each of which showed a distinct pattern. When the birds had learned the task, all landmarks were displaced clockwise by 90 degrees. When tested in the new situation, all birds redirected their choices with respect to the landmark shift. In subsequent tests, however, the previously correct position was also chosen. According to our results, quails are using conspicuous landmarks as a first choice for orientation. The orientation towards the previously rewarded location, however, indicates that the neuronal representation of space which is used by the birds also includes more fine grain, less conspicuous cues, which are probably also taken into account in uncertain situations. We also presume that the rare orientation towards never rewarded feeders may be due to a foraging strategy instead of being mistakes.

  16. Helminth community of scaled quail (Callipepla squamata) from western Texas.

    Science.gov (United States)

    Landgrebe, Jill N; Vasquez, Barbara; Bradley, Russell G; Fedynich, Alan M; Lerich, Scott P; Kinsella, John M

    2007-02-01

    Forty-eight scaled quail (Callipepla squamata) were collected during August 2002 at Elephant Mountain Wildlife Management Area in Brewster County, Texas, and examined for helminths. Eight species of helminths were found (5 nematodes and 3 cestodes), representing 2,811 individuals. Of these species, Gongylonema sp., Procyrnea pileata, and Choanotaenia infundibulum are reported from scaled quail for the first time. Prevalence of Aulonocephalus pennula, Gongylonema sp., Oxyspirura petrowi, Physaloptera sp., P. pileata, C. infundibulum, Fuhrmannetta sp., and Rhabdometra odiosa was 98, 2, 56, 4, 60, 2, 25, and 35%, respectively. Aulonocephalus pennula numerically dominated, accounting for 88% of total worms. Statistical analyses were performed on the 5 species with > or = 25% prevalence using the after-hatch-year host sample (n = 38). Prevalence of P. pileata was higher (P = 0.049) in females than in males and higher (P = 0.037) in the sample collected from the site that had spreader dams (berms 1-2 m high and 4-55 m long constructed in varying sizes to catch and retain rainfall) than the control site (no spreader dams). Higher rank mean abundance of A. pennula and O. petrowi (P = 0.0001 and P = 0.0052, respectively) was found in the host sample collected from the site that had spreader dams than the control site. A host gender-by-collection site interaction (P = 0.0215) was observed for P. pileata. Findings indicate that scaled quail are acquiring indirect life cycle helminths in arid western Texas habitats.

  17. Egg-laying substrate selection for optimal camouflage by quail.

    Science.gov (United States)

    Lovell, P George; Ruxton, Graeme D; Langridge, Keri V; Spencer, Karen A

    2013-02-04

    Camouflage is conferred by background matching and disruption, which are both affected by microhabitat. However, microhabitat selection that enhances camouflage has only been demonstrated in species with discrete phenotypic morphs. For most animals, phenotypic variation is continuous; here we explore whether such individuals can select microhabitats to best exploit camouflage. We use substrate selection in a ground-nesting bird (Japanese quail, Coturnix japonica). For such species, threat from visual predators is high and egg appearance shows strong between-female variation. In quail, variation in appearance is particularly obvious in the amount of dark maculation on the light-colored shell. When given a choice, birds consistently selected laying substrates that made visual detection of their egg outline most challenging. However, the strategy for maximizing camouflage varied with the degree of egg maculation. Females laying heavily maculated eggs selected the substrate that more closely matched egg maculation color properties, leading to camouflage through disruptive coloration. For lightly maculated eggs, females chose a substrate that best matched their egg background coloration, suggesting background matching. Our results show that quail "know" their individual egg patterning and seek out a nest position that provides most effective camouflage for their individual phenotype. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. Genetic characterization of egg weight, egg production and age at first egg in quails

    NARCIS (Netherlands)

    Marubayashi Hidalgo, A.; Martins, E.N.; Santos, A.L.; Quadros, T.C.O.; Ton, A.P.S.; Teixeira, R.

    2011-01-01

    The objective of this research was to estimate genetic parameters for the traits egg weight, egg production in 189 days and age at first egg in three laying quails and one meat line of quails. Data was analyzed by Bayesian procedures using Gibbs sampling. The heritability estimates for egg weight,

  19. Detection of Marek's disease virus DNA in Japanese quail susceptible to atherosclerosis

    International Nuclear Information System (INIS)

    Pyrzak, R.; Shih, J.C.H.

    1986-01-01

    Marek's disease virus (MDV) was demonstrated as an etiological agent which causes atherosclerosis in the chicken. Since herpes viruses are ubiquitous, incidences of viral atherogenesis in humans and other animals were speculated. In this laboratory, the atherosclerosis susceptible (SUS) and resistant (RES) Japanese quail were developed as the animal model for atherosclerosis research. The susceptibility of the animal might be due to an infection of MDV or a related quail herpes virus (QHV). An initial attempt to isolate viruses from quail and an agar gel precipitin test for MDC were not positive. A DNA hybridization technique was used to determine whether the MDC-DNA existed in the quail cell. The gene library of MDV EcoRl DNA fragments was used to prepare the DNA probe, labeled with [ 32 P] by nick translation. Dot hybridizations were carried out by mixing the MDV-DNA probe with DNAs isolated from quail tissues. A high stringent condition was used. From this experiment it was found that the tissues from the SUS quail were hybridization positive, but most of them from RES quail were negative. When aortas were compared, the severe atherosclerotic had a strong hybridization (3-4 cop. of genome/cell) whereas the others hybridized moderately (1 cop./cell). It was concluded that genes from MDV or a QHV indeed existed in Japanese quail

  20. Microsatellite loci in Japanese quail and cross-species amplification in chicken and guinea fowl

    Directory of Open Access Journals (Sweden)

    Mizutani Makoto

    2002-03-01

    Full Text Available Abstract In line with the Gifu University's initiative to map the Japanese quail genome, a total of 100 Japanese quail microsatellite markers isolated in our laboratory were evaluated in a population of 20 unrelated quails randomly sampled from a colony of wild quail origin. Ninety-eight markers were polymorphic with an average of 3.7 alleles per locus and a mean heterozygosity of 0.423. To determine the utility of these markers for comparative genome mapping in Phasianidae, cross-species amplification of all the markers was tested with chicken and guinea fowl DNA. Amplification products similar in size to the orthologous loci in quail were observed in 42 loci in chicken and 20 loci in guinea fowl. Of the cross-reactive markers, 57.1% in chicken and 55.0% in guinea fowl were polymorphic when tested in 20 birds from their respective populations. Five of 15 markers that could cross-amplify Japanese quail, chicken, and guinea fowl DNA were polymorphic in all three species. Amplification of orthologous loci was confirmed by sequencing 10 loci each from chicken and guinea fowl and comparing with them the corresponding quail sequence. The microsatellite markers reported would serve as a useful resource base for genetic mapping in quail and comparative mapping in Phasianidae.

  1. Detection of botulinum toxin types A, B, E, and F activity using the quail embryo

    Science.gov (United States)

    We recently demonstrated an effective new model for the detection of botulinum toxin type A using quail embryos in place of the mouse model. These experiments demonstrated that the Japanese quail embryo at 15 days of incubation was an effective vertebrate animal model to detect the activity of botu...

  2. Stimulation of Egg Production in Japanese Quails by Enriching Feed with Residual Yeast

    Directory of Open Access Journals (Sweden)

    Letitia Oprean

    2010-05-01

    Full Text Available Quail eggs are more and more approved for consumers because they bring many benefits to the human body. Therefore, quails breeding for eggs production have become a very profitable business. Residual yeast may be a nutritional supplement, especially rich in vitamins and proteins. This article studies the influence of residual beer yeast on egg laying in Japanese quails. In order to be integrated into the diet of quails the yeast has undergone a process of autolysis; its influence has been examined on separate groups. The results were reported as a percentage compared with the control group, where the feed does not contain this supplement. Due to its content rich in vitamins and proteins, the residual beer yeast used in feeding the quails bred for eggs stimulates egg laying.

  3. Analisis Migrasi Radio Trunking Analog ke Radio Trunking Digital di Indonesia

    Directory of Open Access Journals (Sweden)

    Riza Azmi

    2013-09-01

    Full Text Available Dalam Tabel Alokasi Spektrum Frekuensi di Indonesia pada catatan kaki INS9 dan INS13 disebutkan bahwa alokasi pada pita-pita frekuensi yang digunakan untuk teknologi trunking direncanakan dimigrasi ke sistem komunikasi trunking digital pada waktu yang akan ditentukan oleh pemerintah. Terkait dengan hal itu, studi ini bertujuan untuk mengkaji bagaimana kelayakan migrasi dari sistem trunking analog ke sistem trunking digital dan hal-hal yang terkait dengannya. Dengan menggunakan analisis biaya dan manfaat (Cost-Benefit Analysis studi ini melihat bahwa migrasi hanya dapat dilakukan jika umur masing-masing lisensi dari operator telah berakhir, atau dengan kata lain pemerintah dapat mendorong transisi ke digital dengan menerbitkan lisensi baru yaitu lisensi trunking digital.

  4. An Anomalous Branching of Coeliac Trunk

    Directory of Open Access Journals (Sweden)

    Jadhav Surekha D

    2013-07-01

    Full Text Available Anatomical variations of the coeliac trunk arevery common. A variation of coeliac trunk oc-curs due to the developmental abnormalities inthe ventral splanchnic arteries. Present paperhighlights a rare variation of branching patternof coeliac trunk which was observed during rou-tine dissection. In a 63 year old male cadaver,we observed a bifurcation of coeliac trunk intoshort hepato-splenic and longer hepato-gastrictrunks. The hepato-splenic trunk divided intocommon hepatic artery and splenic artery. Cys-tic artery originated from proper hepatic arteryand then proper hepatic artery divided into rightand left hepatic arteries. Hepato-gastric trunkran laterally and upward, and then it divided intotwo branches: a left gastric artery and left ac-cessory hepatic artery. Knowledge of this rarevariation is clinically very important for sur-geons, especially while performing liver trans-plantation, gastric, gallbladder surgeries andtransarterial chemoembolization for hepatictumor and during invasive procedures like an-giography and also other radiological studies.

  5. Arthropods vector grapevine trunk disease pathogens.

    Science.gov (United States)

    Moyo, P; Allsopp, E; Roets, F; Mostert, L; Halleen, F

    2014-10-01

    Arthropod-mediated dispersal of pathogens is known in many cropping systems but has never been demonstrated for grapevine trunk disease pathogens. Arthropods from vineyards were screened for the presence of pathogens associated with Petri disease and esca using cultural and molecular techniques. The ability of the most abundant pathogen-carrying species to inoculate healthy grapevine vascular tissues was also determined. Millipedes and ants were allowed to associate with a DsRed- Express-transformed Phaeomoniella chlamydospora, after which they were exposed to freshly pruned healthy grapevines under controlled conditions and wounds were monitored for subsequent infection. In addition, the possibility of millipede excreta, commonly found on pruning wounds in the field, to act as inoculum source was determined. A diverse arthropod fauna was associated with declining grapevines and many of these carried trunk disease pathogens. However, spiders, the ant Crematogaster peringueyi, and the millipede Ommattoiulus moreleti were the most abundant pathogen carriers. The ant and millipede species fed on pruning wound sap and effectively transmitted trunk disease pathogens. Millipede excreta contained viable spores of Phaeomoniella chlamydospora and may serve as an inoculum source. Numerous arthropods, including beneficial predators, are potential vectors of grapevine trunk disease pathogens. Our results highlight the need for an integrated approach, including targeted management of ants and millipedes at the time of pruning, to limit the spread of grapevine trunk diseases.

  6. Interactive Trunk Extraction from Forest Point Cloud

    Directory of Open Access Journals (Sweden)

    T. Mizoguchi

    2014-06-01

    Full Text Available For forest management or monitoring, it is required to constantly measure several parameters of each tree, such as height, diameter at breast height, and trunk volume. Terrestrial laser scanner has been used for this purpose instead of human workers to reduce time and cost for the measurement. In order to use point cloud captured by terrestrial laser scanner in the above applications, it is an important step to extract all trees or their trunks separately. For this purpose, we propose an interactive system in which a user can intuitively and efficiently extract each trunk by a simple editing on the distance image created from the point cloud. We demonstrate the effectiveness of our proposed system from various experiments.

  7. Influence of dietary protein and excess methionine on choline needs for young bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1982-01-01

    Experiments were conducted with young Bobwhite quail (Colinus virginianus) to investigate the effect of differing dietary protein levels and nondetrimental amounts of excess methionine on choline needs. Growth and feed consumption of quail fed an adequate (27.3%) protein purified diet supplemented with 2000 mg/kg of choline were unaffected by increasing the level of excess methionine to 1.75%; however, greater amounts (2.0%, 2.25%) of excess methionine depressed growth (P less than .01), reduced feed consumption (P less than .01), and decreased feed utilization (P less than .05). Quail fed a purified diet containing 13.85% protein and 515 mg/kg of choline grew poorly. Growth was unaffected by additional choline in this diet. Growth was suboptimal among quail fed purified diets containing adequate or high (41.55%) levels of protein in which choline was limiting; however, a high level of protein did not in itself affect performance. Growth was improved by supplemental choline in these diets. Growth of quail fed purified diets with up to 1.35% excess methionine which were limiting (531 mg/kg) in choline was less than that of groups fed 2000 mg/kg of added dietary choline (P less than .01); however, excess methionine did not significantly influence growth of quail fed choline-deficient diets. These experiments indicate that neither high dietary protein nor excess methionine, fed at non-growth-depressing levels, increases dietary choline needs for young Bobwhite quail.

  8. Influence of hydrocolloidal silver nanoparticles on gastrointestinal microflora and morphology of enterocytes of quails

    DEFF Research Database (Denmark)

    Sawosz, Ewa; Binek, Marian; Grodzik, Marta

    2007-01-01

    The objective of the present study was to examine the effects of hydrocolloidal silver nanoparticles (Ag-nano) on microbial profile of caecum and morphology of enterocytes in duodenum of Japanese quail, as a model animal for poultry. Quails (Coturnix coturnix japonica) (10 d old) were randomly...... killed and samples of duodenum and caeca microflora were collected. This initial investigation demonstrated that silver nanoparticles did not influence emphatically microflora of quail caecum; however, water containing 25 mg/kg of Ag-nano significantly increased the population of lactic acid bacteria...

  9. Hematological and biochemical effects of chronic CO exposure on the Japanese quail

    Energy Technology Data Exchange (ETDEWEB)

    Jaeger, J.J.; McGrath, J.J.

    1975-01-01

    Japanese Quail were exposed to a concentration of 300 to 350 ppm CO to maintain an equilibrium carboxyhemoglobin concentration of 30% for a period of 4 weeks. Compared to a control group of birds maintained in an identical chamber, the CO-exposed quail demonstrated increases in hematocrit ratio and hemoglobin concentration. At the end of the exposure period, the CO-exposed quail had significantly larger plasma glucose concentrations than the control birds. Cardiac and skeletal muscle carbohydrate stores were not affected by chronic CO exposure.

  10. The Elephant Trunk Technique: A New Complication

    OpenAIRE

    Neri, Eugenio; Toscano, Thomas; Frati, Giacomo; Sassi, Carlo

    2001-01-01

    We describe a complication that occurred during the 2nd stage of an “elephant trunk” aortic replacement. The patient was a 58-year-old woman who had undergone graft replacement of the ascending aorta and aortic arch with the elephant trunk technique for an acute, Stanford type-A aortic dissection.

  11. DDE increased the toxicity of parathion to coturnix quail

    Science.gov (United States)

    Ludke, J.L.

    1977-01-01

    Adult male Japanese quail (Coturnix coturnix) were exposed to DDE or chlordane in the diet and subsequently dosed with parathion or paraoxon. Pretreatment with 5 or 50 ppm DDE in the diet for 12 weeks resulted in increased cholinesterase (ChE) activity in plasma, but not in the brain. Dietary concentrations of 5 and 50 ppm DDE caused increased susceptibility of quail that were challenged with parathion or paraoxon. The increased mortality resulting from DDE pretreatment was reflected in brain ChE inhibition. The synergistic action of DDE was apparent after 3 days of exposure to 50 ppm DDE and 1 week of exposure to 5 ppm DDE. Birds exposed for 3 weeks to 5 or 50 ppm DDE retained their DDE-potentiated sensitivity to parathion after 2 weeks on clean diet. Chlordane pretreatment resulted in decreased susceptibility (antagonism) to parathion, but not to paraoxon dosage. Implications of differing responses in ChE and mortality among controls, DDE-, and chlordane-pretreated birds after parathion or paraoxon dosage are discussed.

  12. Toxicity of dietary Heliotropium dolosum seed to Japanese quail.

    Science.gov (United States)

    Eroksuz, Y; Eroksuz, H; Ozer, H; Ilhan, N; Cevik, A; Yaman, I; Ceribasi, A O

    2002-10-01

    Five groups of 30 male Japanese quail, each 7-w-old, were fed diets containing 0, 1, 3, 5, or 10% (w/w) of dehulled H dolosum seed. Half of the birds from the each group were killed at 6 and 24 w after beginning of the trial. At the end of 6th w, neither mortality nor clinical sign occurred in test groups. In the 5 and 10% inclusion levels, mild to moderate hepatic injury was detected as evidenced by mild karyomegaly, moderate fatty change, focal or portal fibrosis, bile duct hyperplasie, and ovalocyte proliferation along with lower serum protein and albumin levels. By the termination of the experiment (24 w), 5 birds died in the 10% dosed group. Hepatic cirrhosis was the most prominent finding in the 5 and 10% group; at these levels, serum protein and albumin values decreased significanty while billuribin and ALP levels increased. Based on relative weights and histological evaluations, testicularatrophywasdosedependent. These results partly affirm earlier studies that the quail is highly resistant to the toxic effects of H dolosumseed. However, the resistance to H dolosum is less than Senecio Jacobae and Crotalaria spectabilis when considering tissue injury.

  13. Trunk Muscle Function Deficit in Youth Baseball Pitchers With Excessive Contralateral Trunk Tilt During Pitching.

    Science.gov (United States)

    Oyama, Sakiko; Waldhelm, Andrew G; Sosa, Araceli R; Patel, Ravina R; Kalinowski, Derick L

    2017-09-01

    Pitching technique is one of many factors that affect injury risk. Exhibiting excessive contralateral trunk tilt (CLT) during pitching has been linked to higher ball speed but also to increased joint loading. Deficit in trunk muscle strength has been suggested as an underlying cause of this movement pattern. The purpose of the study was to compare trunk muscle strength between youth baseball pitchers with varying degree of CLT during pitching. Cross-sectional study. Baseball practice fields. Twenty-eight youth baseball pitchers. Pitching technique was captured using a video camera. Based on the 2-dimensional trunk contralateral flexion angle, pitchers were categorized into low (30 degrees) CLT groups. Maximum isometric strength tests for trunk flexion, extension, and bilateral rotation, measured using a dynamometer. The pitchers with high CLT (n = 10) had longer pitching experience (P = 0.014), produced higher ball speed (P = 0.003) compared with the pitchers with moderate (n = 10) and low (n = 8) CLT, but demonstrated greater asymmetry in trunk rotation strength (relative weakness in rotation strength toward dominant side) compared with the pitchers with low CLT (P = 0.015). Excessive CLT may be a strategy that young pitchers learn to achieve higher ball velocity but also may be associated with imbalance between the oblique muscles on dominant and nondominant side, which may be acquired from repetitive pitching. Strengthening and emphasizing the use of dominant side oblique muscles may keep pitchers from leaning excessively during pitching and thus decrease joint loading.

  14. Comparative toxicity of coniine, an alkaloid of Conium maculatum (poison hemlock), in chickens, quails, and turkeys.

    Science.gov (United States)

    Frank, A A; Reed, W M

    1990-01-01

    Coniine, an alkaloid of Conium maculatum (poison hemlock), was administered by gavage to immature chickens, quails, and turkeys at 0, 25, 50, and 100 mg/kg body weight. At 25 mg coniine/kg body weight, clinical signs were observed only in quails (2/10) and consisted of excitement, depression, hypermetria, seizures, opisthotonos, and flaccid paralysis. Chickens (9/10) and quails (8/10) dosed at 50 mg/kg body weight were affected, and several birds of each species died (2/10 and 5/10, respectively). Turkeys (7/10) were affected only when dosed at 100 mg/kg body weight, and quails (6/10), turkeys (4/10), and chickens (10/10) died at this dose. There were no gross or microscopic lesions. Coniine was detected in skeletal muscle and liver of birds dying after ingestion and was present in some survivors 7 days post-treatment.

  15. [Effect of krypton-containing gas mixture on Japanese quail embryo development].

    Science.gov (United States)

    Kussmaul', A R; Gur'eva, T S; Dadasheva, O A; Pavlov, N B; Pavlov, B N

    2008-01-01

    Investigated were effects of gas mixture with up to 3.0 kgs/cm2 of krypton on the embryonic development of domesticated Japanese quail (Coturnix coturnix japonica dom.). Results demonstrated absence of a serious krypton effect on Japanese quail embryos. Development of embryos proceeded in due course; morphometrically the experimental embryos were essentially similar to controls. It should be noted that despite exposure to acute hypoxic hypoxia during the initial 12 hours of development in the krypton-containing gas mixture, viability of quail embryos was high enough which can be ascribed to the krypton protective action. Besides, an additional experiment showed that krypton partial pressure of 5-5.5 kgs/cm2 produces the narcotic effect on adult Japanese quails.

  16. Trunk Robot Rehabilitation Training with Active Stepping Reorganizes and Enriches Trunk Motor Cortex Representations in Spinal Transected Rats

    OpenAIRE

    Oza, Chintan S.; Giszter, Simon F.

    2015-01-01

    Trunk motor control is crucial for postural stability and propulsion after low thoracic spinal cord injury (SCI) in animals and humans. Robotic rehabilitation aimed at trunk shows promise in SCI animal models and patients. However, little is known about the effect of SCI and robot rehabilitation of trunk on cortical motor representations. We previously showed reorganization of trunk motor cortex after adult SCI. Non-stepping training also exacerbated some SCI-driven plastic changes. Here we e...

  17. Haemosporidian infection in captive masked bobwhite quail (Colinus virginianus ridgwayi), an endangered subspecies of the northern bobwhite quail

    Science.gov (United States)

    Pacheco, M. Andreína; Escalante, Ananias A.; Garner, Michael M.; Bradley, Gregory A.; Aguilar, Roberto F.

    2011-01-01

    The avian haemosporidian parasites (phylum Apicomplexa) are taxonomically diverse and cosmopolitan in distribution; infecting most bird families. Sources of concern are reports of clinical haemosporidian infections in birds kept as part of zoo and aviary collections. Recently, severe and acute mortality episodes have been reported in masked bobwhite quail (Colinus virginianus ridgwayi), an endangered subspecies from the American Southwest. Two hundred and five eggs of the captive flock held in Arivaca, Arizona, were hatched at a zoo in the American Southwest. Thirty four sub-adult or adult animals had lesions associated with tissue phases of hemoparasites, especially vasculitis, ventricular leiomyositis and ulcerative pododermatitis. Molecular techniques applied to blood collected from the zoo’s last twelve remaining animals resulted in the detection of a Plasmodium juxtanucleare-like and Haemoproteus sp. parasites. A Raven (Corvus corax), in a contiguous exhibit, was positive for the same Plasmodium juxtanucleare-like parasite, but remained asymptomatic for three years following detection. These findings indicate that other birds in the exhibit within the zoo premises could act as reservoirs. We conclude that haemosporidian infections could be a factor in the demise of the captive masked bobwhite quails housed at the zoo. We suggest that active surveillance for haemoporidian parasites should be incorporated as a precaution to ex-situ conservation efforts of susceptible endangered species. PMID:21726940

  18. Reduced mortality among young endangered masked bobwhite quail fed oxytetracycline-supplemented diets

    Science.gov (United States)

    Serafin, J.A.

    1982-01-01

    Two experiments were conducted to examine the effect of oxytetracycline-supplemented diets on mortality of young endangered masked bobwhite quail (Colinus virginianus ridgwayi). Inclusion of oxytetracycline at 200 g per ton in the feed for 6 weeks resulted in a marked, significant reduction in mortality of young masked bobwhite quail raised in captivity. Including the antibiotic in feed during the first week of life reduced mortality as effectively as feeding it for a longer period.

  19. Characterization and Digestibility of Detoxified Castor Oil Meal for Japanese Quails

    OpenAIRE

    Santos,PA dos; Ludke,MCMM; Ludke,JV; Rabello,CBV; Santos,MJB dos; Torres,TR

    2015-01-01

    ABSTRACT These experiments were performed to determine the chemical composition, coefficients of nutrient and energy metabolizability, amino acid composition, and cytotoxicity of different castor oil meals subjected to different detoxification processes and added to the diet of Japanese quails. In the trial, 180 46-d-old female Japanese quails were distributed according to a completely randomized design into five treatments and with replicates of six bird each. The treatments consisted of fol...

  20. Trunk biomechanics during hemiplegic gait after stroke: A systematic review.

    Science.gov (United States)

    Van Criekinge, Tamaya; Saeys, Wim; Hallemans, Ann; Velghe, Silke; Viskens, Pieter-Jan; Vereeck, Luc; De Hertogh, Willem; Truijen, Steven

    2017-05-01

    Stroke commonly results in trunk impairments that are associated with decreased trunk coordination and limited trunk muscle strength. These impairments often result in biomechanical changes during walking. Additionally, the so-called pelvic step might be influenced by these impairments. Therefore, the aim of this review was twofold. First, to gain more insight into trunk biomechanics during walking in stroke patients compared to healthy individuals. Second, to investigate the influence of walking speed on trunk biomechanics. The search strategy was performed by the PRISMA guidelines and registered in the PROSPERO database (no. CRD42016035797). Databases MEDLINE, Web of Science, Cochrane Library, ScienceDirect, and Rehabdata were systematically searched until December 2016. Sixteen of the 1099 studies met the eligibility criteria and were included in this review. Risk of bias was assessed by the Newcastle-Ottawa Scale. The majority of studies reported on trunk kinematics during walking, data on trunk kinetics and muscle activity is lacking. Following stroke, patients walk with increased mediolateral trunk sway and larger sagittal motion of the lower trunk. Although rotation of the upper trunk is increased, the trunk shows a more in-phase coordination. Acceleration of the trunk diminishes while instability and asymmetry increase as there are less movement towards the paretic side. However, it is of great importance to differentiate between compensatory trunk movements and intrinsic trunk control deficits. Specific exercise programs, assistive devices and orthoses might be of help in controlling these deficits. Importantly, studies suggested that more natural trunk movements were observed when walking speed was increased. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. Effects of pushing height on trunk posture and trunk muscle activity when a cart suddenly starts or stops moving.

    Science.gov (United States)

    Lee, Yun-Ju; Hoozemans, Marco J M; van Dieën, Jaap H

    2012-01-01

    Unexpected sudden (un)loading of the trunk may induce inadequate responses of trunk muscles and uncontrolled trunk motion. These unexpected perturbations may occur in pushing tasks, when the cart suddenly starts moving (unloading) or is blocked by an obstacle (loading). In pushing, handle height affects the user's working posture, which may influence trunk muscle activity and trunk movement in response to the perturbation. Eleven healthy male subjects pushed a 200 kg cart with handles at shoulder and hip height in a start condition (sudden release of brakes) and a stop condition (bumping into an obstacle). Before the perturbation, the baseline of the trunk inclination, internal moment and trunk extensor muscle activity were significantly higher when pushing at hip height than at shoulder height. After the perturbation, the changes in trunk inclination and internal moment were significantly larger when pushing at shoulder height than at hip height in both conditions. The opposite directions of changes in trunk inclination and internal moment suggest that the unexpected perturbations caused uncontrolled trunk motion. Pushing at shoulder height may impose a high risk of low-back injury due to the low trunk stiffness and large involuntary trunk motion occurring after carts suddenly move or stop.

  2. Effects of Divergent Selection Body Weight and the Quail Laying Eggs on some Physical and Mechanical Properties of Japanese Quail Eggs

    Directory of Open Access Journals (Sweden)

    mousareza baghani

    2016-08-01

    Full Text Available Introduction Breeding quail and quail egg industrial production because of the high nutritional value of these products has been developing these years. Considering the high demand and economical production, further development in the future is predicted. In order to design and effective utilization of the equipment for transportation, separation, packaging and storage, the physical and mechanical properties of quail eggs are needed. It is of great importance to study the factors which are influencing these properties. Strength of the shell is an important factor in determination of quail egg quality. Quail egg shell strength depends on several variables including specific gravity, egg weight and volume, shell thickness, weight and percentage of shell, hardness, breaking force, breaking energy, egg surface, farming conditions, type and species of birds, nutrition and geometric characteristics of eggs. Materials and Methods In this paper, initially in three phases, at 15 weeks, 19 weeks and 23 weeks, shell strength changes and physical properties of quail eggs on 90 quails during their first period of laying eggs were studied. Measured properties were included dimensions, weight, volume, specific gravity, shell thickness, weight and percentage of shell, breaking force, breaking energy, egg surface and some other properties. In the second part the effects of divergent selection for the bird’s body weight at four weeks of age on the quail eggs of fifth generation were studied. Measured properties were included dimensions, weight, volume, breaking force, breaking energy and some factors for direct and indirect measurement of strength of quail eggs. For direct measurement of the strength of eggshell of quail, two methods were employed: The first method was quasi-static compression test between two parallel plates of the universal testing machine and the second method was measuring specific gravity. In the first method, eggs were compressed between

  3. Pharmacokinetics of enrofloxacin and marbofloxacin in Japanese quails and common pheasants.

    Science.gov (United States)

    Lashev, L D; Dimitrova, D J; Milanova, A; Moutafchieva, R G

    2015-04-01

    The pharmacokinetics of enrofloxacin and marbofloxacin was studied in Japanese quails and common pheasants. Healthy mature birds from both species and both genders were treated intravenously and orally with enrofloxacin (10 mg/kg) and marbofloxacin (5 mg/kg). After intravenous administration enrofloxacin was extensively metabolised to ciprofloxacin. Metabolites of marbofloxacin were not detected. Values of volume of distribution were respectively 4.63 l/kg and 3.67 l/kg for enrofloxacin and 1.56 l/kg and 1.43 l/kg for marbofloxacin. In quails, total body clearance values were higher than those in pheasants and other avian species. After oral application enrofloxacin was rapidly absorbed in quails, more rapidly than marbofloxacin. Pheasants absorbed both antimicrobials at a lower rate. Higher bioavailability was observed for marbofloxacin (118%). Relatively low bioavailability was established in quails for enrofloxacin (26.4%), accompanied by extensive conversion to ciprofloxacin. Generally, quails absorbed and eliminated both fluoroquinolones more rapidly than pheasants; the latter showed pharmacokinetics similar to poultry. Because of favourable pharmacokinetic properties, marbofloxacin should be preferred for oral administration in Japanese quails and pheasants for treatment of infections caused by equally susceptible pathogens.

  4. Effect of chamomile extract on the welfare of laying Japanese quail

    Directory of Open Access Journals (Sweden)

    Karine Isabela Tenório

    Full Text Available ABSTRACT The objective of this study was to evaluate the effect of chamomile extract on Japanese quail on their performance, animal behavior, tonic immobility, body injuries, and surface temperature. The trial was conducted using 108 quail distributed in a completely randomized experimental design, with three treatments (0, 2.5, and 5.0 g chamomile/kg of feed, six replicates, and six birds per treatment, evaluated in six measures repeated in time (14, 28, 42, 56, 70, and 84 days of trial. The inclusion of chamomile presented a quadratic effect on sitting behavior, estimating the inclusion of 1.8 g chamomile/kg to maximize this behavior. There was a decreasing linear effect for aggressive pecking, that is, the higher the inclusion of chamomile in the diet, the lower the expression of this behavior. The inclusion of 1.8-5.0 g chamomile/kg in a Japanese quail diet reduces the behavior of aggressive pecking, in addition to keeping the birds seated longer. These results are innovative because they show in the literature for the first time that chamomile supplemented in Japanese quail diets has the capacity to modulate the behavior of the quail, leading to an improvement in the welfare of quail raised in cages.

  5. Humoral immunity of Japanese quail subjected to microwave radiation during embryogeny

    International Nuclear Information System (INIS)

    Hamrick, P.E.; McRee, D.I.; Thaxton, P.; Parkhurst, C.R.

    1977-01-01

    Fertile Japanese quail eggs were exposed to continuous wave microwave radiation at an intensity of 5 mW/cm 2 (50 W/m 2 ) and a frequency of 2450 Mhz. The absorbed power density was determined to be 4.03 W/kg. The eggs were exposed throughout the first 12 days of the normal incubation period of 17.5 days. Non-exposed control eggs were incubated in a chamber identical to the exposure chamber. After hatching, exposed and control quail were reared in the conventional laboratory manner. Weekly body weight measurements were made to compare the growth patterns of exposed and control quail. The weights of the exposed male at the ages of 4 and 5 weeks were 12 and 7%, respectively, less than the control males. These differences approached statistical significance (P<=0.05). At 5 weeks of age the quail were challenged with sheep red blood cells (SRBC) and the levels of the anti-SRBC antibodies were determined. The levels of specific anti-SRBC antibodies, determined 4 days after antigen challenges, were of the same magnitude for both the exposed and control quail. Following this assessment of humoral immunity, the quail were sacrificed and the bursa of Fabricius and spleen were removed and a comparison was made of exposed and control birds. The weights of the bursa of Fabricius and spleen were not altered significantly by the microwave exposure. (author)

  6. Caecal worm, Aulonocephalus pennula, infection in the northern bobwhite quail, Colinus virginianus

    Directory of Open Access Journals (Sweden)

    Nicholas R. Dunham

    2017-04-01

    Full Text Available Parasitic nematodes that infect quail have been understudied and long been dismissed as a problem in quail management. Within the Rolling Plains ecoregion of Texas, an area that has experienced quail population “boom and bust” cycles and ultimately a general decline, the need to determine why Northern bobwhite (Colinus virginianus populations are diminishing has increased in priority. Previously, caecal parasites have been documented to cause inactivity, weight loss, reduced growth, inflammation to the caecal mucosa, and even death. The caecal worm Aulonocephalus pennula is an intestinal nematode parasite that is commonly found within the caecum of quail, as well as many other avian species. In the Rolling Plains ecoregion, A. pennula has been documented to have as high as a 98% prevalence in bobwhite quail samples; however, the effect it has on its host is not well understood. The present study documents A. pennula causes no pathological changes within the caeca of the Northern bobwhite. However, there is concern for disruption of digestion and the possible implications of infection for wild bobwhite quail survival are discussed.

  7. The Subfossil Trunk of Chiarano (TV

    Directory of Open Access Journals (Sweden)

    Tiziana Urso

    2017-06-01

    Full Text Available This paper reports the results of the characterization of a subfossil trunk found buried in the mud of the Piavon canal, at Chiarano (TV, when dredging took place in 2008. The trunk, of imposing dimensions, lacking branches and bark, has a black, deeply cracked and strongly deteriorated outer surface with a carbonized appearance, while internally it has the typical blackish colour of the so-called drowned oak. The studies have demonstrated that it is a tree belonging to the genus Quercus, common oak or sessile oak, that may have been felled between the end of the 12 th and early 14 th century A.D.. Determination of the MWC and residual basic density indicate that the deterioration decreases from the outside inwards; the ash content is high externally and diminishes moving toward the centre. Nowadays, the Piavon is an irrigation canal, but in Venetian times it was navigable and was used for the transport of goods and timber. There were extensive woodlands of common oak and sessile oak all along the Piavon, the size and composition of which is documented in the Venetian cadastres, which also report the distances between the woodlands and the nearest water courses, proof of the importance of river transport for the timber. In particular, an 18 hectare oak woodland is recorded in the Surian cadastre (1569-70 for the villa at Chiarano. The oaks were used by the Republic of Venice mainly for the construction and maintenance of the shipping fleet. The Chiarano trunk, given its age and the area where it was found, may therefore be a trunk felled in Venetian times, perhaps destined for naval use, which was lost during its transport by floating.

  8. Trunk stabilization exercises for healthy individuals

    Directory of Open Access Journals (Sweden)

    Francisco J Vera-Garcia

    2014-01-01

    Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2014v16n2p200   The aim of this study was to analyze the trunk muscular response during different variations of some of the most popular stabilization exercises: front-bridge, back-bridge, side-bridge, and bird-dog. Surface electromyography was bilaterally re-corded from rectus abdominis, external and internal oblique and erector spinae during 25 variations of the aforementioned exercises. Compared to the conventional form of the front- and side-bridge, performing these exercises kneeling on a bench or with elbows extended reduced the muscular challenge. Conversely, performing the back-bridge with elbows extended elicited higher muscular activation than the conventional exercise. While bridge exercises with double leg support produced the highest activation levels in those muscles that counteracted gravity, single leg support while bridging increased the activation of the trunk rotators, especially internal oblique. The highest activation levels were found in three exercises: sagittal walkout in a front-bridge position, rolling from right side-bridge into front-bridge position, and side-bridge with single leg support on a BOSUTMbalance trainer. Although the exercises performed on unstable surfaces usu-ally enhanced the muscle activation, performing the exercises on the BOSUTMbalance trainer did not always increase the trunk muscle activity. Overall, this information may be useful to guide fitness instructors and clinicians when establishing stabilization exercise progressions for the trunk musculature.

  9. Variance components for body weight in Japanese quails (Coturnix japonica

    Directory of Open Access Journals (Sweden)

    RO Resende

    2005-03-01

    Full Text Available The objective of this study was to estimate the variance components for body weight in Japanese quails by Bayesian procedures. The body weight at hatch (BWH and at 7 (BW07, 14 (BW14, 21 (BW21 and 28 days of age (BW28 of 3,520 quails was recorded from August 2001 to June 2002. A multiple-trait animal model with additive genetic, maternal environment and residual effects was implemented by Gibbs sampling methodology. A single Gibbs sampling with 80,000 rounds was generated by the program MTGSAM (Multiple Trait Gibbs Sampling in Animal Model. Normal and inverted Wishart distributions were used as prior distributions for the random effects and the variance components, respectively. Variance components were estimated based on the 500 samples that were left after elimination of 30,000 rounds in the burn-in period and 100 rounds of each thinning interval. The posterior means of additive genetic variance components were 0.15; 4.18; 14.62; 27.18 and 32.68; the posterior means of maternal environment variance components were 0.23; 1.29; 2.76; 4.12 and 5.16; and the posterior means of residual variance components were 0.084; 6.43; 22.66; 31.21 and 30.85, at hatch, 7, 14, 21 and 28 days old, respectively. The posterior means of heritability were 0.33; 0.35; 0.36; 0.43 and 0.47 at hatch, 7, 14, 21 and 28 days old, respectively. These results indicate that heritability increased with age. On the other hand, after hatch there was a marked reduction in the maternal environment variance proportion of the phenotypic variance, whose estimates were 0.50; 0.11; 0.07; 0.07 and 0.08 for BWH, BW07, BW14, BW21 and BW28, respectively. The genetic correlation between weights at different ages was high, except for those estimates between BWH and weight at other ages. Changes in body weight of quails can be efficiently achieved by selection.

  10. In ovo Technology and newcastle disease resistance in Japanese Quail

    International Nuclear Information System (INIS)

    Ezzat, I.E.; Abu-Taleb, A.M.; Ali, I.E.; Shabana, M.K.

    2001-01-01

    A total number of 1600 fertile eggs from japanese quail birds were used in this study. The eggs were divided into eight groups then incubated. NDV and vite were administered to the groups of eggs in Ovo injection at day 14 from incubation. Hatchability, body weight, egg production and mortality were recorded weekly for each group. Five blood samples were collected weekly from each group to measure total serum proteins, albumin, globulin, T3, T4 and HI titre. The results of this work revealed an increase in total serum proteins, globulin, and a decrease in t3, T4 and albumin values of the in ove vaccinating groups. Also HI titre recorded higher values due to ovo vaccination alone or combined with vit. E. It was noticed that the group injected by inactive vaccine plus vit. E registered high increases in hatchability, body weight and egg production beside a decrease in mortality

  11. Gemfibrozil disrupts the metabolism of circulating lipids in bobwhite quails.

    Science.gov (United States)

    Bussière-Côté, Sophie; Omlin, Teye; de Càssia Pinheiro, Eliana; Weber, Jean-Michel

    2016-01-01

    The circulating lipids of birds play essential roles for egg production and as an energy source for flight and thermogenesis. How lipid-lowering pharmaceuticals geared to prevent heart disease in humans and that are routinely released in the environment affect their metabolism is unknown. This study assesses the impact of the popular drug gemfibrozil (GEM) on the plasma phospholipids (PL), neutral lipids (NL), and nonesterified fatty acids (NEFA) of bobwhite quails (Colinus virginianus). Results show that bird lipoproteins are rapidly altered by GEM, even at environmentally-relevant doses. After 4 days of exposure, pharmacological amounts cause an 83% increase in circulating PL levels, a major decrease in average lipoprotein size measured as a 56% drop in the NL/PL ratio, and important changes in the fatty acid composition of PL and NEFA (increases in fatty acid unsaturation). The levels of PL carrying all individual fatty acids except arachidonate are strongly stimulated. The large decrease in bird lipoprotein size may reflect the effects seen in humans: lowering of LDL that can cause atherosclerosis and stimulation of HDL that promote cholesterol disposal. Lower (environmental) doses of GEM cause a reduction of %palmitate in all the plasma lipid fractions of quails, but particularly in the core triacylglycerol of lipoproteins (NL). No changes in mRNA levels of bird peroxisome proliferator-activated receptor (PPAR) could be demonstrated. The disrupting effects of GEM on circulating lipids reported here suggest that the pervasive presence of this drug in the environment could jeopardize reproduction and migratory behaviours in wild birds. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. Bioaccessibility tests accurately estimate bioavailability of lead to quail

    Science.gov (United States)

    Beyer, W. Nelson; Basta, Nicholas T; Chaney, Rufus L.; Henry, Paula F.; Mosby, David; Rattner, Barnett A.; Scheckel, Kirk G.; Sprague, Dan; Weber, John

    2016-01-01

    Hazards of soil-borne Pb to wild birds may be more accurately quantified if the bioavailability of that Pb is known. To better understand the bioavailability of Pb to birds, we measured blood Pb concentrations in Japanese quail (Coturnix japonica) fed diets containing Pb-contaminated soils. Relative bioavailabilities were expressed by comparison with blood Pb concentrations in quail fed a Pb acetate reference diet. Diets containing soil from five Pb-contaminated Superfund sites had relative bioavailabilities from 33%-63%, with a mean of about 50%. Treatment of two of the soils with phosphorus significantly reduced the bioavailability of Pb. Bioaccessibility of Pb in the test soils was then measured in six in vitro tests and regressed on bioavailability. They were: the “Relative Bioavailability Leaching Procedure” (RBALP) at pH 1.5, the same test conducted at pH 2.5, the “Ohio State University In vitro Gastrointestinal” method (OSU IVG), the “Urban Soil Bioaccessible Lead Test”, the modified “Physiologically Based Extraction Test” and the “Waterfowl Physiologically Based Extraction Test.” All regressions had positive slopes. Based on criteria of slope and coefficient of determination, the RBALP pH 2.5 and OSU IVG tests performed very well. Speciation by X-ray absorption spectroscopy demonstrated that, on average, most of the Pb in the sampled soils was sorbed to minerals (30%), bound to organic matter (24%), or present as Pb sulfate (18%). Additional Pb was associated with P (chloropyromorphite, hydroxypyromorphite and tertiary Pb phosphate), and with Pb carbonates, leadhillite (a lead sulfate carbonate hydroxide), and Pb sulfide. The formation of chloropyromorphite reduced the bioavailability of Pb and the amendment of Pb-contaminated soils with P may be a thermodynamically favored means to sequester Pb.

  13. Complete nucleotide sequence of the Coturnix chinensis (blue-breasted quail) mitochondrial genome and a phylogenetic analysis with related species.

    Science.gov (United States)

    Nishibori, M; Tsudzuki, M; Hayashi, T; Yamamoto, Y; Yasue, H

    2002-01-01

    Coturnix chinensis (blue-breasted quail) has been classically grouped in Galliformes Phasianidae Coturnix, based on morphologic features and biochemical evidence. Since the blue-breasted quail has the smallest body size among the species of Galliformes, in addition to a short generation time and an excellent reproductive performance, it is a possible model fowl for breeding and physiological studies of the Coturnix japonica (Japanese quail) and Gallus gallus domesticus (chicken), which are classified in the same family as blue-breasted quail. However, since its phylogenetic position in the family Phasianidae has not been determined conclusively, the sequence of the entire blue-breasted quail mitochondria (mt) genome was obtained to provide genetic information for phylogenetic analysis in the present study. The blue-breasted quail mtDNA was found to be a circular DNA of 16,687 base pairs (bp) with the same genomic structure as the mtDNAs of Japanese quail and chicken, though it is smaller than Japanese quail and chicken mtDNAs by 10 bp and 88 bp, respectively. The sequence identity of all mitochondrial genes, including those for 12S and 16S ribosomal RNAs, between blue-breasted quail and Japanese quail ranged from 84.5% to 93.5%; between blue-breasted quail and chicken, sequence identity ranged from 78.0% to 89.6%. In order to obtain information on the phylogenetic position of blue-breasted quail in Galliformes Phasianidae, the 2,184 bp sequence comprising NADH dehydrogenase subunit 2 and cytochrome b genes available for eight species in Galliformes [Japanese quail, chicken, Gallus varius (green junglefowl), Bambusicola thoracica (Chinese bamboo partridge), Pavo cristatus (Indian peafowl), Perdix perdix (gray partridge), Phasianus colchicus (ring-neck pheasant), and Tympanchus phasianellus (sharp-tailed grouse)] together with that of Aythya americana (redhead) were examined using a maximum likelihood (ML) method. The ML analyses on the first/second codon positions

  14. Quail FMO3 gene cloning, tissue expression profiling, polymorphism detection and association analysis with fishy taint in eggs.

    Directory of Open Access Journals (Sweden)

    Fengtao Mo

    Full Text Available Quail eggs comprise a significant and favourable part of table eggs in certain countries. Some quail eggs, however, present fishy off-flavor which directly influences their quality. It is reported that flavin-containing monooxygenase 3 (FMO3 is associated with fish-odour trait in human and animal products. FMO3 is responsible for the degradation of trimethylamine (TMA in vivo. Loss-of-function mutations in FMO3 gene can result in defective TMA N-oxygenation, giving rise to disorder known as "fish-odour syndrome" in human, as well as the fishy off-flavor in cow milk and chicken eggs. In order to reveal the genetic factor of fishy taint in quail eggs, we cloned the cDNA sequence of quail FMO3 gene, investigated FMO3 mRNA expression level in various tissues, detected SNPs in the coding region of the gene and conducted association analysis between a mutation and the TMA content in quail egg yolks. The 1888 bp cDNA sequence of quail FMO3 gene encoding 532 amino acids was obtained and characterized. The phylogenetic analysis revealed quail FMO3 had a closer relationship with chicken FMO3. The FMO3 mRNA was highly expressed in liver and kidney of quail. Nine SNPs were detected in the coding sequence of quail FMO3 gene, including a nonsense mutation (Q319X which was significantly associated with the elevated TMA content in quail egg yolks. Genotype TT at Q319X mutation loci was sensitive to choline. With addition of choline in the feed, the quails with homozygote TT at the Q319X mutation loci laid fish-odour eggs, indicating an interaction between genotype and diet. The results indicated that Q319X mutation was associated with the fishy off-flavor in quail eggs. Identification of the unfavorable allele T of quail FMO3 gene can be applied in future quail breeding to eliminate fishy off-flavor trait in quail eggs.

  15. A survey of Japanese quail (Coturnix coturnix japonica farming in selected areas of Bangladesh

    Directory of Open Access Journals (Sweden)

    Abu Nasar Md. Aminoor Rahman

    2016-09-01

    Full Text Available Aim: To investigate the status, problems and prospects of Japanese quail (Coturnix coturnix japonica farming in selected areas of Bangladesh. Materials and Methods: The study was conducted in 14 districts of Bangladesh, viz., Dhaka, Narayanganj, Munshiganj, Mymensingh, Netrakona, Faridpur, Jessore, Khulna, Satkhira, Kushtia, Bogra, Naogaon, Comilla, and Sylhet during the period from July 2011 to June 2012. A total of 52 quail farmers were interviewed for data collection using a structured questionnaire. Focus group discussions were also carried out with unsuccessful farmers and those want to start quail farming. Workers of quail farms, quail feeds and medicine suppliers, quail eggs and meat sellers were also interviewed regarding the issue. Results: Out of 52 farms, 86.5% were operated by male, 67.3% farmers did not receive any training and 92.3% farmers had no earlier experience of quail farming although 58.0% farmers primary occupation was quail farming. Most of the farms (63.4% were mixed in type having ≤5000 birds of two or three varieties. About 80.7% farms were operated separately round the year with no other poultry and 83.0% farmers wanted to expand their farming. The average pullet weight 14.5±0.12, 11.0±0.07, 12.0±0.22, and 12.8±0.17 g; age at the first lay 46.0±0.04, 42.0±0.31, 42.0±0.09, and 45.2±0.05 days; rearing period 15.0±0.01, 12.0±0.14, 15.0±0.32, and 15.2±0.18 months; culling period 15.5±0.14, 13.0±0.06, 15.0±0.03, and 15.4±0.26 months were for layer, parent stock, hatchery, and mixed farms, respectively. Most of the layer farms had an average egg production of ≤5000/day and net profit BDT 0.75/egg. However, an average number of birds, hatchability and net profit per day-old-chick were ≤5000, 76.8% and BDT 2.75, respectively, in the hatchery. Broiler quails were sold at 30 days with mean weight of 110.8 g and net profit BDT 9.02/bird. The major constraints of quail farming were higher feed price

  16. A survey of Japanese quail (Coturnix coturnix japonica) farming in selected areas of Bangladesh.

    Science.gov (United States)

    Nasar, Abu; Rahman, Aminoor; Hoque, Nazmul; Kumar Talukder, Anup; Das, Ziban Chandra

    2016-09-01

    To investigate the status, problems and prospects of Japanese quail (Coturnix coturnix japonica) farming in selected areas of Bangladesh. The study was conducted in 14 districts of Bangladesh, viz., Dhaka, Narayanganj, Munshiganj, Mymensingh, Netrakona, Faridpur, Jessore, Khulna, Satkhira, Kushtia, Bogra, Naogaon, Comilla, and Sylhet during the period from July 2011 to June 2012. A total of 52 quail farmers were interviewed for data collection using a structured questionnaire. Focus group discussions were also carried out with unsuccessful farmers and those want to start quail farming. Workers of quail farms, quail feeds and medicine suppliers, quail eggs and meat sellers were also interviewed regarding the issue. Out of 52 farms, 86.5% were operated by male, 67.3% farmers did not receive any training and 92.3% farmers had no earlier experience of quail farming although 58.0% farmers primary occupation was quail farming. Most of the farms (63.4%) were mixed in type having ≤5000 birds of two or three varieties. About 80.7% farms were operated separately round the year with no other poultry and 83.0% farmers wanted to expand their farming. The average pullet weight 145.0±0.12, 110.0±0.07, 120.0±0.22, and 128.0±0.17 g; age at the first lay 46.0±0.04, 42.0±0.31, 42.0±0.09, and 45.2±0.05 days; rearing period 15.0±0.01, 12.0±0.14, 15.0±0.32, and 15.2±0.18 months; culling period 15.5±0.14, 13.0±0.06, 15.0±0.03, and 15.4±0.26 months were for layer, parent stock, hatchery, and mixed farms, respectively. Most of the layer farms had an average egg production of ≤5000/day and net profit BDT 0.75/egg. However, an average number of birds, hatchability and net profit per day-old-chick were ≤5000, 76.8% and BDT 2.75, respectively, in the hatchery. Broiler quails were sold at 30 days with mean weight of 110.8 g and net profit BDT 9.02/bird. The major constraints of quail farming were higher feed price, outbreak of endemic diseases, lack of proper knowledge

  17. Comparison of the characteristics in hen and quail corneas as experimental models of refractive surgery.

    Science.gov (United States)

    Gonçalves, G C; Pérez-Merino, P; Martínez-García, M C; Barcía, A; Merayo-Loves, J

    2016-07-01

    To compare the histological, morphological and the biophysical measurements between hen and quail corneas, in order to determine which of them were better suited for use as an animal model for research into corneal refractive surgery. A study was performed using the biophysical measurements of the cornea (curvature, thickness, refraction, and axial length) of 20 animals (10 hens and 10 quails). The corneas were then prepared for histological analysis under microscopy light. The analysis showed that both groups have the same number of corneal layers as the human cornea and with an evident Bowman's layer. The thickness of the hen cornea and axial length of the eye, 225.3±18.4μm and 12.8±0.25mm, respectively, were larger than that of the quail (Phen central cornea, 3.65±0.08mm, was greater than that for the quail (Ppower of each cornea was similar. The proportion of total corneal thickness of the hen stroma, 82.6%, was more similar to that of the human than was the quail stroma, 72.5%. Within the hen stroma, the density of keratocytes, 8.57±1.49 per 5,000μm(2), was about half that in the quail stroma (Phen cornea, the stromal thickness and proportional similarity of the corneal layers with human cornea, the hen maybe better than the quail as an alternative species suitable for use in studies of corneal refractive surgery. Copyright © 2016 Sociedad Española de Oftalmología. Published by Elsevier España, S.L.U. All rights reserved.

  18. Characterization of Rous sarcoma virus-related sequences in the Japanese quail.

    Science.gov (United States)

    Chambers, J A; Cywinski, A; Chen, P J; Taylor, J M

    1986-08-01

    We detected sequences related to the avian retrovirus Rous sarcoma virus within the genome of the Japanese quail, a species previously considered to be free of endogenous avian leukosis virus elements. Using low-stringency conditions of hybridization, we screened a quail genomic library for clones containing retrovirus-related information. Of five clones so selected, one, lambda Q48, contained sequence information related to the gag, pol, and env genes of Rous sarcoma virus arranged in a contiguous fashion and spanning a distance of approximately 5.8 kilobases. This organization is consistent with the presence of an endogenous retroviral element within the Japanese quail genome. Use of this element as a high-stringency probe on Southern blots of genomic digests of several quail DNA demonstrated hybridization to a series of high-molecular-weight bands. By slot hybridization to quail DNA with a cloned probe, it was deduced that there were approximately 300 copies per diploid cell. In addition, the quail element also hybridized at low stringency to the DNA of the White Leghorn chicken and at high stringency to the DNAs of several species of jungle fowl and both true and ruffed pheasants. Limited nucleotide sequencing analysis of lambda Q48 revealed homologies of 65, 52, and 46% compared with the sequence of Rous sarcoma virus strain Prague C for the endonuclease domain of pol, the pol-env junction, and the 3'-terminal region of env, respectively. Comparisons at the amino acid level were also significant, thus confirming the retrovirus relatedness of the cloned quail element.

  19. Distribution of orally administered and chronically fed sup(95m)Tc in Japanese quail tissues and eggs

    International Nuclear Information System (INIS)

    Thomas, J.M.; Cadwell, L.L.; Cataldo, D.A.; Garland, T.R.

    1986-01-01

    In the present study, male and female Japanese quail were chronically fed alfalfa grown on solutions containing TcO 4 which was mixed into a commercial turkey starter. The objective was to estimate concentration ratios and transfer coefficients from Tc incorporated into alfalfa tissue to quail eggs, edible tissues and other organs. (author)

  20. Evaluation of non-invasive trunk sprays and trunk-injected emamectic benzoate

    Science.gov (United States)

    Deborah G. McCullough; D.L. Cappaert; T.M. Poland; A.C. Anulewicz; P. Lewis; J. Molongoski

    2008-01-01

    In 2007, we continued to evaluate two neo-nicotinoid insecticides, imidacloprid and dinotefuron, applied as non-invasive trunk sprays to control emerald ash borer (EAB), Agrilus planipennis Fairmaire. Neo-nicotinoid products are widely used to protect landscape ash trees because they are relatively safe for humans and non-target species. These...

  1. Lighting programs for male and female meat quails (Coturnix coturnix) raised in equatorial region.

    Science.gov (United States)

    Aguiar, G C; Freitas, E R; Watanabe, P H; Figueiredo, C W S; Silva, L P; Nascimento, G A J; Lima, R C; Nepomuceno, R C; Sá, N L

    2017-09-01

    The aim of the present study was to evaluate the effect of lighting programs for male and female meat quails raised in an equatorial region on performance and carcass traits. A total of 1,500 sexed quails (Coturnix coturnix) was distributed in a completely randomized design in a 2 × 3 factorial arrangement, with 2 sexes (male and female) and 3 lighting programs (natural, intermittent, and continuous) with 5 replicates of 50 birds. The lighting programs were applied in the period from 7 to 49 d of age, being natural (12 h and 30 min of natural light and 11 h and 30 min of dark), intermittent (12 h and 30 min of natural light and 5 h and 30 min of artificial light, alternating lighting periods with one h and 06 min and periods of darkness with one h and 12 min), and continuous (23 h of natural + artificial light and one h of dark). Regardless of lighting program, female quails were heavier than males, and birds subjected to natural light weighed less than those exposed to continuous and intermittent lighting programs. Quails exposed to intermittent and continuous light presented higher weight gain and feed intake, and worse feed conversion ratio compared to birds under a natural light regimen. It is concluded that in an equatorial region, it is possible to use a lighting program with only natural light for raising male and female meat quails from 7 to 49 d of age. © 2017 Poultry Science Association Inc.

  2. Studies on the protein and sulfur amino acid requirements of young bobwhite quail

    Science.gov (United States)

    Serafin, J.A.

    1977-01-01

    Four experiments were conducted with purified diets to examine the influence of protein level and to estimate the sulfur amino acid (S.A.A.) requirement of young Bobwhite quail (Colinus virginianus). These studies demonstrated (I) that 26% protein was sufficient for rapid growth when the diet was supplemented with methionine; (2) that diets containing higher levels of protein (29.3% and 31.3%) failed to support satisfactory growth unless they contained supplemental methionine; and (3) that young Bobwhite quail require no more than 1.0% sulfur-containing amino acids for optimal growth and efficiency of feed utilization. A fifth experiment was conducted to examine the protein and S.A.A. requirements of young Bobwhite quail using practical rations and to compare results with those obtained with purified diets. Diets containing 24%, 26% and 28% protein were supplied with and without supplemental methionine in a five week study. Results showed significant growth responses to protein and supplemental methionine. Responses showed that Bobwhite quail require no more than 26% protein for maximum growth and efficiency of feed utilization when the S.A.A. level of the diet was approximately 1.0%. The results were in close agreement with those obtained with purified diets. These findings define more precisely than had been known the quantitative requirements of young Bobwhite quail for protein and for the S.A.A. necessary for optimal growth.

  3. Distribution and metabolism of selenite and selenomethionine in the Japanese quail.

    Science.gov (United States)

    Anan, Yasumi; Ohbo, Ai; Tani, Yuta; Hatakeyama, Yoshiko; Yawata, Ayako; Ogra, Yasumitsu

    2012-05-01

    Compared to the many studies on the physiological and toxicological effects of selenium (Se) in mammals, avian Se metabolism is still an unexplored topic. Some birds are useful as poultry for human nutrition. Moreover, birds belong to higher trophic levels in the biosphere and thus may play an important role in Se circulation in the ecosystem in the same way as mammals do. In this study, we analyzed the distribution and metabolism of Se in an experimental bird, the Japanese quail, which was fed drinking water containing sodium selenite or selenomethionine (SeMet). The highest concentration of Se was detected in the pancreas, followed by down feathers, liver, and kidneys. SeMet was more efficiently incorporated into the quail than selenite. The specific and preferable distribution of Se to the high molecular weight fraction in the serum of the quail was observed only in the SeMet-ingestion group. As in mammals, selenosugar and trimethylselenonium were the major metabolites in quail excreta. Three unknown Se metabolites were detected by HPLC-ICP-MS. Although part of the metabolic pathway of Se in the Japanese quail fed selenite and SeMet was the same as that observed in mammals, the bird also showed certain avian-specific metabolic process for Se.

  4. DETERMINATION OF OPTIMUM THREONINE REQUIREMENTS OF JAPANESE QUAIL (Coturnix coturnix japonica CHICKS REARED UNDER TROPICAL ENVIRONMENT

    Directory of Open Access Journals (Sweden)

    Isaac Samuel

    2017-12-01

    Full Text Available Threonine, like most amino acids, is traditionally noted for its role in protein synthesis. However, dietary threonine concentration required for the maximum performance of Japanese quails is yet to be determined, therefore, a study was conducted to determine the optimum threonine requirement of Japanese quail chicks in the tropical environment. A total of four hundred and fifty, two weeks old quail chicks (mixed sexes were randomly allocated to five dietary treatments (0.67, 0.81, 0.95, 1.08 and 1.22 % total threonine and replicated thrice in a completely randomized design (CRD. There were no significant differences (P>0.05 in average weight gain, average feed intake, feed conversion ratio and age at first lay of quails fed the dietary treatments. Weight of first egg laid was significantly (P0.05 similar for all treatments. There were significant differences (P0.05. It was concluded that the performance of birds were not influenced by the dietary treatments up to the highest dietary level of threonine studied (1.22%. Therefore, it is possible that the optimum dietary level of threonine may be above 1.22 %. Further studies will be necessary to establish higher doses of dietary threonine requirement of Japanese quails reared under tropical climatic environment.

  5. Effect of Transient Treatment with Propylthiouracil on Some Reproduction Traits and Live Weight of Japanese Quails

    Directory of Open Access Journals (Sweden)

    B Sogut

    Full Text Available ABSTRACT This study was conducted to investigate the effects of transient treatment with propylthiouracil (PTU on some reproduction traits and live weight of quails. The trial lasted 8 weeks. To accomplish this goal, 700 1-day-old quail chicks were used, randomly divided into 8 groups. PTU was added to feed by 0.1% and 0.5% /wt. The first 4 groups had 0.5% PTU at the age of 2-4, 4-6, 6-8 and 2-8 wk., respectively. The 5 th, 6 th and 7 th groups had 0.1% PTU at the age of 2-4, 4-6 and 6-8 wk., respectively, and the 8 th group was the control with no PTU. Quails were bled at 60 days of age. Then right and left testes were taken out and weighed. At the end of the trail, least square means of the live weight of the treatment groups were higher than the control (p<0.05. Similar results (p<0.05 were observed for testis weight, testis diameter and fertility rate. As a result, it can be said that the inclusion of PTU in quail rations positively affects the live weight and reproduction traits of quails.

  6. Determining population trends and conservation status of the common quail (Coturnix coturnix in Western Europe

    Directory of Open Access Journals (Sweden)

    Puigcerver, M.

    2012-01-01

    Full Text Available In this paper we review the conservation status and population trends of the common quail (Coturnix coturnix from 1900 to the present. Data are sometimes contradictory with regard to the status of this species as it has some features that make it difficult to produce reliable population estimates. Recent data clearly suggest, either at a local scale or at a trans–national scale, that the Atlantic common quail populations have remained stable in the last two decades, and that restocking practices with farm–reared quails (hybrids with the Japanese quail, Coturnix japonica do not affect our estimates. The complex movement patterns showed by this species require special attention. Analysis of ring recoveries can give important information, especially about the nomadic movement of quails in search of suitable habitats after the destruction of winter cereal crops due to harvesting. Thus, when developing a breeding distribution model for this species, continuously updated information on seasonal habitat and weather must be included for optimal prediction. Including fortnightly data of vegetation indices in distribution models, for example, has shown good results. Obtaining reliable predictions about changes in species distribution and movements during the breeding period could provide useful knowledge about the conservation status and population trends and would help in the design of future management measures.

  7. Assemblages of saproxylic beetles on large downed trunks of oak.

    Science.gov (United States)

    Milberg, Per; Bergman, Karl-Olof; Sancak, Kerem; Jansson, Nicklas

    2016-03-01

    Old living oaks (Quercus robur) are known as a very species-rich habitat for saproxylic beetles, but it is less clear to what extent such veteran trees differ from an even rarer feature: downed trunks of large oaks. In this study, we set out to sample this habitat, using window traps, with two aims: (1) to describe the variation of assemblages among downed trunks of different type and (2) to compare beetles on downed oaks with data from veteran standing trees. The results showed that trunk volume and sun exposure better explained assemblages as well as species numbers on downed trunks than did decay stage. Furthermore, species classified as facultative saproxylic species showed weak or no differentiation among downed trunks. Species with different feeding habits showed no apparent differentiation among downed trunks. Furthermore, species composition on dead, downed oak trunks differed sharply from that of living, veteran oaks. Wood or bark feeders were more common on veterans than downed trunks, but there was no difference for those species feeding on fungi or those feeding on insects and their remains. In conclusion, for a successful conservation of the saproxylic beetle fauna it is important to keep downed oak trunks, and particularly large ones, in forest and pastures as they constitute a saproxylic habitat that differs from that of living trees.

  8. Trunk Robot Rehabilitation Training with Active Stepping Reorganizes and Enriches Trunk Motor Cortex Representations in Spinal Transected Rats

    Science.gov (United States)

    Oza, Chintan S.

    2015-01-01

    Trunk motor control is crucial for postural stability and propulsion after low thoracic spinal cord injury (SCI) in animals and humans. Robotic rehabilitation aimed at trunk shows promise in SCI animal models and patients. However, little is known about the effect of SCI and robot rehabilitation of trunk on cortical motor representations. We previously showed reorganization of trunk motor cortex after adult SCI. Non-stepping training also exacerbated some SCI-driven plastic changes. Here we examine effects of robot rehabilitation that promotes recovery of hindlimb weight support functions on trunk motor cortex representations. Adult rats spinal transected as neonates (NTX rats) at the T9/10 level significantly improve function with our robot rehabilitation paradigm, whereas treadmill-only trained do not. We used intracortical microstimulation to map motor cortex in two NTX groups: (1) treadmill trained (control group); and (2) robot-assisted treadmill trained (improved function group). We found significant robot rehabilitation-driven changes in motor cortex: (1) caudal trunk motor areas expanded; (2) trunk coactivation at cortex sites increased; (3) richness of trunk cortex motor representations, as examined by cumulative entropy and mutual information for different trunk representations, increased; (4) trunk motor representations in the cortex moved toward more normal topography; and (5) trunk and forelimb motor representations that SCI-driven plasticity and compensations had caused to overlap were segregated. We conclude that effective robot rehabilitation training induces significant reorganization of trunk motor cortex and partially reverses some plastic changes that may be adaptive in non-stepping paraplegia after SCI. PMID:25948267

  9. Trunk robot rehabilitation training with active stepping reorganizes and enriches trunk motor cortex representations in spinal transected rats.

    Science.gov (United States)

    Oza, Chintan S; Giszter, Simon F

    2015-05-06

    Trunk motor control is crucial for postural stability and propulsion after low thoracic spinal cord injury (SCI) in animals and humans. Robotic rehabilitation aimed at trunk shows promise in SCI animal models and patients. However, little is known about the effect of SCI and robot rehabilitation of trunk on cortical motor representations. We previously showed reorganization of trunk motor cortex after adult SCI. Non-stepping training also exacerbated some SCI-driven plastic changes. Here we examine effects of robot rehabilitation that promotes recovery of hindlimb weight support functions on trunk motor cortex representations. Adult rats spinal transected as neonates (NTX rats) at the T9/10 level significantly improve function with our robot rehabilitation paradigm, whereas treadmill-only trained do not. We used intracortical microstimulation to map motor cortex in two NTX groups: (1) treadmill trained (control group); and (2) robot-assisted treadmill trained (improved function group). We found significant robot rehabilitation-driven changes in motor cortex: (1) caudal trunk motor areas expanded; (2) trunk coactivation at cortex sites increased; (3) richness of trunk cortex motor representations, as examined by cumulative entropy and mutual information for different trunk representations, increased; (4) trunk motor representations in the cortex moved toward more normal topography; and (5) trunk and forelimb motor representations that SCI-driven plasticity and compensations had caused to overlap were segregated. We conclude that effective robot rehabilitation training induces significant reorganization of trunk motor cortex and partially reverses some plastic changes that may be adaptive in non-stepping paraplegia after SCI. Copyright © 2015 the authors 0270-6474/15/357174-16$15.00/0.

  10. Effect of gamma irradiation on the hatchability and embryonic development of quail eggs

    International Nuclear Information System (INIS)

    Oroszlany, P.; Sinkovicsne Hlubik, I.

    1979-01-01

    The effect of different doses of gamma irradiation on the embryonic development of quail and hen's eggs was examined. The goals of the examinations were to determine the LD 50 and LD 100 values, to establish the effect of single and multiple irradiation on embryonic development and to get some information on the embryonation of eggs produced by quails and their progeny grown from irradiated eggs. It was shown that 200 rad dose has significant stimulation effect of the hatching results of quail eggs. The LD 50 and LD 100 values were about 800 to 850 rad and 1600 rad, respectively. Repeated irradiation on the progeny-generations proved to be unambiguously deleterious on embryonation. High doses changed the rhythm of embryonal mortality, showing a peak under the irradiation and in the first three days of incubation, and significantly enhanced the number of teratological types. (author)

  11. Effect Of Pyridoxine Injection In Japanese Quail Eggs On HATCHABILITY, Performance And Some Physiological Parameters

    International Nuclear Information System (INIS)

    ELSAYED, M.A.; WAKWAK, M.M.; MAHROSE, KH.M.

    2010-01-01

    The present study was carried out at the poultry farm found in the Nuclear Research Center, Atomic Energy Authority, Inshas, Sharkia Governorate, Egypt, during January 2009. A total number of two hundreds and seventy five quail eggs were used in an experiment of a completely randomized design to estimate hatchability percentage, chick weight at hatch, growth performance, some blood parameters and carcass traits of Japanese quails as affected by injecting their eggs with pyridoxine. Eggs were divided into 5 groups (55 eggs each); the first group (without injection) was served as control while the second group was injected in the width end of the egg with 500 μl saline. The third, fourth and fifth groups were injected in the width end of the Japanese quail eggs with 40, 80 and 120 μg pyridoxine, respectively, dissolved in 500 μl saline. Hatchability percentage, live body weight, daily body weight gain and some organ weights (liver, gizzard and heart) were studied. At the end of the experiment, blood samples were collected for analyses. It was observed that the groups of quail eggs received 120 μg pyridoxine injection recorded the highest hatchability percent. Chick weight at hatch was non-significantly affected by saline solution injection. The birds hatched from the groups of quail eggs received 120μg pyridoxine recorded the highest live body weight, especially during the 2 nd and 3 rd weeks of age. The daily body weight gain was significantly affected by pyridoxine injection only during the intervals of 1 to 2, 3 to 4 and from 1 to 6 weeks of age. Serum total protein, albumin and globulin concentrations were highly significantly elevated in the birds hatched from the groups of quail eggs received 120μg pyridoxine than other groups. Serum AST activity was highly significantly increased in the birds hatched from the groups of quail eggs received 40 μg pyridoxine than other groups while serum ALT activity and calcium concentration were non

  12. Scanning Electron Microscopic Studies of the Pecten Oculi in the Quail (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Aris F. Pourlis

    2013-01-01

    Full Text Available The main purpose of this study is to extend the microscopic investigations of the pecten oculi in the quail in order to add some information on the unresolved functional anatomy of this unique avian organ. The pecten oculi of the quail was studied by scanning electron microscopy. Eighteen- to-twenty two highly vascularised accordion-like folds were joined apically by a heavily pigmented bridge of tissue, which holds the pecten in a fanlike shape, widest at the base. The structure of the double layered limiting membrane was recorded. The presence of hyalocytes with macrophage-like appearance was illustrated. It is assumed that the pecten oculi of the quail resembles that of the chicken. Illustrated morphological features of this species may add information on the active physiological role of the pecten. But still, the functional significance of this organ is a matter of controversies.

  13. Short-term spatial memory responses in aged Japanese quail selected for divergent adrenocortical stress responsiveness.

    Science.gov (United States)

    Suhr, C L; Schmidt, J B; Treese, S T; Satterlee, D G

    2010-04-01

    Stress-induced glucocorticoids can dampen learning and spatial memory via neuronal damage to the hippocampus. Cognition losses can be transient (associated with acute stress episodes) or permanent as in aged individuals who show chronic glucocorticoid-induced accelerated brain aging and neurodegeneration (dementia). Thus, chronic versus acute stress effects on spatial memory responses of quail selected for reduced (low stress, LS) or exaggerated (high stress, HS) plasma corticosterone (B) response to brief restraint were assessed. Aged food-motivated male LS and HS quail were tested for 10 min in a feed-baited 8-arm radial arm maze (RAM) 1) at 255 d of age (quail who had experienced lifelong management stressors but who were otherwise never intentionally stressed; that is, chronically stressed birds), 2) on the next day post-acute stressor treatment (5 min of restraint), and 3) on the next day without treatment (acute stress recovery). The RAM tests used the win-shift procedure in which visited arms were not rebaited. Radial arm maze performance was measured by determination of the total number of arm choices made, the number of correct entries made into baited arms out of the first 8 choices, the time required to make a choice, and the number of pellets eaten. Line effects (P LS), and number of pellets eaten (HS RAM testing nor its interaction with line further influenced these variables. Thus, although selection for divergent plasma B responsiveness to an acute stressor was found to be associated with severe impairment of spatial memory in aged male HS compared with LS quail, the observed spatial memory impairments (HS > LS) could not be further altered by acute stressor treatment. Line differences in cognition may reflect lifelong management-induced stress episodes that periodically produce higher plasma B responses in HS than LS quail, which underlie HS quail memory deficits, or other etiologies, or both.

  14. Trunk Flexibility Improvement in Response to Powered Assisted Exercise

    Directory of Open Access Journals (Sweden)

    B.S. Bains

    2016-07-01

    Full Text Available Background study: Flexibility in human spine has always plays an important role in dexterity and seamless ambulatory activities. When optimum range is not maintained by the trunk column, due to lack of flexibility, the posture gets affected resulting in reduce trunk rotation flexibility and mobility hence loss of complete trunk rotation. Objective: The purpose of this study is to determine the effect of Shapemaster Power Assisted Exercise Equipment (SPAEE on trunk flexibility. Methodology: Twenty healthy individual ages between 40 to 60 years were randomly divided into control and exercise groups. Shapemaster exercise program performed two times per week for 5 weeks and 45 minutes per session. Before and after 10 sessions of Shapemaster exercise protocol, Seated trunk rotation test was used to measure trunk flexibility. Results: Repeated measurement ANOVA were used to analysis data between groups. The results of this study illustrated that after 10th sessions trunk flexibility significantly improved (F (1.0, 18 = 11.732, p < 0.003. Conclusion: In conclusion results were determined that SPAEE is safe and it did effectively enhance flexibility among individual healthy adults. Keyword: Shapemaster Power Assisted Exercise Equipment (SPAEE, Trunk Flexibility, Healthy individual

  15. Behavioral and cognitive evaluation of FireWorks education trunk

    Science.gov (United States)

    Linda R. Thomas; James A. Walsh; Jane Kapler Smith

    2000-01-01

    This study assessed the effectiveness of FireWorks, an educational trunk about wildland fire, in increasing student understanding, enabling students to apply classroom learning in a field setting, and improving the learning environment. Students who were in classrooms using the FireWorks educational trunk demonstrated more knowledge in both classroom and field-based...

  16. Anatomical variability of the trunk wood and root tissues of ...

    African Journals Online (AJOL)

    The aim of this study was to investigate the anatomical structure of the trunk wood and the roots of A. nitida and R. racemosa, two mangrove trees from Gabon. The anatomical differences between the trunks and the roots were used to understand their bio-remediating differences through heavy metals. It was found that the ...

  17. The Effect of Fasting Pattern on Biological Performance of Quail at Early Production Period

    OpenAIRE

    Tugiyanti, Efka

    2005-01-01

    The objective of this research was to find out the effect of fasting pattern on biological performance of quail at early production period. 50 kg commercial feed, vitamins and medicine were applied on 140 heads of seven old day quail.  Four different fasting pattern were employed as treatment, i.e. ad libitum diet (Po); every two days fasting (P1); every three days fasting (P2); every four days fasting (P3); and every five days fasting (P4).   Ad libitum amount of  corn and water were offered...

  18. Performance of Japanese quails fed diets with low-protein and isoleucine

    OpenAIRE

    Santos, Graciene Conceição dos; Garcia, Edivaldo Antônio; Vieira Filho, Javer Alves; Molino, Andréa de Britto; Pelicia, Kleber; Berto, Daniella Aparecida

    2016-01-01

    ABSTRACT. Aiming to assess isoleucine levels in low protein diets for laying Japanese quails, 648 quails of 182 days of age were distributed in experimental block design with six treatments and six replicates of 18 birds each. Treatments consisted of a basal level corresponding to 0.672% isoleucine and supplemented with isoleucine to the levels of 0.816, 0.960; 1.104; 1.248%. The experimental diets were compared to a control diet containing 20% CP. The parameters studied were: performance, eg...

  19. Mechanical trunk in pine wood for cattle

    Directory of Open Access Journals (Sweden)

    Antonio Orlando da Luz Freire Neto

    2012-12-01

    Full Text Available The timber reforestation, mainly by Eucalyptus and Pinus sp., has low power processing, strength, good natural durability and, most importantly, provide reduce pressure on native forests. The concern with native forests and the high price of some of these woods force the market to replace those species by other, more abundant and available at most competitive prices. Anything that involves the handling of animals in its various phases has a direct dependency of husbandry facilities, pastures and actions of the people involved (best practices. With the segment of the production and export of meat increasingly competitive and globalized world, the adoption of best practices and animal welfare criteria are striking and decision makers for the acceptance of Brazilian beef in the world market, especially the European market. The use of appropriate animal husbandry facilities is critical to the proper rational management ("action with knowledge" of animals and increased productivity. The trunk restraint carries important role in the implementation and conduct of good animal welfare as having desirable features strength, durability, ability to contain cattle of various sizes, as well as easy to manipulate when the animal inside. Available on the market in the form of different models and costs, is an installation manufactured in wood and iron or galvanized, and may or may not be coupled with an analytical balance or digital, still and mechanical and other systems or electronics. The concern in this installation is perceived improvement in the number of patents filed and recorded and the constant evolution of their functions, with various companies operating in this segment. However, the development and validation of containment trunks with alternative materials, reflecting mainly the reduction of the final cost are poorly studied. In this first phase of the project will be considered the construction of trunk restraint coupled with analytical balance

  20. Anomalous Posterior Intercostal Arterial Trunk Arising From the Abdominal Aorta

    Energy Technology Data Exchange (ETDEWEB)

    Jie, Bing, E-mail: jbshh@163.com; Yu, Dong, E-mail: yudong-mail@126.com; Jiang, Sen, E-mail: jasfly77@vip.163.com [Tongji University School of Medicine, Department of Radiology, Shanghai Pulmonary Hospital (China)

    2016-04-15

    A common trunk of the ipsilateral posterior intercostal artery (PIA) arising from the thoracic aorta is usually an anatomical variation. However, a common trunk of bilateral posterior intercostal arterial trunk (PIAT) arising from the abdominal aorta is rare. It is important to recognize this anatomical variation of PIA when performing interventional radiological procedures. We present a rare case of an anomalous PIAT that originated from the abdominal aorta in a patient with hemoptysis caused by tuberculosis sequelae. Bilateral 4th to 11th PIAs arose from a common trunk and the trunk arising from the posterior aspect of the abdominal aorta at the level of T12/L1 intervertebral space. The pathological right 4th and 5th PIAs and bronchial arteries were embolized. Hemoptysis has been controlled for 3 months.

  1. Pathobiology and transmission of highly and low pathogenic avian influenza viruses in European quail (Coturnix c. coturnix).

    Science.gov (United States)

    Bertran, Kateri; Dolz, Roser; Busquets, Núria; Gamino, Virginia; Vergara-Alert, Júlia; Chaves, Aida J; Ramis, Antonio; Abad, F Xavier; Höfle, Ursula; Majó, Natàlia

    2013-03-28

    European quail (Coturnix c. coturnix) may share with Japanese quail (Coturnix c. japonica) its potential as an intermediate host and reservoir of avian influenza viruses (AIV). To elucidate this question, European quail were experimentally challenged with two highly pathogenic AIV (HPAIV) (H7N1/HP and H5N1/HP) and one low pathogenic AIV (LPAIV) (H7N2/LP). Contact animals were also used to assess the viral transmission among birds. Severe neurological signs and mortality rates of 67% (H7N1/HP) and 92% (H5N1/HP) were observed. Although histopathological findings were present in both HPAIV-infected groups, H5N1/HP-quail displayed a broader viral antigen distribution and extent of microscopic lesions. Neither clinical nor pathological involvement was observed in LPAIV-infected quail. Consistent long-term viral shedding and effective transmission to naive quail was demonstrated for the three studied AIV. Drinking water arose as a possible transmission route and feathers as a potential origin of HPAIV dissemination. The present study demonstrates that European quail may play a major role in AI epidemiology, highlighting the need to further understand its putative role as an intermediate host for avian/mammalian reassortant viruses.

  2. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  3. Responses to graded phytic acid in young Japanese quail

    International Nuclear Information System (INIS)

    Fox, M.R.S.; Tao, S.H.; Fry, B.E. Jr.; Phillippy, B.Q.; Lee, Y.H.; Johnston, M.R.

    1986-01-01

    Graded levels of phytic acid (PA) were fed to day-old Japanese quail (Coturnix coturnix japonica) for 7 d to establish responses for evaluating effects of inositol tri-, tetra-, and pentaphosphates. Sodium phytate was added to supply 1.4, 2.8, 5.5, 8.4, 11.0, and 13.8 g PA/kg adequate casein-gelatin diet containing 20 mg Zn/kg. Eleven g phytic acid approximates that in diets containing defatted soy flour as the protein source. PA:Zn molar ratios were 7, 14, 27, 41, 54, and 68. The effects and graded response ranges (g PA/kg diet) were as follows: decreased body weight, 2.8-13.8; defective feathering, 1.4-5.5; decreased tibia Zn, 1.4-5.5; decreased tibia ash, 1.4-13.8; and decreased pancreas Zn, 1.4-5.5. The lowest level of PA produced marked decreases in tibia and pancreas Zn; thus the PA ranges can be extended to even lower levels. The effects of PA were reproducible between experiments and the mean values were reproducible except for tibia ash and liver Mn, which varied somewhat. There were no effects of PA on liver Zn and Mg, or on pancreas Fe and Mg; the effects on liver Fe and Cu, and tibia Fe and Mg were small and inconsistent. The responses to PA and the dose ranges provide a realistic basis for assessing the biological effects of other inositol phosphates that can be formed during food processing

  4. Neuropeptidomic analysis of the embryonic Japanese quail diencephalon

    Directory of Open Access Journals (Sweden)

    Sköld Karl

    2010-03-01

    Full Text Available Abstract Background Endogenous peptides such as neuropeptides are involved in numerous biological processes in the fully developed brain but very little is known about their role in brain development. Japanese quail is a commonly used bird model for studying sexual dimorphic brain development, especially adult male copulatory behavior in relation to manipulations of the embryonic endocrine system. This study uses a label-free liquid chromatography mass spectrometry approach to analyze the influence of age (embryonic days 12 vs 17, sex and embryonic day 3 ethinylestradiol exposure on the expression of multiple endogenous peptides in the developing diencephalon. Results We identified a total of 65 peptides whereof 38 were sufficiently present in all groups for statistical analysis. Age was the most defining variable in the data and sex had the least impact. Most identified peptides were more highly expressed in embryonic day 17. The top candidates for EE2 exposure and sex effects were neuropeptide K (downregulated by EE2 in males and females, gastrin-releasing peptide (more highly expressed in control and EE2 exposed males and gonadotropin-inhibiting hormone related protein 2 (more highly expressed in control males and displaying interaction effects between age and sex. We also report a new potential secretogranin-2 derived neuropeptide and previously unknown phosphorylations in the C-terminal flanking protachykinin 1 neuropeptide. Conclusions This study is the first larger study on endogenous peptides in the developing brain and implies a previously unknown role for a number of neuropeptides in middle to late avian embryogenesis. It demonstrates the power of label-free liquid chromatography mass spectrometry to analyze the expression of multiple endogenous peptides and the potential to detect new putative peptide candidates in a developmental model.

  5. Isolation and serological differentiation of a herpesvirus from bobwhite quail (Colinus virginianus, L. 1758).

    Science.gov (United States)

    Kaleta, E F; Marschall, H J; Glünder, G; Stiburek, B

    1980-01-01

    An infectious agent was isolated from the liver of bobwhite quails (Colinus virginianus, L. 1758). The agent was sensitive to chloroform and its multiplication was inhibited by 5-iodine-2-deoxy-uridine. It passed filters with a pore diameter of 220 nm and more but not 100 nm filters. Electron microscopic examination revealed numerous nucleocapsids with hollow capsomeres and few enveloped particles in the supernatant fluids of infected cultures. The nucleocapsids were calculated to have 162 capsomeres on their surface. Using the plaque reduction method for neutralization tests no serological cross reactions could be detected between the quail isolate and sera against Marek's disease virus, turkey herpes-virus (HV), duck enteritis HV, infectious laryngotracheitis HV, amazon parrot HV, great horned owl HV, eagle owl HV, snowy owl HV, falcon HV, pigeon HV, Lake Victoria Cormorant HV, and stork HV. The isolate from bobwhite quail did only cross-react with antiserum against crane HV. It is concluded that the isolated virus is a member of the avian herpesvirus group and it is proposed to tentatively term it herpesvirus colinum (from Colinus virginianus = bobwhite quail).

  6. Egg quality of quails fed low methionine diet supplemented with betaine

    Science.gov (United States)

    Ratriyanto, A.; Indreswari, R.; Dewanti, R.; Wahyuningsih, S.

    2018-03-01

    This experiment investigated the effect of betaine supplementation to low methionine diet on egg quality of quails. A total of 340 laying quails (Coturnix coturnix japonica) was divided into 4 dietary treatments with 5 replicates of 17 quails each. The experiment was assigned in a completely randomized design. The four dietary treatments were the low methionine diet (0.3% methionine) without betaine supplementation and the low methionine diet supplemented with 0.07, 0.14, and 0.21% betaine. The experimental diets were applied for 8 weeks and the egg quality traits were measured at the age of 16 and 20 weeks. The data were subjected to analysis of variance, and when the treatment indicated significant effect, it was continued to orthogonal polynomial test to determine the optimum level of betaine. Increasing dietary levels of betaine increased the fat content of the egg with the linear regression of y = 11.0949 + 4.1914x (R2 = 0.18). However, supplementation of betaine did not affect protein content, yolk, albumen, and eggshell percentage. It can be concluded that betaine supplementation up to 0.21% to low methionine diet only had little effect in improving the quality traits of quail eggs.

  7. Validation of the DLW method in Japanese quail at different water fluxes using laser and IRMS

    NARCIS (Netherlands)

    van Trigt, R; Kerstel, E.R.T.; Neubert, R.E.M.; Meijer, H.A.J.; Mclean, M.; Visser, G.H.

    2002-01-01

    In Japanese quail (Coturnix c. japonica; n = 9), the doubly labeled water (DLW) method (H-2, O-18) for estimation Of CO2 production (1/day) was validated. To evaluate its sensitivity to water efflux levels (r(H2Oe); g/day) and to assumptions of fractional evaporative water loss (x; dimensionless),

  8. Organizational effects of diethylstilbestrol on brain vasotocin and sexual behavior in male quail.

    Science.gov (United States)

    Viglietti-Panzica, Carla; Montoncello, Barbara; Mura, Elena; Pessatti, Marzia; Panzica, GianCarlo

    2005-04-15

    In Japanese quail, we previously described a sexual dimorphism of the parvocellular vasotocin system of the limbic region that, as the reproductive behavior, is steroid-sensitive and is organized during embryonic life by the exposure to estradiol. We verified in this study whether diethylstilbestrol, a chemical xenoestrogen, has analogous organizational effects on the vasotocin system of limbic regions and on copulatory behavior of male Japanese quail. We injected in the yolk sac of 3 day-old quail embryos diethylstilbestrol or estradiol benzoate (a treatment which suppresses male copulatory behavior in adulthood and reduces vasotocin innervation), or sesame oil (control). No further hormonal manipulations were performed after hatching. Sexual behavior was recorded in males at the age of 6 weeks. Estradiol- and diethylstilbestrol-treated males exhibited a total suppression of copulatory behavior. After behavioral tests, all males were sacrificed and brain sections processed for vasotocin immunocytochemistry. Significant decrease in the density of vasotocin immunoreactivity was detected in the medial preoptic nucleus, in the bed nucleus of stria terminalis, and in the lateral septum of diethylstilbestrol-treated males. The magnocellular vasotocin neurons were, in contrast, not affected. In conclusion, the present data demonstrate that embryonic treatment with diethylstilbestrol induces a full sex reversal of behavioral phenotype as well as a significant decrease of vasotocin expression in the preoptic-limbic region in male Japanese quail. Therefore, the parvocellular vasotocin system could represent an optimal model to investigate the effects of pollutants on neural circuits controlling reproductive functions.

  9. INFLUENCE OF TRIBULUS TERRESTRIS EXTRACT SUPPLEMENTATION ON LAYING PRODUCTIVITY AND EGGS QUALITY IN JAPANESE QUAILS

    Directory of Open Access Journals (Sweden)

    Martina Nickolova

    2011-01-01

    Full Text Available The aim of the current work was to examine the influence of Bulgarian phytoproduct VemoHerb T (dry extract of Tribulus terrestris –TT on laying productivity of Japanese quails (Coturnix coturnix japonica and their egg morphological and sensor properties. A trial was organized with 52 female and 16 male Japanese quails from the breed Faraon at the age of 44 days randomly divided in four groups – control and three experimental groups, 13 female and 4 male each. All birds were fed ad libitum the same compound feed for Japanese quails. The trial lasted 10 weeks. The experimental groups received with the drink water the tested product in following daily doses: 4mg/kg body weight (10weeks; 10mg/kg body weight (the first 5 weeks of the trial; 10mg/kg body weight (10 weeks for Ist, IInd , IIInd experimental groups respectively. The addition of TT-extract improved significantly the laying productivity. It was found significant higher values of egg weight, albumen - and yolk weight in quails from IInd and IIIrd experimental groups. There was a tendency to increase the egg shell weight and egg shell thickness in all treated groups in comparison to the control group. The usе of VemoHerb T did not aggravate the sensor properties of the quails’ eggs.

  10. Divergent selection for shape of growth curve in Japanese quail. 4. Carcase composition and thyroid hormones

    Czech Academy of Sciences Publication Activity Database

    Hyánková, L.; Novotná, Božena; Darras, V.M.

    2008-01-01

    Roč. 49, č. 2 (2008). s. 96-102 ISSN 0007-1668 R&D Projects: GA ČR GA523/99/1262 Institutional research plan: CEZ:AV0Z50390512 Keywords : Japanese quail * Growth phases * Carcase quality Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.134, year: 2008

  11. Early life stress shapes female reproductive strategy through eggshell pigmentation in Japanese quail

    Czech Academy of Sciences Publication Activity Database

    Duval, C.; Zimmer, C.; Mikšík, Ivan; Cassey, P.; Spencer, K.A.

    2014-01-01

    Roč. 208, Nov 1 (2014), s. 146-153 ISSN 0016-6480 Institutional support: RVO:67985823 Keywords : breeding conditions * early-life stress * eggshell pigmentation * Japanese quail Subject RIV: ED - Physiology Impact factor: 2.470, year: 2014

  12. Feed efficiency of diets with different energy and protein concentrations supplemented with methionine in laying quails

    Science.gov (United States)

    Ratriyanto, A.; Indreswari, R.; Nuhriawangsa, A. M. P.; Purwanti, E.

    2018-03-01

    The study was conducted to evaluate the feed efficiency of quail diets containing different concentrations of metabolizable energy (ME) and crude protein (CP) with constant ratio and supplemented with methionine. Four hundred laying quails (Coturnix coturnix japonica) were randomly assigned to four experimental diets in a 2×2 factorial arrangement. Each dietary treatment used 5 replicates of 20 quails. Two basal diets were formulated to contain 2,800 kcal kg-1 ME and 18.7% CP (High ME-CP) and 2,600 kcal kg-1 ME and 17.3% CP (Low ME-CP). Each basal diet was supplemented with 0 and 0.12% methionine. The High ME-CP diets generated lower feed consumption but higher egg mass and feed efficiency (Pprotein efficiency ratio (PHigh ME-CP supplemented with methionine resulted the highest feed efficiency followed by the Low ME-CP supplemented with methionine, while both High ME-CP and Low ME-CP without methionine supplementation resulted the lowest feed efficiency (PHigh ME-CP supplemented with 0.12% methionine provided benefit to improve the feed efficiency in laying quails.

  13. Effects of Herbal Essential Oil Mixture as a Dietary Supplement on Egg Production in Quail

    Directory of Open Access Journals (Sweden)

    Metin Çabuk

    2014-01-01

    Full Text Available One hundred and eighty 7-week-old laying quail were fed various diets over a 12-week period. The diets included a control diet (without essential oil mixture (EOM or antibiotics (ANTs, a basal diet including EOM (24 mg/kg feed, and a basal diet including an ANT (avilamycin, 10 mg/kg feed. Each treatment comprised 4 replications with 4 cages (15 quail per cage, amounting to 60 quail per treatment group. Diets (in mash form and water were provided for ad libitum consumption. EOM consisted of 6 different essential oils derived from the following herbs: oregano (Origanum sp., laurel leaf (Laurus nobilis L., sage leaf (Salvia triloba L., myrtle leaf (Myrtus communis, fennel seeds (Foeniculum vulgare, and citrus peel (Citrus sp.. In comparison with the control diet, adding supplements such as EOM and ANTs to the basal diet increased egg production in quail (P<0.001. However, egg production was similar between EOM and ANT treatment groups. Moreover, there were no differences between the treatment groups with regard to egg weight. Feed intake was not affected by EOM or ANT supplementation, whereas feed conversion ratio was significantly improved by EOM and ANT supplementation. Thus, we concluded that EOM has beneficial effects as a dietary supplement on egg production and feed conversion ratio.

  14. Evaluation of pomegranate (Punica granatum pericarp aqueous extract on Eimeria spp. from Japanese quails (Coturnix japonica

    Directory of Open Access Journals (Sweden)

    Bruno P. Berto

    2014-06-01

    Full Text Available Antibacterial, anti-inflammatory and antiparasitic properties have been associated with the extract of pomegranate (Punica granatum in several animals and conditions. The Japanese quail (Coturnix japonica, originated from North Africa, Europe and Asia, is used worldwide as an experimental animal and model for aviculture. The current study investigated the effects of the pomegranate pericarp aqueous extract on the shedding, viability and morphometry of three Eimeria spp. from Japanese quails, besides the weight gain and genotoxic activity. Although the pomegranate is recognized by multiple properties, including anti-coccidial, in the current study the results are contrary. The treated group shed greater amount of oocysts; the sporulation times and viability were similar in both groups; despite some morphometric differences, these were not expressive; weight gains were similar; and the pomegranate had insignificant effect genotoxic. Finally, these results suggest that the pomegranate pericarp extract did not influence on Eimeira spp. from Japanese quails; therefore, the pomegranate pericarp extract is not suggested in the prevention/treatment of coccidiosis in Japanese quails, or at least not using methods of preparation and administration applied in this study.

  15. Evaluation of a quail embryo model for the detection of botulinum toxin type A activity

    Science.gov (United States)

    The quail embryo was evaluated for use as a bioassay to detect biologically active botulinum toxin serotype A (BoNT/A). Day 15 of incubation embryos were injected with decreasing dosages of BoNT/A from 250 to 0.5 ng of toxin. At 1 day post-injection, embryos receiving 20 ng of BoNT or higher had m...

  16. Metabolic effects of quail eggs in diabetes-induced rats: comparison with chicken eggs

    Directory of Open Access Journals (Sweden)

    Eric Lontchi-Yimagou

    2016-10-01

    Full Text Available Background: Quail eggs as a food item have recently been introduced into the diet of some Cameroonians. These eggs are being sold in local markets, but with many unfounded health claims. One claim is that quail eggs can reduce blood glucose levels in diabetics. It was therefore necessary to evaluate the effect of consuming quail eggs on blood glucose levels, lipid profiles, and oxidative stress parameters in diabetes-induced rats. Methods: Twenty Wistar rats weighing, on average, 250 g were divided into four groups of five rats each. Group 1 consisted of rats with normal blood glucose, and the other three groups (2, 3, and 4 consisted of diabetes-induced rats achieved by intravenous injection of streptozotocin. During 16 days, rats in groups 1 and 2 received distilled water; and rats in groups 3 and 4 received quail and chicken eggs, respectively, with gastroesophageal probe at a dose of 1 mL/200 g body weight. Fasting blood glucose levels were determined in all the groups on the 1st, 7th, 14th, and 17th days after induction of diabetes. On the 17th day, the fasting rats were sacrificed, and blood and liver samples were collected for biochemical analyses. Results: In 17 days, the consumption of quail and chicken eggs had no effect on blood glucose levels of diabetic rats. Total cholesterol levels were higher in groups 3 (75.59 mg/dL and 4 (59.41 mg/dL compared to group 2 (55.67 mg/dl, although these differences were not significant (all p>0.05. Triglyceride levels were significantly higher (p <0.05 in groups 3 (106.52 mg/dL and 4 (109.65 mg/dL compared to group 2 (65.82 mg/dL. Quail eggs had no effect on oxidative stress parameters (malondialdehyde, hydroperoxides, and catalase. Conclusions: The consumption of quail eggs by diabetic rats at the tested dose had no effect on blood glucose level and oxidative stress parameters and may have a negative effect on lipid profile.

  17. Effect of organic selenium and zinc on the performance and egg quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    VC Cruz

    2011-06-01

    Full Text Available The present study aimed at evaluating the effect of the dietary inclusion of organic trace minerals selenium and zinc on the performance and internal and external egg quality of Japanese quails submitted to heat stress. Data on egg production, feed conversion (kg feed intake/kg eggs and dozen eggs, egg weight, egg specific gravity, eggshell thickness and weight, Haugh unit, yolk index, albumen index and mortality (% of 144 quails were evaluated for 112 days, divided in eight cycles of 14 days. Birds were distributed according to a randomized block experimental design into four treatments (control; 0.3ppm Se; 60ppm Zn and 0.3ppm Se + 60ppm Zn with six replicates each. There were no differences (p> 0.05 in egg production (%, egg mass (g/hen/day, feed conversion per egg mass (kg/kg, feed conversion per dozen eggs (kg/dz, average egg weight (g, egg specific gravity, eggshell thickness and weight (g, Haugh unit, yolk index, albumen index and mortality (%. However, quails fed the combination of Se and Zn presented higher (p < 0.05 feed intake (28.73 g/hen/day. Those fed only organic selenium had higher average daily egg production (30.17 eggs/day, and those fed the diet only supplemented with zinc presented higher mortality (p < 0.05. The results of the present study suggest that the supplementation of organic trace minerals in Japanese quails diets submitted to heat stress does not significantly influence quail performance and internal egg quality, whereas the supplementation of the combination of organic Zn and Se increases feed intake.

  18. Ascorbic acid and melatonin reduce heat-induced performance inhibition and oxidative stress in Japanese quails.

    Science.gov (United States)

    Sahin, N; Onderci, M; Sahin, K; Gursu, M F; Smith, M O

    2004-02-01

    1. The effects of ascorbic acid (L-ascorbic acid) and melatonin supplementation on performance, carcase characteristics, malondialdehyde (MDA) as lipid peroxidation indicator, ascorbic acid, retinol, tocopherol and mineral status in the Japanese quail (Coturnix coturnix japonica) exposed to high ambient temperature were evaluated. 2. Two hundred and forty Japanese quails (10 d old) were randomly assigned to 8 treatment groups consisting of 10 replicates of three birds each. The birds were kept in a temperature-controlled room at 22 degrees C (Thermoneutral, TN groups) or 34 degrees C (for 8 h/d; 09:00 to 17:00 h; Heat stress, HS groups). Birds in both TN and HS were fed either a basal (control) diet or the basal diet supplemented with 250 mg of L-ascorbic acid/kg of diet (Ascorbic acid group), 40 mg of melatonin/kg of diet (Melatonin group) or both (Ascorbic acid + Melatonin group). 3. Supplementing heat-stressed quails with ascorbic acid and melatonin improved performance compared with the control group. Effects generally were greatest in quails supplemented with both ascorbic acid and melatonin. 4. Although supplementation did not consistently restore the concentrations of serum ascorbic acid, retinol and tocopherol to those of TN groups, these concentrations increased significantly with supplementation. Furthermore, serum and liver MDA and serum cholesterol and glucose concentrations were lower in the supplemented groups than in the heat-stressed controls. 5. Within each environment, excretion of Ca, P, Mg, Zn, Fe and Cr were lowest in the combination group and, in all cases, highest in the HS group. Interactions between diet and temperature were detected for live weight gain, cold carcase weight, MDA, ascorbic acid, tocopherol concentrations and excretion of zinc. 6. The results of the study indicate that ascorbic acid and melatonin supplementation attenuate the decline in performance and antioxidant and mineral status caused by heat stress and such

  19. Anatomical variability of the trunk wood and root tissues of ...

    African Journals Online (AJOL)

    Any interspecies variability was found between their trunk vessels diameter. However, a significant ... are discharged in the sea, releasing like this toxic organic ...... Water. Discharge on nutrient contamination of mangrove soils and plants.

  20. A Case of an Aortic Abscess around the Elephant Trunk.

    Science.gov (United States)

    Fujii, Takeshiro; Kawasaki, Muneyasu; Katayanagi, Tomoyuki; Okuma, Shinnosuke; Masuhara, Hiroshi; Shiono, Noritsugu; Watanabe, Yoshinori

    2015-01-01

    A 52-year-old male patient with a history of total arch replacement using the elephant trunk technique for acute aortic dissection 4 years before visited our hospital with the chief complaint of persistent fever. Chest computed tomography (CT) suggested prosthetic vascular graft infection, which was treated surgically after chemotherapy. The first surgery consisted of debridement of an abscess around the vascular graft and in the aorta around the elephant trunk, and thoracic descending aorta replacement and vacuum-assisted closure (VAC) in view of the risk of bleeding from the peripheral region of the elephant trunk. One week later, omental filling was performed as the second step. This is a very rare case of aortic abscess around the elephant trunk that could successfully be managed by graft-conserving treatment.

  1. Observing of tree trunks and other cylindrical objects using GPR

    Science.gov (United States)

    Jezova, Jana; Lambot, Sebastien

    2016-04-01

    Trees are a part of our everyday life, hence it is important to prevent their collapse to protect people and urban infrastructures. It is also important to characterize tree wood properties for usages in construction. In order to investigate internal parts of tree trunks non-invasively, ground-penetrating radar (GPR), or in this case, ultra-wideband microwave radar as a general tool, appears to be a very promising technology. Nevertheless, tree trunk tomography using microwave radar is a complicated task due to the circular shape of the trunk and the very complex (heterogeneous and anisotropic) internal structures of the trunk. Microwave sensing of tree trunks is also complicated due to the electromagnetic properties of living wood, which strongly depend on water content, density and temperature of wood. The objective of this study is to describe tree trunk radar cross sections including specific features originating from the particular circumferential data acquisition geometry. In that respect, three experiments were performed: (1) numerical simulations using a finite-difference time-domain software, namely, gprMax 2D, (2) measurements on a simplified laboratory trunk model including plastic and cardboard pipes, sand and air, and (3) measurements over a real tree trunk. The analysis was further deepened by considering: (1) common zero-offset reflection imaging, (2) imaging with a planar perfect electrical conductor (PEC) at the opposite side of the trunk, and (3) imaging with a PEC arc at the opposite side of the trunk. Furthermore, the shape of the reflection curve of a cylindrical target was analytically derived based on the straight-ray propagation approximation. Subsequently, the total internal reflection (TIR) phenomenon occurring in cylindrical objects was observed and analytically described. Both the straight-ray reflection curve and TIR were well observed on the simulated and laboratory radar data. A comparison between all experiments and radar

  2. Effect of Katuk leaf (Sauropus androgynus L. Merr suplementation in the diet on reproductive function of Quail

    Directory of Open Access Journals (Sweden)

    Sri Subekti

    2008-10-01

    Full Text Available Katuk (Sauropus androgynus L Merr is known to contain carotenoids, vitamin E, vitamin C, protein, and sterol compounds. This study was aimed to determine whether phytosterol in Sauropus androgynus (SA leaf affected the reproductive system of female quails. One hundred and fifty female quails were raised from 2-27 weeks old and divided into three dietary treatment, with five replicates and 10 quails in each replicate. The treatment diets were: 1 control group: diet without katuk leaf meal; 2 diet with 9% SA ethanol extract (TEK; 3 Diet containing 9% SA meal (TDK. The TDK-fed quails laid their first eggs at 46 day of age, compared with the TEK (52 day and the control groups (53 day. The highest fertility (94.55% and hatchability (93.29% were obtained from the TDK fed quails at the age of 23 and 24 weeks, respectively. These findings indicated that the reproductive system of female quails were improved not only by phytosterol in SA leaf, but also by the β-carotene, vitamin C, α-tocopherol in SA leaf.

  3. Role Of SYNBIOTICS And Low Level GAMMA Irradiation Treatments In Improving Performance Of Japanese Quails

    International Nuclear Information System (INIS)

    ABU-TALEB, A.M.

    2009-01-01

    A total number of 800 Japanese quail eggs were obtained from a parent flock maintained the poultry research unit of the Biological Application Department, Nuclear Research Centre at Inshas, Egypt, and used in the present study. Before incubating the eggs, they were divided into two equal groups of 400 eggs each; the 1 st group was exposed to a low level of gamma irradiation at 50 rad before sitting while the 2 nd group did not exposed to gamma irradiation. After hatching of the two groups, fertility, hatchability, embryonic mortality and hatching weight were determined. Hatched quail chicks from each group (1 and 2) were divided into four identical subgroups and all fed the basal diet but with a different supplement. The diet of the 1 st subgroup was supplemented with 2.5% Lactobacilli, the 2 nd with 1.5% lactose, the 3 rd with 2.5% Lactobacilli plus 1.5% lactose, while the 4 th subgroup was fed the basal diet only and served as control. The results showed decreased embryonic mortality and increased hatchability and hatching weight due to exposing quail eggs to low level of gamma radiation as compared to non-exposed eggs. The average body weight and the relative weights of carcass, testis and oviduct, egg production, egg weight, serum total protein, albumin, globulins, RBC, WBC and Hb values were increased significantly (P th week due to adding Lactobacilli and lactose to the basal diet. Significant reduction (P<0.05) in the intestinal wall index was observed due to adding Lactobacilli and lactose to the basal diet of hatched quails. In conclusion, adding Lactobacilli and/or lactose to the basal diet of hatched Japanese quails improved performance as well as blood constituents and intestinal wall index. The magnitude of this improvement was even greater when both supplements were combined. In addition, the exposure of eggs to low level of gamma radiation (50 rad) improved hatchability and hatching weight of Japanese quail eggs, but no relationship to dietary

  4. Nutcracker syndrome associated with celiacomesentric trunk anomaly: case report

    Directory of Open Access Journals (Sweden)

    Al-Zoubi NA

    2017-12-01

    Full Text Available Nabil A Al-Zoubi,1 Ibrahim F Al-Ghalayini,1,2 Radwan Al-Okour1,2 1Department of Surgery, 2Division of Urology, Jordan University of Science and Technology, Irbid, Jordan Introduction: Nutcracker syndrome is a rare disease entity that is caused by entrapment of the left renal vein between the aorta and superior mesenteric artery, usually due to abnormal branching of the superior mesenteric artery from the aorta causing renal venous hypertension. The symptoms vary from asymptomatic hematuria to severe pelvic congestion. Celiacomesenteric trunk anomaly is a rare variation of splanchnic artery anomaly that occurs when the celiac trunk and superior mesenteric arteries have a common origin from the aorta. A disease involving the rarely encountered celiacomesenteric trunk anomaly is extremely uncommon. To our knowledge, association between nutcracker syndrome and celiacomesentric trunk anomaly has not been reported in the literature.Case presentation: A 14-year-old boy with no significant past medical history presented with a 3-year painless hematuria. CT-angiogram revealed anterior nutcracker syndrome with celiacomesenteric trunk anomaly. The patient was managed conservatively with close follow-up.Conclusion: Nutcracker syndrome associated with celiacomesenteric trunk anomaly is extremely uncommon and is a rare cause of hematuria in children. Whether this abnormal anatomy is the cause of nutcracker syndrome or just an association should be investigated. Moreover, awareness of this anatomical variation may help in planning therapeutic options and reducing the chance of surgical iatrogenic injuries. Keywords: nutcracker syndrome, celiacomesenteric trunk, hematuria in children

  5. Whole-Genome de novo Sequencing Of Quail And Grey Partridge

    DEFF Research Database (Denmark)

    Holm, Lars-Erik; Panitz, Frank; Burt, Dave

    2011-01-01

    The development in sequencing methods has made it possible to perform whole genome de novo sequencing of species without large commercial interests. Within the EU-financed QUANTOMICS project (KBBE-2A-222664), we have performed de novo sequencing of quail (Coturnix coturnix) and grey partridge...... (Perdix perdix) on a Genome Analyzer GAII (Illumina) using paired-end sequencing. The amount of generated sequences amounts to 8 to 9 Gb for each species. The analysis and assembly of the generated sequences is ongoing. Access to the whole genome sequence from these two species will enable enhanced...... comparative studies towards the chicken genome and will aid in identifying evolutionarily conserved sequences within the Galliformes. The obtained sequences from quail and partridge represent a beginning of generating the whole genome sequence for these species. The continuation of establishing the genome...

  6. Influence of the method of fluoride administration on toxicity and fluoride concentrations in Japanese quail

    Science.gov (United States)

    Fleming, W.J.; Schuler, C.A.

    1988-01-01

    Young Japanese quail (Coturnix japonica) were administered NaF for 16 d either in their diet or by esophageal intubation. Based on the total fluoride ion (Emg F-) intake over the l6-d experimental period, fluoride administered by intubation was at least six times more toxic than that fed in the diet. Dietary concentrations of 1,000 ppm F- (Emg F- for 16 d = approx. 144) produced no mortality, whereas intubated doses produced 73% or greater mortality in all groups administered 54 mg F- /kg/d or more (Emg F- for 16 d _ approx. 23 mg). GraphIc companson of the regression of log F- ppm in femurs/mg F- intake showed that fluoride levels in the femurs of quail administered fluoride by intubation were higher than in those administered fluoride in the diet.

  7. Eimeria spp. from Japanese quails (Coturnix japonica: new characteristic features and diagnostic tools

    Directory of Open Access Journals (Sweden)

    Bruno P. Berto

    2013-12-01

    Full Text Available The Japanese quail Coturnix japonica originated from North Africa, Europe and Asia, is used worldwide as an experimental animal and model for aviculture. The current paper characterizes Eimeria bateri, Eimeria tsunodai and Eimeria uzura recovered from C. japonica. Based on the fact that quails have a global distribution, as are their coccidia, the findings of this study should provide the means for diagnosis of those Eimeria spp. in other regions and continents. Eimeria bateri showed the greatest intensity of infection and shed oocysts from the fourth day after infection; in contrast, E. tsunodai and E. uzura shed oocysts from the fifth day after infection. The three species shared a high degree of similarity and were all polymorphic. Yet, the application of line regressions, histograms and ANOVA provided means for the identification of these species. Finally, the algorithm was very efficient since verified that resultant values were not superimposed.

  8. Tissue localization of DDT and PCB isomers (octa- and tetrachlorobiphenyl) in laying quails

    International Nuclear Information System (INIS)

    Brandt, I.; Hoegman, P.-G.; Larsson, Y.; Olsson, S.

    1978-01-01

    Whole-body autoradiography of DDT- 14 C, 2,2',4,5'-tetrachlorobiphenyl- 14 C and 2,2',3,3',4,4',5,6'=octachlorobiphenyl- 14 C in laying quails indicated a strong deposition of radioactivity in the yolk of the growing follicles and the egg, confirming this to be a significant excretion route of lipophilic environmental pollutants in laying birds. A specific uptake of DDT and octachlorobiphenyl, but not of tetrachlorobiphenyl, was observed in the cortical cords of the adrenals. The octachlorobiphenyl was concentrated also in the ovarian stroma. Both DDT and the tetrachlorobiphenyl were excreted in the bile juice to the small intestine. No such excretion of octachlorobiphenyl was observed, indicating its rate of metabolization to be low. All compounds were accumulated and stored in the body fat. A previously described specific accumulation of 2,2',4,5'-tetrachlorobiphenyl in the respiratory tract of mice was not observed in the quail. (author)

  9. Classification of the coefficients of variation of parameters evaluated in Japanese quail experiments

    Directory of Open Access Journals (Sweden)

    DHV Leal

    2014-06-01

    Full Text Available The objective of this study was to design a classification range of the coefficients of variation (CV of traits used in experiments with eggtype Japanese quails (Coturnix coturnix japonica. The journal Revista Brasileira de Zootecnia was systematically reviewed, using the key word 'quail' during the period of January, 2000 to 2010. The CV of feed intake (g/bird/d, egg production (%/bird/d, egg weight (g, egg mass (g/bird/d, feed conversion ratio per dozen eggs (g/dozen, feed conversion ratio per egg mass (g/g, and egg specific gravity (g/mL were collected. For each parameter, CV were classified using the following median (MD and pseudo-sigma (PS ratio as follows: low (CV MD + 2PS. According to the results, it was concluded that each parameter has a specific classification range that should be taken into account when evaluating experimental precision.

  10. Nutrient digestibility of vegetables waste flour on male quail (Coturnix coturnix japonica)

    Science.gov (United States)

    Pramono, A.; Primadhani, M. S.; Swastike, W.; Sutrisno, J.

    2018-03-01

    The aim of this research is to determine the nutrient digestibility of vegetables waste flour on of male quail. Four hundred male quails were divided into four groups with five replications. The experiment is Completely Randomized Design and the data were analyzed by analyses of variants. The experimental diets were P0 = basal diet, P1 = 97% basal diet + 3% vegetables waste flour, P2 = 94% basal diet + 6% vegetables waste flour, and P3 = 91% basal diet + 9% vegetables waste flour. The observed variables were the digestibility of dry matter, crude protein and extract ether. Result showed that of the addition of vegetable waste flour in the diet had no effect on crude protein digestibility (P>0.05), however shown significant effect on dry matter (P digestibility.

  11. Lumbopelvic flexibility modulates neuromuscular responses during trunk flexion-extension.

    Science.gov (United States)

    Sánchez-Zuriaga, Daniel; Artacho-Pérez, Carla; Biviá-Roig, Gemma

    2016-06-01

    Various stimuli such as the flexibility of lumbopelvic structures influence the neuromuscular responses of the trunk musculature, leading to different load sharing strategies and reflex muscle responses from the afferents of lumbopelvic mechanoreceptors. This link between flexibility and neuromuscular response has been poorly studied. The aim of this study was to investigate the relationship between lumbopelvic flexibility and neuromuscular responses of the erector spinae, hamstring and abdominal muscles during trunk flexion-extension. Lumbopelvic movement patterns were measured in 29 healthy women, who were separated into two groups according to their flexibility during trunk flexion-extension. The electromyographic responses of erector spinae, rectus abdominis and biceps femoris were also recorded. Subjects with greater lumbar flexibility had significantly less pelvic flexibility and vice versa. Subjects with greater pelvic flexibility had a higher rate of relaxation and lower levels of hamstring activation during maximal trunk flexion. The neuromuscular response patterns of the hamstrings seem partially modulated by pelvic flexibility. Not so with the lumbar erector spinae and lumbar flexibility, despite the assertions of some previous studies. The results of this study improve our knowledge of the relationships between trunk joint flexibility and neuromuscular responses, a relationship which may play a role in low back pain. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Functional and morphological variety in trunk muscles of Urodela.

    Science.gov (United States)

    Omura, Ayano; Anzai, Wataru; Endo, Hideki

    2014-03-01

    Trunk musculature in Urodela species varies by habitat. In this study, trunk musculature was examined in five species of adult salamanders representing three different habitats: aquatic species, Amphiuma tridactylum and Necturus maculosus; semi-aquatic species, Cynops pyrrhogaster; terrestrial species, Hynobius nigrescens and Ambystoma tigrinum. More terrestrial species have heavier dorsal and ventral trunk muscles than more aquatic forms. By contrast, the lateral hypaxial musculature was stronger in more aquatic species. The number of layers of lateral hypaxial musculature varied among Urodela species and did not clearly correlate with their habitats. The M. rectus abdominis was separated from the lateral hypaxial musculature in both terrestrial and semi-aquatic species. In aquatic species, M. rectus abdominis was not separated from lateral hypaxial musculature. Lateral hypaxial musculature differed in thickness among species and was relatively thinner in terrestrial species. In more terrestrial species, dorsal muscles may be used for stabilization and ventral flexing against gravity. Ventral muscle may be used in preventing dorsally concave curvature of the trunk by dorsal muscles and by weight. The lengthy trunk supported by limbs needs muscular forces along the ventral contour line in more terrestrial species. And, the locomotion on well-developed limbs seems to lead to a decrease of the lateral hypaxial musculature.

  13. EnviroAtlas - Durham, NC - Demo (Parent)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

  14. Effect of Long-Term Hypodynamy on Alkaline Phosphatase Activity of Small Intestine in Japanese Quail Chicks

    Directory of Open Access Journals (Sweden)

    Ľ. Lenhardt

    2007-01-01

    Full Text Available The functional development of the small intestine was investigated in Japanese quail chicks subjected to simulated microgravity (hypodynamy on the second day after hatching and reared under these conditions to 63 days of age. On days 5, 7, 14, 21, 28, 35, 42, 56 and 63 the activity of brush-border-bound alkaline phosphatase (AP in the duodenum and jejunum were determined in experimental animals as well as in control quail chicks housed in a floor box during these periods. As compared with control quails the experimental animals displayed a significantly increased enzyme activity until day 42 in the duodenum and day 35 in the jejunum (P < 0.001 whereas in older quails no significant enzymatic differences between these groups was found. However, a decrease in food consumption due to a partial physical constraint cannot be excluded. Moreover, the results suggested that the activity of AP in the control birds did not change substantially during all the periods examined. In contrast, in older hypodynamy quail the AP activity significantly decreased in the duodenum on days 56 and 63 and in the jejunum on days 42, 56 and 63, respectively. These results indicate that a the enhanced intestinal function in early periods of life may reflect the higher sensitivity of small intestine to simulated weightlessness, b the decrease of the AP activity in older animals to the level of controls might be considered as a part of intestinal mechanisms involved in adaptation of quail chicks to long-term hypodynamy, c different activity of AP in the small intestine of Japanese quail may not have resulted only from hypodynamy but also due to decreased food intake.

  15. Performance, carcass traits, meat quality and amino acid profile of different Japanese quails strains.

    Science.gov (United States)

    Nasr, Mohammed A F; Ali, El-Shimaa M R; Hussein, Mohamed A

    2017-12-01

    Poultry production is considered one of the prospective opportunities to accomplish sustainable and quick production of superior protein to challenge the growing mandate for animal protein. Therefore, this study was aimed to explore the difference on growth performance, carcass traits, meat quality and amino acid profile of different Japanese quails strains. A total of 480 quail chicks of four different plumage colors (120 of each white, golden, gray and brown) were collected after hatching. At 6 week of age, birds were stunned and decapitated to determine the physical meat quality, thiobarbituric acid reactive substances and amino acid profile. White quails had the highest weight of slaughter, carcass, dressing, carcass yield, liver, gizzard, heart and spleen (197.27 g, 169.27 g, 91%, 82%, 6.63 g, 6.53 g, 2.27 g and 0.40 g, respectively). Also, they had the highest Ph U , lightness, yellowness and water holding capacity with the lowest level of redness, cooking losses and thiobarbituric acid in pectoral (6.28, 46.40, 12,46, 22.17, 9.20, 19.21 and 0.44, respectively) and thigh muscles (6.37, 42.30, 11.51, 26.01, 10.12 and 0.93, respectively). Moreover, they possessed the highest level of all essential (11.68 and 10.16 g/100 g protein in pectoral and thigh muscles, respectively) and non essential amino acids (13.27 and 12.54 g/100 g protein in pectoral and thigh muscles, respectively). Therefore, the current study revealed that white quails had the heaviest body weight with the best carcass traits and meat quality.

  16. Nutritional requirements of digestible threonine for growing meat-type quails

    Directory of Open Access Journals (Sweden)

    Ana Paula Silva Ton

    2013-07-01

    Full Text Available The objective of this study was to estimate the nutrient requirements of digestible threonine for meat-type quails (Coturnix coturnix sp in the growth phase. A total of 1350 not sexed meat-type quails were distributed in a completely randomized design with six threonine levels (10.80, 11.50, 12.20, 12.90, 13.60 and 14.30 g/kg as fed, five replications and 45 quails per experimental unit, from 1 to 14 days of age. The threonine levels in the diet had a quadratic effect on body weight, feed intake and weight gain. Estimates for highest body weight (79.41 g, feed intake (128.96 g/bird and weight gain (70.73 g were observed with diets containing 12.60 g/kg of digestible threonine. According to the LRP model, the threonine intake was estimated at 13.40 g/kg of digestible threonine. Protein deposition rate and energy retained in the carcass showed quadratic effect, with estimated digestible threonine levels of 11.80 and 12.00 g/kg in the diet for maximum protein deposition rate (2.00 g/bird and retained energy in the carcass (15.88 kcal/g, respectively. There was a linear effect on feed cost per kg of live weight gain as threonine levels were increased. Nutritional requirement of digestible threonine for meat-type quails for maximum growth is 12.60 g/kg, corresponding to a digestible threonine:digestible lysine ratio of 67.02.

  17. The Use of Sweet Almond Meal as a Protein Source in Japanese Quails Diets

    Directory of Open Access Journals (Sweden)

    Arjomandi MA

    2015-12-01

    Full Text Available In the first experiment, the chemical composition, apparent metabolizable energy (AME, AME corrected for nitrogen (AMEn, true metabolizable energy (TME, TME corrected for nitrogen (TMEn values of the sweet almond meal were determined in adult Leghorn cockerels. The second experiment was performed to evaluate the effects of different levels of sweet almond meal at 0, 100, 200 and 300 g/kg on Japanese quail's growth performance, some blood metabolites, relative weight of different organs, meat quality and egg yolk cholesterol in a completely randomized design with 288 Japanese quails including 4 treatments, 4 replicates and 18 birds per replicate. The metabolizable energy values of sweet almond meal were following: AME = 3734, AMEn = 3648, TME = 3908, TMEn = 3746 kcal/kg as fed basis. Feed intake, feed conversion ratio and live weight gain and relative weight of different organs in the birds fed diets with different levels of the sweet almond meal were not statistically different from control. A sweet almond meal at 300 g/kg level showed the lower serum total cholesterol and low-density lipoprotein (P < 0.05 compared to control and 100 g/kg sweet almond meal. Dietary treatments had no significant effect on the total cholesterol content of quail's eggs. Malondialdehyde concentration in breast meat samples after 40 days freezing decreased, whereas the level of sweet almond meal increased (P < 0.01. In general, a sweet almond meal without any adverse effect on growth performance is a good source of energy and protein and can be used up to 300 g/kg of the Japanese quail diets.

  18. Reproductive performance of breeder quails fed diets supplemented with L-cysteine-coated iron oxide nanoparticles.

    Science.gov (United States)

    Mohammadi, H; Farzinpour, A; Vaziry, A

    2017-04-01

    The objective of this study was to investigate the effects of L-cysteine-coated iron oxide nanoparticles on reproductive performance in breeder quails. The five treatment diets consisted of (i) negative control diet not supplemented with iron, (ii) positive control diet supplemented with 60 mg/kg of Fe 3 O 4 and (iii) experimental diets supplemented with 0.6, 6 and 60 mg/kg of L-cysteine-coated iron oxide nanoparticles. A total of 100 seven-day-old quail chicks were weighed and randomly placed to five groups of five replicate cages. Four quails (one male and three females) were raised in each cage (50 × 15 × 17 cm). Egg production, feed consumption and egg weight were recorded daily and calculated on a hen per day basis. Egg components, fertility, hatchability and day-old chicks hatched from their eggs were measured at the end of the experiment. The percentage of egg production and egg mass of the 6 mg/kg Fe 3 O 4 -Cys NPs group were significantly higher than those of the control groups. Throughout the experimental period, the highest weekly egg weight was recorded for the 60 mg/kg Fe 3 O 4 -Cys NPs group. Fertility was improved by diet supplemented with iron, both FeSO 4 and Fe 3 O 4 -Cys NPs. The breeder fed Fe 3 O 4 -Cys NPs had the highest day-old chicks weight. The results of this study showed that Fe 3 O 4 nanoparticles that were coated by L-cysteine could improve availability and utilization of iron in diet. Finally, it was proposed that Fe 3 O 4 -Cys NPs could be used as feed additives in quails. © 2017 Blackwell Verlag GmbH.

  19. Influence of some probiotics on blood components, productive and reproductive performance of japanese quails

    International Nuclear Information System (INIS)

    Abu-Taleb, A.M.; Ezzat, I.E.; El-Barkouky, E.

    2006-01-01

    The current study was conducted to evaluate the effect of adding some probiotics into diets of Japanese quails on productive and reproductive performance, blood constituents, immune response and intestinal wall thickness. A total number of 500 one day old, unsexed Japanese quail chicks were used. Five experimental groups were assigned in the present study, where the 1st group (G1) was provided with protexin at 5 g/litre (5 days weekly). The 2nd group (G2) contained medi stress of 0.75 g/litre (5 days weekly), the 3rd group (G3) was fed a basal diet contained bioaction at 5g/kg, the 4th group (G4) involved a basal diet with active dried yeast (Saccharomyces cerevisiae) at 0.1 g/kg daily and group 5 were fed the basal diet without probiotics supplementation (control). The results showed that the average body weight, egg production and egg weight were significantly increased due to adding probiotics and 0.1g/kg yeast into diets. Feed conversion ratio and mortality were improved significantly and the most improvement was recorded at 1.0% yeast and protexin. Similar improvement was recorded for hatch ability and hatching weight. There were reductions in intestinal wall thickness due to adding 0.1 g/kg yeast or protexin. The values of HI titer against sheep RBCs were increased significantly as compared to the control, which may lead to an enhancement of immune response of Japanese quails. Blood protein, globulin and FSH hormone were increased significantly. In conclusion, adding some probiotics into diets of Japanese quails improved productive, reproductive performance, blood constituents, immune response and intestinal wall thickness

  20. Influence of some probiotics on blood components, productive and reproductive performance of japanese quails

    Energy Technology Data Exchange (ETDEWEB)

    Abu-Taleb, A M; Ezzat, I E; El-Barkouky, E [Biological Applications Department, Radioisotope Applications Division, Nuclear Research Centre, Cairo (Egypt)

    2006-07-01

    The current study was conducted to evaluate the effect of adding some probiotics into diets of Japanese quails on productive and reproductive performance, blood constituents, immune response and intestinal wall thickness. A total number of 500 one day old, unsexed Japanese quail chicks were used. Five experimental groups were assigned in the present study, where the 1st group (G1) was provided with protexin at 5 g/litre (5 days weekly). The 2nd group (G2) contained medi stress of 0.75 g/litre (5 days weekly), the 3rd group (G3) was fed a basal diet contained bioaction at 5g/kg, the 4th group (G4) involved a basal diet with active dried yeast (Saccharomyces cerevisiae) at 0.1 g/kg daily and group 5 were fed the basal diet without probiotics supplementation (control). The results showed that the average body weight, egg production and egg weight were significantly increased due to adding probiotics and 0.1g/kg yeast into diets. Feed conversion ratio and mortality were improved significantly and the most improvement was recorded at 1.0% yeast and protexin. Similar improvement was recorded for hatch ability and hatching weight. There were reductions in intestinal wall thickness due to adding 0.1 g/kg yeast or protexin. The values of HI titer against sheep RBCs were increased significantly as compared to the control, which may lead to an enhancement of immune response of Japanese quails. Blood protein, globulin and FSH hormone were increased significantly. In conclusion, adding some probiotics into diets of Japanese quails improved productive, reproductive performance, blood constituents, immune response and intestinal wall thickness.

  1. Shelf life of fresh air packaged and precooked vacuum packaged quails

    Directory of Open Access Journals (Sweden)

    Francesca Piras

    2013-11-01

    Full Text Available The shelf-life of 3 batches (Q1, Q2, Q3 of quail meat, were examined. Q1 were cut and seasoned with commercial olive oil, stoned green olive and sliced bacon. Q2 were divided into two subgroups: Q2.1 produced in the previously described conditions; Q2.2 seasoned also with rosemary. Quails were placed in lowdensity polystirene barrier trays and aerobically packaged. Q3 quails were boiled in salted hot water for 40 min, seasoned with myrtle leafs, placed in low density polyethylene bags and vacuum packaged. All samples were stored at +2 and +7°C. Analysis were conducted at 0, 3, 7, 9 and 14 days (T0, T3, T7, T9, and T14, respectively. For all the samples, pH measurement and microbial analysis [total viable count (TVC, Enterobacteriaceae, E. coli, Lactobacillus spp. (LAB, Pseudomonas spp., Brochothrix thermosphacta, coagulase-negative Staphylococci (CNS, Enterococcus spp., yeasts and moulds, Salmonella spp., Listeria monocytogenes] were performed. Initial TVC levels of fresh quails (ca. 4 log CFU/g were rather high and this may be due to the microbial population of the raw material. In Q1 and Q2.1 samples, TVC reached the value of 7 log, which is considered as the upper acceptability limit for fresh poultry meat (after T9 under storage at +2°C and after T7 at +7°C. In Q2.2 samples such limit was reached earlier, after T3. In Q3 samples, lower TVC levels were recorded and did not reach the above mentioned limit, not even at the end of storage. However, mean counts >5 log were reached, maybe because of a post-cooking cross-contamination. Salmonella spp. prevalence was 33% in Q1, Q2.1 and Q2.2 samples.

  2. Identification of New World Quails Susceptible to Infection with Avian Leukosis Virus Subgroup J

    Czech Academy of Sciences Publication Activity Database

    Plachý, Jiří; Reinišová, Markéta; Kučerová, Dana; Šenigl, Filip; Stepanets, Volodymyr; Hron, Tomáš; Trejbalová, Kateřina; Elleder, Daniel; Hejnar, Jiří

    2017-01-01

    Roč. 91, č. 3 (2017), č. článku e02002. ISSN 0022-538X R&D Projects: GA ČR GA13-30983S; GA MŠk LO1419 Institutional support: RVO:68378050 Keywords : ALV-J * antiretroviral resistance * Na+/H+ exchanger * New World quail * retroviral receptor Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Virology Impact factor: 4.663, year: 2016

  3. The Effects of Hyperthyroidism and Hypothyroidism Over the Egg Quality in Japanese Quails (Coturnix coturnix Japonica)

    OpenAIRE

    ÖZCAN, Mukaddes; ÇÖTELİOĞLU, Ülker

    1998-01-01

    In this study, the influence of hyperthyroidism and hypothyroidism on the egg quality in 5 week-female Japanese quails was investigated. Hyperthyroidsm and hypothyroidism were achieved by mixing 0.4 mg/100 g. levatrocsyn-sodium and % 0.2 g. propylthiouracil (PTU) in to the food during the 5 weeks period, respectively. It was found that egg weight, albumen weight, shell weight and shell thickness values in both trial groups reduced (P

  4. GC-MS ANALYSIS OF THE FATTY ACID METHYL ESTER IN JAPANESE QUAIL FAT

    Directory of Open Access Journals (Sweden)

    Ion Dragalin

    2015-12-01

    Full Text Available The accumulated as production waste fat from Faraon quail breeds has been investigated for the first time by using GC-MS technique, preventively converting it via methanolysis to fatty acid methyl esters. The test results, regarding the content of unsaturated fatty acids having a favorable to human body cis-configuration (77.8%, confirm their nutritional value and the possibility of using this fat in cosmetic, pharmaceutical and food industries.

  5. Cocaine induces state-dependent learning of sexual conditioning in male Japanese quail.

    Science.gov (United States)

    Gill, Karin E; Rice, Beth Ann; Akins, Chana K

    2015-01-01

    State dependent learning effects have been widely studied in a variety of drugs of abuse. However, they have yet to be studied in relation to sexual motivation. The current study investigated state-dependent learning effects of cocaine in male Japanese quail (Coturnix japonica) using a sexual conditioning paradigm. Cocaine-induced state-dependent learning effects were investigated using a 2×2 factorial design with training state as one factor and test state as the other factor. During a 14-day training phase, male quail were injected once daily with 10mg/kg cocaine or saline and then placed in a test chamber after 15min. In the test chamber, sexual conditioning trials consisted of presentation of a light conditioned stimulus (CS) followed by sexual reinforcement. During the state dependent test, half of the birds received a shift in drug state from training to testing (Coc→Sal or Sal→Coc) while the other half remained in the same drug state (Coc→Coc or Sal→Sal). Results showed that male quail that were trained and tested in the same state (Coc→Coc or Sal→Sal) showed greater sexual conditioning than male quail that were trained and tested in different states (Sal→Coc) except when cocaine was administered chronically prior to the test (Coc→Sal). For the latter condition, sexual conditioning persisted from cocaine training to the saline test. The findings suggest that state dependent effects may alter sexual motivation and that repeated exposure to cocaine during sexual activity may increase sexual motivation which, in turn, may lead to high risk sexual activities. An alternative explanation for the findings is also discussed. Copyright © 2014 Elsevier Inc. All rights reserved.

  6. Dopamine modulates male sexual behavior in Japanese quail in part via actions on noradrenergic receptors.

    Science.gov (United States)

    Cornil, Charlotte A; Dejace, Christel; Ball, Gregory F; Balthazart, Jacques

    2005-08-30

    In rats, dopamine (DA) facilitates male sexual behavior through its combined action on D1- and D2-like receptors, in the medial preoptic area (MPOA) as well as other brain areas. In Japanese quail, systemic injections of dopaminergic drugs suggested a similar pharmacology but central injections have never been performed. Recent electrophysiological experiments demonstrated that DA effects in the MPOA of quail are mediated mainly through the activation of alpha2-noradrenergic receptors. Previous studies of DA action on behavior used specific dopaminergic agonists/antagonists and therefore unintentionally avoided the potential cross-reaction with alpha2-receptors. The present study was thus designed to investigate directly the effects of DA on male sexual behavior and to test whether the interaction of DA with heterologous receptors affects this behavior. Intracerebroventricular (i.c.v.) injection of DA or NE inhibited copulation in a dose-dependent manner. Systemic injections of yohimbine, an alpha2-noradrenergic antagonist, modulated copulation in a bimodal manner depending on the dose injected. Interestingly, a behaviorally ineffective dose of yohimbine markedly reduced the inhibitory effects of DA when injected 15min before. Together, these results show for the first time that i.c.v. injections of DA itself inhibit male sexual behavior in quail and suggest that the interaction of DA with alpha2-receptors has behavioral significance.

  7. Neuroanatomical localization of endocrine control of reproductive behavior in the Japanese quail (Coturnix japonica)

    International Nuclear Information System (INIS)

    Watson, J.T. III.

    1989-01-01

    Steroid autoradiography and systematic and intracranial steroid treatment were undertaken to determine the neuroanatomical loci which are sufficient to activate steroid sensitive behaviors in the Japanese quail. (1) Autoradiographic localization of steroid binding cells was performed on male and female quail brains using tritiated ( 3 H) testosterone (T), estradiol (E2), or 5α-dihydrotestosterone (DHT). The distributions of labelled cells in the quail brain following 3 H-T or 3 H-E2 injection and autoradiography were similar to one another. The distribution of labelled cells following 3 H-DHT autoradiography was limited in comparison to that following 3 H-T autoradiography. Males were found to have more labelled cells than females in nucleus taeniae. (2) Intracranial implantation of minute pellets of testoterone propionate (TP) and estradiol benzoate (EB) was performed to determine neuroanatomical loci at which steroids activate sexual behavior. Both TP and EB implants in the preoptic area (POA) activated male copulatory behavior. (3) Systematic injection of aromatase inhibitor prior to and concurrent with implantation completely blocked copulatory behavior in males with TP implants in the POA but failed to block copulation in males with EB implants in the POA. (4) Intact males and castrated males given 5 dosages of systematic EB treatment were tested for sexual behavior, and blood samples from each group were assayed for E2 concentration. (5) Midbrain DHTP implants were activated crowing without significantly stimulating peripheral androgen-sensitive tissues, but the effect on crowing was not localized to any one nucleus

  8. Protective effects of Arctium lappa L. root extracts (AREs) on high fat diet induced quail atherosclerosis.

    Science.gov (United States)

    Wang, Zhi; Li, Ping; Wang, Chenjing; Jiang, Qixiao; Zhang, Lei; Cao, Yu; Zhong, Weizhen; Wang, Chunbo

    2016-01-08

    This study was designed to evaluate the protective effects of Arctium lappa L. root extracts (AREs) from different extraction methods (aqueous, ethanol, chloroform and flavone) on atherosclerosis. Quails (Coturnix coturnix) were subjected to high fat diet, with or without one of the four different AREs or positive control simvastatin. Blood samples were collected before treatment, after 4.5 weeks or ten weeks to assess lipid profile (Levels of total cholesterol (TC), Triacylglycerol (TG), low-density lipoprotein (LDL) and high-density lipoprotein (HDL)). After ten weeks, the serum levels of nitric oxide (NO) as well as antioxidant and pro-oxidative status (Levels of malondialdehyde (MDA), superoxide dismutase (SOD), catalase (CAT), glutathione (GSH), nicotinamide adenine dinucleotide phosphate (NADPH) and glutathione peroxidase (GSH-Px)) were measured. Furthermore, aortas were collected after ten weeks treatment, aorta lipid contents (TC, TG and LDL) were assessed, and histology was used to confirm atherosclerotic changes. The results indicated that high fat diet significantly deteriorated lipid profile and antioxidant status in quail serum, while all the extracts significantly reverted the changes similar to simvastatin. Aorta lipid profile assessment revealed similar results. Histology on aortas from quails treated for ten weeks confirmed atherosclerotic changes in high fat diet group, while the extracts significantly alleviated the atherosclerotic changes similar to simvastatin. Among the different extracts, flavones fraction exerted best protective effects. Our data suggest that the protective effects of AREs were medicated via hypolipidemic and anti-oxidant effects. Underlying molecular mechanisms are under investigation.

  9. Enhancement of parathion toxicity to quail by heat and cold exposure

    Science.gov (United States)

    Rattner, B.A.; Becker, J.M.; Nakatsugawa, T.

    1987-01-01

    Effects of ambient temperature on the acute oral toxicity of parathion were investigated in Japanese quail (Coturnix japonica) maintained at thermoneutral temperature (26.degree. C) or exposed to elevated (37.degree. C) or reduced (4.degree. C) temperatures commonly encountered by free-ranging wild birds. Based upon estimates of the median lethal dosage, there was up to a two-fold enhancement of parathion toxicity in birds chronically exposed to heat or cold. Twenty-four hours after administration of a low dosage (4 mg/kg body wt, po), there was markedly greater cholinesterase inhibition in surviving heat-exposed quail compared with those reared at 26.degree. C (e.g., brain acetylcholinesterase depression of 42% versus 12%). There were no differences in hepatic activities of parathion oxidase, paraoxonase, or paraoxon deethylase which could account for greater toxicity to chronically heat-exposed birds. In contrast, 4 mg parathion/kg wt elicited less plasma cholinesterase inhibition in cold-exposed quail compared to thermoneutral controls (e.g., birds is substantially influenced by environmental temperature.

  10. Effect of Increasing Yolk Testosterone Levels on Early Behaviour in Japanese Quail Hatchlings

    Directory of Open Access Journals (Sweden)

    M. Okuliarová

    2007-01-01

    Full Text Available The aim of our study was to investigate effects of increased testosterone content in egg yolk on early behaviour of 1- and 2-day-old Japanese quail. Three different doses of testosterone (0.25; 2.5 and 25 ng, not exceeding a physiological range, were examined in three separate experiments. Testosterone propionate dissolved in 20 μl olive oil was injected into the yolk before the onset of incubation. Behaviour of newly hatched chicks was recorded in response to both a novel environment in the open-field test and manual restraining in the test of tonic immobility (TI. Behavioural consequences of embryonic exposure to elevated testosterone were observed in the open-field test in all three experiments which indicated inhibition of behavioural responses in hatchlings. Birds treated with testosterone in ovo displayed longer latency to leave the start square, decreased locomotor activity, enhanced defecation and lower number of distress calls as compared to control birds. In TI test, the influence of treatment was manifested at the highest concentration only. Hatchlings from testosterone treated eggs expressed longer duration of TI and required less attempts to induce TI in comparison with the control group. Our results demonstrated increased fearfulness of Japanese quail chicks hatched from eggs with experimentally elevated testosterone content. The effect is specific for a short period after hatching since previous studies reported stimulatory effect of yolk testosterone on behaviour of Japanese quail later in ontogeny.

  11. Metabolizable energy levels for meat quails from 15 to 35 days of age

    Directory of Open Access Journals (Sweden)

    Jorge Cunha Lima Muniz

    Full Text Available ABSTRACT: This trial was carried out to evaluate the effects of dietetic metabolizable energy levels on performance and carcass traits of meat quails from 15 to 35 days old. Five hundred sixty, 15-d old, meat quails were randomly assigned to five treatments (2.850; 2.950; 3.050; 3.150 e 3.250kcal of ME kg-1 of diet, with eight replicates and fourteen birds per experimental unit. Feed intake, protein and lysine intake and feed conversion decreased linearly as the metabolizable energy content of diets increased (P0.05 by the treatments. Diets did not influence (P>0.05 carcass traits as dry matter, moisture and protein content in carcass. However a quadratic effect (P<0.04 were observed on carcass fat content. Based on these results, the adequate metabolizable energy level to ensure better meat quails' growth is 3.250kcal of ME kg-1 diet, that corresponds to a metabolizable energy: crude protein ratio of 139,24.

  12. Effects of exposure to clothianidin on the reproductive system of male quails.

    Science.gov (United States)

    Tokumoto, Junko; Danjo, Megumi; Kobayashi, Yoshihiro; Kinoshita, Kyoko; Omotehara, Takuya; Tatsumi, Atsutoshi; Hashiguchi, Mineo; Sekijima, Tsuneo; Kamisoyama, Hiroshi; Yokoyama, Toshifumi; Kitagawa, Hiroshi; Hoshi, Nobuhiko

    2013-01-01

    Clothianidin (CTD) is a neonicotinoid developed in the 1990s as an insecticide having selective toxicity, but it was later found to cause reproductive abnormalities in rats through oxidative stress. There is an attempt to preserve endangered animals, including the Japanese crested ibis, in Japan. However, there is a concern that neonicotinoid affects the reproduction of this bird, since it is used in its habitat. CTD toxicity in the birds is poorly understood, so we investigated whether or not the daily oral administration of CTD has any deleterious effects on the reproductive functions of mature male quails as experimental animals. The animals were randomly divided into four groups of 6 or 7 quails each, treated orally with 0, 0.02, 1 or 50 mg CTD/kg body weight (Control, CTD0.02, CTD1 and CTD50). After that the males bred with untreated females to estimate the egg weights, and rates of fertilization and normal development, the testes, liver and spleen were examined histologically. Vacuolization and the number of germ cells having fragmented DNA in seminiferous tubules, and the number and size of vacuoles in hepatocytes increased dose-dependently. There were no significant differences in egg weights and fertilization rates between the groups, but some eggs of the CTD1 and CTD50 groups failed to develop, and embryonic length decreased dose-dependently. Thus, it was found that CTD affected the reproduction of the male quail through the fragmentation of germ cells and the inhibition or delay of embryonic development.

  13. USE OF SACCHROMYCES CERVISIAE TO SUPPRESS THE EFFECTS OF FUMONISIN MYCOTOXICOSIS IN JAPANESE QUAIL

    International Nuclear Information System (INIS)

    ABU TALEB, A.M.

    2008-01-01

    In this study, 400 unsexed Japanese quail chicks (1 day old) were used. The quail chicks were randomly assigned into four groups of 100 birds in each. The first group was served as control. The other experimental groups were fed on a basal diet supplemented with 0.5% yeast/kg diet (G2), 0.5% yeast/kg diet ± 200 mg fumonicin-B1/kg diet (G3) and 200 mg fumonicin-B1/kg diet (G4). The results showed significant increases in mortality rate, GPT (ALT), GOT (AST), cholesterol, uric acid, creatinine and alpha-fetoprotein (AFP) and decreases in body weight, hatchability, fertility and hatching weight, serum total proteins, globulin and glutathione peroxidase (GPx) activity in group of quails received fumonisin (G4) in comparison with the control group (G1) and all treatments. Yeast led to partial improvement in the parameters in group two (G2). Also, yeast suppressed the toxic effect of fumonisin B-1 (G3)

  14. USE OF SACCHROMYCES CERVISIAE TO SUPPRESS THE EFFECTS OF FUMONISIN MYCOTOXICOSIS IN JAPANESE QUAIL

    Energy Technology Data Exchange (ETDEWEB)

    ABU TALEB, A M [Biological Applications Dept., Radioisotope Applications Division, Nuclear Research Center, Abou-Zaable, Inshas (Egypt)

    2008-07-01

    In this study, 400 unsexed Japanese quail chicks (1 day old) were used. The quail chicks were randomly assigned into four groups of 100 birds in each. The first group was served as control. The other experimental groups were fed on a basal diet supplemented with 0.5% yeast/kg diet (G2), 0.5% yeast/kg diet {+-} 200 mg fumonicin-B1/kg diet (G3) and 200 mg fumonicin-B1/kg diet (G4). The results showed significant increases in mortality rate, GPT (ALT), GOT (AST), cholesterol, uric acid, creatinine and alpha-fetoprotein (AFP) and decreases in body weight, hatchability, fertility and hatching weight, serum total proteins, globulin and glutathione peroxidase (GPx) activity in group of quails received fumonisin (G4) in comparison with the control group (G1) and all treatments. Yeast led to partial improvement in the parameters in group two (G2). Also, yeast suppressed the toxic effect of fumonisin B-1 (G3)

  15. Egg shell quality in Japanese quail: characteristics, heritabilities and genetic and phenotypic relationships.

    Science.gov (United States)

    Narinc, D; Aygun, A; Karaman, E; Aksoy, T

    2015-07-01

    The objective of the present study was to estimate heritabilities as well as genetic and phenotypic correlations for egg weight, specific gravity, shape index, shell ratio, egg shell strength, egg length, egg width and shell weight in Japanese quail eggs. External egg quality traits were measured on 5864 eggs of 934 female quails from a dam line selected for two generations. Within the Bayesian framework, using Gibbs Sampling algorithm, a multivariate animal model was applied to estimate heritabilities and genetic correlations for external egg quality traits. The heritability estimates for external egg quality traits were moderate to high and ranged from 0.29 to 0.81. The heritability estimates for egg and shell weight of 0.81 and 0.76 were fairly high. The genetic and phenotypic correlations between egg shell strength with specific gravity, shell ratio and shell weight ranging from 0.55 to 0.79 were relatively high. It can be concluded that it is possible to determine egg shell quality using the egg specific gravity values utilizing its high heritability and fairly high positive correlation with most of the egg shell quality traits. As a result, egg specific gravity may be the choice of selection criterion rather than other external egg traits for genetic improvement of egg shell quality in Japanese quails.

  16. Sex Determination of Japanese Quails (Coturnix Coturnix Japonica using with Zoometric Measurements

    Directory of Open Access Journals (Sweden)

    Tülin Çiçek Rathert

    2017-09-01

    Full Text Available The difficulty of sex determination in most poultry species causes significant financial losses for poultry production as birds cannot be separated at early stages of growth for meat or egg production. Therefore it is important to determine bird’s sex with zoometric parameters. This study was carried out to determine the sex of Japanese quails with zoometric measurements, such as live weight, body length, chest depth and chest width. Eighty-eight male and female Japanese quail chicks were used individually for live weight, chest depth (mm, chest width (mm and body length (mm with using digital scaled balance and caliper for every week over a period of six weeks. The weekly collected data were applied to t test for estimating the sex discrimination. The Pearson’s correlation was applied for examining the interrelationship between sex and biometric traits. The results indicated that there was a significant positive correlation between live weight and body length beginning with the 2nd week. Therefore, zoometric measurement of these body traits is suitable for discriminating the sex of Japanese quails in early phase of life.

  17. Performance of Japanese quails fed diets with low-protein and isoleucine

    Directory of Open Access Journals (Sweden)

    Graciene Conceição Santos

    2016-05-01

    Full Text Available Aiming to assess isoleucine levels in low protein diets for laying Japanese quails, 648 quails of 182 days of age were distributed in experimental block design with six treatments and six replicates of 18 birds each. Treatments consisted of a basal level corresponding to 0.672% isoleucine and supplemented with isoleucine to the levels of 0.816, 0.960; 1.104; 1.248%. The experimental diets were compared to a control diet containing 20% CP. The parameters studied were: performance, egg quality, total solids and nitrogen in the excreta. There was a linear increase only for isoleucine intake with increasing levels of isoleucine in the diets. The comparison of mean values of each combination of isoleucine levels for diets with 16% CP with the control with 20% CP showed that the intake of CP and isoleucine, egg weight, nitrogen excretion and yolk color were significantly affected. For Japanese quail fed diets with 16% CP, with isoleucine level at 0.672%, meets the requirements for obtaining satisfactory performance and egg quality and promoted a reduction in nitrogen excretion.

  18. Vitamin K supplementation for meat quail in growth of 1 to 14 days old

    Directory of Open Access Journals (Sweden)

    Caroline Espejo Stanquevis

    2015-12-01

    Full Text Available The experiment was carried outto determine the levels of vitamin K for meat quails (Coturnixcoturnixsp from 1 to 14 days of age. Atotal of 2200 birds were used, complete by random experimental design, with 8 treatments, 5 repetitions and 55 meat quails per experimental unit. The levels of vitamin K supplementation were 0; 0.7; 1.0; 1.3; 1.6; 1.9; 2.2; 2.5 mg/kg diets. The performance was measured through weighing weekly from the birds and feed, and at the end of the experiment was carried out collects blood and bones for the assessment of bone quality parameters. The levels of vitamin K supplementation had no influence on performance orbone quality, except thatthe bone density and calcium concentration of the femur and the bone density of the tibia showeda quadratic effect, with estimates of 0.98; 0.92 and 1.18 respectively. The length of the tibia showed a linear increase according to the levels of vitamin K. There was no effect in the concentration of serum calcium, but there was a quadratic effect in the concentration of alkaline phosphatase. The vitamin K supplementation did not affect the performance of the meat quails from 1 to 14 days of age, showing that the amount of vitamin K present in ground corn and soybean meal-based diets is sufficient to meet the needs of the birds’ performance.

  19. Uses of irradiation or sodium tripolyphosphate for shelf-life extension of quail carcasses

    International Nuclear Information System (INIS)

    Rady, A.H.; Khalaf, H.H.; Afifi, E.A.; Nasr, E.H.

    2002-01-01

    this investigation aims to study the possibility of using gamma iraadiation or sodium tripolyphoshate (STPP) for increasing shelf-life of quail carcasses during cold storage. The quail carcasses were gamma irradiated at 4, 6 and 8 kGy or soaked in 3% STPP. The effect of these treatments on the organoleptic, microbiological aspects and chemical properties of samples under investigation were evaluated during cold storage (4± 1C degree). The results indicated that, the chemical compositions of samples did not alter by gamma irradiation or soaking in STPP. Futhermore, treatment had no deterious effects on the organoleptic properties of quail samples. Meanwhile, irradiation of samples at doses of 4, 6 and 8 kGy or soaking in STPP greatly reduced its microbial count and prolonged the shelf-life for 15,21,24 and 9 days at 4 ± 1 Cdegree in comparison with 6 days for control samples. Moreover, the acid value (A.V), peroxide value (P.V) and thiobarbituric acid (TBA) value were increased after irradiation, while total volatile basic nitrogen (TVBN) content had no real change by this treatment. On the other hand, soakking in STPP treatment decreased these values and gradual increases were observed during cold storage

  20. Dietary cadmium and enteropathy in the Japanese quail: histochemical and ultrastructural studies

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, M.E.; Fox, M.R.S.

    1974-01-01

    Cadmium was fed to young Japanese quail, at a level of 75 mg. per kg. of diet, from hatching to 4 weeks of age. Cadmium produced gross, microscopic, and ultrastructural lesions in the proximal small intestine of these quail, similar to those occurring in human malabsorption syndromes, celiac disease, nontropical sprue, and tropical sprue. The small intestines of the quail were dilated and thin walled. Villi were short and thick and had a dense cellular infiltrate in the lamina propria. The striated border was thin but stained for neutral mucopolysaccharides, as did the normal border. Some villi were covered with stratified epithelial cells. Hypertrophy and hyperplasia of goblet were seen, but the mucin stained for weakly acidic mucopolysaccharides, as did the normal cells. At the ultrastructural level, microvilli of both absorptive and goblet cells were markedly shortened, particularly near the tips of the villi. Absorptive cells were atrophic, and there was s diminution of the usual cellular organelles. Granular cisternae were long and tortuous, mitochondria were dense and small, and large lysosome-like bodies and large lipid droplets accumulated in the cytoplasm, but there was a decrease in the normal small, pale and dark lipid droplets. The cellular infiltrate of the lamina propria included groups of plasma cells with dilated cisternae. There were large, irregular, electron-dense bodies in the endothelium of large veins and degeneration of some nerve plexuses in the muscularis propria. 31 references, 21 figures.

  1. Improving the microbial safety and quality of quail carcasses by gamma irradiation

    International Nuclear Information System (INIS)

    Rady, A.H.; Khalaf, H.H.; Afifi, E.A.; Nasr, E.H.

    2002-01-01

    This investigation aims to study the possibility of using gamma irradiation for improving the microbial safety quality of quail carcasses. One hundred quail carcasses were examined for the presence of salmonella. The examination illustrated that 70 carcasses from all examined carcasses were positive for salmonella. therefore, the contaminated quail carcasses were gamma irradiated at 2, 4 and 6 kGy doses and the effects of these treatments on the microbiological aspects and chemical properties of samples under investigation were evaluated. The results indicated that, the chemical composition of samples did not alter by gamma irradiation treatment. Furthermore, irradiation of samples at doses of 2, 4 and kGy greatly reduced its microbial count. Moreover, irradiation doses of 2 and 4 kGy completely destroyed salmonella and enterococcus faecalis, respectively. In addition, the acid value, peroxide value and thiobarbituric acid value were increased after irradiation. On the other hand, irradiation treatment had no real effects on the total volatile basic nitrogen content and amino acid composition of samples under investigation

  2. Ovarian radiographic and direct measurements of Japanese Quail ( Coturnix coturnix japonica submitted to light restriction

    Directory of Open Access Journals (Sweden)

    M. Albuquerque

    Full Text Available ABSTRACT Often, in pet birds, any stimulus to lay eggs is unwanted in order to reduce reproductive diseases and disorders. The objectives of this study were: to determine the time necessary to promote ovary involution after an eight hour photoperiod using laying Japanese quails (Coturnix coturnix japonica; to connect the ovarian radiographic measurements with egg production; and to compare these measurements with direct ovary data obtained at necropsy. Birds were separated into three groups: 12h/24d (control group - 12h photoperiod for 24 days, 8h/24d and 8h/36d (8h photoperiod for 24 and 36 days. After euthanasia, all cadavers were x-rayed to measure ovary length and height. Birds were necropsied to measure ovarian length and weight. Results: radiographic ovary length demonstrated strong and positive correlation (r=0.96 with direct ovary length of all three groups; laying quails showed higher ovary height (p=0.025 and length (p=0.009 than non-laying quails; eight hours of artificial light per day promotes ovary length (p=0.025 and weight (p=0.009 reduction. Conclusions: radiography can estimate the ovary measure and indicate posture; an eight hour photoperiod of 24 days is not enough to promote ovarian regression, while the use of reduced photoperiod for 36 days promotes significant ovary involution.

  3. Studi Perencanaan Migrasi Sistem Digital Oleh Penyelenggara Radio Trunking di Indonesia

    Directory of Open Access Journals (Sweden)

    Awangga Febian Surya Admaja

    2013-06-01

    Full Text Available Sistem Radio Trunking merupakan sistem radio yang berbasis repeater untuk satu atau lebih menara dengan menggunakan lebih dari satu frekuensi, dimana pengguna secara semi-privat dapat memiliki kanal tersendiri untuk melakukan pembicaraan secara grup. Di Indonesia, alokasi pada pita frekuensi radio trunking analog direncanakan akan digunakan untuk trunking digital, dimana aplikasi sistem radio trunking  yang baru harus menggunakan teknologi trunking digital dan sistem analog yang ada disyaratkan untuk beralih ke teknologi digital. Studi ini bertujuan untuk melihat seberapa besar kesiapan dari penyelenggara radio trunking di Indonesia dalam melakukan migrasi radio trunking digital. Studi ini menggunakan pendekatan kualitatif melalui wawancara mendalam dan didukung dengan data kuantitatif untuk menunjukkan nilai indeks kesiapan dari penyelenggara radio trunking. Studi ini menghasilkan nilai indeks kesiapan dari sampel penyelenggara radio trunking dengan skema perencanaan migrasi sesuai dengan nilai indeks kesiapan.

  4. Removal of oil palm trunk lignin in ammonium hydroxide pretreatment

    Science.gov (United States)

    Az-Zahraa, Balqis; Zakaria, Sarani; Daud, Muhammad F. B.; Jaafar, Sharifah Nabihah Syed

    2018-04-01

    Alkaline pretreatment using ammonium hydroxide, NH4OH serves as one of a process to remove lignin from lignocellulosic biomass such as oil palm trunk fiber. In this study, the effect of NH4OH pretreatment on removal of oil palm trunk lignin was investigated. The oil palm trunk fiber was dissolved in NH4OH with different concentrations (6, 8 and 10 %), different duration (3, 5 and 7 h) and temperatures (60, 80 and 100 °C). The samples were analyzed by using UV-Vis to estimate the concentration of extracted lignin. The result indicates that the optimum conditions to gain maximum extracted lignin were 8% NH4OH, 100 °C and 5 h with concentration of 64 mgL-1 while the lowest was at 6% NH4OH, 100 °C and 5 h with concentration of 62.5 mgL-1.

  5. The influence of a probiotic supplementation on memory in quail suggests a role of gut microbiota on cognitive abilities in birds.

    Science.gov (United States)

    Parois, Severine; Calandreau, Ludovic; Kraimi, Narjis; Gabriel, Irène; Leterrier, Christine

    2017-07-28

    The gut microbiota is involved in host behaviour and memory in mammals. Consequently, it may also influence emotional behaviour and memory in birds. Quail from two genetic lines with different fearfulness (LTI: long tonic immobility, n=37; STI: short tonic immobility, n=32) were either or not supplemented with a probiotic (Pediococcus acidilactici) from hatching. Emotional reactivity was measured in a tonic immobility test (d6 and 7 of age) and two open-field tests (d13-15; d22-24). Memory was measured in a test rewarded with mealworms, where quail had to remember the cups previously visited (d34-36). Quail endured a 5-days stress period from days 17 to 21 to help revealing the potentially beneficial effect of the probiotic. As expected, STI quail were less fearful compared to the LTI quail (p0.05), except in the tonic immobility test where supplemented STI quail had lower immobility duration (p=0.0001). Regarding the memory test, the two lines had similar performances. Quail fed with probiotics made fewer errors (p=0.040). There was no significant correlation between traits of emotional reactivity and of memory. In conclusion, the supplementation with Pediococcus acidilactici as a probiotic, affected a specific trait of emotional reactivity in STI quail, and improved memory in both lines, whichstrengthens the idea that the influence of gut microbiota on the host behaviour and memory seen in mammals is shared by birds. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Chondroid lipoma of the trunk: MRI appearance and pathologic correlation

    Energy Technology Data Exchange (ETDEWEB)

    Boets, An; Mieghem, Isabelle M.Van; Breuseghem, Iwan Van [Catholic University Leuven Radiology, University Hospitals, Leuven (Belgium); Sciot, Raf [Catholic University Leuven, Pathology, University Hospitals, Leuven (Belgium)

    2004-11-01

    Chondroid lipoma is a rare tumour of adipose tissue, bearing a strikingly close pathologic resemblance to myxoid liposarcoma and extraskeletal myxoid chondrosarcoma. Unlike these malignant tumours, chondroid lipoma has a non-aggressive behaviour and does not require radical treatment. Although repeatedly reported in the proximal extremities and limb girdles, this rare entity may less frequently be observed in the trunk. We describe the imaging findings of a chondroid lipoma in the trunk and provide a discussion on the radiologic-pathologic correlation and differential diagnosis. (orig.)

  7. Duplicated facial nerve trunk with a first branchial cleft cyst.

    Science.gov (United States)

    Hinson, Drew; Poteet, Perry; Bower, Charles

    2014-03-01

    First branchial cleft anomalies are rare and their various anatomical relationships to the facial nerve have been described. We encountered a 15-year-old female with a type II first branchial cleft cyst presenting as a right neck mass that we found during surgical excision to transverse two main facial nerve trunks. To our knowledge, this is the first reported case of a first branchial cleft anomaly in conjunction with a duplicated facial nerve trunk. © 2013 The American Laryngological, Rhinological and Otological Society, Inc.

  8. The positive expression of genotype VII Newcastle disease virus (Malaysian isolate in Japanese quails (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Lizma Felisha Mazlan

    2017-05-01

    Full Text Available Aim: Genotype VII Newcastle disease virus (NDV is the most predominant NDV strains that circulating in Malaysia; thus, this study was aimed to determine the susceptibility of Japanese quails toward genotype VII NDV. Clinical signs, gross pathological lesions of organs, positive detection of virus in organs and cloacal swabs, as well as the expression of the antibody titer, were used as parameters to assess the susceptibility of Japanese quails following infection of genotype VII NDV. Materials and Methods: About 20 quails were divided into three groups (n=8 for Groups A and B; n=4 for the control group. The quails in the Groups A and B were infected via intraocular route with 0.03 ml of 103.5 ELD50 and 107.0 ELD50 of NDV strain IBS 002, respectively, while the control group received 1x phosphate-buffered saline. Cloacal swabs and necropsy were taken on day 7 post-infection for all quails were subjected to one-step reverse transcription real-time quantitative polymerase chain reaction (RT-qPCR for detection of virus and examination for gross pathological lesion, respectively. Blood serums of infected quails were taken on day 10, 14, and 21 post-day infections and were subjected for hemagglutination inhibition (HI assay. Results: Depression and ruffled feathers, trachea rales, leg paralysis, and torticollis were shown in some of the quails in both infected groups. Based on statistical analysis, there was no significant difference (p>0.05 in clinical signs between the infected groups. The results for RT-qPCR were found to be negative for all groups, and no gross pathological lesions of organs observed for quails in both infected groups. Trachea, proventriculus, and cecal tonsil were taken for the detection of NDV by RT-qPCR, and some of the organ samples showed positive detection of virus in both infected groups. HI assay showed an increase in mean titers of antibody across time and between infected groups. Conclusion: In summary, Japanese quails

  9. Value added by Spirulina platensis in two different diets on growth performance, gut microbiota, and meat quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    Mohamed S. Yusuf

    2016-11-01

    Full Text Available Aim: The growth promoting effect of the blue-green filamentous alga Spirulina platensis (SP was observed on meat type Japanese quail with antibiotic growth promoter alternative and immune enhancing power. Materials and Methods: This study was conducted on 180 Japanese quail chicks for 4 weeks to find out the effect of diet type (vegetarian protein diet [VPD] and fish meal protein diet [FMPD]- Spirulina dose interaction (1 or 2 g/kg diet on growth perfor-mance, gut microbiota, and sensory meat quality of growing Japanese quails (1-5 weeks old. Results: Data revealed improvement (p<0.05 of weight gain, feed conversion ratio and European efficiency index due to 1, 2 g (SP/kg VPD, and 2 g (SP/kg FMPD, respectively. There was a significant decrease of ileum mean pH value by 1 g (SP/kg VPD. Concerning gut microbiota, there was a trend toward an increase in Lactobacilli count in both 1; 2 g (SP/kg VPD and 2 g (SP/kg FMPD. It was concluded that 1 or 2 g (SP/kg vegetarian diet may enhance parameters of performance without obvious effect on both meat quality and gut microbiota. Moreover, 1 and/or 2 g (SP may not be invited to share fish meal based diet for growing Japanese quails. Conclusion: Using of SP will support the profitable production of Japanese quails fed vegetable protein diet.

  10. Utilization of Katuk (Sauropus androgynus L Merr meal and extract as ration substitution to produce low chollesterol Japanese Quail product

    Directory of Open Access Journals (Sweden)

    Sri Subekti

    2006-12-01

    Full Text Available Katuk (Sauropus androgynus L Merr is known to contain carotenoids, vitamin E, vitamin C, protein and phytosterol compound. This study was aimed to determine the ability of phytosterols in Sauropus androgynus (SA leaf to obtain poultry product that has low cholesterol content. One hundred fifty female quails were raised from 2-27 weeks old, divided into three treatment diets, five replicates with 10 quails in each replicate. The treatment diets were: 1 Control group: diet without katuk leaf meal; 2 Diet with 9% SA ethanol 70% extract (SAE; 3 Diet containing 9% SA meal (SAM. Kolesterols were determined with CHOD-PAP-Method by Human, there is enzymatic Colorimetric Test for Cholesterol with Lipid Clearing Factor. The result showed that total cholesterol in the egg yolk, carcass and liver of SAE and SAM treated quails were lower (P<0.05 than that of the control-treated quails, except the cholesterol content in the serum. These findings indicated that the cholesterol concentration of female quails was decreased due to phytosterol content in katuk leaf.

  11. [Quantitative changes in the ultrastructure of myocardial cells in Japanese quail during hypergravity, hypodynamia and space flight].

    Science.gov (United States)

    Bózner, A; Boda, K; Dostál, J; Matĕjková, Z; Devecka, V

    1993-03-01

    The experimental work aimed at the quantitative ultrastructure of the myocardial cells of the Japanese quail Coturnix coturnix japonica during hypergravitation, hypodynamism and space flight in a Soviet satellite. For the determination of quantitative changes of the myocardial ultrastructure a morphometrical method was used with parameters like the number of mitochondria, average mitochondrial size, relative mitochondrial volume, deficiency of cristae and relative volume of myofibrils. The quails were observed in 3 groups. The absolute control consisted of quails living in normal Earth conditions, in the laboratory group the quails were exposed to conditions of hypergravitation and hypodynamism in a specially constructed centrifuge, and in the flying group the quails were exposed to space flight in a Soviet orbital station MIR. In the group of absolute controls no pathological changes of the myocardial ultrastructure were found. In the flying group there were no significant changes, with the exception of decreased relative volume of myofibrils, which however agrees with the findings on symptoms corresponding to human and animal heart weakness during space flights. In the laboratory group, pathological changes were observed in each of the fractions. The most significant pathological findings were found in the group controls in the center and in hypergravitation combined with hypodynamism. It can be concluded that the laboratories can simulate conditions induced by the start and flight of space ships. (Fig. 2, Ref, 8.)

  12. Effect of feed supplement containing earthworm meal (Lumbricus rubellus) on production performance of quail (Coturnix coturnix japonica)

    Science.gov (United States)

    Istiqomah, L.; Sakti, A. A.; Suryani, A. E.; Karimy, M. F.; Anggraeni, A. S.; Herdian, H.

    2017-12-01

    The objective of this study was to evaluate the effect of feed supplement (FS) contained earthworm meal (EWM) on production performance of laying quails. Twenty weeks-old of 360 Coturnix coturnix japonica quails were used in a Completely Randomized Design (CRD) with three dietary treatments A = CD (control without FS), B = CD + 0.250 % of FS, and C = CD + 0.375 % of FS during 6 weeks of experimental period. Each treatment in 4 equal replicates in which 30 quails were randomly allocated into 12 units of cages. Variable measured were feed intake, feed conversion ratio, feed efficiency, mortality rate, hen day production, egg weight, and egg uniformity. Data were statistically analyzed by One Way ANOVA and the differences among mean treatments are analysed using Duncan’s Multiple Range Test (DMRT). The results showed that administration of 0.375% FS based on earthworm meal, fermented rice bran, and skim milk impaired the feed conversion ratio and increased the feed efficiency. The experimental treatments did not effect on feed intake, mortality, hen day production, egg weight, and egg uniformity of quail. It is concluded that administration of feed supplement improved the growth performance of quail.

  13. Fibronectin promotes differentiation of neural crest progenitors endowed with smooth muscle cell potential

    International Nuclear Information System (INIS)

    Costa-Silva, Bruno; Coelho da Costa, Meline; Melo, Fernanda Rosene; Neves, Cynara Mendes; Alvarez-Silva, Marcio; Calloni, Giordano Wosgrau; Trentin, Andrea Goncalves

    2009-01-01

    The neural crest (NC) is a model system used to investigate multipotency during vertebrate development. Environmental factors control NC cell fate decisions. Despite the well-known influence of extracellular matrix molecules in NC cell migration, the issue of whether they also influence NC cell differentiation has not been addressed at the single cell level. By analyzing mass and clonal cultures of mouse cephalic and quail trunk NC cells, we show for the first time that fibronectin (FN) promotes differentiation into the smooth muscle cell phenotype without affecting differentiation into glia, neurons, and melanocytes. Time course analysis indicated that the FN-induced effect was not related to massive cell death or proliferation of smooth muscle cells. Finally, by comparing clonal cultures of quail trunk NC cells grown on FN and collagen type IV (CLIV), we found that FN strongly increased both NC cell survival and the proportion of unipotent and oligopotent NC progenitors endowed with smooth muscle potential. In contrast, melanocytic progenitors were prominent in clonogenic NC cells grown on CLIV. Taken together, these results show that FN promotes NC cell differentiation along the smooth muscle lineage, and therefore plays an important role in fate decisions of NC progenitor cells

  14. The effect of organic quail egg supplementation on the blood lipid profile of white mice (Rattus Norvegicus L.) during the lactation period

    Science.gov (United States)

    lestari purba, Sri; Rini Saraswati, Tyas; Isdadiyanto, Sri

    2018-05-01

    Background: Quail eggs contain a considerable amount of complete nutritional sources such as carbohydrates, proteins, fats, and micronutrients. However, they also have a high cholesterol level, which can potentially cause atherosclerosis and chronic heart diseases. The response of the body to foods containing is influenced by factors such as ethnicity, genetics, and hormonal and nutrient status of the consumer. The cholesterol level of quail eggs can be reduced by manipulating the feed using supplemental organic feed. Organic quail eggs have been believed to correct the lipid profile of white mice during the lactation phase. Purpose: The aim of this study was to analyze the effect of feed containing organic quail eggs on the blood lipid profile of white mice (Rattus norvegicus L.) during the lactation phase. Materials and Methods: This experimental study was conducted using a completely randomized design with four experiments and five repetitions. Experimental mice: T0 mice were used as control; T1 mice were supplemented with quail eggs produced by quails that were fed with standard feed; T2 mice were supplemented with eggs produced by quails fed with standard organic feed; and T3 mice were supplemented with eggs produced by quails fed with organic feed with the addition of cassava leaf flour, mackerel flour, and turmeric powder. Quail egg supplementation was administered to the mice from the early pregnancy period till the end of the lactation phase. The acquired data were analyzed using ANOVA. SPSS version 16.0 software for Windows was used for data analyses. Results and summary: Feeding the white mice with different compositions of organic quail egg supplements had no effect on the consumption of feed and water, body weight, and lipid profile (including total cholesterol, LDL, HDL, and triglyceride) during the lactation phase (P > 0.05).

  15. Trunk muscle recruitment patterns in simulated precrash events.

    Science.gov (United States)

    Ólafsdóttir, Jóna Marín; Fice, Jason B; Mang, Daniel W H; Brolin, Karin; Davidsson, Johan; Blouin, Jean-Sébastien; Siegmund, Gunter P

    2018-02-28

    To quantify trunk muscle activation levels during whole body accelerations that simulate precrash events in multiple directions and to identify recruitment patterns for the development of active human body models. Four subjects (1 female, 3 males) were accelerated at 0.55 g (net Δv = 4.0 m/s) in 8 directions while seated on a sled-mounted car seat to simulate a precrash pulse. Electromyographic (EMG) activity in 4 trunk muscles was measured using wire electrodes inserted into the left rectus abdominis, internal oblique, iliocostalis, and multifidus muscles at the L2-L3 level. Muscle activity evoked by the perturbations was normalized by each muscle's isometric maximum voluntary contraction (MVC) activity. Spatial tuning curves were plotted at 150, 300, and 600 ms after acceleration onset. EMG activity remained below 40% MVC for the three time points for most directions. At the 150- and 300 ms time points, the highest EMG amplitudes were observed during perturbations to the left (-90°) and left rearward (-135°). EMG activity diminished by 600 ms for the anterior muscles, but not for the posterior muscles. These preliminary results suggest that trunk muscle activity may be directionally tuned at the acceleration level tested here. Although data from more subjects are needed, these preliminary data support the development of modeled trunk muscle recruitment strategies in active human body models that predict occupant responses in precrash scenarios.

  16. Structural evolution and diversity of the caterpillar trunk

    DEFF Research Database (Denmark)

    Dupont, Steen Thorleif

    cuticle thickness, the degree of myrmecopily and the underlying mechanism of lycaenid-ant associations (MS4). In two major manuscripts (MS1-2), comparative descriptions are provided of the larval trunk in, respectively the Micropterigidae and the lowest-grade leaf-mining caterpillars. Available knowledge...

  17. Test-retest reliability of trunk accelerometric gait analysis

    DEFF Research Database (Denmark)

    Henriksen, Marius; Lund, Hans; Moe-Nilssen, R

    2004-01-01

    The purpose of this study was to determine the test-retest reliability of a trunk accelerometric gait analysis in healthy subjects. Accelerations were measured during walking using a triaxial accelerometer mounted on the lumbar spine of the subjects. Six men and 14 women (mean age 35.2; range 18...... a definite potential in clinical gait analysis....

  18. A nonlinear dynamics of trunk kinematics during manual lifting tasks.

    Science.gov (United States)

    Khalaf, Tamer; Karwowski, Waldemar; Sapkota, Nabin

    2015-01-01

    Human responses at work may exhibit nonlinear properties where small changes in the initial task conditions can lead to large changes in system behavior. Therefore, it is important to study such nonlinearity to gain a better understanding of human performance under a variety of physical, perceptual, and cognitive tasks conditions. The main objective of this study was to investigate whether the human trunk kinematics data during a manual lifting task exhibits nonlinear behavior in terms of determinist chaos. Data related to kinematics of the trunk with respect to the pelvis were collected using Industrial Lumbar Motion Monitor (ILMM), and analyzed applying the nonlinear dynamical systems methodology. Nonlinear dynamics quantifiers of Lyapunov exponents and Kaplan-Yorke dimensions were calculated and analyzed under different task conditions. The study showed that human trunk kinematics during manual lifting exhibits chaotic behavior in terms of trunk sagittal angular displacement, velocity and acceleration. The findings support the importance of accounting for nonlinear dynamical properties of biomechanical responses to lifting tasks.

  19. Diverticulum of the brachiocephalic trunk - angiography and embryological explanation

    Energy Technology Data Exchange (ETDEWEB)

    Pfefferkorn, J.R.; Lunkenheimer, A.; Loeser, H.; Hilgenberg, F.

    1983-03-01

    A diverticulum of the brachiocephalic trunk is described in 5 children with unilateral absence of the pulmonary artery, in a child with tetralogy of Fallot, and in an other child with Bland-White-Garland syndrome. The diverticulum is a remnant of a contralateral ductus arteriosus, which closed after birth and represents the origin of the distal part of the sixth aortic arch.

  20. TD-LTE maritime trunking communication system based on TVWS

    Science.gov (United States)

    Ren, Chunxiang; Chen, Xing; Li, Wanchao; Chen, Baodan

    2014-10-01

    This paper collects the measurement results of 470 MHZ-960MHZ spectrum in the coastal areas, and analyzes the characteristics of TV broadcast spectrum occupancy in the measurement region. Moreover, this article proposes construct the TD-LTE maritime trunking communication system using geolocation database, television database (TVDB) and cognitive radio (CR) technology.

  1. Hip and trunk muscles activity during nordic hamstring exercise

    Science.gov (United States)

    Narouei, Shideh; Imai, Atsushi; Akuzawa, Hiroshi; Hasebe, Kiyotaka; Kaneoka, Koji

    2018-01-01

    The nordic hamstring exercise (NHE) is a dynamic lengthening hamstring exercise that requires trunk and hip muscles activation. Thigh muscles activation, specifically hamstring/quadriceps contractions has been previously examined during NHE. Trunk and hip muscles activity have not been enough studied. The aim of this study was to analyze of hip and trunk muscles activity during NHE. Surface electromyography (EMG) and kinematic data were collected during NHE. Ten healthy men with the age range of 21–36 years performed two sets of two repetitions with downward and upward motions each of NHE. EMG activity of fifteen trunk and hip muscles and knee kinematic data were collected. Muscle activity levels were calculated through repeated measure analysis of variance in downward and upward motions, through Paired t-test between downward and upward motions and gluteus maximus to erector spine activity ratio (Gmax/ES ratio) using Pearson correlation analyses were evaluated. Semitendinosus and biceps femoris muscles activity levels were the greatest in both motions and back extensors and internal oblique muscles activity were greater than other muscles (Phamstrings contractions. It could be important for early assessment of subjects with hamstring injury risk. PMID:29740557

  2. Trunk Reservation in Multi-service Networks with BPP Traffic

    DEFF Research Database (Denmark)

    Zheng, H.; Zhang, Qi; Iversen, Villy Bæk

    2006-01-01

    In this paper we develop approximate models for trunk reservation in multi-service systems with BPP (Binomial-Poisson-Pascal) multi-rate traffic streams. The approximation is a generalization of previous work by Tran-Gia & Hubner who assumed Poisson arrival processes. It is based on a generalized...

  3. Hip and trunk muscles activity during nordic hamstring exercise.

    Science.gov (United States)

    Narouei, Shideh; Imai, Atsushi; Akuzawa, Hiroshi; Hasebe, Kiyotaka; Kaneoka, Koji

    2018-04-01

    The nordic hamstring exercise (NHE) is a dynamic lengthening hamstring exercise that requires trunk and hip muscles activation. Thigh muscles activation, specifically hamstring/quadriceps contractions has been previously examined during NHE. Trunk and hip muscles activity have not been enough studied. The aim of this study was to analyze of hip and trunk muscles activity during NHE. Surface electromyography (EMG) and kinematic data were collected during NHE. Ten healthy men with the age range of 21-36 years performed two sets of two repetitions with downward and upward motions each of NHE. EMG activity of fifteen trunk and hip muscles and knee kinematic data were collected. Muscle activity levels were calculated through repeated measure analysis of variance in downward and upward motions, through Paired t -test between downward and upward motions and gluteus maximus to erector spine activity ratio (Gmax/ES ratio) using Pearson correlation analyses were evaluated. Semitendinosus and biceps femoris muscles activity levels were the greatest in both motions and back extensors and internal oblique muscles activity were greater than other muscles ( P hamstrings contractions. It could be important for early assessment of subjects with hamstring injury risk.

  4. COMPARATIVE HISTOMORPHOLOGICAL STUDY ON THE THYMUS WITH REFERENCE TO ITS IMMUNOLOGICAL IMPORTANCE IN QUAIL, CHICKEN AND DUCK

    Directory of Open Access Journals (Sweden)

    M. R. Senapati

    2015-06-01

    Full Text Available A comparative histomorphological study was conducted on thymus of broiler chicken, duck and quail. The thymus of all three species of post-hatch (adult birds showed a thin connective tissue capsule. However, fine septa originating from the capsule divided the organ into incomplete but distinct lobules in chicken, whereas lobules were ill defined in both quail and duck. Each lobule, in turn, was composed of a peripheral cortex, densely studded with lymphocytes and a central medulla that was enriched with epithelial reticular cells. So, the cortex appeared more basophilic than that of medulla. But the concentration of lymphocyte, an immune competent cell was highest in chicken followed by duck and quail. Hassall’s corpuscles like structures were found inside the medulla as pale stained diffuse body. General histo-architecture was almost similar in all the birds.

  5. Age-related reduction of trunk muscle torque and prevalence of trunk sarcopenia in community-dwelling elderly: Validity of a portable trunk muscle torque measurement instrument and its application to a large sample cohort study.

    Directory of Open Access Journals (Sweden)

    Eiji Sasaki

    Full Text Available Trunk muscle weakness and imbalance are risk factors for postural instability, low back pain, and poor postoperative outcomes. The association between trunk muscle strength and aging is poorly understood, and establishing normal reference values is difficult. We aimed to establish the validity of a novel portable trunk muscle torque measurement instrument (PTMI. We then estimated reference data for healthy young adults and elucidated age-related weakness in trunk muscle strength. Twenty-four university students were enrolled to validate values for PTMI, and 816 volunteers from the general population who were recruited to the Iwaki Health Promotion Project were included to estimate reference data for trunk muscle strength. Trunk flexion and extension torque were measured with PTMI and KinCom, and interclass correlation coefficients (ICC were estimated to evaluate the reliability of PTMI values. Furthermore, from the young adult reference, the age-related reduction in trunk muscle torque and the prevalence of sarcopenia among age-sex groups were estimated. The ICC in flexion and extension torque were 0.807 (p<0.001 and 0.789 (p<0.001, respectively. The prevalence of sarcopenia increased with age, and the prevalence due to flexion torque was double that of extension torque. Flexion torque decreased significantly after 60 years of age, and extension torque decreased after 70 years of age. In males over age 80, trunk muscle torque decreased to 49.1% in flexion and 63.5% in extension. In females over age 80, trunk muscle torque decreased to 60.7% in flexion and 68.4% in extension. The validity of PTMI was confirmed by correlation with KinCom. PTMI produced reference data for healthy young adults, and demonstrated age-related reduction in trunk muscle torque. Trunk sarcopenia progressed with aging, and the loss of flexion torque began earlier than extension torque. At age 80, trunk muscle torque had decreased 60% compared with healthy young adults.

  6. Age-related reduction of trunk muscle torque and prevalence of trunk sarcopenia in community-dwelling elderly: Validity of a portable trunk muscle torque measurement instrument and its application to a large sample cohort study.

    Science.gov (United States)

    Sasaki, Eiji; Sasaki, Shizuka; Chiba, Daisuke; Yamamoto, Yuji; Nawata, Atsushi; Tsuda, Eiichi; Nakaji, Shigeyuki; Ishibashi, Yasuyuki

    2018-01-01

    Trunk muscle weakness and imbalance are risk factors for postural instability, low back pain, and poor postoperative outcomes. The association between trunk muscle strength and aging is poorly understood, and establishing normal reference values is difficult. We aimed to establish the validity of a novel portable trunk muscle torque measurement instrument (PTMI). We then estimated reference data for healthy young adults and elucidated age-related weakness in trunk muscle strength. Twenty-four university students were enrolled to validate values for PTMI, and 816 volunteers from the general population who were recruited to the Iwaki Health Promotion Project were included to estimate reference data for trunk muscle strength. Trunk flexion and extension torque were measured with PTMI and KinCom, and interclass correlation coefficients (ICC) were estimated to evaluate the reliability of PTMI values. Furthermore, from the young adult reference, the age-related reduction in trunk muscle torque and the prevalence of sarcopenia among age-sex groups were estimated. The ICC in flexion and extension torque were 0.807 (psarcopenia increased with age, and the prevalence due to flexion torque was double that of extension torque. Flexion torque decreased significantly after 60 years of age, and extension torque decreased after 70 years of age. In males over age 80, trunk muscle torque decreased to 49.1% in flexion and 63.5% in extension. In females over age 80, trunk muscle torque decreased to 60.7% in flexion and 68.4% in extension. The validity of PTMI was confirmed by correlation with KinCom. PTMI produced reference data for healthy young adults, and demonstrated age-related reduction in trunk muscle torque. Trunk sarcopenia progressed with aging, and the loss of flexion torque began earlier than extension torque. At age 80, trunk muscle torque had decreased 60% compared with healthy young adults.

  7. Comparison of trunk activity during gait initiation and walking in humans.

    Directory of Open Access Journals (Sweden)

    Jean-Charles Ceccato

    Full Text Available To understand the role of trunk muscles in maintenance of dynamic postural equilibrium we investigate trunk movements during gait initiation and walking, performing trunk kinematics analysis, Erector spinae muscle (ES recordings and dynamic analysis. ES muscle expressed a metachronal descending pattern of activity during walking and gait initiation. In the frontal and horizontal planes, lateroflexion and rotation occur before in the upper trunk and after in the lower trunk. Comparison of ES muscle EMGs and trunk kinematics showed that trunk muscle activity precedes corresponding kinematics activity, indicating that the ES drive trunk movement during locomotion and thereby allowing a better pelvis mobilization. EMG data showed that ES activity anticipates propulsive phases in walking with a repetitive pattern, suggesting a programmed control by a central pattern generator. Our findings also suggest that the programs for gait initiation and walking overlap with the latter beginning before the first has ended.

  8. An analysis of trunk kinematics and gait parameters in people with stroke

    Directory of Open Access Journals (Sweden)

    Adnil W. Titus

    2018-03-01

    Conclusion: This pilot study found significant asymmetry in trunk motion between the affected and unaffected sides that varied across the gait cycle. This suggests the trunk may need to be targeted in clinical gait retraining post-stroke.

  9. Energy cost of running instability evaluated with wearable trunk accelerometry.

    Science.gov (United States)

    Schütte, Kurt H; Sackey, Saint; Venter, Rachel; Vanwanseele, Benedicte

    2018-02-01

    Maintaining stability under dynamic conditions is an inherent challenge to bipedal running. This challenge may impose an energetic cost (Ec) thus hampering endurance running performance, yet the underlying mechanisms are not clear. Wireless triaxial trunk accelerometry is a simple tool that could be used to unobtrusively evaluate these mechanisms. Here, we test a cost of instability hypothesis by examining the contribution of trunk accelerometry-based measures (triaxial root mean square, step and stride regularity, and sample entropy) to interindividual variance in Ec (J/m) during treadmill running. Accelerometry and indirect calorimetry data were collected concurrently from 30 recreational runners (16 men; 14 women) running at their highest steady-state running speed (80.65 ± 5.99% V̇o 2max ). After reducing dimensionality with factor analysis, the effect of dynamic stability features on Ec was evaluated using hierarchical multiple regression analysis. Three accelerometry-based measures could explain an additional 10.4% of interindividual variance in Ec after controlling for body mass, attributed to anteroposterior stride regularity (5.2%), anteroposterior root mean square ratio (3.2%), and mediolateral sample entropy (2.0%). Our results lend support to a cost of instability hypothesis, with trunk acceleration waveform signals that are 1) more consistent between strides anteroposterioly, 2) larger in amplitude variability anteroposterioly, and 3) more complex mediolaterally and are energetically advantageous to endurance running performance. This study shows that wearable trunk accelerometry is a useful tool for understanding the Ec of running and that running stability is important for economy in recreational runners. NEW & NOTEWORTHY This study evaluates and more directly lends support to a cost of instability hypothesis between runners. Moreover, this hypothesis was tested using a minimalist setup including a single triaxial trunk mounted accelerometer

  10. Surgical treatment of celiomesenteric trunk aneurysm-7 case report.

    Science.gov (United States)

    Wang, Chunxi; Cai, Xiangjun; Liang, Faqi; Chu, Futao; Chen, Gang; Duan, Zhiquan

    2014-01-01

    The celiomesenteric trunk is a rare anomaly characterized by a common origin of the celiac axis and superior mesenteric artery from the aorta, which accounts for less than 1% of all celiac artery anomalies, so the aneurysm occurred in such trunk is even rarer. There have been few reports on how to diagnose and deal with such malformed celiomesenteric trunk aneurysms till now. This paper tries to summarize the experience of how to expose and excise such kind of aneurysm according to the seven cases' data. The clinic data were collected retrospectively. There were seven cases with celiomesenteric trunk aneurysm from February 2000 to February 2013, including 5 males and 2 females aged 35~62. The operations were done including aneurysm resection and vascular reconstruction under general anesthesia. The operated patients were followed-up at the sixth month and each year post operation. The vascular stomas were detected or examined by Color Doppler Sonography, spiral Computed Tomography angiography (SCTA). The seven operated patients were cured and discharged from hospital, and they were followed up for 3~10 years (mean time 5 years), with four patients being followed up longer than 5 years. No sign of intestinal ischemia or hepatic ischemia or splenic ischemia was found, and no image of anastomosis stricture or stenosis was found during the follow-up. Five patients are alive now while two patients were dead, with one dying of large area myocardial infarction unexpectedly at 6 years post operation and the other dying of cerebral infarction abruptly at 4 years post operation. It is an effective and safe method to treat the celiomesenteric trunk aneurysm by using by-pass operation with artificial blood vessels, originating from inferior kidney aorta to visceral arteries including hepatic artery, splenic artery and superior mesenteric artery. Its short-term and middle-term effects are relatively better.

  11. Isolation and characterization of Ornithobacterium rhinotracheale in the commercial turkey, quail flocks and domestic pigeons by bacteriological and molecular methods

    Directory of Open Access Journals (Sweden)

    Banani, M.

    2011-12-01

    Full Text Available Ornithobacterium rhinotracheale (ORT is a respiratory pathogen which has been isolated throughout the world from numerous bird species. The present study was designed to isolate and characterize the ORT from domestic turkeys, quails and pigeons. For this purpose, 250 samples from each bird species (turkey, quail and pigeon with or without respiratory signs were tested by taking of tracheal swabs. In addition, respiratory tissue samples (tracheal and lung, from 250 slaughtered turkeys, 50 slaughtered quails and 100dead pigeons were also subjected to culture for ORT as tracheal swabs. Respiratory tissues were also tested for bacterial DNA by using polymerase chain reaction (PCR. In general, 30 isolates including 4 isolates from turkeys, 3 isolates from quails and 23 isolates from pigeons were identified as ORT by bacteriologicalmethod and then confirmed by PCR. Bacterial DNA was detected in 20%, 50% and 35% of respiratory tissues in turkeys, quails and pigeons respectively. Five ORT isolates from pigeon and all four isolates from turkey showed smaller colony size, while other isolates had larger colonies when cultured in blood agar. Fifty percent of the isolates with larger colony but none of the isolates with small colony size could agglutinate red blood cells (RBCs. All of the isolates were sensitive to danofloxacin and chloramphenicolwhile more than 90% of pigeon isolates were resistant to ampicillin. All of turkey and quail and 30% of pigeon isolates were resistant to tetracycline. Our ORT isolates showed high identity (98%- 100% insequence of 16S rRNA gene to related data in GeneBank.

  12. Experimental Assessment of the Pathogenicity of Avian Influenza Virus H9N2 Subtype in Japanese Quail (Coturnix Coturnix Japanica

    Directory of Open Access Journals (Sweden)

    Asasi, K.

    2010-07-01

    Full Text Available H9N2 avian influenza A viruses are endemic in poultry of many Eurasian countries and have caused repeated human infections in Asia since 1998. It has been also reported that H9N2 can cause high mortality in commercial broiler farms in Iran previously. However there was no report of H9N2 outbreak in any other species. In order to evaluate the pathogenicity of H9N2 virus in Japanese quail, 145 Japanese quail were randomly divided into 5 separate groups (116 quails in the treatment and 29 quails in the control groups. The experimental groups infected via oral rout, eye drop, intramuscular injection and spray method at the age of 32 days with 106.5 EID50/bird. The virus A/chicken/Iran/ZMT-101/98(H9N2 was kindly provided obtained from Razi vaccine& serum institute with EID50=108. The blood samples were experimented the day before use to show freedom from antibodies to influenza A and more specifically, the H9 subtype. The clinical signs and antibody titer of the infected chicks were also monitored. Five birds of each group were bled at 10 and 20 days post infection (DPI, and 20 birds of each group at 30 DPI were bled. The immune response to infection was measured by Haemmaglutination Inhibition (HI test using the H9N2 virus as antigen. Feed & water consumption were recorded on daily bases before and after inoculation. Body weight of each group was also recorded on weekly bases before and after inoculation. During the current study clinical signs such as sneezing, gasping, depression observed in challenged groups followed by decreasing in laying (1-17%. High HI antibody titers of AIV subtype H9 was seen in 10 DPI. The quails exhibited no decrease in food and water consumption and all quails were growing well and did not show any abnormality.

  13. Trace element concentrations in the fruit peels and trunks of Musa paradisiaca.

    Science.gov (United States)

    Selema, M D; Farago, M E

    1996-08-01

    Chemical analyses for the elementary compositions of the ashes of the fruit peels and trunks of the tropical plantain Musa paradisiaca have been undertaken. The elements, categorized as trace elements, generally are found to have higher mean concentrations in the fruit peels than in the trunks (except in the case of Zn). Their peel-trunk uptake ratios have been calculated and range between 1 and 4, showing normal levels of accumulations in the fruit peels over the trunks.

  14. Effects of selection for yolk cholesterol on growth and meat quality in Japanese quail (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Marek Bednarczyk

    2010-01-01

    Full Text Available Descendants ( of S18 generation of Japanese quails (Coturnix coturnix japonica, selected for low (line 11, n=15 or for high (line 12, n=6 yolk cholesterol content were used for this experiment. The high (12 and low (11 lines were developed from a control egg type (line13 wild color plumage stock 07, from Poultry Breeding Station in Ivanka at Danube (Slovakia that was maintained without conscious selection. The results of selected lines were compared to this one from unselected lines, egg type (line 13, n=15 and meat type (line 8, n=15, to study productive performance (growth and carcass weight as well as meat quality traits (intramuscular collagen properties, fatty and cholesterol content. The birds were grown up to 35 days of age. Quails were fed ad libitum with commercial diets according to their ages. Animals had free access to water during the experiment. The body weight of the quails was controlled every week (from week 1 to 5. At the slaughter (at avg. weight of 104.0, 107.7, 110.6 g vs 209.3 g for lines 11, 12, 13 vs 8, respectively; P<0.05 the hot carcass weight was recorded and dressing percentage was calculated. Pectoralis superficialis muscles were removed from the carcasses to assess intramuscular collagen (IMC properties (collagen and crosslink concentrations, intramuscular lipid and cholesterol contents. Growth and slaughter performance, intramuscular fat percentage and IMC properties of Pectoralis superficialis were not different between the birds selected for low (line 11 and high (line 12 yolk cholesterol content and were also found to be similar between the quails of egg type and those selected for yolk cholesterol content (lines 11 and 12. Compared to the birds of egg type line and those selected for yolk cholesterol content, the quails of meat type had higher growth and carcass traits (P<0.05, while meat quality traits were found to be similar. The meat of the quails selected for low cholesterol in the egg yolk (line 11

  15. Normal xeroradiographic and radiographic anatomy of the bobwhite quail (Colinus virginianus), with reference to other galliform species

    International Nuclear Information System (INIS)

    Smith, B.J.; Smith, S.A.

    1991-01-01

    The purpose of this study was to provide a reference for xeroradiographic and conventional radiographic anatomy of the bobwhite quail (Colinus virginianus) as a representative of the avian order Galliformes. The heads, bodies, wings, and pelvic limbs of four adult birds were radiographed using xeroradiographic and conventional radiographic techniques. Nine xeroradiographs and their corresponding conventional radiographs were selected, and the xeroradiographs labeled to illustrate the normal anatomy of these regions. A xeroradiograph of the tarsometatarsus of the domestic peacock (Pavo cristatus) was also included to demonstrate the metatarsal spur, which is not present in the quail

  16. The influence of artificially increased trunk stiffness on the balance recovery after a trip

    NARCIS (Netherlands)

    van der Burg, J.C.E.; Pijnappels, M.A.G.M.; van Dieen, J.H.

    2007-01-01

    Falls occur frequently in the growing population of elderly. Since trunk control is critical for maintaining balance, the higher trunk stiffness in elderly people compared to the general population has been associated with their increased fall-risk. Theoretically, trunk stiffness may be beneficial

  17. Reorganized trunk muscle activity during multidirectional floor perturbations after experimental low back pain

    DEFF Research Database (Denmark)

    Larsen, Lars Henrik; Hirata, Rogerio Pessoto; Graven-Nielsen, Thomas

    2016-01-01

    Low back pain changes the trunk muscle activity after external perturbations but the relationship between pain intensities and distributions and their effect on the trunk muscle activity remains unclear. The effects of unilateral and bilateral experimental low back pain on trunk muscle activity w...

  18. 49 CFR 571.401 - Standard No. 401; Interior trunk release.

    Science.gov (United States)

    2010-10-01

    .... Requirements. S4.1 Each passenger car with a trunk compartment must have an automatic or manual release... possible for a person trapped inside the trunk compartment of a passenger car to escape from the compartment. S2. Application. This standard applies to passenger cars that have a trunk compartment. This...

  19. File list: His.Emb.10.AllAg.Embryonic_trunk [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Emb.10.AllAg.Embryonic_trunk mm9 Histone Embryo Embryonic trunk SRX093317,SRX09...3316 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Emb.10.AllAg.Embryonic_trunk.bed ...

  20. File list: NoD.Emb.20.AllAg.Embryonic_trunk [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.Emb.20.AllAg.Embryonic_trunk mm9 No description Embryo Embryonic trunk ERX40226...7,ERX402264 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/NoD.Emb.20.AllAg.Embryonic_trunk.bed ...

  1. File list: DNS.Emb.20.AllAg.Embryonic_trunk [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.Emb.20.AllAg.Embryonic_trunk mm9 DNase-seq Embryo Embryonic trunk SRX191030 htt...p://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/DNS.Emb.20.AllAg.Embryonic_trunk.bed ...

  2. File list: His.Emb.50.AllAg.Embryonic_trunk [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Emb.50.AllAg.Embryonic_trunk mm9 Histone Embryo Embryonic trunk SRX093317,SRX09...3316 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Emb.50.AllAg.Embryonic_trunk.bed ...

  3. CONTROL OF APERTURE CLOSURE INITIATION DURING TRUNK-ASSISTED REACH-TO-GRASP MOVEMENTS

    Science.gov (United States)

    Rand, Miya K.; Van Gemmert, Arend W. A.; Hossain, Abul B.M.I.; Shimansky, Yury P.; Stelmach, George E.

    2012-01-01

    The present study investigated how the involvement and direction of trunk movement during reach-to-grasp movements affect the coordination between the transport and grasping components. Seated young adults made prehensile movements in which the involvement of the trunk was varied; the trunk was not involved, moved forward (flexion), or moved backward (extension) in the sagittal plane during the reach to the object. Each of the trunk movements was combined with an extension or flexion motion of the arm during the reach. Regarding the relation between the trunk and arm motion for arm transport, the onset of wrist motion relative to that of the trunk was delayed to a greater extent for the trunk extension than for the trunk flexion. The variability of the time period from the peak of wrist velocity to the peak of trunk velocity was also significantly greater for trunk extension compared to trunk flexion. These findings indicate that trunk flexion was better integrated into the control of wrist transport than trunk extension. In terms of the temporal relationship between wrist transport and grip aperture, the relation between the time of peak wrist velocity and the time of peak grip aperture did not change or became less steady across conditions. Therefore, the stability of temporal coordination between wrist transport and grip aperture was maintained despite the variation of the pattern of intersegmental coordination between the arm and the trunk during arm transport. The transport-aperture coordination was further assessed in terms of the control law according to which the initiation of aperture closure during the reach occurs when the hand crosses a hand-to-target distance threshold for grasp initiation that is a function of peak aperture, wrist velocity and acceleration, trunk velocity and acceleration, and trunk-to-target distance at the time of aperture closure initiation. The participants increased the hand-to-target distance threshold for grasp initiation in

  4. Control of aperture closure initiation during trunk-assisted reach-to-grasp movements.

    Science.gov (United States)

    Rand, Miya K; Van Gemmert, Arend W A; Hossain, Abul B M I; Shimansky, Yury P; Stelmach, George E

    2012-06-01

    The present study investigated how the involvement and direction of trunk movement during reach-to-grasp movements affect the coordination between the transport and grasping components. Seated young adults made prehensile movements in which the involvement of the trunk was varied; the trunk was not involved, moved forward (flexion), or moved backward (extension) in the sagittal plane during the reach to the object. Each of the trunk movements was combined with an extension or flexion motion of the arm during the reach. Regarding the relationship between the trunk and arm motion for arm transport, the onset of wrist motion relative to that of the trunk was delayed to a greater extent for the trunk extension than for the trunk flexion. The variability of the time period from the peak of wrist velocity to the peak of trunk velocity was also significantly greater for trunk extension compared to trunk flexion. These findings indicate that trunk flexion was better integrated into the control of wrist transport than trunk extension. In terms of the temporal relationship between wrist transport and grip aperture, the relationship between the time of peak wrist velocity and the time of peak grip aperture did not change or become less steady across conditions. Therefore, the stability of temporal coordination between wrist transport and grip aperture was maintained despite the variation of the pattern of intersegmental coordination between the arm and the trunk during arm transport. The transport-aperture coordination was further assessed in terms of the control law according to which the initiation of aperture closure during the reach occurs when the hand crosses a hand-to-target distance threshold for grasp initiation, which is a function of peak aperture, wrist velocity and acceleration, trunk velocity and acceleration, and trunk-to-target distance at the time of aperture closure initiation. The participants increased the hand-to-target distance threshold for grasp

  5. A Review on Some Parameters of Environment in Youth Intensive Raising of Japanese Quail

    Directory of Open Access Journals (Sweden)

    Lucian Ioniţă

    2012-10-01

    Full Text Available The aim of this paper is to review the state-of-art of scientific research on some environmentalparameters recommended by the literature in the intensive raising of young quails. As a result ofthe research it can be said that the temperature in the raising area of the young Japanese quailvaries between 35 º - 37.8 º C in the first week of life, after which it decreases by 3-4 ° C / week.The relative humidity in the shelter of young quails in the first week of raising must bemaintained at 80% (made with trays of water; then it should decrease at the value of 70%. Lightregime recommended for intensive young quails raising can be 24 hours light per day to 42 daysor can choose a program of light of 24 hours a day during the first 7 days of life, after which itcan be reducde up to 16 hours a day until the age of 42 days. Light intensity should be between20 lux and 45 lux for the first 7 days of life of the youth, then can be reduced by 20 to 5 lux untilthe age of 41 days. Density per area unit in the house is of 150 chicken / sqm (for ground riasing,reaching the age of 6 weeks at a density of 100 chicks / sqm or 250 chicken / sqm cage (in thecase of youth raising in batteries The number of chickens decreases to 250 for 1.5 sqm of cagearea in the second week of life and 250 chicken for 2 sqm cage area in the third week.

  6. Genetic analysis of partial egg production records in Japanese quail using random regression models.

    Science.gov (United States)

    Abou Khadiga, G; Mahmoud, B Y F; Farahat, G S; Emam, A M; El-Full, E A

    2017-08-01

    The main objectives of this study were to detect the most appropriate random regression model (RRM) to fit the data of monthly egg production in 2 lines (selected and control) of Japanese quail and to test the consistency of different criteria of model choice. Data from 1,200 female Japanese quails for the first 5 months of egg production from 4 consecutive generations of an egg line selected for egg production in the first month (EP1) was analyzed. Eight RRMs with different orders of Legendre polynomials were compared to determine the proper model for analysis. All criteria of model choice suggested that the adequate model included the second-order Legendre polynomials for fixed effects, and the third-order for additive genetic effects and permanent environmental effects. Predictive ability of the best model was the highest among all models (ρ = 0.987). According to the best model fitted to the data, estimates of heritability were relatively low to moderate (0.10 to 0.17) showed a descending pattern from the first to the fifth month of production. A similar pattern was observed for permanent environmental effects with greater estimates in the first (0.36) and second (0.23) months of production than heritability estimates. Genetic correlations between separate production periods were higher (0.18 to 0.93) than their phenotypic counterparts (0.15 to 0.87). The superiority of the selected line over the control was observed through significant (P egg production in earlier ages (first and second months) than later ones. A methodology based on random regression animal models can be recommended for genetic evaluation of egg production in Japanese quail. © 2017 Poultry Science Association Inc.

  7. Genetic analyses of partial egg production in Japanese quail using multi-trait random regression models.

    Science.gov (United States)

    Karami, K; Zerehdaran, S; Barzanooni, B; Lotfi, E

    2017-12-01

    1. The aim of the present study was to estimate genetic parameters for average egg weight (EW) and egg number (EN) at different ages in Japanese quail using multi-trait random regression (MTRR) models. 2. A total of 8534 records from 900 quail, hatched between 2014 and 2015, were used in the study. Average weekly egg weights and egg numbers were measured from second until sixth week of egg production. 3. Nine random regression models were compared to identify the best order of the Legendre polynomials (LP). The most optimal model was identified by the Bayesian Information Criterion. A model with second order of LP for fixed effects, second order of LP for additive genetic effects and third order of LP for permanent environmental effects (MTRR23) was found to be the best. 4. According to the MTRR23 model, direct heritability for EW increased from 0.26 in the second week to 0.53 in the sixth week of egg production, whereas the ratio of permanent environment to phenotypic variance decreased from 0.48 to 0.1. Direct heritability for EN was low, whereas the ratio of permanent environment to phenotypic variance decreased from 0.57 to 0.15 during the production period. 5. For each trait, estimated genetic correlations among weeks of egg production were high (from 0.85 to 0.98). Genetic correlations between EW and EN were low and negative for the first two weeks, but they were low and positive for the rest of the egg production period. 6. In conclusion, random regression models can be used effectively for analysing egg production traits in Japanese quail. Response to selection for increased egg weight would be higher at older ages because of its higher heritability and such a breeding program would have no negative genetic impact on egg production.

  8. Performance of japanese quails fed feeds containing different corn and limestone particle sizes

    Directory of Open Access Journals (Sweden)

    DA Berto

    2007-09-01

    Full Text Available This study aimed at evaluating performance and egg quality of Japanese quails fed feeds containing different corn and limestone particle sizes. A total number of 648 birds in the peak of production was distributed in a random complete block experimental design, using a 2x3 factorial arrangement (2 corn particle sizes and 3 limestone particle sizes. Birds were designated to one of two blocks, with six replicates of 18 birds each. Mean geometric diameter (MGD values used were 0.617mm and 0.723mm (corn fine and coarse particle sizes, respectively, and 0.361mm, 0.721mm, and 0.947mm (limestone fine, intermediate and coarse particle sizes, respectively. The following treatments were applied: T1: fine corn feed, with 100% fine limestone; T2: fine corn feed, with 50% fine limestone and 50% intermediate limestone; T3: fine corn feed, with 50% fine limestone and 50% coarse limestone; T4: coarse corn feed, with 100% fine limestone; T5: coarse corn feed, with 50% fine limestone and 50% intermediate limestone; T6: coarse corn feed, with 50% fine limestone and 50% coarse limestone. The experiment lasted 112 days, consisting of 4 cycles of 28 days. No significant interaction was observed among corn and limestone particle sizes for any of the analyzed parameters. There were no significant effects (p>0.05 of the tested corn particle sizes on quail performance or egg quality. There were significant (p<0.05 isolated effects of limestone particle size only on the percentage of cracked eggs, which was reduced when birds fed 50% coarse limestone (0.947mm and 50% fine limestone (0.361mm as compared to those fed 100% fine limestone. Therefore, the inclusion of 50% coarse limestone (0.947mm is recommended for quail egg production.

  9. Characterization and Digestibility of Detoxified Castor Oil Meal for Japanese Quails

    Directory of Open Access Journals (Sweden)

    PA dos Santos

    2015-12-01

    Full Text Available ABSTRACT These experiments were performed to determine the chemical composition, coefficients of nutrient and energy metabolizability, amino acid composition, and cytotoxicity of different castor oil meals subjected to different detoxification processes and added to the diet of Japanese quails. In the trial, 180 46-d-old female Japanese quails were distributed according to a completely randomized design into five treatments and with replicates of six bird each. The treatments consisted of following detoxification methods of castor oil meal: Castor oil meal A (CMA - recovery in alcohol at 80 °C for 20 minutes and drying at 80 °C; castor oil meal B (CMB and C (CMC - recovery in alcohol at 80 °C for 6 minutes, neutralization with 5% NaOH, and drying under direct sunlight sun for two days (CMB or pelleted (CMC; castor oil meal D (CMD - recovery in alcohol at 110 °C for 15 minutes and drying at 110 °C. Castor oil meal was added replacing 20% of the reference diet. There was slight chemical composition variation (1.21% in crude protein, 6% in dry matter, 2.2% in ether extract and 64 kcal/kg in gross energy among the castor oil meals submitted to the different treatments. The castor oil meal submitted to treatment C showed the highest amino acid values. In the cytotoxicity test, treatment D presented lower ricin activity. Castor oil meals A, C, and D may be included in Japanese quail diets; however, castor oil meal D is recommended due to the simplicity its industrial process, its low toxicity, and metabolizability coefficients obtained.

  10. Immunomodulation and hormonal disruption without compromised disease resistance in perfluorooctanoic acid (PFOA) exposed Japanese quail

    International Nuclear Information System (INIS)

    Smits, Judit E.G.; Nain, Sukhbir

    2013-01-01

    This study evaluated the impact of oral perfluorooctanoic acid (PFOA) on Japanese quail at concentrations found in American and Belgian workers at PFOA manufacturing facilities. Three arms of the immune system were tested; T cell, B cell, and innate immunity. After 6 weeks exposure, quail were challenged with E. coli infection to test the ultimate measure of immunotoxicity, disease resistance. The T cell response was lower in the high exposure groups. Antibody mediated, and innate immune responses were not different. Growth rate was higher, whereas thyroid hormone levels were lower in PFOA-exposed birds. Morbidity/mortality from disease challenge was not different among the control and PFOA-exposed groups, and no overt PFOA toxicity was observed pre-disease challenge. Although PFOA at ‘worst case scenario’ levels caused T cell immunosuppression, this did not translate into increased disease susceptibility, demonstrating that immunotoxicity testing must be interpreted with caution since disease resistance is the ultimate concern. -- Highlights: •Birds orally exposed to high levels of PFOA for 8 wks showed no signs of toxicity. •PFOA exposure caused immunotoxicity by suppressing the T cell mediated response. •PFOA exposure did not affect antibody mediated, or innate immunity. •PFOA exposure did not cause increased morbidity/mortality after E. coli infection. •PFOA exposed birds showed endocrinological changes that may warrant further study. -- Oral exposure of quail to the pollutant, PFOA, resulted in hormonal and immunological changes, but did not compromise disease resistance after challenge by a common avian pathogen

  11. Influence of a mobile robot on the spatial behaviour of quail chicks

    Energy Technology Data Exchange (ETDEWEB)

    De Margerie, E; Lumineau, S; Houdelier, C; Richard Yris, M-A, E-mail: emmanuel.demargerie@univ-rennes1.fr [CNRS UMR 6552 Ethologie Animale et Humaine, Universite Rennes 1, Rennes (France)

    2011-09-15

    Quail chicks encountered an autonomous mobile robot during their early development. The robot incorporated a heat source that stimulated following of chicks. The spatial behaviour of grown-up chicks was tested in an exploration test and a detour test. Chicks that grew with the mobile robot exhibited better spatial abilities than chicks grown with a static heat source. We discuss these results in the perspective of animal-robot interaction and of the role of early spatial experience on the behavioural development. (communication)

  12. Comparison between the effects of animal and plant basal diets on productivity of Japanese quails

    International Nuclear Information System (INIS)

    Abu-Taleb, A.M.

    2004-01-01

    The outbreak of bovine spongiform encephalopathy (BSE) disease in cattle, known as m ad cow disease , make the European commission to take an action for preventing the spread of such disease by banning the feeding ruminant tissue and animal by-products to farm animals. This study suggested to compare between two basal diets originated from either plants or animal and their effects on some physiological parameters related to the bird growth. A total number of 800 one day old unsexed Japanese quails were used in this study. Quails were divided equally into two groups containing 400 birds each. Each group contained 4 replicates of 100 birds. Group one the birds were fed on animal diet and group two fed on plant diet. The two diets contained 24% crude protein (CP) and 4% fat and contains 3200 Kcal/kg diet in starter, while the layer diet contained 21% CP and 4% fat and contains 3000 Kcal/kg diet. Growth data were obtained by weighing the quails individually every week until 6 th weeks, 6 th months and 1 2th months. Eggs were collected daily and weighed for eight months starting from the onset of first egg lying. At 8 th month, a sample of 8 quails was sacrificed, organ weighted and blood samples were collected. Carcass composition was performed to determine % fat, % protein, % ash and total moisture. Hematological and histological parameters, liver and kidney functions, total protein, albumin, globulin, estradiol, testosterone, cholesterol and total lipids were evaluated. The results showed significant increase in body weights gain in one and three weeks only in animal protein diet but no difference were shown between animal and plant diet after 4 weeks and until 12 month. No difference between animal and plant diets were noted in total dry solids (TDS), fat %, ash and protein of TDS and egg production. Levels of serum estradiol, testosterone, total protein, albumin, hematological parameters and total lipids showed non-significant values. The histological parameters

  13. Hepatic microsomal metabolism of BDE-47 and BDE-99 by lesser snow geese and Japanese quail.

    Science.gov (United States)

    Krieger, Lisa K; Szeitz, András; Bandiera, Stelvio M

    2017-09-01

    In the present study, we investigated the oxidative biotransformation of 2,2',4,4'-tetrabromodiphenyl ether (BDE-47) and 2,2',4,4',5-pentabromodiphenyl ether (BDE-99) by liver microsomes from wild lesser snow geese (Chen caerulescens caerulescens) and domesticated Japanese quail (Coturnix japonica). Formation of hydroxy-metabolites was analyzed using an ultra-high performance liquid chromatography-tandem mass spectrometry-based method. Incubation of BDE-47 with avian liver microsomes produced sixteen hydroxy-metabolites, eight of which were identified using authentic standards. The major metabolites formed by liver microsomes from individual lesser snow geese were 4-hydroxy-2,2',3,4'-tetrabromodiphenyl ether (4-OH-BDE-42), 3-hydroxy-2,2',4,4'-tetrabromodiphenyl ether (3-OH-BDE-47), and 4'-hydroxy-2,2',4,5'-tetrabromodiphenyl ether (4'-OH-BDE-49). By comparison, 4-OH-BDE-42 and 4'-OH-BDE-49, but not 3-OH-BDE-47, were major metabolites of Japanese quail liver microsomes. Unidentified metabolites included monohydroxy- and dihydroxy-tetrabromodiphenyl ethers. Incubation of BDE-99 with avian liver microsomes produced seventeen hydroxy-metabolites, twelve of which were identified using authentic standards. The major metabolites formed by lesser snow goose liver microsomes were 2,4,5-tribromophenol, 3-OH-BDE-47, 4'-OH-BDE-49, 4-hydroxy-2,2',3,4',5-pentabromodiphenyl ether (4-OH-BDE-90), and 5'-hydroxy-2,2',4,4',5-pentabromodiphenyl ether (5'-OH-BDE-99). By comparison, the major metabolites produced by liver microsomes from Japanese quail included 6-hydroxy-2,2',4,4'-tetrabromodiphenyl ether (6-OH-BDE-47) and 2-hydroxy-2',3,4,4',5-pentabromodiphenyl ether (2-OH-BDE-123), but not 3-OH-BDE-47. Unidentified metabolites consisted of monohydroxy-pentabromodiphenyl ethers, monohydroxy-tetrabromodiphenyl ethers and dihydroxy-tetrabromodiphenyl ethers. Another difference between the two species was that formation rates of BDE-47 and BDE-99 metabolites were greater with liver

  14. Incorporation of radioactive zinc into the eggs of Japanese quails (coturnix coturnix Japonica)

    International Nuclear Information System (INIS)

    Matsusaka, Naonori; Nishimura, Yoshikazu; Nakamura, Isao; Yuyama, Akira

    1975-01-01

    The incorporation of 65 Zn into eggs was investigated after single or daily intraperitoneal administration to laying Japanese quails. After a single intraperitoneal administration, 65 Zn appeared first in the 2nd egg yolks and reached the highest level in the 3rd and 4th ones, followed by a gradual decrease. The cumulative amount of 65 Zn in the egg yolks over a period of 3 weeks accounted for about 40% of dose. After daily intraperitoneal administration, the 6th-9th egg's yolks contained the highest radioactivity of the eggs examined. Whole-body retention patterns were also observed in both of the experiments. (auth.)

  15. Kisspeptin-10 Enhanced Egg Production in Quails Associated with the Increase of Triglyceride Synthesis in Liver

    Directory of Open Access Journals (Sweden)

    J. Wu

    2013-08-01

    Full Text Available Our previous results showed that kisspeptin-10 (Kp-10 injections via intraperitoneal (i.p. once daily for three weeks notably promoted the egg laying rate in quails. In order to investigate the mechanism behind the effects of Kp-10 on enhancing the egg laying rate in birds, this study focused on the alternations of lipids synthesis in liver after Kp-10 injections. 75 female quails (22 d of age were allocated to three groups randomly, and subjected to 0 (control, Con, 10 nmol (low dosage, L and 100 nmol (high dosage, H Kp-10 injections via i.p. once daily for three weeks, respectively. At d 52, quails were sacrificed and sampled for further analyses. Serum E2 concentration was increased by Kp-10 injections, and reached statistical significance in H group. Serum triglyceride (TG concentrations were increased by 46.7% in L group and 36.8% in H group, respectively, but did not reach statistical significance, and TG contents in liver were significantly elevated by Kp-10 injections in a dose-dependent manner. Serum total cholesterol (Tch concentrations significantly decreased in H group, while in H group the hepatic Tch content was markedly increased. The level of non-esterified fatty acid (NEFA, apolipoprotein A1 and B (apoA1 and apoB were not altered by Kp-10 injections. The genes expression of sterol regulatory element binding protein-1 (SREBP-1, fatty acid synthetase (FAS, apolipoprotein VLDL-II (apoVLDL-II, cholesterol 7α-hydroxylase (CYP7A1 and vitellogenin II (VTG-II were significantly up-regulated by high but not low dosage of Kp-10 injection compared to the control group. However, the expression of SREBP-2, acetyl-CoA carboxylase (ACCα, malic enzyme (ME, stearoyl-CoA (Δ9 desaturase 1 (SCD1, apolipoprotein A1 (apoA1, fatty acid binding protein 2 (FABP2, 3-hydroxyl-3-methyl glutaryl-coenzyme A reductases (HMGCR, estrogen receptor α, β (ERα and β mRNA were not affected by Kp-10 treatment. In line with hepatic mRNA abundance, hepatic SREBP

  16. Effect of Hypodynamy on Structure and Alkaline Phosphatase Activity of Kidney in Japanese Quails

    Directory of Open Access Journals (Sweden)

    V. Almášiová

    2008-01-01

    Full Text Available The objective of the study was to observe the effect of experimental hypodynamy simulating weightlessness in space on the structure, ultrastructure and alkaline phosphatase activity of kidney in Japanese quail (Coturnix coturnix japonica. Two days after hatching, the quails were suspended in special shirts below the cage ceiling so their feet did not touch the floor. They could consume food and water ad libitum. Experimental animals were sacrificed after 14, 21, 28, 35, 42, 49 and 56 days of hypodynamy. Birds of the same age, hatched at the same time, and fed the same diet were used as a control. Samples of kidney were processed for light (LM and transmission electron microscopy (TEM, and alkaline phosphatase (AP analysis. Short-term (14–28 days hypodynamy caused no marked damage to the structure and ultrastructure of kidneys. However, after long-term (35–59 days hypodynamy, morphological changes were observed in some cells of the proximal and distal tubules. The dying cells in proximal tubules, observed in semi-thin sections by LM, were dark and contained a nucleus of irregular shape. Observation by TEM showed that their nucleus was dark and shrivelled and the electron-dense cytoplasm contained long, dense, rod-shaped mitochondria with thin mitochondrial cristae. Microvilli were present on the apical surface of cells and formed a brush border. Sporadic dying cells were also observed in distal tubules. Large, light vacuoles were found in the cytoplasm of cells of collecting tubules, however, the structure of renal corpuscles and medullary loops remained undisturbed. Microscopical analysis by means of a direct TUNEL reaction on days 35 to 59 of hypodynamy showed a moderate occurrence of cellular apoptosis in the proximal and distal tubules of experimental Japanese quail. The activity of AP in the brush border of the proximal tubules on days 14–29 of hypodynamy was normal in experimental animals and showed no significant differences in

  17. Influence of a mobile robot on the spatial behaviour of quail chicks

    International Nuclear Information System (INIS)

    De Margerie, E; Lumineau, S; Houdelier, C; Richard Yris, M-A

    2011-01-01

    Quail chicks encountered an autonomous mobile robot during their early development. The robot incorporated a heat source that stimulated following of chicks. The spatial behaviour of grown-up chicks was tested in an exploration test and a detour test. Chicks that grew with the mobile robot exhibited better spatial abilities than chicks grown with a static heat source. We discuss these results in the perspective of animal-robot interaction and of the role of early spatial experience on the behavioural development. (communication)

  18. Performance of japanese quails fed feeds containing different corn and limestone particle sizes

    OpenAIRE

    Berto,DA; Garcia,EA; Móri,C; Faitarone,ABG; Pelícia,K; Molino,AB

    2007-01-01

    This study aimed at evaluating performance and egg quality of Japanese quails fed feeds containing different corn and limestone particle sizes. A total number of 648 birds in the peak of production was distributed in a random complete block experimental design, using a 2x3 factorial arrangement (2 corn particle sizes and 3 limestone particle sizes). Birds were designated to one of two blocks, with six replicates of 18 birds each. Mean geometric diameter (MGD) values used were 0.617mm and 0.72...

  19. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

  20. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

  1. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

  2. ORF Sequence: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

  3. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

  4. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

    Science.gov (United States)

    2013-04-24

    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  5. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  6. Spinal mobility and trunk muscle strength in elite hockey players.

    Science.gov (United States)

    Lindgren, S; Twomey, L

    1988-01-01

    Elite hockey players of both sexes from the Australian Institute of Sport were assessed for lumbar spine mobility, trunk flexion and back extensor muscle strength, hamstring flexibility and postural characteristics over a two year period. All the athletes were more mobile in rotation than the 'normal' West Australian population, and demonstrated flexible hamstrings and powerful back extensor muscles; trunk flexion was less strong initially, but improved after intervention in the form of a specific exercise programme, over the measurement period. A questionnaire disclosed that low back pain is a common complaint of hockey players, but rarely required intensive physical and medical treatment. The term 'hockey player's back' has been coined in recognition of the long flat thoracolumbar spine frequently noted in these subjects. Copyright © 1988 Australian Physiotherapy Association. Published by . All rights reserved.

  7. The measurement of blood speed in the pulmonary artery trunk

    Energy Technology Data Exchange (ETDEWEB)

    Saro, J P; Bula-Cruz, J [UTAD - 5000 Vila Real (Spain); Rafael, J A [Dep. Electronica e Telecomunicacoes da Univ. de Aveiro - 3800 Aveiro (Spain); Botelho, M F; Lima, J P [IBILI - Faculdade de Medicina da Univ. de Coimbra - 3000 Coimbra (Spain)

    1999-12-31

    The paper describes a non invasive methodology for the measurement of blood speed in the pulmonary artery trunk. The methodology has been tested with a moving radioactive tracer (nuclear medicine). An image processing technique is proposed, for detection and analysis of a moving object with variable shape and intensity over time (radioactive bolus). Experiments on the application of the technique in nuclear medicine are critically analysed. (authors) 9 refs., 7 figs.

  8. Celiac artery trunk thrombosis presenting as acute liver failure

    International Nuclear Information System (INIS)

    Akbarian, M.A.; Kahrom, M.; Kahrom, H.

    2011-01-01

    Acute mesenteric ischemia is a life-threatening vascular emergency that requires early diagnosis and intervention to adequately restore mesenteric blood flow and to prevent bowel necrosis and patient death. While, almost always superior and inferior mesenteric arteries are involved, we report a 57-year-old male with an unusual celiac artery trunk thrombosis leading to gastero-duodenal and hepato-splenic infarction, and presenting an acute liver failure. (author)

  9. Pseudo aneurysm of the celiac trunk - radiological findings report

    International Nuclear Information System (INIS)

    Magalhaes Junior, Mauricio R. de; Henrique, Katia; Teixeira, Sonia Marcelino; Cardenas, Gloria Pamela Galdames; Marchiori, Edson; Acceta, Pietro

    1997-01-01

    The authors report a case of a celiac trunk pseudoneurysm, diagnosed by ultrasonography, computed tomography and arteriography, in a 54-year-old man, alcoholic, with gastrointestinal bleeding, abdominal pain and an epigastric pulsatile mass. After the diagnostic, he was operated and it was showed a fistula from the pseudoaneurysm to the choledoch and the gall bladder fill with blood. The patient has a good clinic development. (author)

  10. A diverticulum of the brachiocephalic trunk - angiography and embryological explanation

    International Nuclear Information System (INIS)

    Pfefferkorn, J.R.; Lunkenheimer, A.; Loeser, H.; Hilgenberg, F.

    1983-01-01

    A diverticulum of the brachiocephalic trunk is described in 5 children with unilateral absence of the pulmonary artery, in a child with tetralogy of Fallot, and in an other child with Bland-White-Garland syndrome. The diverticulum is a remnant of a contralateral ductus arteriosus, which closed after birth and represents the origin of the distal part of the sixth aortic arch. (orig.) [de

  11. Application of computer graphics to regional trunk road network planning

    OpenAIRE

    M Odani

    1992-01-01

    The author attempts to demonstrate the use of computer graphics to provide an efficient and effective visual presentation method for tranbsprtation planning. First, the basic concept of the visual presentation method of planning is explained and the required hardware is introduced. The information presented graphically by the proposed method is then shown for each step in the process of regional trunk road network planning in the Keihanshin Metropolitan Area of Japan: analysis of the traffic-...

  12. THE RELATIONSHIP BETWEEN TRUNK MUSCLES ENDURANCE AND NORMAL BMI AMONG UNIVERSITY STUDENTS WITH SEDENTARY LIFESTYLE

    Directory of Open Access Journals (Sweden)

    Karthikeyan Selvaganapathy

    2017-12-01

    Full Text Available Background: The most important trunk stabilizers are the trunk flexors and extensors. The isometric endurance of the trunk muscles is an essential element for mechanical support of the spine in all positions. The study objectives were to find out the trunk flexors and extensors endurance, its relationship with normal BMI and to find out the ratio of trunk flexors to extensors endurance. Methods: In this correlation study, 50 subjects were selected by convenience sampling method on the basis of inclusion and exclusion criteria from Asia metropolitan university, Malaysia. The trunk flexors and extensors endurance were assessed by Kraus- Weber and Sorenson test respectively. Paired 't' test and Spearman correlation test were used for data analysis. Results: There was a significant difference (p 0.01 and TEE, rs (50 = -0.162, p >0.01 but there was a significant strong positive relationship between TFE and TEE, rs (50 = 0.68, p < 0.01. The ratio of trunk flexors to extensors was 0.61. Conclusion: The trunk extensors endurance is higher than trunk flexors endurance and BMI has no relationship with trunk flexors and extensors muscle endurance. The ratio of trunk flexors to extensors endurance value is low

  13. Immediate Effects of Different Trunk Exercise Programs on Jump Performance.

    Science.gov (United States)

    Imai, A; Kaneoka, K; Okubo, Y; Shiraki, H

    2016-03-01

    The aim of this study was to investigate the immediate effects of trunk stabilization exercise (SE) and conventional trunk exercise (CE) programs on jump performance. 13 adolescent male soccer players performed 2 kinds of jump testing before and immediate after 3 experimental conditions: SE, CE, and non-exercise (NE). The SE program consisted of the elbow-toe, hand-knee, and back bridge, and the CE program consisted of the sit-up, sit-up with trunk rotation and back extension. Testing of a countermovement jump (CMJ) and rebound jump (RJ) were performed to assess jump performance. Jump height of the CMJ and RJ-index, contact time, and jump height of the RJ were analyzed. The RJ index was improved significantly only after SE (p=0.017). However, contact time and jump height did not improve significantly in the SE condition. Moreover, no significant interaction or main effects of time or group were observed in the CMJ. Consequently, this study showed the different immediate effect on the RJ between the SE and CE, and suggested the possibility that the SE used in this study is useful as a warm-up program to improve the explosive movements. © Georg Thieme Verlag KG Stuttgart · New York.

  14. Stability and Control of Human Trunk Movement During Walking.

    Science.gov (United States)

    Wu, Q.; Sepehri, N.; Thornton-Trump, A. B.; Alexander, M.

    1998-01-01

    A mathematical model has been developed to study the control mechanisms of human trunk movement during walking. The trunk is modeled as a base-excited inverted pendulum with two-degrees of rotational freedom. The base point, corresponding to the bony landmark of the sacrum, can move in three-dimensional space in a general way. Since the stability of upright posture is essential for human walking, a controller has been designed such that the stability of the pendulum about the upright position is guaranteed. The control laws are developed based on Lyapunov's stability theory and include feedforward and linear feedback components. It is found that the feedforward component plays a critical role in keeping postural stability, and the linear feedback component, (resulting from viscoelastic function of the musculoskeletal system) can effectively duplicate the pattern of trunk movement. The mathematical model is validated by comparing the simulation results with those based on gait measurements performed in the Biomechanics Laboratory at the University of Manitoba.

  15. [Muscular trunk stability in professional and amateur volleyball players].

    Science.gov (United States)

    Miltner, O; Siebert, C; Tschaepe, R; Maus, U; Kieffer, O

    2010-03-01

    The aim of this study was to analyse the efficiency of muscular activity in the trunk stabilisation of professional volleyball players compared to a group of amateur hobby players. The results were compared amongst the groups as well as with a reference group consisting of asymptomatic individuals. The question to be answered was whether or not professional volleyball players possess a characteristic strength profile in their trunk musculature and if differences exist with regard to the individuals' competitive playing level. In this comparative study 12 professional volleyball players (German Bundesliga) and 18 non-professional volleyball players were analysed with regard to their isometric strength profile in all three planes. The reference group was provided by the Proxomed company, which had previously analysed healthy untrained individuals (n = 1045) of various age groups. A sports-specific profile for the musculature of volleyball players revealed a significant reduction in the flexion and rotation strength as well as a well-developed lateral flexion strength (highly significant when compared to the reference group). With reference to the level played, better strength values in flexion and lateral flexion were found among the professional athletes. Professional volleyball players present with a characteristic trunk musculature strength profile. A detailed analysis of the muscle strength of the spine as part of a sports medicine work-up could prove helpful in preventing injuries and overuse problems in professional and hobby volleyball players.

  16. Evolution of the head-trunk interface in tetrapod vertebrates

    Science.gov (United States)

    Sefton, Elizabeth M; Bhullar, Bhart-Anjan S; Mohaddes, Zahra; Hanken, James

    2016-01-01

    Vertebrate neck musculature spans the transition zone between head and trunk. The extent to which the cucullaris muscle is a cranial muscle allied with the gill levators of anamniotes or is instead a trunk muscle is an ongoing debate. Novel computed tomography datasets reveal broad conservation of the cucullaris in gnathostomes, including coelacanth and caecilian, two sarcopterygians previously thought to lack it. In chicken, lateral plate mesoderm (LPM) adjacent to occipital somites is a recently identified embryonic source of cervical musculature. We fate-map this mesoderm in the axolotl (Ambystoma mexicanum), which retains external gills, and demonstrate its contribution to posterior gill-levator muscles and the cucullaris. Accordingly, LPM adjacent to the occipital somites should be regarded as posterior cranial mesoderm. The axial position of the head-trunk border in axolotl is congruent between LPM and somitic mesoderm, unlike in chicken and possibly other amniotes. DOI: http://dx.doi.org/10.7554/eLife.09972.001 PMID:27090084

  17. Adsorption of Cu, As, Pb and Zn by Banana Trunk

    International Nuclear Information System (INIS)

    Nurzulaifa Shaheera Erne Mohd Yasim; Zitty Sarah Ismail; Suhanom Mohd Zaki; Mohd Fahmi Abd Azis

    2016-01-01

    The purpose of this study is to investigate the effectiveness of banana trunk as an adsorbent in removal of heavy metals in aqueous solution. Functional groups of adsorbent were determined using Fourier Transform Infrared spectroscopy (FTIR). Batch experiments were conducted to determine the adsorption percentage of heavy metals (Cu, As, Pb and Zn). The optimum adsorption using banana trunk was based on pH difference, contact time and dosage. Adsorption percentage was found to be proportional to pH, contact time and dosage. Maximum adsorption percentage of Cu, As, Pb and Zn at pH 6, 100 minutes and 8 gram of dosage are 95.80 %, 75.40 %, 99.36 % and 97.24 %, respectively. Langmuir and Freundlich isotherms were used to determine the equilibrium state for heavy metals ion adsorption experiments. All equilibrium heavy metals were well explained by the Freundlich isotherm model with R"2= 0.9441, R"2= 0.8671, R"2= 0.9489 and R"2= 0.9375 for Cu, As, Pb and Zn respectively. It is concluded that banana trunk has considerable potential for the removal of heavy metals from aqueous solution. (author)

  18. Incidence, species and antimicrobial resistance of naturally occurring Campylobacter isolates from quail carcasses sampled in a commercial processing facility

    Science.gov (United States)

    Most of the published information about the presence of Campylobacter on processed poultry is from studies with chickens and turkeys; therefore there is a paucity of published material about the presence of Campylobacter on commercially processed quail (Coturnix coturnix). The objective of this stud...

  19. Comparative pharmacokinetics of enrofloxacin, danofloxacin, and marbofloxacin after intravenous and oral administration in Japanese quail (Coturnix coturnix japonica).

    Science.gov (United States)

    Haritova, Aneliya; Dimitrova, Dimitrichka; Dinev, Toncho; Moutafchieva, Rumyana; Lashev, Lubomir

    2013-03-01

    A population approach was used to evaluate the pharmacokinetic parameters of 3 fluoroquinolones administered to Japanese quail (Coturnix coturnix japonica). Healthy adult quail (n = 50) were divided into 3 groups, each administered a separate intravenous and oral dose of the compounded drug: enrofloxacin at 10 mg/kg (n = 18; 9 male, 9 female), danofloxacin at 10 mg/kg (n = 12; 6 male, 6 female), and marbofloxacin at 5 mg/kg (n = 20; 10 male, 10 female). A fourth group was used as a control (n = 5). Enrofloxacin was metabolized extensively to ciprofloxacin, while no metabolites of either danofloxacin or marbofloxacin were detected. The volume of distribution was high, greater than 1 in all cases, and highest for danofloxacin, followed by enrofloxacin, then marbofloxacin. The total body clearance was higher in quail than that reported for other avian species with the exception of ostriches. As in mammals, the lowest clearance rate of the 3 fluoroquinolones was observed for marbofloxacin. Enrofloxacin was absorbed most rapidly, followed by marbofloxacin, then danofloxacin. The highest bioavailability was observed for danofloxacin followed by marbofloxacin, while very low bioavailability with significant conversion to ciprofloxacin was observed for enrofloxacin. Population analysis showed low intersubject variability for danofloxacin and marbofloxacin in contrast to that for enrofloxacin and its main metabolite, ciprofloxacin. Because of their more favorable pharmacokinetic properties after oral administration, either danofloxacin or marbofloxacin appears to be preferable to enrofloxacin for the treatment of susceptible bacterial infection in Japanese quail.

  20. EFFECT OF USING SOME MEDICINAL PLANTS (ANISE, CHAMOMILE AND GINGER) ON PRODUCTIVE AND PHYSIOLOGICAL PERFORMANCE OF JAPANESE QUAIL

    International Nuclear Information System (INIS)

    ABU TALEB, A.M.; HAMODI, S.J.; EL AFIFI, SH.F.

    2008-01-01

    This experiment was conducted to evaluate the effects of adding medicinal plants to Japanese quail diet on their performance and some metabolic functions. Four hundred, one day old, unsexed Japanese quails were used in this study. Quails were divided equally into four groups of 100 birds each according to medicinal plant additives. Group one was control (without additives, and the other groups contained 0.3% from anise (group 2), chamomile (group 3) and ginger (group 4). The end of the experiment was terminated when birds were 6 weeks old. Body weight, feed intake, some organs weight and some blood parameters were measured.The results indicated that addition of medicinal plants (anise, chamomile and ginger) improved growth rate, carcass and the relative weights of spleen, ovary and testis. Also, significant increases were observed in RBC, WBC, Hb, PCV, total protein and globulin. There was reduction in cholesterol in treated groups as compared to the control.The present results confirmed the beneficial effects of dietary medicinal plants (anise, chamomile and ginger) to improve the health condition as well as the productive and physiological characteristics of quails

  1. Effect of feeding camphor (Eucalyptus Globules) levels on some immunity characteristics, growth and gut microflora of japanese quails

    International Nuclear Information System (INIS)

    Abu Taleb, A.M.; Salah, H.M.; Ezzat, I.E.; El Barkouky, E.

    2003-01-01

    This experiment was conducted to evaluate the effect of adding Eucalyptus globules Egypt to Japanese quail diet on performance and some metabolic functions and immunity. Four hundred,one day old, unsexed japanese quails were used in this study. Quails were divided equally into four groups containing 100 birds in each. Each group contained 4 replicates of 25 birds. Group one was supplemented with 1% Egypt in basal diet, group two was supplemented with 2% Egypt in basal diet, group three was used as negative control (-ve)without any addition of antibiotic in diet or water, while group four represented the positive control (+ ve) by addition antibiotics (0.5 g neomycin sulphate +0.5 g oxytetracyclin) in drinking water for 5 days post hatching. The experimented diet contained 3200 Kcal ME/kg and 24% crude proteins. The end of the experiment was terminated when birds were 6 weeks old. Body weight, mortality, some organs weighs and some blood parameters were measured and some microbial population of small intestines was counted. Results indicated that the addition of Egypt led to significant increase in quails body weights, spleen, bursa and ovary and the measures of total proteins, globulins, haemagglutination inhibition (HI)and triiodothyronine (T3). Decrease in mortality ratio and less counts of microflora and salmonella of gut were also achieved as a result of diet camphor addition

  2. Bovine meat and bone meal is an economically viable alternative in quail feeding in the initial phase.

    Science.gov (United States)

    Pizzolante, Carla C; Kakimoto, Sérgio K; Moraes, José E; Saccomani, Ana Paula O; Soares, Daniela F; Paschoalin, Gustavo C; Budiño, Fábio E L

    2016-05-31

    Quail egg production has experienced a steep rise in the last decade. Nutrition is the main factor affecting productive potential in the poultry industry, as appropriate nutritional management is necessary to ensure the maintenance of optimal physical conditions, growth and the production of high quality products. Meat and bone meal (MBM) has often been used in the poultry industry as an alternative and cost-effective source of protein in partial replacement of corn and soybean meal. However, there have been no studies to date that have investigated the effect of dietary MBM on the performance of quail or on the costs of production in the starter phase. This is particularly important considering that this phase is characterized by large investments by producers, without immediate economic return. In this study, we investigated whether partial replacement of soybean meal (SBM) by meat and bone meal (MBM) in the diet of Japanese quail during the starter phase is a viable alternative that would maintain or improve their productive and economic performance. Our results show that the inclusion of MBM in the diet of quail reduces feeding costs by up to 6% without impairing productive performance.

  3. Effect of photoperiod on body weight gain, and daily energy intake and energy expenditure in Japanese quail (Coturnix c. Japonica)

    NARCIS (Netherlands)

    Boon, P; Visser, GH; Daan, S

    2000-01-01

    Effect of photoperiod and food duration on body weight gain, energy intake, energy expenditure, and sexual development were investigated in two strains of Japanese quail (Coturnix c. japonica), bred for meat (broilers) or egg production (layers), from 7 to 71 days of age. In a first experiment

  4. Autoradiographic study on the distribution of mercury and its transfer to the egg in the laying quail

    Energy Technology Data Exchange (ETDEWEB)

    Nishimura, M; Urakawa, N; Ikeda, M

    1971-01-01

    Autoradiographic and tracer techniques were employed to investigate the distribution and movement of radiomercury in the form of /sup 203/Hg-nitrate, and its transfer to eggs in laying quails. After injection, the radiomercury tended to concentrate in the kidneys and ova, plateauing about 12 hours after injection. Within the egg, the mercury concentrated in the yolk.

  5. Bovine meat and bone meal is an economically viable alternative in quail feeding in the initial phase

    Directory of Open Access Journals (Sweden)

    Carla C. Pizzolante

    2016-06-01

    Full Text Available Quail egg production has experienced a steep rise in the last decade. Nutrition is the main factor affecting productive potential in the poultry industry, as appropriate nutritional management is necessary to ensure the maintenance of optimal physical conditions, growth and the production of high quality products. Meat and bone meal (MBM has often been used in the poultry industry as an alternative and cost-effective source of protein in partial replacement of corn and soybean meal. However, there have been no studies to date that have investigated the effect of dietary MBM on the performance of quail or on the costs of production in the starter phase. This is particularly important considering that this phase is characterized by large investments by producers, without immediate economic return. In this study, we investigated whether partial replacement of soybean meal (SBM by meat and bone meal (MBM in the diet of Japanese quail during the starter phase is a viable alternative that would maintain or improve their productive and economic performance. Our results show that the inclusion of MBM in the diet of quail reduces feeding costs by up to 6% without impairing productive performance.

  6. Age Maturity of Female Japanese Quails Fed Diets Containing Katuk Leave Meal (Sauropus androgynus L.Merr.

    Directory of Open Access Journals (Sweden)

    R Wiradimadja

    2007-05-01

    Full Text Available This experiment was conducted to study the effects of katuk leave meal on sexual maturity in Japanese quail. Three hundred female Japanese quails, with 4 weeks age, were assigned into a completely randomized design with 4 treatments i.e., R1 (diet with neither katuk leave meal nor cholesterin, R2 (diet without katuk leave meal + 0.10% cholesterin, R3 (diet with 15% katuk leave meal without cholesterin, and R4 (diet with 15% katuk leave meal + 0.10% cholesterin. The parameters measured were estradiol hormone in plasma, and age maturity (five percent henday production. Estradiol hormone was measured with Radioimmunoassay. The data were collected and analyzed by using completely randomized design. The results showed that the addition of 15% katuk leave meal in the diet significantly decreased the estrogen concentration (P<0.05, so that slow down on the age maturity of female Japanese quail. (Animal Production 9(2: 67-72 (2007Key Words : Katuk leave meal, estradiol hormone, age maturity, quail

  7. Responses of growing Japanese quails that received selenium from selenium enriched kale sprout (Brassica oleracea var. alboglabra L.).

    Science.gov (United States)

    Chantiratikul, Anut; Chinrasri, Orawan; Pakmaruek, Pornpan; Chantiratikul, Piyanete; Thosaikham, Withpol; Aengwanich, Worapol

    2011-12-01

    The objectives of this study were to determine the effect of selenium (Se) from Se-enriched kale sprout (Brassica oleracea var. alboglabra L.) on the performance and Se concentrations in tissues of growing Japanese quails. Two hundred quails were divided into five treatments. Each treatment consisted of four replicates and each replicate contained ten quails in a completely randomize design. The experiment was conducted for 5 weeks. The treatments were T1, control diet; T2, control diet plus 0.2 mg Se/kg from sodium selenite; T3, T4, and T5, control diet plus 0.2, 0.5, and 1.0 mg Se/kg from Se-enriched kale sprout. The results revealed that Se supplementation had no impact on feed intake, performance, and carcass characteristics of quails (p > 0.05). However, Se supplementation from both sodium selenite and Se-enriched kale sprout increased (p kale sprout. The results indicate that Se from Se-enriched kale sprout offers no advantage over Se from sodium selenite on tissue Se concentration.

  8. The Effect of Divergent Selection on 4-wk BW on the Shape of Growth Curve in Japanese Quail

    Directory of Open Access Journals (Sweden)

    H Beyki

    2011-12-01

    Full Text Available The current study was conducted to investigate the effect of short-term divergent selection on the shape growth curve in different lines of Japanese quail. The Quail lines utilized in this study were two divergently selected for high (HW and low (LW 4-wk body weight during 7 generation and also a control line (C. The Richard function parameters were used to describe growth curves of different lines. The weight at hatch was approximately similar among lines (8.08 g, 7.55 g and 8.76 g for HW, LW and C line respectively. The results of current study indicated that the selected lines (HW & LW were immediately diverged from the C line after hatch. Sexes within each line had no difference in average growth rate, age and body weight at inflection point and adult body weight. However significant differences were found in the growth curve parameters among lines. The results of current study indicated that short term divergent selection for 4-wk BW in Japanese quail can change the growth pattern and the carcass compartments of the selected birds. Therefore to avoid undesirable side effects due to selection in Japanese quails it is recommended to consider the growth pattern changes of the selected birds in the breeding programs

  9. The effect of mustard seed meal (Sinapis arvensis on thyroid hormones and liver enzymes in Japanese quails (Coturnix coturnix japonica

    Directory of Open Access Journals (Sweden)

    Sajjad Mohebali

    2016-07-01

    Full Text Available Objective: To investigate the effect of wild black mustard seed meal on thyroid hormones (thyroxine and thyroid-stimulating hormone in Japanese quails and also study the ability of FeSO4 to alleviate the possible negative effect of mustard meal on thyroid hormones in these birds for the first time. Methods: The experimental procedure was undertaken on 28 quails which were randomly assigned to a control and 6 test groups with 4 quails in each group for 28 days, during which the control group received basic diet with no mustard meal whereas the test groups (No. 2, 3 and 4 received mustard meal (5%, 10% and 15%, respectively and test groups (No. 5, 6 and 7 received FeSO4 (1%-treated mustard meal (5%, 10% and 15%, respectively on the basic of basic diet. Results: The group fed on 15% non-treated mustard seed meal had the least thyroxine level and its level backed to normal in group fed on 15% FeSO4-treated mustard seed meal although this group had the highest alanine transaminase and aspartate transaminase levels. Conclusions: We concluded that up to 10% FeSO4 mustard seed meal could be incorporated in the quail diet successfully with the least damage to thyroids and livers, but further investigations on these birds are still needed to confirm this hypothesis.

  10. Lead pellet retention time and associated toxicity in northern bobwhite quail (Colinus virginianus).

    Science.gov (United States)

    Kerr, Richard; Holladay, Steven; Jarrett, Timothy; Selcer, Barbara; Meldrum, Blair; Williams, Susan; Tannenbaum, Lawrence; Holladay, Jeremy; Williams, Jamie; Gogal, Robert

    2010-12-01

    Birds are exposed to Pb by oral ingestion of spent Pb shot as grit. A paucity of data exists for retention and clearance of these particles in the bird gastrointestinal tract. In the current study, northern bobwhite quail (Colinus virginianus) were orally gavaged with 1, 5, or 10 Pb shot pellets, of 2-mm diameter, and radiographically followed over time. Blood Pb levels and other measures of toxicity were collected, to correlate with pellet retention. Quail dosed with either 5 or 10 pellets exhibited morbidity between weeks 1 and 2 and were removed from further study. Most of the Pb pellets were absorbed or excreted within 14 d of gavage, independent of dose. Pellet size in the ventriculus decreased over time in radiographs, suggesting dissolution caused by the acidic pH. Birds dosed with one pellet showed mean blood Pb levels that exceeded 1,300 µg/dl at week 1, further supporting dissolution in the gastrointestinal tract. Limited signs of toxicity were seen in the one-pellet birds; however, plasma δ-aminolevulinic acid dehydratase (d-ALAD) activity was persistently depressed, suggesting possible impaired hematological function. © 2010 SETAC.

  11. Green synthesis and characterisation of platinum nanoparticles using quail egg yolk

    Science.gov (United States)

    Nadaroglu, Hayrunnisa; Gungor, Azize Alayli; Ince, Selvi; Babagil, Aynur

    2017-02-01

    Nanotechnology is extensively used in all parts today. Therefore, nano synthesis is also significant in all explored areas. The results of studies conducted have revealed that nanoparticle synthesis is performed by using both chemical and physical methods. It is well known that these syntheses are carried out at high charge, pressure and temperature in harsh environments. Therefore, this study investigated green synthesis method that sustains more mild conditions. In this study, quail egg yolk having high vitamin and protein content was prepared for green synthesis reaction and used for the synthesis of platinum nanoparticles in the reaction medium. Reaction situations were optimised as a function of pH, temperature, time and concentration by using quail egg yolk. The results showed that the highest platinum nanoparticles were synthesised at 20 °C and pH 6.0 for 4 h. Also, optimal concentration of metal ions was established as 0.5 mM. The synthesised platinum nanoparticles were characterised by using UV spectrum, X-ray diffraction and scanning electron microscope.

  12. RESEARCH ON THE QUAIL EGGS ALBUMEN CONTENT IN SOME HEAVY METALS

    Directory of Open Access Journals (Sweden)

    I. VIZITIU

    2015-12-01

    Full Text Available Out of a sample batch of 20 Japanese quails, Pharaoh race, with an age of 100 days and weighing 245 g, approximately 200 eggs were collected at the peak phase of the laying period. The eggs were measured, weighed and broken, separating the albumen from the other components. The data obtained served to calculate the physical and morphological indices. Primary chemical composition, caloricity, heavy metals content were first determined, the following data being obtained: quail eggs albumen has an average weight of 7.1025±0.061g, an average volume of 7.158±0.09cm3, an average density of 1.0168±0.0139 g/cm3 and an index (of freshness of 0.0797±0.0015. The albumen contains: 86.76% water, 13.24% dry matter, 0.835% mineral matter, 11.37% protein, 1.03% non-nitrogenous extractive substances and a caloricity of 289.498 kJ for 100 g product. The average content of heavy metals in albumen was: 1.33*10-3 ppm, for cadmium; 8.83*10-2 ppm, for zinc; 1.005 ppm, for cooper and 0.0 ppm, respectively, for lead.

  13. Interactions between aromatase (estrogen synthase) and dopamine in the control of male sexual behavior in quail.

    Science.gov (United States)

    Balthazart, Jacques; Baillien, Michelle; Ball, Gregory F

    2002-05-01

    In male quail, like in other vertebrates including rodents, testosterone acting especially through its estrogenic metabolites is necessary for the activation of male sexual behavior. Also, the administration of dopamine agonists and antagonists profoundly influences male sexual behavior. How the steroid-sensitive neural network and dopamine interact physiologically, remains largely unknown. It is often implicitly assumed that testosterone or its metabolite estradiol, stimulates male sexual behavior via the modification of dopaminergic transmission. We have now identified in quail two possible ways in which dopamine could potentially affect sexual behavior by modulating the aromatization of testosterone into an estrogen. One is a long-acting mechanism that presumably involves the modification of dopaminergic transmission followed by the alteration of the genomic expression of aromatase. The other is a more rapid mechanism that does not appear to be dopamine receptor-mediated and may involve a direct interaction of dopamine with aromatase (possibly via substrate competition). We review here the experimental data supporting the existence of these controls of aromatase activity by dopamine and discuss the possible contribution of these controls to the activation of male sexual behavior.

  14. Effect of Adding Different Vegetable Oils to Quail Diets On Some Blood Parameters and Immune System

    International Nuclear Information System (INIS)

    Abu Taleb, A.M.; Wakwak, M.; Sabek, E.M.; Elaroussi, M.A.; El-Gendy, H.M.; Hammad, M.R.

    2007-01-01

    A total number of 1400 one-day old Japanese quail birds were used in this study, the birds were divided into seven equal groups, six treated while the 7 t h served as the control. The diet of the six treated groups was supplemented with 8 % of either one of the following tested oils: soybean (SBO), sunflower (SFO), corn (CO), cottonseed (CSO), olive (OO) or palm (PO). At the end of the 4 t hand 8 t h weeks of age blood samples were collected for blood picture, proteins and cortisol determination. Antibody titer against sheep red blood cells (SRBCs) and NewCastle disease virus (NDV) were determined at 7 and 8 weeks of age respectively. The results showed significant increase in relative lymphoid organ weights, RBCs, WBCs, Hb and PCV, total protein, globulin and cortisol hormone in treated groups compared to the control. The immunological parameters showed a significant increase in (HA) and (HI) against (SRBCs) and (NDV), respectively, in all treated groups compared to the control group. The present results confirm the beneficial effects of dietary oil supplementation to quail birds and in particular olive oil.

  15. Effect of gamma radiation on mutability in male gametes of Japanese quail (Coturnix coturnix japonica)

    Energy Technology Data Exchange (ETDEWEB)

    Baumgartner, J [Vyskumny Ustav Chovu a Slachtenia Hydiny, Laboratorim Genetiky, Ivanka pri Dunaji (Czechoslovakia)

    1978-01-01

    An analysis of the mutability of developmental stages of male gametes of the japanese quail (Coturnix coturnix japonica), after irradiation with /sup 60/Co exposures (5.16; 15.48; and 30.96)x10/sup -2/C kg/sup -1/, i.e. 200, 600 and 1200 R, at an exposure rate of 8.59x10/sup -5/C kg/sup -1/s/sup -1/, i.e. O.33 R s/sup -1/, has shown that the rate of overall induced dominant lethality as well as the rate of mutation were highest in spermatocytes of the second order at all exposures. Starting from an exposure of 200 R the following values were found for lethal interference per 1 gamete for 1 R: spermatozoa 2.0x10/sup -3/, spermatides 1.95x10/sup -3/, spermatocytes II 6.1x10/sup -3/, spermatocytes I 4.06x10/sup -3/, spermatogonia in the process of differentiation 6.8x10/sup -3/. When analysing overall embryonic lethality, according to early and late lethality, dominant lethal mutations mainly manifested themsel--ves in the oviductal and germinal developmental periods, so that these periods can be considered as sensitive indices of genetic changes. The spermatogenic epithelium of the japanese quail was found to be greatly radioresistant since not even an exposure to 1200 R caused complete and permanent sterility.

  16. Factorial correspondence analysis of fear-related behaviour traits in Japanese quail.

    Science.gov (United States)

    Mignon-Grasteau, S; Roussot, O; Delaby, C; Faure, J M.; Mills, A; Leterrier, C; Guéméné, D; Constantin, P; Mills, M; Lepape, G; Beaumont, C

    2003-02-28

    Factorial correspondence analysis was performed on 341 quails from a F2 cross between two lines divergently selected on the duration of tonic immobility over 29 generations. Several fear- or stress-related traits were recorded, i.e. tonic immobility duration, number of inductions needed to induce tonic immobility, open-field behaviour (time spent walking, latency before first movement and number of defecations), asymmetry of tibia lengths and corticosterone concentration after restraint stress. Variables were categorised in classes and analysed by factorial correspondence analysis. The first axis was mostly described by open-field behaviour, and the second by tonic immobility traits (duration of tonic immobility and number of inductions), which showed that these behaviours were almost independent. No relationship was found between axes of the factorial correspondence analysis and corticosterone concentration or asymmetry of tibia lengths, showing that these variables reflected other characteristics of stress susceptibility than those described by tonic immobility and open-field behaviour. These results show that reaction to stress of quails is a multidimensional trait and cannot be summarised by one trait.

  17. Comparative metabolism and fate of fenvalerate in Japanese quail (Coturnix coturnix japonica) and rats (Rattus norwegicus)

    International Nuclear Information System (INIS)

    Mumtaz, M.M.; Menzer, R.E.

    1986-01-01

    Adult Japanese quail were administered 100 mg/kg chlorophenyl-labeled [ 14 C]fenvalerate, α-cyano-3-phenoxybenzyl 2-(4-chlorophenyl)isovalerate, for study of its distribution, elimination, and metabolism. Ninety percent of the administered dose was eliminated in the excreta within the first 24 h. In addition to fenvalerate, the following metabolites were present: benzeneacetic acid, 4-chloro-α-(1-methylethyl)-,cyano(3-phenoxy-4-hydroxyphenyl)methyl ester [4'-OH-fenvalerate]; benzeneacetic acid, 4-chloro-α-(1-methylethyl)-,(aminocarbonyl)(3-phenoxyphenyl)methyl ester [CONH 2 -fenvalerate]; 4-chloro-α-(1-methylethyl)benzeneacetic acid[Cl-V acid]; 4-chloro-α-(2-hydroxy-1-methylethyl)benzeneacetic acid[4-OH-Cl-V acid]. In time course studies radiocarbon peaked at 3 h (9μg/g) in the liver and gradually declined, while in the blood it peaked within 2 h and fell quickly to an equilibrium value of 1.5 μg/mL blood. In liver microsomal and isolated heptatocyte preparations of Japanese quail and rat, the following metabolites were identified: Cl-V acid, 4-OH-Cl-V acid, 4'-OH-fenvalerate, CONH 2 -fenvalerate. Oxidation was found to be the predominant route of degradation either pre- or post-hydrolysis of the parent compound. Rapid excretion, lesser absorption, and faster metabolism probably explain the lower toxicity of fenvalerate to birds compared to rats

  18. RADIOIODINATION OF OCHRATOXIN TO STUDY THE ROLE OF YEAST IN COUNTERACTING ITS EFFECT ON JAPANESE QUAIL

    International Nuclear Information System (INIS)

    ABU TALEB, A.M.; EL-BARKOUKY, E.E.; AYYOUB, S.M.; EL-KOLALY, M.T.

    2007-01-01

    The radioiodination of ochratoxin using iodogen as an oxidizing agent was studied. The factors affecting the radioiodination yield, such as reaction time, concentration of substrate and oxidizing agent, pH, stability of iodogen coated tubes have been investigated. Separation and purification of the labelled product using thin layer chromatography and gel chromatography on sephadex G-25 column were described.A total number of 80 quail chicks at eight weeks age were divided into two groups 40 birds each. The first group (control) feed basal diet and the second group was supplemented with 0.5% active dried yeast (Saccharomyces cerevisiae) in basal diet. All groups were given orally labelled ochratoxin. After 6, 12, 24 and 48 hours from oral feeding, the quails (5 birds from every group) were slaughtered and blood samples were collected when slaughtering. The organs; liver, heart, spleen lung, proventriculus, gizzard, intestine content, kidney, testis, ovary, oviduct, breast and thigh, were removed and weighed individually and their weights related to body weight have been calculated. Also, manure and eggs were collected. The radioactivity levels in the second group that supplemented yeast in diet was lower than the first group (control) except manure

  19. Number and size of nucleoli in the spermatocytes of chicken and Japanese quail.

    Science.gov (United States)

    Andraszek, Katarzyna; Gryzińska, Magdalena; Knaga, Sebastian; Wójcik, Ewa; Smalec, Elzbieta

    2012-01-01

    Nucleoli are the product of nucleolus organizing region activity (NOR) of specific chromosomes. Their basic function is to synthetise ribosomal RNA precursors and promote the maturation and assemblage of preribosomal RNP molecules. Information on rRNA-coding gene activity can be provided by the analysis of the number and size of nucleoli in the prophase of the first meiotic division. The morphology and ultrastructure of a nucleolus depends, among others, on the species and cell growth cycle as well as the physiological and pathological state of an organism. The purpose of this research was to determine the number and size of nucleoli in the spermatocytes of the domestic chicken and the Japanese quail. Diverse numbers and sizes of nucleoli in the cells of the analysed birds were observed. 1-4 nucleoli were identified in chicken cells (1.91 +/- 0.63 on average) and 1-2 in quail cells (1.13 +/- 0.33 on average). For the total of 957 nucleoli observed in Gallus cells, 329 were classified as large and 628 as small. In Coturnix cells, 563 nucleoli were identified (66 large and 497 small ones). An analysis of the numbers and sizes of nucleoli can be performed at the cytogenetic level and serve as an alternative source of information on rRNA encoding gene and nucleolus organising region (NOR) activities.

  20. Effect of immobilized lipase supplementation of diets on the performance of the Japanese quails

    International Nuclear Information System (INIS)

    Abu-Taleb, A.M.; Ezzat, I.E.; Saleh, M.

    2004-01-01

    In the present study, lipase was immobilized onto two different supports, agarose and gelatin. Some physico-chemical properties of the free and immobilized lipase such as optimum temperature, optimum ph and storage stability were studied. Storage of the enzymes for 2 months showed that the free enzyme lost its activity, while the immobilized on the gelatin showed better resistance towards ph and temperature variations than that immobilized onto agarose. Four experiments were conducted to test the effect of the immobilized lipase supplementation on the productive performance of the Japanese quails. During the first 3 weeks, the addition of lipase to poultry diets caused an increase in the body weight gain of birds than the enzyme-free diet. An obvious improvement in quail day egg production during the laying period was observed with the groups fed on a diet supplemented with 3000 and 2000 I U of immobilized lipase per kilogram feed. Blood cholesterol was not affected with lipase addition, while total lipids were significantly increased. Significant reduction was also observed in thyroid hormones (T 3 and T 4 ) as compared with the control group

  1. The effects of testosterone on immune function in quail selected for divergent plasma corticosterone response.

    Science.gov (United States)

    Roberts, Mark L; Buchanan, Katherine L; Evans, Matthew R; Marin, Raul H; Satterlee, Daniel G

    2009-10-01

    The immunocompetence handicap hypothesis (ICHH) suggests that the male sex hormone testosterone has a dual effect; it controls the development and expression of male sexually selected signals, and it suppresses the immune system. Therefore only high quality males are able to fully express secondary sexual traits because only they can tolerate the immunosuppressive qualities of testosterone. A modified version of the ICHH suggests that testosterone causes immunosuppression indirectly by increasing the stress hormone corticosterone (CORT). Lines of Japanese quail (Coturnix japonica) selected for divergent responses in levels of plasma CORT were used to test these hypotheses. Within each CORT response line (as well as in a control stock) we manipulated levels of testosterone in castrated quail by treatment with zero (sham), low or high testosterone implants, before testing the birds' humoral immunity and phytohaemagglutinin (PHA)-induced immune response, as well as body condition. The PHA-induced response was not significantly affected by CORT selected line, testosterone treatment or their interaction. There was, however, a significant effect of CORT line on humoral immunity in that the control birds exhibited the greatest antibody production, but there was no significant effect of testosterone manipulation on humoral immunity. The males in the sham implant treatment group had significantly greater mass than the males in the high testosterone group, suggesting a negative effect of high testosterone on general body condition. We discuss these results in the context of current hypotheses in the field of sexual selection.

  2. Performance of japanese quail chickens injected with monosodium glutamate in the early post hatch period

    International Nuclear Information System (INIS)

    Fahmy, M.O.; Ezzat, I.E. and others

    2002-01-01

    Neo hatched Japanese quails chicks were divided equally into three groups (G1, G2 and G3) and injected once subcutaneously with monosodium glutamate (MSG) at 0,2 or 4 mg/g body weight for G1, G2 and G3 respectively. The obtained results clear that, 1-At-marketing stage, body weight increased by about 4% and 6%, feed conversion ratio reduced by 8.7% and 5.7% in-groups G2 and G3 respectively. 2-MSG had no significant effect on male and female serum T4 as well as male serum T3. The injection with 2-mg MSG per gram body weight increased female serum T3 significantly. 3-MSG increased significantly fat % DM in the male and female quails. This treatment in was positively correlated with the amount of injected MSG. Ash % DM and protein % DM were decreased significantly in both injected males and females and the reduction was dose dependent. 5-in males, weights of heart, spleen and testes besides weights and lengths of gastrointestinal tract regions were not significantly affected by MSG administration. 6-in females, the injection with MSG (2 mg/g body weight) significantly reduced the weight as percent body weight, moreover, the administration of MSG had no significant effect on the weights or the lengths of the remain parameters of the females gastrointestinal tract regions, ovary, oviduct, heart and spleen

  3. The Effect of Different Foam Concentrations on Sperm Motility in Japanese Quail

    Directory of Open Access Journals (Sweden)

    Avishek Biswas

    2010-01-01

    Full Text Available A study was conducted to determine the effect of foam extract on sperm motility in the male Japanese quail (Coturnix coturnix japonica. Adult male quails (<12 weeks of heavy body weight strain were housed in individual cages and divided into 5 groups according to the size of their cloacal glands. The data indicated that the size of the cloacal gland was positively correlated with the frequency of foam secretion and total foam production. One gram of freshly collected clean foam was mixed with 1.0 mL of normal saline and homogenized for 10 minutes. After centrifugation at 35 000 rpm, the supernatant was used as 100% foam extract. The extract was diluted to 1:40, 1:20, 1:10, and 1:4 with normal saline to produce 2.5, 5.0, 10, and 25% foam extracts, respectively. 5% foam extract enhanced sperm survival at room temperature (30°–35°C for 2 to 3 hrs, whereas higher concentrations (10% and above suppressed sperm motility. From this study, it may be concluded that foam secretion and quantity of foam are directly proportional to the size of the cloacal gland and that the foam enhances and prolongs sperm motility, in vitro at an optimum concentration of 5%.

  4. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  5. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  6. The effects of “Beijing grass” in diets on growth performance, humoral antibody and carcass characteristics in quails

    Directory of Open Access Journals (Sweden)

    Chethanond, U.

    2005-08-01

    Full Text Available Pharmacological study on Beijing grass (Bj. grass: Murdannia loriformis showed immunomodulator and anticancer activities. Thus, the effect of Bj. grass in diets was investigated in Japanese quails (aged 0-6 weeks on growth performances, humoral immunity and carcass characteristics. 708 1-day-old quails (Corturnix type which had no vaccination program were used in this study. They were experimented using completely randomized design and were divided into 6 treatments consisted of 4 replications with 27-31 heads each. The treatments were assigned as follows: Treatment 1 (T1 no vaccination and no Bj.grass, Treatment 2 (T2 vaccination and no Bj.grass, Treatment 3 (T3 vaccination and 3% Bj.grass, Treatment 4 (T4 vaccination and 6% Bj.grass, Treatment 5 (T5 vaccination and 9% Bj.grass and Treatment 6 (T6 vaccination and 10% Bj.grass juice (w/v. Vaccination program by 1 Newcastle disease + Infectious Bronchitis and 2 Pox were given at 1 and 3 weeks. Approximately 25% of quails were bled for determination of packed cell volume, gamma globulin levels and ND-HI titers. All male quails were put to sleep at 6 weeks. The results showed weight gain in the 3rd week was different in treatments using Bj. grass and treatments using control diet which body weight gain reduced when the level of Bj. grass increased (p 0.05. It was noted that not more than 6% Bj. grass could be used in quail diet without abnormal clinical signs. However, the more grass showed the tendency of poor weight gain. There were no differences in packed cell volume or gamma IgG level and ND-HI titers did not reach protection level. For carcass characteristics, Bj. grass 3% in diet gave the best carcass characteristics. (p < 0.05 In addition there was a dose-related reduction of abdominal fat (P=0.001.

  7. Chemical composition of solar dried blood and the ruminal content and its effect on performance of Japanese quails.

    Science.gov (United States)

    Mishra, Jyotiprabha; Abraham, Robinson J J; Rao, V Appa; Rajini, R Asha; Mishra, B P; Sarangi, N R

    2015-01-01

    The aim was to determine the chemical composition of solar dried blood and rumen content (DBRC) and further ascertain the concentration at which DBRC could be included in Japanese quail diets without any adverse effect on its performance. Feeding trial on the effect of DBRC on performance of Japanese quails was studied up to 5 weeks. 252 numbers of day old (Nandanam Type III breed) Japanese quails were purchased from Poultry Research Station, Madhavaram and divided into 7 batches (control+ six treatments) each consisting of 36 birds. The DBRC was included at 0%, 5%, 10%, 15%, 20%, 25% and 30% in diets as control, treatment-1 (T1), treatment-2 (T2), treatment-3 (T3), treatment-4 (T4), treatment-5 (T5) and treatment-6 (T6) respectively in a completely randomized design to replace soybean meal in Japanese quail feed. The birds were provided with ad-labidum feed and drinking water ad-libitum during the entire experimental period. The crude protein (CP), crude fiber (CF), ether extract (EE) and ash contents of DBRC were 35.87%, 17.40%, 3.6% and 12.6%, respectively. The amount of essential amino acids and non-essential amino acid content were found to be 12.98 and 4.87 (g/100 g of feed) respectively in DBRC feed. Result showed that all birds fed DBRC diets performed better than the control group. Mortality was unaffected by dietary treatments. There was a significant difference (p<0.01) observed in weight gain in treatment groups compared to the control. Up to 30% DBRC could be incorporated in the diets of Japanese quails without any adverse effects on its performance.

  8. [The composition of lipids and lipid peroxidation in the pancreas of quails exposed to nitrates and correction by the amaranth's seeds].

    Science.gov (United States)

    Tsekhmistrenko, S I; Ponomarenko, N V

    2013-01-01

    Researches of features of lipid composition, functioning of the system of antioxidant defense, maintenance of lipid peroxidation products in the quail's pancreas on the early postnatal ontogenesis stages are conducted for actions of nitrates and feeding with amaranth's seeds in mixed fodder. The arrival of nitrates in the organism of quails results in the decline of general lipids maintenance and nonetherified fat acids in the pancreas. Using of amaranth's seeds in mixed fodder on the background of the nitrate loading results in the increase of activity of the enzimes system of antioxidant defence, the growth of general lipid level in the quail's pancreas. Thus in correlation with separate classes of lipid maintenance of cholesterol goes down for certain, whereas the maintenance of triacylglycerols and ethers of cholesterol rises. The results obtained in the researches show the ability of amaranth's seeds to avert oxidative stress in quail's pancreas under nitrates influence.

  9. Relationships between trunk performance, gait and postural control in persons with multiple sclerosis.

    Science.gov (United States)

    Freund, Jane E; Stetts, Deborah M; Vallabhajosula, Srikant

    2016-06-30

    Multiple sclerosis (MS) is a chronic progressive disease of the central nervous system. Compared to healthy individuals, persons with multiple sclerosis (PwMS) have increased postural sway in quiet stance, decreased gait speed and increased fall incidence. Trunk performance has been implicated in postural control, gait dysfunction, and fall prevention in older adults. However, the relationship of trunk performance to postural control and gait has not been adequately studied in PwMS. To compare trunk muscle structure and performance in PwMS to healthy age and gendered-matched controls (HC); to determine the effects of isometric trunk endurance testing on postural control in both populations; and to determine the relationship of trunk performance with postural control, gait and step activity in PwMS. Fifteen PwMS and HC completed ultrasound imaging of trunk muscles, 10 m walk test, isometric trunk endurance tests, and postural sway test. Participants wore a step activity monitor for 7 days. PwMS had worse isometric trunk endurance compared to HC. PwMS trunk flexion endurance negatively correlated to several postural control measures and positively correlated to gait speed and step activity. Clinicians should consider evaluation and interventions directed at impaired trunk endurance in PwMS.

  10. The influence of artificially increased trunk stiffness on the balance recovery after a trip.

    Science.gov (United States)

    van der Burg, J C E; Pijnappels, M; van Dieën, J H

    2007-07-01

    Falls occur frequently in the growing population of elderly. Since trunk control is critical for maintaining balance, the higher trunk stiffness in elderly people compared to the general population has been associated with their increased fall-risk. Theoretically, trunk stiffness may be beneficial for balance recovery in walking, i.e. after a trip. A stiff joint may provide a torque that restricts the perturbation effects and thereby reduces the probability of a fall. The aim of this study was to test whether trunk stiffness impaired or assisted balance recovery after a trip during walking. An orthopedic corset was used to simulate trunk stiffness in 11 young male adults. Subjects walked over a platform, with or without the corset on, and were occasionally tripped over a hidden obstacle. Kinematics of the tripping reaction were measured. Initial trunk accelerations were significantly attenuated by the corset, which indicates a positive effect of the stiffening corset. However, no subsequent effects on peak trunk inclination and on the peak moment arm of gravity on the trunk were found. The pattern of trunk motion allowed ample time for triggered or voluntary muscle responses to be generated, before a substantial inclination occurred. It appears that such active responses were sufficient in the young subjects tested to obtain a similar net effect with or without the increased trunk stiffness induced by the corset.

  11. Continuous Static Gait with Twisting Trunk of a Metamorphic Quadruped Robot

    Directory of Open Access Journals (Sweden)

    C. Zhang

    2018-01-01

    Full Text Available The natural quadrupeds, such as geckos and lizards, often twist their trunks when moving. Conventional quadruped robots cannot perform the same motion due to equipping with a trunk which is a rigid body or at most consists of two blocks connected by passive joints. This paper proposes a metamorphic quadruped robot with a reconfigurable trunk which can implement active trunk motions, called MetaRobot I. The robot can imitate the natural quadrupeds to execute motion of trunk twisting. Benefiting from the twisting trunk, the stride length of this quadruped is increased comparing to that of conventional quadruped robots.In this paper a continuous static gait benefited from the twisting trunk performing the increased stride length is introduced. After that, the increased stride length relative to the trunk twisting will be analysed mathematically. Other points impacting the implementation of the increased stride length in the gait are investigated such as the upper limit of the stride length and the kinematic margin. The increased stride length in the gait will lead the increase of locomotion speed comparing with conventional quadruped robots, giving the extent that natural quadrupeds twisting their trunks when moving. The simulation and an experiment on the prototype are then carried out to illustrate the benefits on the stride length and locomotion speed brought by the twisting trunk to the quadruped robot.

  12. Trunk muscle attributes are associated with balance and mobility in older adults: a pilot study.

    Science.gov (United States)

    Suri, Pradeep; Kiely, Dan K; Leveille, Suzanne G; Frontera, Walter R; Bean, Jonathan F

    2009-10-01

    To determine whether trunk muscle attributes are associated with balance and mobility performance among mobility-limited older adults. Cross-sectional analysis of data from a randomized clinical trial. Outpatient rehabilitation research center. Community-dwelling older adults (N = 70; mean age 75.9 years) with mobility limitations as defined by the Short Physical Performance Battery (SPPB). Independent variables included physiologic measures of trunk extension strength, trunk flexion strength, trunk extension endurance, trunk extension endurance, and leg press strength. All measures were well tolerated by the study subjects without the occurrence of any associated injuries or adverse events. The association of each physiologic measure with each outcome was examined by the use of separate multivariate models to calculate the partial variance (R(2)) of each trunk and extremity measure. Balance measured by the Berg Balance Scale and Unipedal Stance Test and mobility performance as measured by the SPPB. Trunk extension endurance (partial R(2) = .14, P = .02), and leg press strength (partial R(2) = .14, P = .003) accounted for the greatest amount of the variance in SPPB performance. Trunk extension endurance (partial R(2) = .17, P = .007), accounted for the greatest amount of the variance in BBS performance. Trunk extension strength (R(2) = .09, P = .03), accounted for the greatest amount of the variance in UST performance. The variance explained by trunk extension endurance equaled or exceeded the variance explained by limb strength across all three performance outcomes. Trunk endurance and strength can be safely measured in mobility-limited older adults and are associated with both balance and mobility performance. Trunk endurance and trunk strength are physiologic attributes worthy of targeting in the rehabilitative care of mobility-limited older adults.

  13. Effects of Propolis, Royal Jelly, Bee Pollen and Ronozyme Supplementation in Diets of Japanese Quails (Coturnix Coturnix Japonica) on Yolk Lipid Peroxidation

    OpenAIRE

    Yılmaz S; Tatli Seven P; Kaya E

    2017-01-01

    This study discovers the possible effect propolis, royal jelly, bee pollen and Ronozyme supplementation in diets that can be beneficial for Japanese quails (Coturnix coturnix japonica). Total one hundred and sixty Japanese quails at 43 days of age were used and divided randomly into 4 replicate groups each containing 32 animals. The experimental groups as follows: control group was feed a basal diet, royal jelly group was added to the water with 500 mg/kg diet, propolis group was feed orally ...

  14. Infection levels of the eyeworm Oxyspirura petrowi and caecal worm Aulonocephalus pennula in the northern bobwhite and scaled quail from the Rolling Plains of Texas.

    Science.gov (United States)

    Dunham, N R; Peper, S T; Downing, C; Brake, E; Rollins, D; Kendall, R J

    2017-09-01

    Northern bobwhite (Colinus virginianus) and scaled quail (Callipepla squamata) have experienced chronic declines within the Rolling Plains ecoregion of Texas. Parasitic infection, which has long been dismissed as a problem in quail, has not been studied thoroughly until recently. A total of 219 northern bobwhite and 101 scaled quail from Mitchell County, Texas were captured and donated from 2014 to 2015, and examined for eyeworm (Oxyspirura petrowi) and caecal worm (Aulonocephalus pennula) infections. In 2014, bobwhites averaged 19.6 ± 1.8 eyeworms and 98.6 ± 8.2 caecal worms, and 23.5 ± 2.1 eyeworms and 129.9 ± 10.7 caecal worms in 2015. Scaled quail averaged 4.8 ± 1.0 eyeworms and 50 ± 6.8 caecal worms in 2014, and 5.7 ± 1.3 eyeworms and 38.1 ± 7.1 caecal worms in 2015. This study expands the knowledge of parasitic infection in quail inhabiting the Rolling Plains of Texas. A significant difference was documented in O. petrowi infection between species but there was no significant difference in A. pennula between quail species. No significant difference was detected in parasite infection between the sexes of both northern bobwhite and scaled quail. This study also documented the highest reported O. petrowi infection in both species of quail. Additional research is needed on the life history and infection dynamics of O. petrowi and A. pennula infections to determine if there are individual- and/or population-level implications due to parasitic infection.

  15. Productivity and selenium concentrations in egg and tissue of laying quails fed selenium from hydroponically produced selenium-enriched kale sprout (Brassica oleracea var. alboglabra L.).

    Science.gov (United States)

    Chinrasri, Orawan; Chantiratikul, Piyanete; Maneetong, Sarunya; Chookhampaeng, Sumalee; Chantiratikul, Anut

    2013-12-01

    This study aimed to determine the effectiveness of Se from hydroponically produced Se-enriched kale sprout (HPSeKS) on productive performance, egg quality, and Se concentrations in egg and tissue of laying quails. Two-hundred quails, 63 days of age, were divided into four groups. Each group consisted of five replicates and each replicate had ten birds, according to a completely randomized design. The experiment lasted for 6 weeks. The dietary treatments were T1 (control diet), T2 (control diet plus 0.2 mg Se/kg from sodium selenite), T3 (control diet plus 0.2 mg Se/kg from Se-enriched yeast), T4 (control diet plus 0.2 mg Se/kg from HPSeKS). The findings revealed that productive performance and egg quality of quails were not altered (p > 0.05) by Se sources. Whole egg Se concentrations of quails fed Se from HPSeKS and Se-enriched yeast were higher (p  0.05), but higher (p < 0.05) than that of quails fed Se from sodium selenite. The results reveal that Se from HPSeKS did not change the performance and egg quality of quails. The effectiveness of Se from HPSeKS was comparable to that of Se-enriched yeast, which was higher than that of Se from sodium selenite.

  16. Trunk muscle activation during moderate- and high-intensity running.

    Science.gov (United States)

    Behm, David G; Cappa, Dario; Power, Geoffrey A

    2009-12-01

    Time constraints are cited as a barrier to regular exercise. If particular exercises can achieve multiple training functions, the number of exercises and the time needed to achieve a training goal may be decreased. It was the objective of this study to compare the extent of trunk muscle electromyographic (EMG) activity during running and callisthenic activities. EMG activity of the external obliques, lower abdominals (LA), upper lumbar erector spinae (ULES), and lumbosacral erector spinae (LSES) was monitored while triathletes and active nonrunners ran on a treadmill for 30 min at 60% and 80% of their maximum heart rate (HR) reserve, as well as during 30 repetitions of a partial curl-up and 3 min of a modified Biering-Sørensen back extension exercise. The mean root mean square (RMS) amplitude of the EMG signal was monitored over 10-s periods with measures normalized to a maximum voluntary contraction rotating curl-up (external obliques), hollowing exercise (LA), or back extension (ULES and LSES). A main effect for group was that triathletes had greater overall activation of the external obliques (p runs, respectively, than with the curl-ups (p = 0.001). The back extension exercise provided less ULES (p = 0.009) and LSES (p = 0.0001) EMG activity than the 60% and 80% runs, respectively. In conclusion, triathletes had greater trunk activation than nonrunners did while running, which could have contributed to their better performance. Back-stabilizing muscles can be activated more effectively with running than with a prolonged back extension activity. Running can be considered as an efficient, multifunctional exercise combining cardiovascular and trunk endurance benefits.

  17. Survey Study of Trunk Materials for Direct ATRP Grafting

    Energy Technology Data Exchange (ETDEWEB)

    Saito, Tomonori [ORNL; Chatterjee, Sabornie [ORNL; Johnson, Joseph C. [ORNL; Dai, Sheng [ORNL; Brown, Suree [ORNL

    2015-02-01

    In previous study, we demonstrated a new method to prepare polymeric fiber adsorbents via a chemical-grafting method, namely atom-transfer radical polymerization (ATRP), and identified parameters affecting their uranium adsorption capacity. However, ATRP chemical grafting in the previous study still utilized conventional radiation-induced graft polymerization (RIGP) to introduce initiation sites on fibers. Therefore, the objective of the present study is to perform survey study of trunk fiber materials for direct ATRP chemical grafting method without RIGP for the preparation of fiber adsorbents for uranium recovery from seawater.

  18. A tutorial on queuing and trunking with applications to communications

    CERN Document Server

    Tranter, William H

    2012-01-01

    The motivation for developing this synthesis lecture was to provide a tutorial on queuing and trunking, with extensions to networks of queues, suitable for supplementing courses in communications, stochastic processes, and networking. An essential component of this lecture is MATLAB-based demonstrations and exercises, which can be easily modified to enable the student to observe and evaluate the impact of changing parameters, arrival and departure statistics, queuing disciplines, the number of servers, and other important aspects of the underlying system model. Much of the work in this lecture

  19. Effect of shed rooftype and babassu pie on the productive characteristics of meat quails

    Directory of Open Access Journals (Sweden)

    Jordane de Oliveira Borges

    2017-08-01

    Full Text Available We aimed to evaluate the effects of shed roof(SR typeand the inclusion of babassu pie (BP in rations on the productive characteristics ofmeat quailsfrom days 14 to 28 and days14 to 40. We studied 896 meatquails. The experimental design was completely randomized with a 4x4 factorial arrangement, using four types of shedroofs (fiber cement, ceramic, straw, and painted fiber cement and four rations (with 0, 5, 10, and 15% inclusion of babassu pie. The performance variables evaluated from 14 to 28 and 14 to 40 days included food intake (FI, g/bird, mean weight gain (WG, g/bird, food conversion (FC, g/g, mean live weight on day 28 (MW28, g/bird, mean live weight on day 40 (MW40, g/bird, and energy efficiency (EF; g Mcal. After slautherthe birds on day 40, we measured the carcass weight (CW and the carcass yield (CY, %, obtained for the breast (BY, legs (LGY, and wings (WINGY. We also obtained the relative weight of the heart (HRW, liver (LRW, gizzard (GRW, and intestine (IRW. To compare the economic efficiency between the experimental rations, we analyzed the cost of ration per kg of carcass (CC and determined the gross margin (GM. Between day 14 and day 28, we found that the use of SR influenced the FI28, WG28, and the MW28 of the quails (p 0.05, but it linearly improved WG28, FC28, MW28, and EF28. Between days 14 and 40, we found that SR influenced the WG40, FC40, MW40, and EF40 of the quails (p < 0.05 and that a BP increased the FI40, WG40, and MW40 in a quadratic manner. SR and BP did not affect the CW, BY, WINGY, LGY, HRW, LRW,or IRW. However, BP influenced MGRW, which increased linearly with the inclusion of BP. We concluded that a ceramic roof provides better environmental conditions than do other shed roofs. The inclusion of BP improved the performance characteristics, and it was technically feasible to include up to 15% BP in the rations of meat quails. Based on the current cost analysis, however, the inclusion of BP is economically

  20. The central role of trunk control in the gross motor function of children with cerebral palsy

    DEFF Research Database (Denmark)

    Curtis, Derek John; Butler, Penny; Saavedra, Sandy

    2015-01-01

    . The participants were tested using the Gross Motor Function Measure (GMFM), the Pediatric Evaluation of Disability Inventory (PEDI), and the Segmental Assessment of Trunk Control (SATCo). Results Linear regression analysis showed a positive relationship between the segmental level of trunk control and age......, with both gross motor function and mobility. Segmental trunk control measured using the SATCo could explain between 38% and 40% of variation in GMFM and between 32% and 37% of variation in PEDI. Interpretation This study suggests a strong association between segmental trunk postural control and gross motor...

  1. Assessing delay and lag in sagittal trunk control using a tracking task.

    Science.gov (United States)

    Reeves, N Peter; Luis, Abraham; Chan, Elizabeth C; Sal Y Rosas, Victor G; Tanaka, Martin L

    2018-05-17

    Slower trunk muscle responses are linked to back pain and injury. Unfortunately, clinical assessments of spine function do not objectively evaluate this important attribute, which reflects speed of trunk control. Speed of trunk control can be parsed into two components: (1) delay, the time it takes to initiate a movement, and (2) lag, the time it takes to execute a movement once initiated. The goal of this study is to demonstrate a new approach to assess delay and lag in trunk control using a simple tracking task. Ten healthy subjects performed four blocks of six trials of trunk tracking in the sagittal plane. Delay and lag were estimated by modeling trunk control for predictable and unpredictable (control mode) trunk movements in flexion and extension (control direction) at movement amplitudes of 2°, 4°, and 6° (control amplitude). The main effect of control mode, direction, and amplitude of movement were compared between trial blocks to assess secondary influencers (e.g., fatigue). Only control mode was consistent across trial blocks with predictable movements being faster than unpredictable for both delay and lag. Control direction and amplitude effects on delay and lag were consistent across the first two trial blocks and less consistent in later blocks. Given the heterogeneity in the presentation of back pain, clinical assessment of trunk control should include different control modes, directions, and amplitudes. To reduce testing time and the influence of fatigue, we recommend six trials to assess trunk control. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. Late morphological and functional changes caused by ionizing radiation in eggs of Japanese quail

    Energy Technology Data Exchange (ETDEWEB)

    Baumgartner, J; Grom, A; Csuka, J; Stasko, J; Kindlova, L [Vyskumny Ustav Chovu a Slachtenia Hydiny, Ivanka pri Dunaji (Czechoslovakia)

    1976-01-01

    Eggs of Japanese quail (Coturnix coturnix japonica) were irradiated before incubation with doses of 300, 500, 800, 1500, 2000 and 2500 R of /sup 60/Co gamma rays at a dose rate of 187 R/min. The parameters of hatchability, embryonic morphology in the last phases of development, growth changes, viability, sex ratio and production of eggs in the control and experimental groups were followed. Embryonic mortality was proportional to the dose, irradiation weakened the embryos, at doses of 800 R and more the radiation evoked various teratogenic changes and slightly lengthened the incubation period. For the period of embryonic development, LD/sub 50/ approximately equal to 800 R and LD/sub 100/=2500 R was determined. Radiation slightly suppressed growth, viability in the postembryonic stage was influenced very slightly. Irradiation of eggs did not influence the sex ratio; the production of eggs was significantly reduced only at a dose of 1500 R and more.

  3. Hormonal responses and tolerance to cold of female quail following parathion ingestion

    Science.gov (United States)

    Rattner, B.A.; Sileo, L.; Scanes, C.G.

    1982-01-01

    Thirty-week-old female bobwhite quail (Colinus virginianus), maintained at 26 + 1?C, were provided diets containing 0,25, or 100 ppm parathion ad libitum. After 10 days, birds were exposed to mild cold (6 + 1?C) for 4,8, 12, 24, or 48 hr. Brain acetylcholinesterase activity was inhibited in a dose-dependent manner in birds receiving 25 and 100 ppm parathion. Body weight, egg production, and plasma luteinizing hormone and progesterone concentrations were reduced in birds receiving 100 ppm parathion compared with other groups. Cold exposure did not alter plasma corticosterone levels in the 0- and 25-ppm parathion groups, but a two- to five fold elevation of plasma corticosterone was observed in birds fed 100 ppm parathion. These findings indicate that (i) short-term ingestion of parathion can impair reproduction possibly by altering gonadotropin or steroid secretion, and (ii) tolerance to cold may be reduced following ingestion of this organophosphate.

  4. Late morphological and functional changes caused by ionizing radiation in eggs of Japanese quail

    International Nuclear Information System (INIS)

    Baumgartner, J.; Grom, A.; Csuka, J.; Stasko, J.; Kindlova, L.

    1976-01-01

    Eggs of Japanese quail (Coturnix coturnix japonica) were irradiated before incubation with doses of 300, 500, 800, 1500, 2000 and 2500 R of 60 Co gamma rays at a dose rate of 187 R/min. The parameters of hatchability, embryonic morphology in the last phases of development, growth changes, viability, sex ratio and production of eggs in the control and experimental groups were followed. Embryonic mortality was proportional to the dose, irradiation weakened the embryos, at doses of 800 R and more the radiation evoked various teratogenic changes and slightly lengthened the incubation period. For the period of embryonic development, LD 50 approximately equal to 800 R and LD 100 =2500 R was determined. Radiation slightly suppressed growth, viability in the postembryonic stage was influenced very slightly. Irradiation of eggs did not influence the sex ratio; the production of eggs was significantly reduced only at a dose of 1500 R and more. (author)

  5. Activation of vitellogenin II gene expression by steroid hormones in the old Japanese quail.

    Science.gov (United States)

    Gupta, S; Upadhyay, R; Kanungo, M S

    1998-11-01

    Alterations in the basal transcription rates of eukaryotic genes are believed to involve the binding of trans-acting factor(s) with specific DNA sequences in the promoter. We show here two interrelated events for the VTGII gene of the old, non-egg laying Japanese quail: alterations in the structure of the chromatin encompassing the gene, and binding of trans-acting factors to the promoter of the gene. Estradiol/progesterone alone or together cause alterations in the conformation of the chromatin of the promoter region of the gene. This may allow free access of nuclear protein(s) to the cis-acting elements, ERE, PRE and NF1, in the promoter of the gene and cause activation of transcription.

  6. Non-leptonic kaon decays at large Nc

    Science.gov (United States)

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

    2018-03-01

    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  7. Short-term forecasting of turbidity in trunk main networks.

    Science.gov (United States)

    Meyers, Gregory; Kapelan, Zoran; Keedwell, Edward

    2017-11-01

    Water discolouration is an increasingly important and expensive issue due to rising customer expectations, tighter regulatory demands and ageing Water Distribution Systems (WDSs) in the UK and abroad. This paper presents a new turbidity forecasting methodology capable of aiding operational staff and enabling proactive management strategies. The turbidity forecasting methodology developed here is completely data-driven and does not require hydraulic or water quality network model that is expensive to build and maintain. The methodology is tested and verified on a real trunk main network with observed turbidity measurement data. Results obtained show that the methodology can detect if discolouration material is mobilised, estimate if sufficient turbidity will be generated to exceed a preselected threshold and approximate how long the material will take to reach the downstream meter. Classification based forecasts of turbidity can be reliably made up to 5 h ahead although at the expense of increased false alarm rates. The methodology presented here could be used as an early warning system that can enable a multitude of cost beneficial proactive management strategies to be implemented as an alternative to expensive trunk mains cleaning programs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Effects of Vojta method on trunk stability in healthy individuals.

    Science.gov (United States)

    Ha, Sun-Young; Sung, Yun-Hee

    2016-12-01

    Vojta reflex locomotion is important to main upright posture through stimulation of breast zone to patient with cerebral palsy. However, application in other diseases is no investigated. So, we determined the effects of stimulation of the breast zone on trunk stability in healthy individuals. Fourteen young healthy adults (7 males and 7 females) voluntarily participated in this study. The subjects were randomly divided into an experimental group (breast zone) and control group (arbitrary point). All groups were stimulated for 5 min on the left and right sides, respectively, for a total 10 times. We used the thickness of the external oblique abdominal muscle (EO), the internal oblique abdominal muscle, the transversus abdominis muscle (TrA), and the rectus abdominis muscles, as well as the area of the diaphragm by using ultrasonography. In the experimental group, the thickness of the TrA significantly increased during stimulation ( P <0.05) while the thickness of the EO significantly decreased ( P <0.05). Also, the area of diaphragm in inspiration was significantly different ( P <0.05). Therefore, stimulation of the breast zone may be effective to improve trunk stability through activation of the TrA muscle and the diaphragm.

  9. Performance and Fatty Acid Profile of Japanese Quails Fed on Diets Supplemented with Used Restaurant Oil

    International Nuclear Information System (INIS)

    El-Faramawy, A.A.; Fahmy, M.O.

    2005-01-01

    The experiment was designed to study the effects of replacing cotton seed oil (CSO) with Used Restaurant Oil (URO) in Japanese quail diets on performance, fatty acid composition of the carcass and egg and concentration of iodine metabolites. URO was added to the diets at 0, 1, 2 or 4 % at the expense of CSO (4 %) in the control diet during a 10-week trial period. Feed intake, weight gain, feed conversion, mortality rate, triiodothyronine (T3), and thyroxine (T4) were not significantly (p>0.05) affected by the levels of used restaurant ,oi). Replacing 25,% or 50 % of CSO with URO had no significant (p>0.05) effect on linoleic acid content of carcass and egg. In contrary, linoleic acid content was reduced significantly (p<0.05) in the carcass and egg of the group which fed on the diet with 4 % URO. It can be concluded that used restaurant oil can be supplemented to the Japanese quail diets at the levels of 1 % and 2 % without any determine effect on the performance and the fatty acid profile of carcass and egg. rat supplementation to broiler chicken is a long standing practice for improving the consistency and palatability of the diets; increasing the energy density of broiler meat; stimulating growth and utilization of food and energy; feed efficiency; egg size, yield, and hatch ability (Carew and Hill, 1964; Vermeersch and Vanschoubroek, 1968 and Summers and Lesson, 1979 ). Poultry required fat in the diet as a source of essential fatty acids and to facilitate supply and absorption of vitamins (Clarke et al, 1977). Oil may be added to poultry diets in order to meet the 1% linoleic acid requirements

  10. Diurnal rhythm of pituitary gonadotropic activity of male Japanese quail in relation to testicular growth

    International Nuclear Information System (INIS)

    Hashiguchi, Mineo; Koga, Osamu; Nishiyama, Hisayoshi

    1977-01-01

    Male Japanese quail were exposed to 14-hr (5:00-19:00) light:10-hr darkness (14 L:10D) from 1 day to 28 days of age and exposed to 8 L (5:00-13:00); 16D from 29 days to 49 days of age. Thereafter the birds were again transferred to 14L:10D for photostimulation. Gonadotropic activities of the anterior lobes of the pituitary were measured at various times during the 24-hr period in relation to testicular growth with a blossary method based on sup(32P)-uptake by one-day-old chick tests. The mean testicular weights increased from the 2nd to 35th day of exposure to 14L:10D and an abrupt increase was observed between the 7th and 21st day. Thereafter the weight reached a plateau. Under 8L:16D and on the 1st day of exposure to 14L:10D, no diurnal changes in the pituitary gonadotropic activity were observed but on the 2nd day the activity showed a peak at 19:00 (14 hr after the onset of light). On the 7th and 21st day, two peaks of the activity were found at 8:00 (3 hr after the onset of light) and 22:00 (17 hr after the onset of light or 3 hr after the onset of darkness). However, only one peak was found at 19:00 (14 hr after the onset of light) on the 35th and 49th day. These results indicate that the diurnal rhythm of pituitary gonadotropic activity of male quail appears after transfer of the birds from short days to long days, and that the diurnal pattern changes with photoperiodically induced testicular growth. (auth.)

  11. In ovo exposure quail assay for risk assessment of endocrine disrupting chemicals.

    Science.gov (United States)

    Kamata, Ryo; Takahashi, Shinji; Shimizu, Akira; Morita, Masatoshi; Shiraishi, Fujio

    2006-12-01

    Although there are in vivo assays using various organisms for the risk assessment of chemicals with endocrine disrupting properties, effective experimental methods for avian species are still under debate. We have developed an in ovo exposure assay using Japanese quail eggs, aimed at assessing disrupting effects on avian reproductive development and function. Hybrid eggs from Brazilian Brown male and White Egg female quails, which can be genetically sexed by their plumage color after hatching, were prepared, and test materials dissolved in olive oil were injected into the air-chamber on day 10 of incubation. After sexual maturation of hatched chicks, we observed egg production by females and the egg quality and male-typical reproductive behavior, and then examined reproductive system morphology and serum steroid concentrations in both sexes. Treatment with a synthetic estrogen, diethylstilbestrol (DES, 0.5-50 ng/g egg), dose-dependently reduced the eggshell thickness and strength of eggs. A few females treated with 5 ng/g DES per egg produced soft-shelled/ unmarked eggs, and all laying females treated with 50 ng/g egg produced eggs completely lacking shells. DES also induced shortening of the left oviduct and abnormal development of the right oviduct in a dose-dependent manner, while testis weight was reduced symmetrically. In addition, 2,2',4',6'-tetrachlorobiphenyl-4-ol (10-1,000 ng/g egg), which previously showed relatively high estrogenic activity in vitro, caused dose-dependent shortening of the left oviduct and reduction in testis weight. The methods for evaluating endocrine disrupting effects and preparing experimental birds proposed in the present study are expected to facilitate assays for avian reproductive toxicology.

  12. Enterococci Isolated from Japanese Quails Exposed to Microgravity Conditions and Stability of their Properties

    Directory of Open Access Journals (Sweden)

    Andrea Lauková

    2009-01-01

    Full Text Available Enterococci isolated from the crop and caecum of Japanese quails exposed to 7 day conditions of microgravity were re-vitalized after their dry-freezing long storage. Originally, the strains were isolated from Japanese quails after their landing from flight onboard the orbital station Mir during the experiment in August 1990. Because taxonomy as well as the studies concerning the bacteriocins, especially those produced by enterococci, have been continually developed for years, the aim of this study was to confirm species identification, stability of the properties of enterococci as well as to test new properties after their long storage. Genotyping allotted the strains to the species E. faecium. Lactic acid production was detected in similar amounts in the strains before and after their long-storage in dry-frozen form. The strains were vancomycinsensitive and kanamycin-resistant before as well as after their long-time storage. Variability in sensitivity to different antibiotics was found among the strains tested even before and after longtime storage. Each of the strains possessed at least one structural enterocin gene. The structural genes for enterocin A, P, B, L50B were detected in E. faecium EP7. E. faecium EP2, EEP4 have the genes for ent A, B, L50B. The gene for ent P was detected only in the strain EP7. The most often detected was ent A gene followed by ent genes B, L50B. All strains inhibited growth of at least 4 out of 15 indicators. The stability of the enterococcal properties determined before as well as after their dry-freezing was not influenced during their long-term storage; moreover, new properties were determined.

  13. Adjustment of equations to predict the metabolizable energy of corn for meat type quails

    Directory of Open Access Journals (Sweden)

    Tiago Junior Pasquetti

    2015-08-01

    Full Text Available The metabolizable energy (ME determination for foods used in quail diets, through metabolism assays, takes time, infrastructure and financial resources, which makes the development of prediction equations based on proximal composition of foods to estimate the ME values of particular interest. The objective of this study was to adjust the prediction equations of metabolizable energy (ME of corn for quail. The chemical compositions of 12 maize varieties were determined and a metabolism assay was carried out in order to determine the apparent metabolizable energy (AME and nitrogen-corrected apparent metabolizable energy (AMEn of these corn varieties. The values of chemical composition, AME and AMEn, converted to dry matter, were used to adjust the prediction equations. The initial adjustment of simple and multiple linear regression of the AME and AMEn was performed using the values of crude protein (CP, ether extract (EE, neutral (NDF and acid (ADF detergent fiber, mineral matter (MM, calcium (Ca and phosphorus (P as regressors (full model. To adjust the prediction equations the statistical procedure of simple and multiple linear regression was used, with the technique of indirect elimination (Backward. There was adjustment of 10 prediction equations, in which five were for AME and another five for AMEn, the R² values of which ranged from 0.20 to 0.75 and from 0.21 to 0.78, respectively. For all adjusted equations, negative correlations for MM were observed, which may be related to its dilutive effect of the gross energy contained in corn. In conclusion, the equations that showed better adjustment were AME= 5605.46 - 385.074CP + 111.648EE + 48.1133NDF + 303.924ADF - 929.931MM (R²= 0.75 and AMEn= 5878.16 - 403.937CP + 81.9618EE + 41.8954NDF + 303.506FDA - 901.621MM (R²= 0.78.

  14. ORF Sequence: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

  15. ORF Sequence: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  16. ORF Sequence: NC_003078 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  17. ORF Sequence: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  18. ORF Sequence: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

  19. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

  20. ORF Sequence: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  1. ORF Sequence: NC_003279 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

  2. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

  3. ORF Sequence: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

  4. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

  5. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

  6. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

  7. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

  8. Effect of boiled oil as dietary supplements for Japanese Quail on serum protein fractions and intestinal and hepatic cells

    International Nuclear Information System (INIS)

    Faramawy, A.A.; Soliman, S.M.; Fahmy, Y.M.O.

    2006-01-01

    This study was designed to examine the levels of serum protein fractions and testosterone, in addition to histopathological changes of small intestine and liver of Japanese quail following feeding with diets containing different concentrations of boiled oil (BO). Male Japanese quails (n=120), arranged into four groups each of three replicates, were supplemented with BO at 1%, 2% and 4% at the expense of 4% cotton seed oil (CSO). At the end of the experiment (10 weeks), three birds from each replicate were slaughtered and serum, small intestine and liver were collected for the determination of total testosterone, total protein, albumin and globulin fractions and fat studying the histology of small intestine and liver. The data revealed that feeding with BO led to decrease of total proteins and β-globulins in addition to cellular damages of small intestine and liver. This effect was increased with increasing the BO concentration in the diet

  9. Trunk and hip biomechanics influence anterior cruciate loading mechanisms in physically active participants.

    Science.gov (United States)

    Frank, Barnett; Bell, David R; Norcross, Marc F; Blackburn, J Troy; Goerger, Benjamin M; Padua, Darin A

    2013-11-01

    Excessive trunk motion and deficits in neuromuscular control (NMC) of the lumbopelvic hip complex are risk factors for anterior cruciate ligament (ACL) injury. However, the relationship between trunk motion, NMC of the lumbopelvic hip complex, and triplanar knee loads during a sidestep cutting task has not been examined. To determine if there is an association between multiplanar trunk motion, NMC of the lumbopelvic hip complex, and triplanar knee loads with ACL injury during a sidestep cutting task. Descriptive laboratory study. The hip and knee biomechanics and trunk motion of 30 participants (15 male, 15 female) were analyzed during a sidestep cutting task using an optoelectric camera system interfaced to a force plate. Trunk and lower extremity biomechanics were calculated from the kinematic and ground-reaction force data during the first 50% of the stance time during the cutting task. Pearson product moment correlation coefficients were calculated between trunk and lower extremity biomechanics. Multiple linear regression analyses were carried out to determine the amount of variance in triplanar knee loading explained by trunk motion and hip moments. A greater internal knee varus moment (mean, 0.11 ± 0.12 N·m/kg*m) was associated with less transverse-plane trunk rotation away from the stance limb (mean, 20.25° ± 4.42°; r = -0.46, P = .011) and a greater internal hip adduction moment (mean, 0.33 ± 0.25 N·m/kg*m; r = 0.83, P < .05). A greater internal knee external rotation moment (mean, 0.11 ± 0.08 N·m/kg*m) was associated with a greater forward trunk flexion (mean, 7.62° ± 5.28°; r = 0.42, P = .020) and a greater hip internal rotation moment (mean, 0.15 ± 0.16 N·m/kg*m; r = 0.59, P = .001). Trunk rotation and hip adduction moment explained 81% (P < .05) of the variance in knee varus moment. Trunk flexion and hip internal rotation moment explained 48% (P < .05) of the variance in knee external rotation moment. Limited trunk rotation displacement

  10. Muscular condition and trunk stability in judoka of national and international level

    Directory of Open Access Journals (Sweden)

    Casto Juan-Recio

    2013-12-01

    Full Text Available Background: It is theorized that the development of the ability to stabilize the trunk may improve the performance of a judoka because it improves body balance control and optimizes force transmission from the lower extremities to the upper limbs. However, there is a lack of scientific evidence to establish a clear relationship between trunk stability and performance in judo.Aim: The purpose of this study was to determine whether the quantification of trunk stability and muscular strength and endurance allowed differentiation between national level (n = 7 and international level judoka (n = 6. In addition, the relationship between trunk stability and muscular strength and endurance of the muscles involved in trunk stability control was analyzed.Method: To assess trunk stability, trunk responses to sudden loads applied by a pneumatic mechanism were analyzed, as well as trunk postural control through an unstable sitting paradigm. Muscular strength and endurance were assessed via a flexion and extension trunk test using an isokinetic dynamometer.Results/Conclusions: International level judokas showed lower CoP displacement in the most complex task in unstable seat (7.00 ± 1.19 vs 8.93 ± 1.45 mm, T = .025 and higher absolute and relative peak torque in extensor muscles (7.05 ± 0.87 vs 5.74 ± 0.72 Nm, T = .013 than national level judoka. According to these results, core stability and trunk muscular condition are important qualities in the physical training of elite judoka. Correlational analysis found no relation between the analyzed variables, thus muscular strength and endurance appear to have a non-significant effect on performance in the trunk stability tests.

  11. Steps for arm and trunk actions of overhead forehand stroke used in badminton games across skill levels.

    Science.gov (United States)

    Wang, Jianyu; Liu, Wenhao; Moffit, Jeffrey

    2009-08-01

    The purpose of this study was to examine arm and trunk actions in overhead forehand strokes used in badminton games across skill levels. The participants were 80 students (40 boys, 40 girls) who were randomly selected from video recordings of 300 students ages 16 to 19 years. The videotaped performances of overhead forehand strokes were coded based on three steps of arm action (elbow flexion, elbow and humeral flexion, and upward backswing) and three steps of trunk action (no trunk action, forward-backward movement, and trunk rotation). Students across the four skill levels exhibited different patterns of arm and trunk actions. Students at advanced levels used more mature arm and trunk actions.

  12. Modified saponification and HPLC methods for analyzing carotenoids from the retina of quail: implications for its use as a nonprimate model species.

    Science.gov (United States)

    Toomey, Matthew B; McGraw, Kevin J

    2007-09-01

    To investigate carotenoid content in the retina of Japanese quail (Coturnix japonica), for comparison with carotenoids in human retina, and to assess the effects of different saponification procedures on the recovery of quail retinal carotenoids. Extracted retinal carotenoids were saponified with methods adapted from recent studies, then identified and quantified with reverse-phase high-performance liquid chromatography (HPLC). To assess the effects of saponification conditions on carotenoid recovery from quail retina, we varied base concentration and the total time of saponification across a wide range and again used HPLC to compare carotenoid concentrations among conditions. Astaxanthin and galloxanthin were the dominant carotenoids recovered in the quail retina, along with smaller amounts of five other carotenoids (lutein, zeaxanthin, 3'-epilutein, epsilon-carotene, and an unidentified carotenoid). Astaxanthin was sensitive to saponification conditions; recovery was poor with strong bases (0.2 and 0.5 M KOH) and best with weak bases (0.01 and 0.2 M KOH). In contrast, xanthophyll carotenoids (galloxanthin, zeaxanthin, lutein, 3'-epilutein, and the unknown) were best recovered with strong base after 6 hours of saponification at room temperature. The recovery of epsilon-carotene was not affected by saponification conditions. Separate chemical hydrolysis procedures--using a strong base to recover xanthophylls and a weak base to recover astaxanthin--should be used for maximizing recovery of quail retinal carotenoids. Because the dominant carotenoids in quail retina are absent in human retina, and because of their different packaging (e.g., esterified in oil droplets) and light-absorbance properties compared with xanthophylls in the human eye, use of the quail as a model organism for studying human retinal carotenoids should be approached with caution.

  13. The effect of diet and host genotype on ceca microbiota of Japanese quail fed a cholesterol enriched diet.

    Science.gov (United States)

    Liu, Shasha; Bennett, Darin C; Tun, Hein M; Kim, Ji-Eun; Cheng, Kimberly M; Zhang, Hongfu; Leung, Frederick C

    2015-01-01

    Two Japanese quail strains, respectively atherosclerosis-susceptible (SUS) and -resistant (RES), have been shown to be good models to study cholesterol metabolism and transportation associated with atherosclerosis. Our objective was to examine possible difference in cecal microbiota between these strains when fed a control diet and a cholesterol enriched diet, to determine how host genotype and diet could affect the cecal microbiome that may play a part in cholesterol metabolism. A factorial study with both strains and two diets (control, cholesterol) was carried out. Cecal content was collected from 12 week old quail that have been on their respective diets for 6 weeks. DNA was extracted from the samples and the variable region 3-5 of the bacterial 16S rRNA gene was amplified. The amplicon libraries were subjected to pyrosequencing. Principal Component Analysis (PCA) of β-diversity showed four distinct microbiota communities that can be assigned to the 4 treatment groups (RES/control, RES/cholesterol, SUS/control, SUS/cholesterol). At the Phylum level, the 4 treatment groups has distinct Firmicutes community characteristics but no significant difference in Bacteroidetes. Eubacterium dolichum was rare in RES/control but became overabundant in RES/cholesterol. An unclassified species of Lactobacillaceae was found in abundance in SUS/control but the same species was rare in RES/cholesterol. On the other hand, two Lactobacillus species were only found in RES/control and an unclassified Lachnospiraceae species was abundant in RES/cholesterol but rare in SUS/control. The abundance of four species of Lachnospiraceae, three species of Ruminococcaceae and one species of Coprobacillaceae was positively correlated with plasma Total Cholesterol, plasma LDL, and LDL/HDL ratio. Our study of cecal microbiota in these quail has demonstrated that selection for susceptibility/resistance to diet induced atherosclerosis has also affected the quail's cecal environment to host

  14. Effect of Different Levels of Artichoke (Cynara scolymus L. Leaf Powder on the Performance and Meat Quality of Japanese Quail

    Directory of Open Access Journals (Sweden)

    Abbasi F

    2014-12-01

    Full Text Available A total of 240 Japanese quail chicks (1 d old were used in a 42-d trial to study the effects of Artichoke leaf powder and vitamin E on growth performance and meat quality. This experiment was performed as a completely randomized design with 4 replicates of 15 quails in each, using a 4×2 factorial arrangement with diet and gender as the main effects. Four dietary treatments were formulated by addition of 2 levels (1.5 and 3 percent of Artichoke leaf powder and 300 mg/Kg vitamin E to the basal diet. Results showed that supplementing the basal diet with Artichoke leaf powder and vitamin E significantly affected growth performance at 21 d of age (P. Dietary treatments significantly affected 2-thiobarbituric acid-reactive substance (TBARS and water holding capacity (WHC values of breast meat (P. The value of TBARS in breast meat was not affected by dietary levels of Artichoke leaf powder, whereas the value decreased significantly by vitamin E treatment (P. Quails receiving 1.5 percent Artichoke leaf powder and 300 mg/Kg vitamin E had significantly lower breast meat WHC than those  receiving the basal diet (P. Breast meat crude fat and WHC were affected by gender (P. Dietary 3 percent Artichoke leaf powder increased the b* values of thigh meat compared with the control. The lightness of thigh and breast meat and also redness of thigh meat were affected by gender (P. In general, the results indicated that supplementation of diet by Artichoke leaf powder did not improve growth performance of quails, but may have a potential to improve the oxidative stability and meat quality.

  15. Appraisal and standardization of curvilinear velocity (VCL) cut-off values for CASA analysis of Japanese quail (Coturnix japonica) sperm.

    Science.gov (United States)

    Farooq, U; Malecki, I A; Mahmood, M; Martin, G B

    2017-06-01

    One of the basic steps in objective analysis of sperm motility is the subdivision of a motile sperm population into slow, medium and rapid categories based on their velocity. However, for CASA analysis of quail sperm, the velocity values for categorization of slow, medium and rapid sperm have not yet been standardized. To identify the cut-off values of "velocity curvilinear" (VCL) for quail sperm categorization, we captured and analysed 22,300 tracks of quail sperm using SCA ® -CASA. The median and mean VCL values were 85 and 97 μm/s. To define the VCL cut-off values, we used two methods. In the first, we identified the upper (rapid sperm) and lower (slow sperm) cut-off values using: (i) median VCL ± 25% or ± 50% or ± 75% of median VCL value; (ii) first and third quartile values of VCL data (i.e. 25% cut-off setting); and (iii) 33% and 66% of VCL data. Among these settings, sperm categories and their corresponding motility characteristics recorded using the "25%" setting (i.e. slow ≤36 ≤ medium ≤154 ≤ rapid) were found the most realistic and coherent with male ranking by fertility. In the second method, we calculated heteroscedasticity in the total VCL data using PCA and the two-step clustering method. With this approach, the mean of the high and low clusters was 165 and 51 μm/s, respectively. Together, the mean from two methods suggested that, for SCA ® -CASA categorization of quail sperm, sperm should be classed as "rapid" at VCL ≥160 μm/s and "slow" at VCL ≤45 μm/s. © 2017 Blackwell Verlag GmbH.

  16. The role of heat shock protein 70 in oxidant stress and inflammatory injury in quail spleen induced by cold stress.

    Science.gov (United States)

    Ren, Jiayi; Liu, Chunpeng; Zhao, Dan; Fu, Jing

    2018-05-15

    The aim of this study was to investigate the role of heat shock protein 70 (Hsp70) in oxidative stress and inflammatory damage in the spleen of quails which were induced by cold stress. One hundred ninety-two 15-day-old male quails were randomly divided into 12 groups and kept at 12 ± 1 °C to examine acute and chronic cold stress. We first detected the changes in activities of antioxidant enzymes in the spleen tissue under acute and chronic cold stress. The activities of glutathione peroxidase (GSH-Px) fluctuated in acute cold stress groups, while they were significantly decreased (p stress. The activities of superoxide dismutase (SOD), inducible nitric oxide synthase (iNOS), and nitric oxide (NO) content were decreased significantly (p stress groups. Malondialdehyde (MDA) content was significantly increased (p stress except the 0.5 h group of acute cold stress. Besides, histopathological analysis showed that quail's spleen tissue was inflammatory injured seriously in both the acute and chronic cold stress groups. Additionally, the inflammatory factors (cyclooxygenase-2 (COX-2), prostaglandin E synthase (PTGES), iNOS, nuclear factor-kappa B (NF-κB), and tumor necrosis factor-a (TNF-α)) and Hsp70 mRNA levels were increased in both of the acute and chronic cold stress groups compared with the control groups. These results suggest that oxidative stress and inflammatory injury could be induced by cold stress in spleen tissues of quails. Furthermore, the increased expression of Hsp70 may play a role in protecting the spleen against oxidative stress and inflammatory damage caused by cold stress.

  17. Effect of using different levels of Nigella sativa meal on the growth performance and meat quality of Japanese quails

    Directory of Open Access Journals (Sweden)

    Tayebeh Mousapour

    2014-08-01

    Full Text Available This study was conducted to investigate the effects of dietary Nigella sativa meal (NSM on the growth performance, blood parameters, carcass characteristics, egg yolk cholesterol and meat quality in Japanese quail. For this purpose 300 one-day old Japanese quail chicks in a completely randomized design was used with five treatments in four replicates containing 15 birds each(. The experimental diets were control group (without NSM and diets containing 5, 10, 15 and 20% of NSM. Feed intake of birds fed diets with 5 and 15% of NSM were statistically higher than control group. Weight gain in birds fed with 15% of NSM was significantly higher than control group. Feed conversion ratio of birds fed diets with 20% of NSM was statistically higher than control. No significant treatment effect was observed on egg yolk cholesterol, blood parameters (including triglyceride, HDL and total cholesterol concentrations and meat quality parameters (TBA, WHC, Dripping loss, Cooking loss. And also the use of different levels of NSM had no any significant effect on internal organs weight, except gizzard. NSM significantly decreased feed costs compared to control group. So, by using NSM up to 15% in Japanese quails diets, can improve weight gain and feed conversion ratio and decrease feed and meat production costs.

  18. Effect of different levels of selenium and vitamin E on blood biochemical parameters in the Japanese quail

    Directory of Open Access Journals (Sweden)

    hossein zadeh adamnejad

    2015-11-01

    Full Text Available Co-administration of vitamin E and selenium has positive effects on growth performance of avian species, but their effect is not fully elicited in the Japanese quail. Also, controversial reports exist for the effect of vitamin E and selenium on avian performance. This study was designed to investigate the effect of different levels of selenium (0, 0.2 and 0.4 mg/kg and vitamin E (0, 150 and 300 mg/kg in the diet of the Japanese quail. Birds received mesh diet from the start of the study, then selenium and vitamin E were added on day 17. At the end of the study, after food deprivation for 6 hours, Japanese quail (1 male and 1 female were selected and blood samples collected for biochemical investigations and determination of glucose, albumin, total protein, cholesterol, triglyceride, HDL and LDL levels. There was significant decrease in cholesterol, glucose, and triglyceride levels and significant decrease in albumin and total protein levels on day 35 (p

  19. Effect of using garlic or curcumin or parsley on the growth performance, meat and egg quality of Japanese quail

    International Nuclear Information System (INIS)

    El-Faramawy, A.A.; Fahmy, M.O.; Wakwak, M.M.

    2006-01-01

    Two grams of powdered garlic or curcumin or parsley were added separately to each kg of the diet of unsexed Japanese quail aged one day old in an attempt to evaluate growth performance, serum cholesterol, triiodothyronine hormone, small intestine thickness and caecal microbial count to improve meat quality and egg production. The quails were hold in equal 4 groups; each group contained three replicates of 30 birds. Birds were watered and fed ad libitum for 7 weeks then 69 chicks from each group (6 males and 17 females for each replicate) were transferred into laying cages for another 6 weeks while 3 birds from each replicate were slaughtered for serum cholesterol, triiodothyronine, small intestine thickness, microbial count and carcass fatty acid determination. The data revealed that addition of each of the tested herb supplements caused significant increase in body weight, while there was non-significant changes in serum cholesterol, T3, small intestine thickness and total bacterial count. In addition, there was significant increase in unsaturated fatty acids and significant decrease in saturated fatty acids of carcass. The three additives caused remarkable increases in egg production and hatch ability %, besides augmenting the fertility % and number of ovarian follicles. It may be concluded that addition of 2g garlic or curcumin or parsley powder to each kg of the diet of Japanese quail favored consumer expectation in relation to meat quality and egg production and prolonged feed preservation

  20. Immunocytochemical distribution of glial fibrillary acidic protein in the central nervous system of the Japanese quail (Coturnix coturnix japonica).

    Science.gov (United States)

    Cameron-Curry, P; Aste, N; Viglietti-Panzica, C; Panzica, G C

    1991-01-01

    In the present study we detailed the distribution of GFAP-immunopositive structures within the central nervous system of the Japanese quail. Different fixation and embedding procedures were applied. The best results were obtained on frozen cryostatic sections from freshly dissected brains subsequently fixed by a short immersion in cold acetone. Immunopositive structures were observed both with immunofluorescence, and with immunoperoxidase methods. Immunoreactive cell bodies and processes were observed within the whole central nervous system, and different cell types can be identified on the basis of their topographical location and morphology. A first class of astrocytes is composed of intensely stained unipolar cells lining the inner surface of the pia mater and the large blood vessels. A second type is represented by multipolar astrocytes of variable size, provided with an irregular cell body. The last type is represented by similar elements, showing an immunonegative cell body, that can be identified only by the presence of converging processes. These three types of cells, and several isolated processes, show a differential distribution within the quail central nervous system, both in the grey and in the white matter. Present results suggest that GFAP may represent a good marker for at least part of the astroglial population in quail.

  1. Effect of dietary fat type on the fatty acids composition of irradiated and frozen storage japanese quails meat

    International Nuclear Information System (INIS)

    Abd EI-Wahab, S. A.

    2009-01-01

    The effect of substitution of dietary cotton seed oil (CSO) by used restaurant oil (URO) with different percentages 25% group 2 (G2), 50% group 3 (G3) and 100% group 4 (G4) in Japanese quail diets on the fatty acids composition of their meat especially polyunsaturated fatty acids (PUFA). The effect of gamma irradiation doses (1.5, 3 and 5 kGy) at frozen storage -18 C (degree) for 2 and 4 months in comparison with unirradiated and un storage were studied. The total saturated fatty acids (SFA) in quail meat fed G4 diet (100% URO) increased significantly in comparison with SFA in G2 (25% URO) and G3 (50% URO) but there is no significant effect with G2 and G3 in comparison with G1 (100% CSO).The monounsaturated fatty acids (MUFA) and polyunsaturated fatty acids (PUFA) were not affected by G2 and G3 diet. Also, linoleic acid (C 18:2, n-6) had the same trend in those groups with range (32.75% to 33.35%). It is concluded that feeding a diet with URO 25% and 50% conserve the content of linoleic acid and the content of PUFA in quail meat. The irradiation doses and storage periods had no significant effect on the linoleic acid, MUFA and PUFA content.

  2. Effect of probiotic supplementation on organic feed to alternative antibiotic growth promoter on production performance and economics analysis of quail.

    Science.gov (United States)

    Lokapirnasari, W P; Dewi, A R; Fathinah, A; Hidanah, S; Harijani, N; Soeharsono; Karimah, B; Andriani, A D

    2017-12-01

    The purpose of this study was to know the production performance and economic analysis in quail which use probiotic supplementation to alternate antibiotic growth promoter (AGP) to feed consumption, water consumption, egg production, egg mass, feed conversion, and feed efficiency. About 240 quails ( Coturnix coturnix japonica) at 14 weeks of age were completely randomized into four treatments, each treatment consisted of six replications and each replication consisted by 10 heads. The treatment was T0 (organic feed without AGP and without probiotic), T1 (organic feed + 0.001% AGP), T2 (organic feed + 0.005% probiotic in feed), and T3 (organic feed + 0.005% probiotic in drinking water). The probiotic consist of 1.2×10 5 CFU/g of Lactobacillus casei and Lactobacillus rhamnosus . The results showed that the probiotic supplementation both in feed and water give a significant impact to feed consumption, water intake, feed conversion, feed efficiency, and quail day production, but no statistical difference of egg mass. The T3 also show the most profitable business analysis, which has the best result in income, profit, break-even point, return cost ratio, benefit-cost ratio, and return on investment. It can be concluded that giving 0.005% probiotic in drinking water to get the best egg production and profit.

  3. Traceability of animal meals in Japanese quail eggs using the technique of 13C e 15N* stable isotopes

    Directory of Open Access Journals (Sweden)

    C Mori

    2013-03-01

    Full Text Available The objective of this study was to trace the inclusion of bovine meat and bone meal (BMBM in the diet of Japanese quails by analyzing eggs and egg fractions (yolk and albumen by the technique of carbon-13 (13C and nitrogen-15 (15N stable isotopes. In the trial, 120 Japanese quails were distributed in six treatments with four replicates of five birds each. The following treatments were applied: feed based on corn and soybean meal, containing graded BMBM inclusions (0, 1, 2, 3, 4 or 5%. After 42 days, 20 eggs per treatment were randomly collected for three consecutive days. Ten eggs were used for yolk and albumen sample collection, and ten for total egg sample collection. It was possible to detect the dietary inclusion of 1% BMBM in the egg and its fractions. Therefore, the technique of isotopes 13C and 15N is able of tracing since 1% inclusion level of BMBM in the diet of Japanese quails in eggs and their fractions.

  4. Changes in Trunk and Head Stability in Children with Cerebral Palsy after Hippotherapy: A Pilot Study

    Science.gov (United States)

    Shurtleff, Tim L.; Engsberg, Jack R.

    2010-01-01

    Hippotherapy (HPOT) is a therapy that uses horse movement. This pilot investigation objectively evaluated the efficacy of HPOT in improving head/trunk stability in children with cerebral palsy (CP). The participants were six children with spastic diplegia and six children without disability. Head and trunk stability was challenged by using a…

  5. Ultrasound-guided drainage of subcutaneous abscesses on the trunk is feasible

    DEFF Research Database (Denmark)

    Kjær, Søren; Rud, Bo; Bay-Nielsen, Morten

    2013-01-01

    Subcutaneous trunk abscesses are frequent, and current treatment options generally involve incision. By contrast, the standard care for breast abcesses is ultrasound-guided drainage. The aim of this study was to evaluate the feasibility of ultrasound-guided drainage combined with antibiotics...... in the treatment of subcutaneous abscesses on the trunk....

  6. Effect of Ankle Mobility and Segment Ratios on Trunk Lean in the Barbell Back Squat

    DEFF Research Database (Denmark)

    Fuglsang, Emil I; Telling, Anders S; Sørensen, Henrik

    2017-01-01

    , injuries are common, and people with a history of lower back pain are especially vulnerable. Past studies have shown that higher trunk angles (less forward lean) generate less stress on the lower back; thus, it seems appropriate to investigate the factors presumed to influence the trunk angle. Therefore...

  7. Trunk position modulates anterior cruciate ligament forces and strains during a single-leg squat

    NARCIS (Netherlands)

    Kulas, Anthony S.; Hortobagyi, Tibor; DeVita, Paul

    Background: Although the squat exercise and its variations are commonly prescribed for anterior cruciate ligament rehabilitation, whether trunk position affects these ligament forces and strains during the squat is unclear. Our purpose was to evaluate the effects of trunk position on anterior

  8. Three-dimensional trunk kinematics in golf: between-club differences and relationships to clubhead speed.

    Science.gov (United States)

    Joyce, Christopher; Burnett, Angus; Cochrane, Jodie; Ball, Kevin

    2013-06-01

    The aims of this study were (i) to determine whether significant three-dimensional (3D) trunk kinematic differences existed between a driver and a five-iron during a golf swing; and (ii) to determine the anthropometric, physiological, and trunk kinematic variables associated with clubhead speed. Trunk range of motion and golf swing kinematic data were collected from 15 low-handicap male golfers (handicap = 2.5 +/- 1.9). Data were collected using a 10-camera motion capture system operating at 250 Hz. Data on clubhead speed and ball velocity were collected using a real-time launch monitor. Paired t-tests revealed nine significant (p golf swing kinematics, namely trunk and lower trunk flexion/extension and lower trunk axial rotation. Multiple regression analyses explained 33.7-66.7% of the variance in clubhead speed for the driver and five-iron, respectively, with both trunk and lower trunk variables showing associations with clubhead speed. Future studies should consider the role of the upper limbs and modifiable features of the golf club in developing clubhead speed for the driver in particular.

  9. Screen time viewing behaviors and isometric trunk muscle strength in youth

    DEFF Research Database (Denmark)

    Grøntved, Anders; Ried-Larsen, Mathias; Froberg, Karsten

    2013-01-01

    The objective of this study was to examine the association of screen time viewing behavior with isometric trunk muscle strength in youth.......The objective of this study was to examine the association of screen time viewing behavior with isometric trunk muscle strength in youth....

  10. Researchers and stakeholders shape advances in management of tree and vine trunk-disease complexes

    Science.gov (United States)

    The grapevine trunk-disease complex limits grape production and vineyard longevity worldwide. Every vineyard in California eventually is infected by one or more trunk diseases. The causal fungi, which are taxonomically unrelated Ascomycetes, infect and then degrade the permanent woody structure of t...

  11. Neocosmospora perseae sp. nov., causing trunk cankers on avocado in Italy

    NARCIS (Netherlands)

    Guarnaccia, Vladimiro; Sandoval-Denis, Marcelo; Aiello, Dalia; Polizzi, Giancarlo; Crous, P.W.

    2018-01-01

    Trunk and branch cankers are among the most important diseases compromising avocado production worldwide. A novel species, Neocosmospora perseae sp. nov. is described isolated from trunk lesions on Persea americana in the main avocado producing area of Sicily, Italy. The new species is characterised

  12. Trunk muscle activity increases with unstable squat movements.

    Science.gov (United States)

    Anderson, Kenneth; Behm, David G

    2005-02-01

    The objective of this study was to determine differences in electromyographic (EMG) activity of the soleus (SOL), vastus lateralis (VL), biceps femoris (BF), abdominal stabilizers (AS), upper lumbar erector spinae (ULES), and lumbo-sacral erector spinae (LSES) muscles while performing squats of varied stability and resistance. Stability was altered by doing the squat movement on a Smith machine, a free squat, and while standing on two balance discs. Fourteen male subjects performed the movements. Activities of the SOL, AS, ULES, and LSES were highest during the unstable squat and lowest with the Smith machine protocol (p squats on unstable surfaces may permit a training adaptation of the trunk muscles responsible for supporting the spinal column (i.e., erector spinae) as well as the muscles most responsible for maintaining posture (i.e., SOL).

  13. Novel anatomic variation: heptafurcation of the celiac trunk.

    Science.gov (United States)

    Rusu, M C; Manta, B A

    2018-04-01

    We report here anatomic variants which were found during a retrospective study of a male patient, 54 years old, evaluated in computed tomography: heptafurcation of the celiac trunk (CT) and bilateral double renal arteries. The seven branches of the heptafurcated CT were the (1) left and (2) right inferior phrenic arteries, the (3) splenic and (4) left gastric artery, the (5) common hepatic artery, further sending off the (a) proper, continued as left, hepatic artery and (b) the gastroduodenal artery, (6) a replaced right hepatic artery and (7) the dorsal pancreatic artery. To our knowledge, heptafurcation of the CT was not reported previously. The arterial variants have great importance during various surgical and interventional procedures and should be documented prior to respective procedures.

  14. The 30/20 GHz communications satellite trunking network study

    Science.gov (United States)

    Kolb, W.

    1981-01-01

    Alternative transmission media for a CONUS-wide trunking network in the years 1990 and 2000 are examined. The alternative technologies comprised fiber optic cable, conventional C- and Ku-band satellites, and 30/20 GHz satellites. Three levels of implementation were considered - a 10-city network, a 20-city network, and a 40-city network. The cities selected were the major metropolitan areas with the greatest communications demand. All intercity voice, data, and video traffic carried more than 40 miles was included in the analysis. In the optimized network, traffic transmitted less than 500 miles was found to be better served by fiber optic cable in 1990. By the year 2000, the crossover point would be down to 200 miles, assuming availability of 30/20 GHz satellites.

  15. Along the Grand Trunk Road: The Photography of Raghubir Singh

    Directory of Open Access Journals (Sweden)

    Chaya Chandrasekhar

    2013-05-01

    Full Text Available For more than two millennia, the historic Grand Trunk Road, the busy thoroughfare that extends some 1500 miles through north India and Pakistan served as the main artery of South Asia. It was also the gateway through which waves of immigrants, travelers, and invaders entered the subcontinent. As a result, a great deal of diversity and tolerance marks the road. Between 1988 and 1991, Raghubir Singh (1942-1999, one of India’s renowned documentary photographers, traveled and photographed the Indian stretch of the Road. Ninety-six photographs from his journeys appear in the publication, 'The Grand Trunk Road: A Passage Through India '(1995. Singh used the pictorial style of street photography that he is known for to capture everyday life along the path. Further, he emphasized the tremendous diversity he witnessed along the road through the selections he made for inclusion in the book and the specific manner in which he arranged many of them. By underscoring the heterogeneity, Singh provided a critical visual commentary of the political climate in India during the 1980s and early nineties. This period coincided with the rise of Hindu nationalism, which aimed to erase the subcontinent’s diverse past and promote instead the idea of a homogenous/Hindu India. By documenting the road in his uniquely pictorial style and arranging the photographs in his book to draw attention to the differences and tolerance witnessed along the path, Singh demonstrated that India was not a monolithic culture as the politics of the time claimed, but a rich interwoven fabric of many varied strands.

  16. Duplication of Inferior Gluteal Artery and Course of Superior Gluteal Artery Through the Lumbosacral Trunk

    Directory of Open Access Journals (Sweden)

    Satheesha Nayak B

    2017-07-01

    Full Text Available Internal iliac artery (IIA shows great deal of variations in its branching pattern. The knowledge of its variant branches is required for successful surgical, orthopedic, plastic surgery and radiological procedures. We observed variations of some of the branches of right IIA in an adult male cadaver. The iliolumbar artery originated from the main trunk of the IIA. After this, IIA divided into anterior and posterior divisions. The posterior division gave lateral sacral and superior gluteal arteries. Superior gluteal artery pierced the lumbosacral trunk before leaving the pelvis. The anterior division further divided into anterior and posterior trunks. Anterior trunk gave rise to superior vesical, inferior vesical, middle rectal and obturator arteries. The posterior trunk gave two inferior gluteal arteries and an internal pudendal artery.

  17. Trunk- and head-centred spatial coordinates do not affect free-viewing perceptual asymmetries.

    Science.gov (United States)

    Nicholls, Michael E R; Mattingley, Jason B; Bradshaw, John L; Krins, Phillip W

    2003-11-01

    Turning the trunk or head to the left can reduce the severity of leftward neglect. This study sought to determine whether turning the trunk or head to the right would reduce pseudoneglect: A phenomenon where normal participants underestimate the rightward features of a stimulus. Participants made luminance judgements of two mirror-reversed greyscales stimuli. A preference for selecting the stimulus dark on the left was found. The effect of trunk-centred coordinates was examined in Expt. 1 by facing the head toward the display and turning the trunk to the left, right or toward the display. Head-centred coordinates were examined in Expt. 2 by directing the eyes toward the display and then turning the head and trunk. No effect of rotation was observed. It was concluded that the leftward bias for the greyscales task could be based on an object-centred attentional bias or left-to-right eye scanning habits.

  18. Growth performance, meat quality traits, and genetic mapping of quantitative trait loci in 3 generations of Japanese quail populations (Coturnix japonica).

    Science.gov (United States)

    Tavaniello, S; Maiorano, G; Siwek, M; Knaga, S; Witkowski, A; Di Memmo, D; Bednarczyk, M

    2014-08-01

    The current research was conducted to compare growth, carcass traits, pH, intramuscular collagen (IMC) properties, and genetic bases of IMC and carcasses (breast-muscle weight) of different lines and generations of adult males and females of Japanese quail (Coturnix japonica). Forty-four quails (generation F0), 22 Pharaoh (F-33) meat-type males and 22 Standard (S-22) laying-type females, were crossed to produce the F1 hybrids generation. The F2 generation was created by mating one F1 male with one F1 female, full siblings. The birds, randomly chosen from F0 (22 males and 22 females), F1 (22 males and 22 females), and F2 (84 males and 152 females) were raised to 20 wk of age in collective cages. Quails were fed ad libitum commercial diets. At slaughter, all birds were individually weighed (after a fasting period of 12 h) and dressing yield (without giblets) was calculated. The carcasses were then dissected. Genomic DNA was extracted from all of the blood, and 30 microsatellite markers located on 2 quail chromosomes were genotyped. The F -: 33 quails had higher in vivo and postmortem performances and a higher abdominal fat percentage than those of the egg line. Meat from S -: 22 quails had a slower collagen maturation (hydroxylysylpyridinoline crosslink/collagen) and a higher ultimate pH. The F1 and F2 generations showed an evident sexual dimorphism, and an additional effect could be due to hybrid heterosis evident in F2. Meat from quails of F1 and F2 generations had a lower IMC amount with a higher degree of collagen maturation compared with parental lines. Two statistically significant QTL have been detected on quail chromosome 2 (CJA02): a QTL with an additive effect (0.50) for IMC in the marker bracket GUJ0037 and GUJ0093; a second QTL with additive (1.32) and dominant (1.91) effects for breast-muscle weight in the marker bracket GUJ0084 and GUJ0073. To our knowledge, this is the first report of a QTL associated with breast-muscle weight and IMC in quail and

  19. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-05-23

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

  20. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-05

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  1. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-06-29

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

  2. 76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-26

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  3. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  4. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  5. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  6. Isolation, identification, and serotyping of Avibacterium paragallinarum from quails in Indonesia with typical infectious coryza disease symptoms

    Directory of Open Access Journals (Sweden)

    Agnesia Endang Tri Hastuti Wahyuni

    2018-04-01

    Full Text Available Background and Aim: Infectious coryza (IC or snot is an infectious upper respiratory disease affecting chickens and birds, including quails, and it is caused by Avibacterium paragallinarum. The symptoms of IC are facial swelling, malodorous nasal discharge, and lacrimation. This study aimed to isolate, identify, and serotype the A. paragallinarum of snot in quails and to determine the sensitivity and resistance to several antibiotics. Materials and Methods: Nine quails from Yogyakarta, Indonesia with typical snot disease symptoms were used in this study. The nasal swab was obtained and directly streaked onto a chocolate agar plate and blood agar plate (BAP, then incubated in 5% CO2 at 37°C for 24-48 h. Staphylococcus spp. was cross-streaked onto the BAP to show the satellite growth. The observation of the morphology of the suspected colony, Gram staining, and biochemical tests (catalase test, oxidase test, urease test, peptone test, and carbohydrate fermentation such as maltose, mannitol, lactose, and sorbitol are done to identify the species of bacteria. This research also detects the serovar of A. paragallinarum using hemagglutination inhibition test. The antibiotic sensitivity tests were also performed using several antibiotics against five A. paragallinarum isolates that were cultured on Mueller-Hinton Agar and added with antibiotic discs, then incubated in 5% CO2 at 37°C for 24-48 h. Results: Five isolates out of nine suspected isolates (55.5% were A. paragallinarum. The growth of isolates from quails did not depend on the nicotinamide adenine dinucleotide (NAD (NAD-independent. Sensitivity test was done using the five identified A. paragallinarum isolates, results showed that they were 100% sensitive to amoxicillin (AMC and ampicillin (AMP; 100% resistant toward amikacin (AK, erythromycin (E, gentamycin (CN, and tetracycline (TE; 80% resistant toward kanamycin (K and trimethoprim (W; 60% resistant toward chloramphenicol (C; and 20

  7. The role of vitamin E or clay in growing Japanese quail fed diets polluted by cadmium at various levels.

    Science.gov (United States)

    Abou-Kassem, D E; Mahrose, Kh M; Alagawany, M

    2016-03-01

    This study was conducted to verify whether vitamin (Vit) E or natural clay as feed additives has the potential to modulate the deleterious effects resulting from exposure to cadmium (Cd) in growing Japanese quail. 648 Japanese quail chicks (1 week old) were used to evaluate the effects of dietary Cd (0, 40, 80 and 120 mg/kg diet) and two levels of Vit E (0, 250 mg/kg diet) or two levels of natural clay (0 and 100 mg/kg diet) to study the influences of Cd, Vit E, clay or their different combinations on growth performance, carcass traits, some blood biochemical components and Cd residues in muscles and liver. Live BW and weight gain of quails were linearly decreased with increasing dietary Cd levels. Moreover, feed conversion was significantly worsened with increasing Cd level. Mortality percentage was linearly increased as dietary Cd level increased up to 120 mg/kg diet. Carcass percentage was linearly decreased as dietary Cd level increased. While, giblets percentage were linearly and quadratically differed as dietary Cd level increased. Cd caused significant changes in total plasma protein, albumin, globulin, A/G ratio, creatinine, urea-N and uric acid concentrations as well as ALT, AST and ALP activities. Increasing dietary Cd level was associated with its increase in the muscles and liver. Dietary supplementation with 250 mg of Vit E/kg diet or 100 mg clay/kg improved live BW, BW gain and feed conversion when compared with the un-supplemented diet. Quails fed diet contained 250 mg Vit E/kg and those fed 100 mg clay/kg had the highest percentages of carcass and dressing than those fed the un-supplemented diet. Blood plasma biochemical components studied were better when birds received 250 mg of Vit E/kg diet and those received 100 mg clay/kg. Cd residues in the muscles and liver were significantly less in the birds had 250 mg of Vit E/kg or those received 100 mg clay/kg diet than those un-supplemented with Vit E. Growth performance traits and blood plasma

  8. Effect of dietary supplementation of hemp seed (Cannabis sativa L.) on meat quality and egg fatty acid composition of Japanese quail (Coturnix coturnix japonica).

    Science.gov (United States)

    Yalcin, H; Konca, Y; Durmuscelebi, F

    2018-02-01

    This study was conducted in two separate experiments. Experiment I was conducted to investigate the effects of hemp seed (HS) on meat quality traits, and experiment II was designed to determine egg fatty acid (FA) composition in Japanese quail (Coturnix coturnix japonica). In experiment I and experiment II treatments, groups were as follows: (i) control (not included HS0), (ii) 5% HS inclusion to diets, (iii) 10% HS inclusion to diets and (iv) 20% HS inclusion to diets. In experiment I, a total of 192 7-day-old-quail were fed with HS diets for 5 weeks, and end of the experiment I, a total of 64 quail (16 each) slaughtered and meat samples were analysed for meat colour, pH, cooking and thawing loss and FA composition. In experiment II, a total of 120 8-week-old laying quail were fed with experimental diets for 6 weeks and egg FA composition were determined. Breast meat cooking loss was significantly lower in 20% supplemented group (p egg samples were linearly increased with increasing the dietary HS ratio (p eggs (p egg yolk omega-3 FA content and decrease cooking loss of quail meats. © 2017 Blackwell Verlag GmbH.

  9. Conventional versus frozen elephant trunk surgery for extensive disease of the thoracic aorta.

    Science.gov (United States)

    Di Eusanio, Marco; Borger, Michael; Petridis, Francesco D; Leontyev, Sergey; Pantaleo, Antonio; Moz, Monica; Mohr, Friedrich; Di Bartolomeo, Roberto

    2014-11-01

    To compare early and mid-term outcomes after repair of extensive aneurysm of the thoracic aorta using the conventional elephant trunk or frozen elephant trunk (FET) procedures. Fifty-seven patients with extensive thoracic aneurysmal disease were treated using elephant trunk (n = 36) or FET (n = 21) procedures. Patients with aortic dissection, descending thoracic aorta (DTA) diameter less than 40 mm, and thoracoabdominal aneurysms were excluded from the analysis, as were those who did not undergo antegrade selective cerebral perfusion during circulatory arrest. Short-term and mid-term outcomes were compared according to elephant trunk/FET surgical management. Preoperative and intraoperative variables were similar in the two groups, except for a higher incidence of female sex, coronary artery disease and associated procedures in elephant trunk patients. Hospital mortality (elephant trunk: 13.9% versus FET: 4.8%; P = 0.2), permanent neurologic dysfunction (elephant trunk: 5.7% versus FET: 9.5%; P = 0.4) and paraplegia (elephant trunk: 2.9% versus FET: 4.8%; P = 0.6) rates were similar in the two groups. Follow-up was 100% complete. In the elephant trunk group, 68.4% of patients did not undergo a second-stage procedure during follow-up for a variety of reasons. Of these patients, the DTA diameter was greater than 51 mm in 72.2% and two (6.7%) died due to aortic rupture while awaiting stage-two intervention. Endovascular second-stage procedures were successfully performed in all FET patients with residual DTA aneurysmal disease (n = 3), whereas nine of 11 elephant trunk patients who returned for second-stage procedures required conventional surgical replacement through a lateral thoracotomy. Kaplan-Meier estimate of 4-year survival was 75.8 ± 7.6 and 72.8 ± 10.6 in elephant trunk and FET patients, respectively (log-rank P = 0.8). In patients with extensive aneurysmal disease of thoracic aorta, elephant trunk and FET procedures

  10. NC CATCH: Advancing Public Health Analytics.

    Science.gov (United States)

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi

    2010-01-01

    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  11. Acidulants for japanese quails housed at high stocking rates at finishing phase

    Directory of Open Access Journals (Sweden)

    Ana Paula de Oliveira Saccomani

    2013-12-01

    Full Text Available The quail for being an alternative species will be able to supply a new market niche due to its fast growth, high laying rate, low feed intake, in addition to the increase of the acceptance of its products by the consumer. A growing interest in raising the stocking rates in the cages as an alternative to increase the performance of the stock is noticed; although studies demonstrate that high densities can result into unfavorable environment to the birds’ welfare with alterations in the performance of the flocks and as a stressing factor being able to alter the production and profitability of the flock. At high stocking rates, the birds become predisposed to aggressiveness reactions, presenting cannibalism behavior, besides the combination of factors such as pH, temperature, ventilation and humidity deficiency which create environmental conditions favorable for certain benign bacteria which utilize uric acid of the manure through their enzymatic complexes and produce ammonia, causing stress to birds and which can cause damages to performance with significant economic losses to the producer.  The experiment with 112-day duration was conducted with the objective of evaluating the inclusion of acidulants in the Japanese quails’ drinking water and verifying the effect on the stocking rate in cages. A completely randomized design with four treatments (2 stocking rates of quails x 2 additions of and 5 replications of 24 and 36 birds per cage, corresponding to the stocking rates of 141.67 and 94.44 cm2/bird, respectively, receiving or not acidulant in the water (acetic, lactic and phosphoric acid was utilized. Performance was evaluated through egg weight (EWg, egg yield (%Laying., egg mass (EMg/bird/day, feed intake (FIg/bird/day, feed conversion (FCkg/dz and FCkg/kg and mortality (%Mort. No significant statistical differences about the performance (P>0.05 were found. There was a significant effect (P<0.05 of the density for daily feed intake with

  12. Subjects with hip osteoarthritis show distinctive patterns of trunk movements during gait-a body-fixed-sensor based analysis

    NARCIS (Netherlands)

    Reininga, Inge H. F.; Stevens, Martin; Wagenmakers, Robert; Bulstra, Sjoerd K.; Groothoff, Johan W.; Zijlstra, Wiebren

    2012-01-01

    Background: Compensatory trunk movements during gait, such as a Duchenne limp, are observed frequently in subjects with osteoarthritis of the hip, yet angular trunk movements are seldom included in clinical gait assessments. Hence, the objective of this study was to quantify compensatory trunk

  13. Anticipation of direction and time of perturbation modulates the onset latency of trunk muscle responses during sitting perturbations.

    Science.gov (United States)

    Milosevic, Matija; Shinya, Masahiro; Masani, Kei; Patel, Kramay; McConville, Kristiina M V; Nakazawa, Kimitaka; Popovic, Milos R

    2016-02-01

    Trunk muscles are responsible for maintaining trunk stability during sitting. However, the effects of anticipation of perturbation on trunk muscle responses are not well understood. The objectives of this study were to identify the responses of trunk muscles to sudden support surface translations and quantify the effects of anticipation of direction and time of perturbation on the trunk neuromuscular responses. Twelve able-bodied individuals participated in the study. Participants were seated on a kneeling chair and support surface translations were applied in the forward and backward directions with and without direction and time of perturbation cues. The trunk started moving on average approximately 40ms after the perturbation. During unanticipated perturbations, average latencies of the trunk muscle contractions were in the range between 103.4 and 117.4ms. When participants anticipated the perturbations, trunk muscle latencies were reduced by 16.8±10.0ms and the time it took the trunk to reach maximum velocity was also reduced, suggesting a biomechanical advantage caused by faster muscle responses. These results suggested that trunk muscles have medium latency responses and use reflexive mechanisms. Moreover, anticipation of perturbation decreased trunk muscles latencies, suggesting that the central nervous system modulated readiness of the trunk based on anticipatory information. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Walking with robot assistance: the influence of body weight support on the trunk and pelvis kinematics.

    Science.gov (United States)

    Swinnen, Eva; Baeyens, Jean-Pierre; Knaepen, Kristel; Michielsen, Marc; Hens, Gerrit; Clijsen, Ron; Goossens, Maggie; Buyl, Ronald; Meeusen, Romain; Kerckhofs, Eric

    2015-05-01

    The goal was to assess in healthy participants the three-dimensional kinematics of the pelvis and the trunk during robot-assisted treadmill walking (RATW) at 0%, 30% and 50% body weight support (BWS), compared with treadmill walking (TW). 18 healthy participants walked (2 kmph) on a treadmill with and without robot assistance (Lokomat; 60% guidance force; 0%, 30% and 50% BWS). After an acclimatisation period (four minutes), trunk and pelvis kinematics were registered in each condition (Polhemus Liberty [240 Hz]). The results were analysed using a repeated measures analysis of variance with Bonferroni correction, with the level of suspension as within-subject factor. During RATW with BWS, there were significantly (1) smaller antero-posterior and lateral translations of the trunk and the pelvis; (2) smaller antero-posterior flexion and axial rotation of the trunk; (3) larger lateral flexion of the trunk; and (4) larger antero-posterior tilting of the pelvis compared with TW. There are significant differences in trunk and pelvis kinematics in healthy persons during TW with and without robot assistance. These data are relevant in gait rehabilitation, relating to normal balance regulation. Additional research is recommended to further assess the influence of robot assistance on human gait. The trunk and pelvis moves in a different way during walking with robot assistance. The data suggest that the change in movement is due to the robot device and the harness of the suspension system more than due to the level of suspension itself.

  15. Trunk lean gait decreases multi-segmental coordination in the vertical direction.

    Science.gov (United States)

    Tokuda, Kazuki; Anan, Masaya; Sawada, Tomonori; Tanimoto, Kenji; Takeda, Takuya; Ogata, Yuta; Takahashi, Makoto; Kito, Nobuhiro; Shinkoda, Koichi

    2017-11-01

    [Purpose] The strategy of trunk lean gait to reduce external knee adduction moment (KAM) may affect multi-segmental synergy control of center of mass (COM) displacement. Uncontrolled manifold (UCM) analysis is an evaluation index to understand motor variability. The purpose of this study was to investigate how motor variability is affected by using UCM analysis on adjustment of the trunk lean angle. [Subjects and Methods] Fifteen healthy young adults walked at their preferred speed under two conditions: normal and trunk lean gait. UCM analysis was performed with respect to the COM displacement during the stance phase. The KAM data were analyzed at the points of the first KAM peak during the stance phase. [Results] The KAM during trunk lean gait was smaller than during normal gait. Despite a greater segmental configuration variance with respect to mediolateral COM displacement during trunk lean gait, the synergy index was not significantly different between the two conditions. The synergy index with respect to vertical COM displacement during trunk lean gait was smaller than that during normal gait. [Conclusion] These results suggest that trunk lean gait is effective in reducing KAM; however, it may decrease multi-segmental movement coordination of COM control in the vertical direction.

  16. An assistance device to help people with trunk impairment maintain posture.

    Science.gov (United States)

    Ogura, Tomoka; Itami, Taku; Yano, Ken'ichi; Mori, Ichidai; Kameda, Kazuhiro

    2017-07-01

    People with trunk impairment cannot lean forward because of the dysfunction of the trunk resulting from events such as cervical cord injury (CCI). It is therefore difficult for such people to work at a table because they may easily fall from their wheelchair, and it is also hard for them to return to their original position. This limits the activities of daily living (ADLs) of people with trunk impairment. These problems can be solved to some extent with equipment such as a wheelchair belt or a spinal orthosis that can help the person to maintain his or her posture. However, people cannot move freely with this equipment. Furthermore, if this equipment is used for a long time, there is a risk of physical pain and skin issues. In this study, we developed a device that assists the trunk of people with trunk impairment when they lean forward. This device supports people with trunk impairment so that they may take their meals at the table and prevents them from falling over their wheelchair without hindering their daily performance when they are sitting normally. The effectiveness of our proposed device was verified by experiments involving having a meal, operating a wheelchair, and colliding with a curb. Our device can help people with trunk impairment by improving their ADLs and quality of life (QOL).

  17. Control of trunk motion following sudden stop perturbations during cart pushing.

    Science.gov (United States)

    Lee, Yun-Ju; Hoozemans, Marco J M; van Dieën, Jaap H

    2011-01-04

    External perturbations during pushing tasks have been suggested to be a risk factor for low-back symptoms. An experiment was designed to investigate whether self-induced and externally induced sudden stops while pushing a high inertia cart influence trunk motions, and how flexor and extensor muscles counteract these perturbations. Twelve healthy male participants pushed a 200 kg cart at shoulder height and hip height. Pushing while walking was compared to situations in which participants had to stop the cart suddenly (self-induced stop) or in which the wheels of the cart were unexpectedly blocked (externally induced stop). For the perturbed conditions, the peak values and the maximum changes from the reference condition (pushing while walking) of the external moment at L5/S1, trunk inclination and electromyographic amplitudes of trunk muscles were determined. In the self-induced stop, a voluntary trunk extension occurred. Initial responses in both stops consisted of flexor and extensor muscle cocontraction. In self-induced stops this was followed by sustained extensor activity. In the externally induced stops, an external extension moment caused a decrease in trunk inclination. The opposite directions of the internal moment and trunk motion in the externally induced stop while pushing at shoulder height may indicate insufficient active control of trunk posture. Consequently, sudden blocking of the wheels in pushing at shoulder height may put the low back at risk of mechanical injury. Copyright © 2010 Elsevier Ltd. All rights reserved.

  18. Trunk repositioning errors are increased in balance-impaired older adults.

    Science.gov (United States)

    Goldberg, Allon; Hernandez, Manuel Enrique; Alexander, Neil B

    2005-10-01

    Controlling the flexing trunk is critical in recovering from a loss of balance and avoiding a fall. To investigate the relationship between trunk control and balance in older adults, we measured trunk repositioning accuracy in young and balance-impaired and unimpaired older adults. Young adults (N = 8, mean age 24.3 years) and two groups of community-dwelling older adults defined by unipedal stance time (UST)-a balance-unimpaired group (UST > 30 seconds, N = 7, mean age 73.9 years) and a balance-impaired group (UST tested in standing trunk control ability by reproducing a approximately 30 degrees trunk flexion angle under three visual-surface conditions: eyes opened and closed on the floor, and eyes opened on foam. Errors in reproducing the angle were defined as trunk repositioning errors (TREs). Clinical measures related to balance, trunk extensor strength, and self-reported disability were obtained. TREs were significantly greater in the balance-impaired group than in the other groups, even when controlling for trunk extensor strength and body mass. In older adults, there were significant correlations between TREs and three clinical measures of balance and fall risk, UST and maximum step length (-0.65 to -0.75), and Timed Up & Go score (0.55), and between TREs and age (0.63-0.76). In each group TREs were similar under the three visual-surface conditions. Test-retest reliability for TREs was good to excellent (intraclass correlation coefficients > or =0.74). Older balance-impaired adults have larger TREs, and thus poorer trunk control, than do balance-unimpaired older individuals. TREs are reliable and valid measures of underlying balance impairment in older adults, and may eventually prove to be useful in predicting the ability to recover from losses of balance and to avoid falls.

  19. [Intravascular Hemolysis Caused by Stenosis of an Elephant Trunk;Report of a Case].

    Science.gov (United States)

    Takamaru, Rikako; Kawahito, Koji; Aizawa, Kei; Misawa, Yoshio

    2017-07-01

    Symptomatic intravascular hemolysis after prosthetic aortic graft replacement is rare. It is primarily attributed to mechanical injury of red blood cells caused by stenosis of the vascular graft. A 50-year-old man presented with hemolytic anemia, 5 years after total arch replacement with an elephant trunk for type A aortic dissection. The hemolysis was caused by graft stenosis of the elephant trunk. Endovascular treatment for the stenotic elephant trunk was successfully performed. The postoperative course was uneventful, and the hemolysis was resolved immediately after operation.

  20. Effect of 17β-trenbolone on male and female reproduction in Japanese quail (Coturnix japonica)

    Science.gov (United States)

    Henry, Paula F.P.; Akuffo, Valorie G.; Chen, Yu; Karouna-Renier, Natalie K.; Sprague, Daniel T.; Bakst, Murray R.

    2012-01-01

    The anabolic steroid 17β trenbolone (17β-TB), a known endocrine disrupting chemical, may influence reproductive functions in avian wildlife. We evaluated the effects of dietary exposure to 17β-TB at 5 and 20 ppm on reproductive functional endpoints in Japanese quail during and after sexual maturation. In the male, 5 and 20 ppm treatments revealed no differences in body and testes weight, testes histology, plasma testosterone concentrations, or size and weight of the foam glands. However, the onset of foam production was significantly earlier (days of age) in the 20 ppm males. In females, dietary 17β-TB at 20 ppm caused a reduction in the number of maturing yellow yolk follicles and overall egg production. Plasma testosterone concentrations were reduced compared to controls. Histology of the oviductal sperm storage tubules was normal in all treatments. The number of sperm holes, sites on the perivitelline layer (PVL) where sperm bound and hydrolyzed a path through the PVL, was significantly greater in the 10th egg laid compared to the 1st egg laid in the 20 ppm treatment. Potential effects, albeit transient, on endpoints associated with male maturation warrant further investigation into the sensitivity of these measures in the event of embryonic and/or trans-generational exposure to 17β-TB.

  1. An application of CART algorithm in genetics: IGFs and cGH polymorphisms in Japanese quail

    Science.gov (United States)

    Kaplan, Selçuk

    2017-04-01

    The avian insulin-like growth factor-1 (IGFs) and avian growth hormone (cGH) genes are the most important genes that can affect bird performance traits because of its important function in growth and metabolism. Understanding the molecular genetic basis of variation in growth-related traits is of importance for continued improvement and increased rates of genetic gain. The objective of the present study was to identify polymorphisms of cGH and IGFs genes in Japanese quail using conventional least square method (LSM) and CART algorithm. Therefore, this study was aimed to demonstrate at determining the polymorphisms of two genes related growth characteristics via CART algorithm. A simulated data set was generated to analyze by adhering the results of some poultry genetic studies which it includes live weights at 5 weeks of age, 3 alleles and 6 genotypes of cGH and 2 alleles and 3 genotypes of IGFs. As a result, it has been determined that the CART algorithm has some advantages as for that LSM.

  2. The distribution of 14C-chloramphenicol in the Japanese quail (coturnix coturnix japonica)

    International Nuclear Information System (INIS)

    Appelgreen, L.-E; Biessmann, A.; Martin, K.; Salemi, M.A.; Wiese, B.

    1985-01-01

    The distribution of 14 C-labelled chloramphenicol after oral and intravenous administration to egg laying Japanese quail was studied by whole-body autoradiography. In the liver, kidneys, gizzard, intestinal contents (bile) and oviduct, the 14 C-concentration was higher than that of the blood short time after injection and remained higher than the blood up to 4 days. From 4 hrs, the concentration of 14 C in the egg yolks was higher than that of the blood and from 24 hrs the radioactivity in the albumen of the eggs in the oviduct was also higher than that of the blood. The peak concentration in the egg yolk was found in the second egg laid 2-4 days after administration of 14 C-chloramphenicol. In the albumen the maximum concentration was found in the first laid egg 24-48 hrs after administration. In the egg yolks, about 30% of the radioactivity represented unchanged chloramphenicol up to 5 days after administration. It was also shown that about 5% of the injected 14 c-chloramphenicol was exhaled as 14 CO 2 during the first 12 hrs and about 37% of the dose was excreted in the combined faeces and urine during the same period of time. (author)

  3. Influence of long-term hypodynamy on spongy bone tissue in Japanese quails

    Directory of Open Access Journals (Sweden)

    Lucia Tarabová

    2013-01-01

    Full Text Available Weightlessness can cause various damages especially on the musculoskeletal system both in animals and humans. The aim of our study was to observe the influence of simulated, long-term microgravity on the spongy bone tissue of the femur in Japanese quails. A total of 80 cockerels at the age of 2 days were exposed to simulated microgravity – hypodynamy. After days 56, 63, 90 and 180, six birds from the experimental group and six birds from the control group were euthanised. Samples for histological examination were collected from femur epiphysis. The whole femur of the other limb was used for the analysis of the calcium content. Microscopic examination showed differences between experimental and control animals in the spongy bone tissue after every day of the experiment. In the experimental animals, there were numerous, big, multinucleated cells osteoclasts, lying on the bone trabeculae surface, which were damaged. The highest difference in the calcium content in femurs between the control and experimental animals was found after 90 days of hypodynamy. This study builds on short-term hypodynamy experiments; such long periods had never been studied before in birds. Because our findings are similar to those found in osteoporotic bone tissue, it could by useful in the development of countermeasures against the negative influence of microgravity and immobilization.

  4. Effect of mercuric chloride feeding on sexual maturity, egg production and fertility in Japanese quail

    Science.gov (United States)

    Hill, E.F.; Shaffner, C.S.

    1973-01-01

    Japanese quail (Coturnix c. japonica) were fed 0, 8, 16 or 32 p.p.m. of mercury as mercuric chloride from 3 days of age through 20 weeks of age. The onset of egg production generally occurred earlier for hens fed HgCl2. Average age in days at first oviposition for the control, 8 p.p.m., 16 p.p.m. and 32 p.p.m. was 48.4, 50.9, 46.9 and 44.0 respectively. The average rate of egg productivity from first oviposition to attainment of full growth (9 weeks of age) correlated positively with in increased dietary mercury (controls, 8 p.p.m., 16 p.p.m., 32 p.p.m. ? 75.2, 69.3, 86.1 and 93.3% respectively). By 20 weeks of age productivity was 81.0, 80.6, 87.5 and 92.9% for control, 8, 16 and 32 p.p.m. groups respectively. Fertility was depressed when hens were fed HgCl2. At 9 weeks of age average control fertility was 59% contrasted with 25% for the 32 p.p.m. group. At 12 weeks fertility increased to 89% and 57% for these groups. From this study it is apparent. that the onset and rate of egg production was stimulated by HgCl2, but fertility was adversely affected.

  5. Estimation of Digestible Lysine Requirements of Japanese Quail during the Starter Period

    Directory of Open Access Journals (Sweden)

    M Ashoori

    2013-11-01

    Full Text Available The aim of this study was the estimation of digestible lysine requirements of Japanese quail during the 7-21d period. Graduation level of L-lysine.HCL were added to the basal diet at the expense of corn starch to create different levels of digestible lysine ranged from 0.75 to 1.35% of diet. Growth performance and carcass composition were evaluated during the experiment. The results showed that incremental levels of digestible lysine significantly affected the body weight gain (BWG, feed conversion ratio (FCR, feed intake (FI, breast meat yield (BMY and thigh meat yield (TMY. Either linear broken- line or quadratic broken line model were used to get break points of digestible lysine as a requirement. Based on linear broken line analysis, the break points for FCR and BMY were 0.99 and 1.04 % of diet, respectively. Using the quadratic broken-line model, the estimated Lys requirements for BWG, FCR, and BMY were 1.11, 1.04, and 1.15% of diet, respectively. The results showed that the Lys needs for optimum BMY was higher than BWG and FCR.

  6. Impact of vinclozolin on reproductive behavior and endocrinology in Japanese quail (Coturnix coturnix japonica)

    Science.gov (United States)

    McGary, S.; Henry, P.F.P.; Ottinger, M.A.

    2001-01-01

    The impact of endocrine-disrupting chemicals (EDCs) has been demonstrated in mammalian models, but less research is available for avian species. The effects of vinclozolin (VIN), an antiandrogenic fungicide, on sexual differentiation and maturation were investigated in Japanese quail (Coturnix coturnix japonica). On day 4 of incubation, embryos were exposed to no treatment, oil, or 25, 50, or 100 ppm of VIN. Endpoints measured included adult male reproductive behavior, hypothalamic gonadotropin-releasing hormone I (GnRH-I) content in hatchlings and adults, plasma steroid levels in hatchlings and adults, proctodeal gland growth during maturation, and relative testicular weight at seven weeks of age. Results showed that exposure to VIN significantly (p < 0.05) altered GnRH-I in male hatchlings, whereas GnRH-I levels in females remained unaffected. Although steroid levels were unaltered by any VIN treatment, the display of male reproductive behavior seemed delayed, with the number of mounts and the number of cloacal contacts being significantly (p < 0.05) lower in the VIN-treated males. This could have an extreme negative impact on wild avian species that are routinely exposed to similar EDCs.

  7. Distinct protease pathways control cell shape and apoptosis in v-src-transformed quail neuroretina cells

    International Nuclear Information System (INIS)

    Neel, Benjamin D.; Aouacheria, Abdel; Nouvion, Anne-Laure; Ronot, Xavier; Gillet, Germain

    2005-01-01

    Intracellular proteases play key roles in cell differentiation, proliferation and apoptosis. In nerve cells, little is known about their relative contribution to the pathways which control cell physiology, including cell death. Neoplastic transformation of avian neuroretina cells by p60 v-src tyrosine kinase results in dramatic morphological changes and deregulation of apoptosis. To identify the proteases involved in the cellular response to p60 v-src , we evaluated the effect of specific inhibitors of caspases, calpains and the proteasome on cell shape changes and apoptosis induced by p60 v-src inactivation in quail neuroretina cells transformed by tsNY68, a thermosensitive strain of Rous sarcoma virus. We found that the ubiquitin-proteasome pathway is recruited early after p60 v-src inactivation and is critical for morphological changes, whereas caspases are essential for cell death. This study provides evidence that distinct intracellular proteases are involved in the control of the morphology and fate of v-src-transformed cells

  8. The negative influence of high-glucose ambience on neurogenesis in developing quail embryos.

    Directory of Open Access Journals (Sweden)

    Yao Chen

    Full Text Available Gestational diabetes is defined as glucose intolerance during pregnancy and it is presented as high blood glucose levels during the onset pregnancy. This condition has an adverse impact on fetal development but the mechanism involved is still not fully understood. In this study, we investigated the effects of high glucose on the developing quail embryo, especially its impact on the development of the nervous system. We established that high glucose altered the central nervous system mophologically, such that neural tube defects (NTDs developed. In addition, we found that high glucose impaired nerve differentiation at dorsal root ganglia and in the developing limb buds, as revealed by neurofilament (NF immunofluorescent staining. The dorsal root ganglia are normally derived from neural crest cells (NCCs, so we examine the delamination of NCCs from dorsal side of the neural tube. We established that high glucose was detrimental to the NCCs, in vivo and in vitro. High glucose also negatively affected neural differentiation by reducing the number and length of neurites emanating from neurons in culture. We established that high glucose exposure caused an increase in reactive oxidative species (ROS generation by primary cultured neurons. We hypothesized that excess ROS was the factor responsible for impairing neuron development and differentiation. We provided evidence for our hypothesis by showing that the addition of vitamin C (a powerful antioxidant could rescue the damaging effects of high glucose on cultured neurons.

  9. Inherent and antigen-induced airway hyperreactivity in NC mice

    OpenAIRE

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

    1999-01-01

    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  10. [Supra-aortic trunks occlusive disease: three different treatment approaches].

    Science.gov (United States)

    Dias, P; Almeida, P; Sampaio, S; Silva, A; Leite-Moreira, A; Pinho, P; Roncon de Albuquerque, R

    2010-01-01

    Unlike carotid bifurcation atherosclerotic stenosis, supra-aortic trunks (SAT) occlusive disease is rare and its revascularization uncommon, accouting for less than 10% of the operations performed on the extracranial brain-irrigating arteries. There are three different treatment approaches: transthoracic, extra-anatomic cervical and endovascular. Endovascular repair is gaining popularity as first-line therapy for proximal lesions with favorable anatomy because of its low morbidity and rare mortality. Extra-anatomic bypass is a safe and durable reconstruction and should be considered in patients with single vessel disease, with cardiopulmonary high-risk or with limited life expectancy. If cardiac surgery is needed, central transthoracic reconstruction is preferable, and the two procedures should be combined. The long-term patency of bypasses with aortic origin, specially when multiple vessels are involved, is superior to other repair techniques. We present three clinical cases that illustrate each of these therapeutic strategies: central brachiocephalic revascularization and synchronous cardiac surgery in a patient with complex SAT atherosclerosis disease; subclavian-carotid transposition for disabling upper limb claudication; and subclavian artery stenting for subclavian-steal syndrome. Surgical approach selection should be based on the individual patient's anatomy and operative risk.

  11. Phytotoxins Produced by Fungi Associated with Grapevine Trunk Diseases

    Science.gov (United States)

    Andolfi, Anna; Mugnai, Laura; Luque, Jordi; Surico, Giuseppe; Cimmino, Alessio; Evidente, Antonio

    2011-01-01

    Up to 60 species of fungi in the Botryosphaeriaceae family, genera Cadophora, Cryptovalsa, Cylindrocarpon, Diatrype, Diatrypella, Eutypa, Eutypella, Fomitiporella, Fomitiporia, Inocutis, Phaeoacremonium and Phaeomoniella have been isolated from decline-affected grapevines all around the World. The main grapevine trunk diseases of mature vines are Eutypa dieback, the esca complex and cankers caused by the Botryospheriaceae, while in young vines the main diseases are Petri and black foot diseases. To understand the mechanism of these decline-associated diseases and the symptoms associated with them, the toxins produced by the pathogens involved in these diseases were isolated and characterised chemically and biologically. So far the toxins of only a small number of these decline fungi have been studied. This paper presents an overview of the toxins produced by the most serious of these vine wood pathogens: Eutypa lata, Phaeomoniella chlamydospora, Phaeoacremonium aleophilum and some taxa in the Botryosphaeriaceae family, and examines how these toxins produce decline symptoms. The chemical structure of these metabolites and in some cases their vivotoxin nature are also discussed. PMID:22295177

  12. Gnarled-trunk evolutionary model of influenza A virus hemagglutinin.

    Directory of Open Access Journals (Sweden)

    Kimihito Ito

    Full Text Available Human influenza A viruses undergo antigenic changes with gradual accumulation of amino acid substitutions on the hemagglutinin (HA molecule. A strong antigenic mismatch between vaccine and epidemic strains often requires the replacement of influenza vaccines worldwide. To establish a practical model enabling us to predict the future direction of the influenza virus evolution, relative distances of amino acid sequences among past epidemic strains were analyzed by multidimensional scaling (MDS. We found that human influenza viruses have evolved along a gnarled evolutionary pathway with an approximately constant curvature in the MDS-constructed 3D space. The gnarled pathway indicated that evolution on the trunk favored multiple substitutions at the same amino acid positions on HA. The constant curvature was reasonably explained by assuming that the rate of amino acid substitutions varied from one position to another according to a gamma distribution. Furthermore, we utilized the estimated parameters of the gamma distribution to predict the amino acid substitutions on HA in subsequent years. Retrospective prediction tests for 12 years from 1997 to 2009 showed that 70% of actual amino acid substitutions were correctly predicted, and that 45% of predicted amino acid substitutions have been actually observed. Although it remains unsolved how to predict the exact timing of antigenic changes, the present results suggest that our model may have the potential to recognize emerging epidemic strains.

  13. Phytotoxins Produced by Fungi Associated with Grapevine Trunk Diseases

    Directory of Open Access Journals (Sweden)

    Antonio Evidente

    2011-12-01

    Full Text Available Up to 60 species of fungi in the Botryosphaeriaceae family, genera Cadophora, Cryptovalsa, Cylindrocarpon, Diatrype, Diatrypella, Eutypa, Eutypella, Fomitiporella, Fomitiporia, Inocutis, Phaeoacremonium and Phaeomoniella have been isolated from decline-affected grapevines all around the World. The main grapevine trunk diseases of mature vines are Eutypa dieback, the esca complex and cankers caused by the Botryospheriaceae, while in young vines the main diseases are Petri and black foot diseases. To understand the mechanism of these decline-associated diseases and the symptoms associated with them, the toxins produced by the pathogens involved in these diseases were isolated and characterised chemically and biologically. So far the toxins of only a small number of these decline fungi have been studied. This paper presents an overview of the toxins produced by the most serious of these vine wood pathogens: Eutypa lata, Phaeomoniella chlamydospora, Phaeoacremonium aleophilum and some taxa in the Botryosphaeriaceae family, and examines how these toxins produce decline symptoms. The chemical structure of these metabolites and in some cases their vivotoxin nature are also discussed.

  14. Is the frozen elephant trunk procedure superior to the conventional elephant trunk procedure for completion of the second stage?

    Science.gov (United States)

    Rustum, Saad; Beckmann, Erik; Wilhelmi, Mathias; Krueger, Heike; Kaufeld, Tim; Umminger, Julia; Haverich, Axel; Martens, Andreas; Shrestha, Malakh

    2017-10-01

    Our goal was to compare the results and outcomes of second-stage completion in patients who had previously undergone the elephant trunk (ET) or the frozen elephant trunk (FET) procedure for the treatment of complex aortic arch and descending aortic disease. Between August 2001 and December 2014, 53 patients [mean age 61 ± 13 years, 64% (n = 34) male] underwent a second-stage completion procedure. Of these patients, 32% (n = 17) had a previous ET procedure and 68% (n = 36) a previous FET procedure as a first-stage procedure. The median times to the second-stage procedure were 7 (0-78) months in the ET group and 8 (0-66) months in the FET group. The second-stage procedure included thoracic endovascular aortic repair in 53% (n = 28) of patients and open surgical repair in 47% (n = 25). More endovascular interventions were performed in FET patients (61%, n = 22) than in the ET group (35%, n = 6, P = 0.117). The in-hospital mortality rate was significantly lower in the FET (8%, n = 3) group compared with the ET group (29%, n = 5, P = 0.045). The median follow-up time after the second-stage operation for the entire cohort was 4.6 (0.4-10.4) years. The 5-year survival rate was 76% in the ET patients versus 89% in the FET patients (log-rank: P = 0.11). We observed a significantly lower in-hospital mortality rate in the FET group compared to the ET group. This result might be explained by the higher rate of endovascular completion in the FET group. We assume that the FET procedure offers the benefit of a more ideal landing zone, thus facilitating endovascular completion. © The Author 2017. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.

  15. Finding the neck-trunk boundary in snakes: anteroposterior dissociation of myological characteristics in snakes and its implications for their neck and trunk body regionalization.

    Science.gov (United States)

    Tsuihiji, Takanobu; Kearney, Maureen; Rieppel, Olivier

    2012-09-01

    The neck and trunk regionalization of the presacral musculoskeletal system in snakes and other limb-reduced squamates was assessed based on observations on craniovertebral and body wall muscles. It was confirmed that myological features characterizing the neck in quadrupedal squamates (i.e., squamates with well-developed limbs) are retained in all examined snakes, contradicting the complete lack of the neck in snakes hypothesized in previous studies. However, the posterior-most origins of the craniovertebral muscles and the anterior-most bony attachments of the body wall muscles that are located at around the neck-trunk boundary in quadrupedal squamates were found to be dissociated anteroposteriorly in snakes. Together with results of a recent study that the anterior expression boundaries of Hox genes coinciding with the neck-trunk boundary in quadrupedal amniotes were dissociated anteroposteriorly in a colubrid snake, these observations support the hypothesis that structures usually associated with the neck-trunk boundary in quadrupedal squamates are displaced relative to one another in snakes. Whereas certain craniovertebral muscles are elongated in some snakes, results of optimization on an ophidian cladogram show that the most recent common ancestor of extant snakes would have had the longest craniovertebral muscle, M. rectus capitis anterior, that is elongated only by several segments compared with that of quadrupedal squamates. Therefore, even such a posteriorly displaced "cervical" characteristic plesiomorphically lies fairly anteriorly in the greatly elongated precloacal region of snakes, suggesting that the trunk, not the neck, would have contributed most to the elongation of the snake precloacal region. A similar dissociation of structures usually associated with the neck-trunk boundary in quadrupedal squamates is observed in limb-reduced squamates, suggesting that these forms and snakes may share a developmental mechanism producing modifications in the

  16. The effects of Bobath-based trunk exercises on trunk control, functional capacity, balance, and gait: a pilot randomized controlled trial.

    Science.gov (United States)

    Kılınç, Muhammed; Avcu, Fatma; Onursal, Ozge; Ayvat, Ender; Savcun Demirci, Cevher; Aksu Yildirim, Sibel

    2016-02-01

    The aim of this study was to investigate the effects of Bobath-based individually designed trunk exercises on trunk control, upper and lower extremity function, and walking and balance in stroke patients. The main aim of treatment was to eliminate individual trunk impairments during various patient functions. The study was planned as an assessor-blinded, randomized controlled trial. A total of 22 patients volunteered to participate in the study. Trunk function, functional capacity, and gait were assessed with the Trunk Impairment Scale (TIS), stroke rehabilitation assessment of movement (STREAM), and a 10-m walking test, respectively. The Berg Balance Test (BBT), functional reach (FR), and timed up-and-go (TUG) tests were used to evaluate balance. After the initial assessment, the patients were divided randomly into two groups, the study group (12 patients) and the control group (10 patients). The mean age of the patients in the study group was 55.91 years (duration of stroke 58.66 months) and that of the control group was 54.00 years (duration of stroke 67.20 months). Individual training programs were determined for the patients in the study group, taking into consideration their evaluation results; and strengthening, stretching, range of motion, and mat exercises were determined for the control group according to their functional level. The participants in both groups were taken into the physiotherapy program for 12 weeks, 3 days a week for 1 hour a day. In group analyses, both groups showed improvement in STREAM, TIS, and TUG tests. Only the study group produced significant gains in the BBT, FR, and 10 m walking tests (P 0.05). Individually developed exercise programs in the Bobath concept improve trunk performance, balance, and walking ability in stroke patients more than do conventional exercises.

  17. Functional analysis of SH3 domain containing ring finger 2 during the myogenic differentiation of quail myoblast cells

    Directory of Open Access Journals (Sweden)

    Si Won Kim

    2017-08-01

    Full Text Available Objective Owing to the public availability of complete genome sequences, including avian species, massive bioinformatics analyses may be conducted for computational gene prediction and the identification of gene regulatory networks through various informatics tools. However, to evaluate the biofunctional activity of a predicted target gene, in vivo and in vitro functional genomic analyses should be a prerequisite. Methods Due to a lack of quail genomic sequence information, we first identified the partial genomic structure and sequences of the quail SH3 domain containing ring finger 2 (SH3RF2 gene. Subsequently, SH3RF2 was knocked out using clustered regularly interspaced short palindromic repeat/Cas9 technology and single cell-derived SH3RF2 mutant sublines were established to study the biofunctional activity of SH3RF2 in quail myoblast (QM7 cells during muscle differentiation. Results Through a T7 endonuclease I assay and genotyping analysis, we established an SH3RF2 knockout (KO QM7#4 subline with 61 and 155 nucleotide deletion mutations in SH3RF2. After the induction of myotube differentiation, the expression profiles were analyzed and compared between regular QM7 and SH3RF2 KO QM7#4 cells by global RNA sequencing and bioinformatics analysis. Conclusion We did not detect any statistically significant role of SH3RF2 during myotube differentiation in QM7 myoblast cells. However, additional experiments are necessary to examine the biofunctional activity of SH3RF2 in cell proliferation and muscle growth.

  18. Is gastrointestinal plasticity in king quail (Coturnix chinensis) elicited by diet-fibre or diet-energy dilution?

    Science.gov (United States)

    Williamson, Sean A; Jones, Stephanie K Courtney; Munn, Adam J

    2014-06-01

    Phenotypic plasticity of organ size allows some animals to manage fluctuations of resource quality or availability. Here, we examined the phenotypic plasticity of the gastrointestinal tract of king quail (Coturnix chinensis) in a diet-fibre manipulation study. Quail were offered either a control low-fibre (high-quality) food (8.5% neutral-detergent fibre; NDF), or one of two experimental diets of higher fibre contents of 16% NDF (i.e. low-quality food). To examine whether phenotypic plasticity of organ size was associated with the fibre content per se, or as a consequence of diluting the diet energy contents by adding fibre, one of the high-fibre feeds was 'balanced' with additional energy to match that of the low-fibre control diet. Total empty dry mass of the gastrointestinal tract was significantly heavier among birds offered the unbalanced high-fibre diet as compared with those offered the control diet, with birds offered the fibrous but energy-balanced diet having guts of intermediate size. The heavier entire-gut mass (dry) of quail offered the unbalanced high-fibre diet was associated mainly with these birds having significantly heavier gizzards. Notably, the larger gizzard in the birds offered the unbalanced high-fibre diet was associated with marked increases in their metabolisability (digestion) of diet fibre. Our findings suggest that the available energy in the diet may be more important for eliciting phenotypic changes in the gut of these herbivorous birds rather than simple physical effects of diet fibre on feed intakes or on muscular compensation to fibrous ingesta. © 2014. Published by The Company of Biologists Ltd.

  19. Quail egg safety and trade on beaches of Salvador (BA: a study from a child labor perspective

    Directory of Open Access Journals (Sweden)

    Permínio Oliveira Vidal Júnior

    2013-08-01

    Full Text Available OBJECTIVE: This study aimed to describe the trade and microbiological quality of boiled quail eggs on the waterfront of Salvador , Bahia, Brazil, from the child labor perspective. METHODS: This cross-sectional study administered semi-structured questionnaires to 40 underage vendors and performed the microbiological assessment of 40 quail egg samples as follows: mesophilic aerobic microorganism count, coagulase-positive staphylococcus count, estimation of the most probable number of total and thermotolerant coliforms/Escherichia coli, and testing for Salmonella spp.. The results were compared with the standards provided by the Resolution RDC nº 12/2001, National Sanitary Surveillance Agency. RESULTS: The vendors were mostly female (57.5% students (95.0% aged 8 to 17 years. The most common reason for working was supplementation of the family income (57.5%. The mean gross income was R$38.31/day. Most of them presented inadequate personal hygiene but they recognized that foods could cause diseases. Many (47.5% vendors reported washing their hands up to twice daily. Mean mesophilic aerobic microorganism and coagulase-positive staphylococcus counts were 2.43 and 2.01 log colony-forming unit/g, respectively, and the estimated thermotolerant coliform contamination was 0.98 log most probable number/g. Escherichia coli was found in 15.0% of the samples and none contained Salmonella spp. Most (55.0% samples were noncompliant with the legislation. CONCLUSION: The results evidenced the presence of minors selling quail eggs on beaches of Salvador and suggest risk to consumers' health because of the detected contamination and vendors' ignorance of principles of hygiene.

  20. Grounded running in quails: simulations indicate benefits of observed fixed aperture angle between legs before touch-down.

    Science.gov (United States)

    Andrada, Emanuel; Rode, Christian; Blickhan, Reinhard

    2013-10-21

    Many birds use grounded running (running without aerial phases) in a wide range of speeds. Contrary to walking and running, numerical investigations of this gait based on the BSLIP (bipedal spring loaded inverted pendulum) template are rare. To obtain template related parameters of quails (e.g. leg stiffness) we used x-ray cinematography combined with ground reaction force measurements of quail grounded running. Interestingly, with speed the quails did not adjust the swing leg's angle of attack with respect to the ground but adapted the angle between legs (which we termed aperture angle), and fixed it about 30ms before touchdown. In simulations with the BSLIP we compared this swing leg alignment policy with the fixed angle of attack with respect to the ground typically used in the literature. We found symmetric periodic grounded running in a simply connected subset comprising one third of the investigated parameter space. The fixed aperture angle strategy revealed improved local stability and surprising tolerance with respect to large perturbations. Starting with the periodic solutions, after step-down step-up or step-up step-down perturbations of 10% leg rest length, in the vast majority of cases the bipedal SLIP could accomplish at least 50 steps to fall. The fixed angle of attack strategy was not feasible. We propose that, in small animals in particular, grounded running may be a common gait that allows highly compliant systems to exploit energy storage without the necessity of quick changes in the locomotor program when facing perturbations. © 2013 Elsevier Ltd. All rights reserved.

  1. The effect of diet and host genotype on ceca microbiota of Japanese quail fed a cholesterol enriched diet

    Directory of Open Access Journals (Sweden)

    Shasha eLiu

    2015-10-01

    Full Text Available Two Japanese quail strains, respectively atherosclerosis-susceptible (SUS and –resistant (RES, have been shown to be good models to study cholesterol metabolism and transportation associated with atherosclerosis. Our objective was to examine possible difference in cecal microbiota between these strains when fed a control diet and a cholesterol enriched diet, to determine how host genotype and diet could affect the cecal microbiome that may play a part in cholesterol metabolism. A factorial study with both strains and two diets (control, cholesterol was carried out. Cecal content was collected from 12 week old quail that have been on their respective diets for 6 weeks. DNA was extracted from the samples and the variable region 3 to 5 of the bacterial 16S rRNA gene was amplified. The amplicon libraries were subjected to pyrosequencing. Principal Component Analysis (PCA of β-diversity showed four distinct microbiota communities that can be assigned to the 4 treatment groups (RES/control, RES/cholesterol, SUS/control, SUS/cholesterol. At the Phylum level, the 4 treatment groups has distinct Firmicutes community characteristics but no significant difference in Bacteroidetes. Eubacterium dolichum was rare in RES/control but became overabundant in RES/cholesterol. An unclassified species of Lactobacillaceae was found in abundance in SUS/control but the same species was rare in RES/cholesterol. On the other hand, two Lactobacillus species were only found in RES/control and an unclassified Lachnospiraceae species was abundant in RES/cholesterol but rare in SUS/control. The abundance of 4 species of Lachnospiraceae, 3 species of Ruminococcaceae and one species of Coprobacillaceae was positively correlated with plasma Total Cholesterol, plasma LDL, and LDL/HDL ratio. Our study of cecal microbiota in these quail has demonstrated that selection for susceptibility/resistance to diet induced atherosclerosis has also affected the quail’s cecal environment

  2. Bovine meat and Bone Meal as an Economically Viable Alternative in Quail Feeding in the Final Phase

    Directory of Open Access Journals (Sweden)

    CC Pizzolante

    Full Text Available ABSTRACT Bovine meat and bone meal (MBM has been used as a low-cost protein source in corn- and soybean meal-based poultry diets. However, to date, no studies investigating the effect of the dietary inclusion of MBM on the performance of Japanese quails and on egg production costs were found in literature. In this study, 600 Japanese quails in lay were distributed in a completely randomized experimental design consisting of six treatments (replacement levels of soybean meal by MBM:0, 1, 2, 3, 4, and 5% with five replicates of 20 birds each to investigate if MBM is a viable alternative to maintain or to improve the live and economic performances of these birds. Treatments consisted of a control diet, based on corn and soybean meal, with no inclusion of MBM, and diets formulated with increasing levels (1, 2, 3, 4, and 5% of MBM inclusion at the expense of soybean meal. The studied parameters were evaluated in four periods of 28 days each. Live performance parameters (egg weight, g; average egg production, %; egg weight, g; feed intake, g; feed conversion ratio per egg mass, kg/kg and per dozen eggs, dz/kg; and livability, %; egg quality parameters (proportion of egg components, yolk, albumen, eggshell %; egg specific weight, g/cm3; and economic parameter (bio-economic nutritional index were determined. Only egg weight, egg specific weight, and eggshell percentage were affected (p<0.05 by the treatments. Our results show that inclusion of bovine meat and bone meal can be added to the diet of Japanese quails in lay, causing no performance losses and promoting feed cost savings up to 5.24%.

  3. Hippotherapy effects on trunk, pelvic, and hip motion during ambulation in children with neurological impairments.

    Science.gov (United States)

    Encheff, Jenna L; Armstrong, Charles; Masterson, Michelle; Fox, Christine; Gribble, Phillip

    2012-01-01

    This study investigated the effects of a 10-week hippotherapy program on trunk, pelvis, and hip joint positioning during the stance phase of gait. Eleven children (6 boys and 5 girls; 7.9 ± 2.7 years) with neurological disorders and impaired ambulation participated. Joint range of motion data were collected via 3-dimensional computerized gait analysis before and after the program. Paired t tests were performed on kinematic data for each joint. Significant improvements (P ≤ .008) and large effect sizes (ESs) for sagittal plane hip positions at initial contact and toe-off were found. No differences in pelvic or trunk positioning were determined, although sagittal plane pelvic positioning displayed a trend toward improvement with large ESs. Several trunk variables displayed moderate ESs with a trend toward more upright positioning. Improvements in pelvic and hip joint positioning and more normalized vertical trunk position may indicate increased postural control during gait after 10 sessions of hippotherapy.

  4. Diagnosis of celiac trunk compression stenosis in ischemic gastric and duodenal ulcer

    International Nuclear Information System (INIS)

    Potashov, L.V.; Morozov, V.P.; Chekhuta, S.M.; Rodionov, K.K.

    1986-01-01

    Chronic gastric and duodenal ulcers may result from ischemia determined by celiac trunk compression stenosis (CTCS). In such cases angiography is necessary to specify diagnosis, to bring to light the causes of ulceration and to define therapeutic tactics. An analysis of angiograms of 75 patients with gastric and duodenal mucosa ulcers in CTCS and its characteristics have presented. The opening and proximal part of the celiac trunk are more frequently subjected to compression. The length of a narrow part of the celiac trunk is on an average of 6.62±0.31 mm. Enlargement in the diameter of the gastroduodenal artery was noted. Simultaneous narrowing of the celaic trunk and the upper mesenteric artery was found in 18 patients

  5. Studies on oil palm trunks as sources of infection in the field.

    Science.gov (United States)

    Flood, J; Keenan, L; Wayne, S; Hasan, Y

    2005-01-01

    Diseases of oil palm caused by Ganoderma boninense are of major economic importance in much of South-East Asia. This paper describes results from an ongoing field trial concerning the spread of the pathogen from artificially inoculated trunks used to simulate spread from windrowed trunks. Three planting distances for bait seedlings revealed that the closer the seedling was planted to the source of inoculum the sooner it succumbed to the disease. However, infection only occurred when the trunks were mounded (covered with soil), and seedlings planted around uncovered trunks (at any distance) have showed no symptoms of disease to date. Isolates are being collected from infected plants and molecular analysis is being undertaken to give more information on the spread of the pathogen.

  6. Vulnerability of terrestrial-trunked radio to intelligent intentional electromagnetic interference

    NARCIS (Netherlands)

    Tanuhardja, Ray R.; van de Beek, G.S.; Bentum, Marinus Jan; Leferink, Frank Bernardus Johannes

    2015-01-01

    The terrestrial-trunked radio (TETRA) specification is produced by the European Telecommunication Standards Institute for private mobile radio systems. We investigated the resilience of TETRA against intelligent intentional electromagnetic interference (IEMI) with low amplitude. Low power signals

  7. Back muscle response to sudden trunk loading can be modified by training among healthcare workers

    DEFF Research Database (Denmark)

    Pedersen, Mogens Theisen; Essendrop, Morten; Skotte, Jørgen H.

    2007-01-01

    Study Design. Experimental study of the effect of physical training on the reaction to sudden back loading. Objective. To investigate the effect and sustainability of "on the job training" on the reaction to sudden back loading among employees at a geriatric ward. Summary of Background Data...... of the trunk (stopping time). Data on the possibilities of a training-induced improvement in the reflex response among workers exposed to sudden trunk loading on the job are, however, nonexistent, and there is no evidence of long-term benefits, i.e., the sustainability of a positive training effect. Methods....... Available data suggest that a delayed muscle reflex response to sudden trunk loading may increase the risk of low back injuries. We have previously shown that training may alter the response to sudden trunk loading in healthy subjects and decrease the time elapsed until stopping of the forward movement...

  8. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  9. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  10. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  11. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  12. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  13. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  14. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  15. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  16. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  17. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  18. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  19. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  20. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  1. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  2. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  4. Observations of NC stop nets for bottlenose dolphin takes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  5. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  6. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  7. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  8. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

  9. ORF Sequence: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  10. ORF Sequence: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  11. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

  12. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  13. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  14. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  15. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

  16. ORF Alignment: NC_006569 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

  17. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  18. Explorations of the extended ncKP hierarchy

    International Nuclear Information System (INIS)

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert

    2004-01-01

    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  19. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

  20. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  1. ORF Alignment: NC_006371 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  2. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  3. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

  4. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  5. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

  6. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  7. ORF Sequence: NC_001147 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

  8. ORF Sequence: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

  9. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  10. ORF Sequence: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

  11. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

  12. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC

    Science.gov (United States)

    2011-12-16

    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  13. ORF Sequence: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

  14. ORF Sequence: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

  15. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  16. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

  17. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  18. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

  19. ORF Alignment: NC_003064 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  20. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

  1. 77 FR 46631 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-08-06

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  2. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  3. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  4. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  5. BChPT x 1/Nc: masses and currents

    Energy Technology Data Exchange (ETDEWEB)

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)

    2018-04-01

    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  6. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

  7. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

  8. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

  9. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

  10. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

  11. Toxicity of Heliotropium dolosum, Heliotropium circinatum, and Senecio vernalis in Parental Quail and Their Progeny, with Residue Evaluation of Eggs

    OpenAIRE

    ERÖKSÜZ, Yesari; ÇERİBAŞI, Ali Osman; ÇEVİK, Aydın; ERÖKSÜZ, Hatice

    2014-01-01

    In all, 160 Japanese quail (80 male and 80 female) were divided into 4 groups (3 test groups and 1 control group). The test groups were fed a diet containing aerial parts (leaves, stems, and flowers) of Senecio vernalis (SV group), Heliotropium dolosum (HD group), or Heliotropium circinatum (HC group) at the level of 30% for 6 weeks, and the control group was fed 0% in order to evaluate parental and progenial toxicity, along with the transference of alkaloid residues to their eggs. The pyrrol...

  12. Viability of quail embryos and nestlings from the eggs exposed to gamma-radiation, vibration and storage

    International Nuclear Information System (INIS)

    Mishchenko, V.F.; Shafirkin, A.V.

    1986-01-01

    The viability of quail embryos and nestlings from the incubation eggs exposed (in) to gamma-radiation at a dose of 300 cGy and stored for 15 days or (ii) to gamma-radiation at a dose of 300 cGy and stored for 30 days or (iii) to vibration with the acute egg end oriented contrary to the vibration front and stored for 30 days did not decrease as compared to that of the controls stored for the same time period. The viability diminished if the radiation dose was increased to 600-1200 cGy of if the egg orientation during vibration was changed

  13. Reconstructed frontal and coronal cuts in computed tomography of the trunk

    International Nuclear Information System (INIS)

    Fochem, K.; Klumair, J.

    1982-01-01

    A comparison between the original coronally cuts and the reconstructed coronal cuts yielded basic information on the loss of quality by computed reconstruction of images. As for the trunk, only comparisons between the conventional linear tomography and computed frontal of trunk cuts are possible. A few examples will demonstrate that despite a considerable loss of quality, computed frontal cuts will supply additional information in certain cases. It is also shown that the reconstructed frontal cuts cannot replace conventional tomography. (orig.) [de

  14. An Unusual Case of Stent Migration After Celiac Trunk Endovascular Revascularization

    Energy Technology Data Exchange (ETDEWEB)

    Negri, Silvia; Ferraro, Stefania; Piffaretti, Gabriele, E-mail: gabriele.piffaretti@uninsubria.it; Rivolta, Nicola; Bossi, Matteo [University of Insubria School of Medicine, Vascular Surgery, Department of Surgical Sciences, Circolo University Hospital (Italy); Carrafiello, Gianpaolo [University of Insubria School of Medicine, Interventional Radiology, Department of Radiology, Circolo University Hospital (Italy); Castelli, Patrizio [University of Insubria School of Medicine, Vascular Surgery, Department of Surgical Sciences, Circolo University Hospital (Italy)

    2012-08-15

    A 61-year-old woman underwent celiac trunk stenting to treat abdominal angina. Three months later, she was readmitted for recurrent symptoms. Computed tomography control revealed the migration of the stent into the splenic artery. No sign of vessel injury or end-organ ischemia was detected. Repeat stenting of the celiac trunk was performed; the postoperative course was uneventful. 12 months later, the patient was asymptomatic with the second stent in its correct position, and she was asymptomatic for mesenteric ischemia.

  15. An Unusual Case of Stent Migration After Celiac Trunk Endovascular Revascularization

    International Nuclear Information System (INIS)

    Negri, Silvia; Ferraro, Stefania; Piffaretti, Gabriele; Rivolta, Nicola; Bossi, Matteo; Carrafiello, Gianpaolo; Castelli, Patrizio

    2012-01-01

    A 61-year-old woman underwent celiac trunk stenting to treat abdominal angina. Three months later, she was readmitted for recurrent symptoms. Computed tomography control revealed the migration of the stent into the splenic artery. No sign of vessel injury or end-organ ischemia was detected. Repeat stenting of the celiac trunk was performed; the postoperative course was uneventful. 12 months later, the patient was asymptomatic with the second stent in its correct position, and she was asymptomatic for mesenteric ischemia.

  16. Trunk Dynamics Are Impaired in Ballet Dancers with Back Pain but Improve with Imagery.

    Science.gov (United States)

    Gildea, Jan E; VAN DEN Hoorn, Wolbert; Hides, Julie A; Hodges, Paul W

    2015-08-01

    Trunk control is essential in ballet and may be compromised in dancers with a history of low back pain (LBP) by associated changes in motor control. This study aimed to compare trunk mechanical properties between professional ballet dancers with and without a history of LBP. As a secondary aim, we assessed whether asking dancers to use motor imagery to respond in a "fluid" manner could change the mechanical properties of the trunk and whether this was possible for both groups. Trunk mechanical properties of stiffness and damping were estimated with a linear second-order system, from trunk movement in response to perturbations, in professional ballet dancers with (n = 22) and without (n = 8) a history of LBP. The second-order model adequately described trunk movement in response to the perturbations. Trials were performed with and without motor imagery to respond in a fluid manner to the perturbation. Dancers with a history of LBP had lower damping than dancers without LBP during the standard condition (P = 0.002) but had greater damping during the "fluid" condition (P 0.99). Stiffness was not different between the dancers with and those without a history of LBP (P = 0.252) but was less during the fluid condition than the standard condition (P < 0.001). Although dancers with a history of LBP have less trunk damping than those without LBP, they have the capacity to modulate the trunk's mechanical properties to match that of pain-free dancers by increasing damping with motor imagery. These observations have potential relevance for LBP recurrence and rehabilitation.

  17. precision deburring using NC and robot equipment. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, L.K.

    1980-05-01

    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  18. Is the basic trunk control recovery different between stroke patients with right and left hemiparesis?

    Science.gov (United States)

    Pappalardo, A; Ciancio, M R; Patti, F

    2014-01-01

    Basic trunk movement control is often impaired after stroke and its recovery is a "miliary stone" in rehabilitation. In this prospective, observational, parallel-group study, we investigated whether there are differences in terms of post-stroke recovery of basic trunk control between patients with left or with right hemiparesis. We recruited 94 patients with loss of postural trunk control due to stroke. Patients were divided into Group A (48 patients with left hemiparesis) and Group B (46 patients with right hemiparesis). We administered the Trunk Control Test (TCT) and the 13 motor items included on the Functional Independence Measure. Evaluation was performed at admission (To) and discharge (T1). TCT increased respectively from 46.7 ± 23.3 to 62.6 ± 19.5 (mean ± standard deviation-SD, p hemiparesis could affect the degree of recovery of basic trunk control after stroke. Patients with right hemiparesis benefit more than those with left hemiparesis. Improvement of basic trunk control was not responsible for an advantage on functional independence.

  19. Effect of Gene and Physical Activity Interaction on Trunk Fat Percentage Among the Newfoundland Population

    Directory of Open Access Journals (Sweden)

    Anthony Payne

    2014-01-01

    Full Text Available Objective To explore the effect of FTO gene and physical activity interaction on trunk fat percentage. Design and Methods Subjects are 3,004 individuals from Newfoundland and Labrador whose trunk fat percentage and physical activity were recorded, and who were genotyped for 11 single-nucleotide polymorphisms (SNPs in the FTO gene. Subjects were stratified by gender. Multiple tests and multiple regressions were used to analyze the effects of physical activity, variants of FTO , age, and their interactions on trunk fat percentage. Dietary information and other environmental factors were not considered. Results Higher levels of physical activity tend to reduce trunk fat percentage in all individuals. Furthermore, in males, rs9939609 and rs1421085 were significant (α = 0.05 in explaining central body fat, but no SNPs were significant in females. For highly active males, trunk fat percentage varied significantly between variants of rs9939609 and rs1421085, but there is no significant effect among individuals with low activity. The other SNPs examined were not significant in explaining trunk fat percentage. Conclusions Homozygous male carriers of non-obesity risk alleles at rs9939609 and rs1421085 will have significant reduction in central body fat from physical activity in contrast to homozygous males of the obesity-risk alleles. The additive effect of these SNPs is found in males with high physical activity only.

  20. Application of Ground-Penetrating Radar for Detecting Internal Anomalies in Tree Trunks with Irregular Contours.

    Science.gov (United States)

    Li, Weilin; Wen, Jian; Xiao, Zhongliang; Xu, Shengxia

    2018-02-22

    To assess the health conditions of tree trunks, it is necessary to estimate the layers and anomalies of their internal structure. The main objective of this paper is to investigate the internal part of tree trunks considering their irregular contour. In this respect, we used ground penetrating radar (GPR) for non-invasive detection of defects and deteriorations in living trees trunks. The Hilbert transform algorithm and the reflection amplitudes were used to estimate the relative dielectric constant. The point cloud data technique was applied as well to extract the irregular contours of trunks. The feasibility and accuracy of the methods were examined through numerical simulations, laboratory and field measurements. The results demonstrated that the applied methodology allowed for accurate characterizations of the internal inhomogeneity. Furthermore, the point cloud technique resolved the trunk well by providing high-precision coordinate information. This study also demonstrated that cross-section tomography provided images with high resolution and accuracy. These integrated techniques thus proved to be promising for observing tree trunks and other cylindrical objects. The applied approaches offer a great promise for future 3D reconstruction of tomographic images with radar wave.

  1. Richness and epiphytic mosses cover variation on ironwood trees (Parrotia persica Pojark trunks

    Directory of Open Access Journals (Sweden)

    Seyedeh Rahimeh Yavarynik

    2016-06-01

    Full Text Available This research was conducted to determination and assess changes in richness and cover of epiphytic mosses on ironwood trees(Parrotia persica Pojark trunks along trunk elevation and slope aspect gradients, in lowland and protected forest of Natural Resource College of Tarbiat Modares University (Parts of western limit of Noor forest reserved. To do this, a number of 20 individual of ironwood trees with a diamerter higher than 40 cm were selected randomly in the study area. A rectangle with 40*30 cm in two geographical directions (Northern and Southern, in 4 height classes (from 0 to 160cm on the trunks was sampled and related characteristics were recorded. Results of floristic study showed that presence of 17 epiphytic mosses species and the endemic species Palamocladium euchloron among the species with highest presence and Brachytheciaceae family with 7 species were the most important taxa and family in the forest. Richness and cover percentage of epiphytic mosses had the highest averages in northern and lower parts of the trees trunk, this could be due to higher moisture in northern direction and lower parts of the trunk. Result of the study, well clarified the changes of distribution and abundance of the most important forest elements in relationship changes of geographical situation of Parrotia persica trunks.

  2. Trunk muscle activation in a person with clinically complete thoracic spinal cord injury.

    Science.gov (United States)

    Bjerkefors, Anna; Carpenter, Mark G; Cresswell, Andrew G; Thorstensson, Alf

    2009-04-01

    The aim of this study was to assess if, and how, upper body muscles are activated in a person with high thoracic spinal cord injury, clinically classified as complete, during maximal voluntary contractions and in response to balance perturbations. Data from one person with spinal cord injury (T3 level) and one able-bodied person were recorded with electromyography from 4 abdominal muscles using indwelling fine-wire electrodes and from erector spinae and 3 upper trunk muscles with surface electrodes. Balance perturbations were carried out as forward or backward support surface translations. The person with spinal cord injury was able to activate all trunk muscles, even those below the injury level, both in voluntary efforts and in reaction to balance perturbations. Trunk movements were qualitatively similar in both participants, but the pattern and timing of muscle responses differed: upper trunk muscle involvement and occurrence of co-activation of ventral and dorsal muscles were more frequent in the person with spinal cord injury. These findings prompt further investigation into trunk muscle function in paraplegics, and highlight the importance of including motor tests for trunk muscles in persons with thoracic spinal cord injury, in relation to injury classification, prognosis and rehabilitation.

  3. Real time noninvasive assessment of external trunk geometry during surgical correction of adolescent idiopathic scoliosis

    Directory of Open Access Journals (Sweden)

    Mac-Thiong Jean-Marc

    2009-02-01

    Full Text Available Abstract Background The correction of trunk deformity is crucial in scoliosis surgery, especially for the patient's self-image. However, direct visualization of external scoliotic trunk deformity during surgical correction is difficult due to the covering draping sheets. Methods An optoelectronic camera system with 10 passive markers is used to track the trunk geometry of 5 scoliotic patients during corrective surgery. The position of 10 anatomical landmarks and 5 trunk indices computed from the position of the passive markers are compared during and after instrumentation of the spine. Results Internal validation of the accuracy of tracking was evaluated at 0.41 +/- 0.05 mm RMS. Intra operative tracking during surgical maneuvers shows improvement of the shoulder balance during and after correction of the spine. Improvement of the overall patient balance is observed. At last, a minor increase of the spinal length can be noticed. Conclusion Tracking of the external geometry of the trunk during surgical correction is useful to monitor changes occurring under the sterile draping sheets. Moreover, this technique can used be used to reach the optimal configuration on the operating frame before proceeding to surgery. The current tracking technique was able to detect significant changes in trunk geometry caused by posterior instrumentation of the spine despite significant correction of the spinal curvature. It could therefore become relevant for computer-assisted guidance of surgical maneuvers when performing posterior instrumentation of the scoliotic spine, provide important insights during positioning of patients.

  4. Radiologic Findings of Epidermal Cysts in the Trunk

    International Nuclear Information System (INIS)

    Kim, Myung Hyun; Chung, Jae Joon; Park, Kyoung Seuk; Park, Su Mi

    2005-01-01

    To evaluate the ultrasonographic (US) or computer tomography (CT) findings of surgically proven epidermal cysts in the trunk, and to compare the echogenicity of cysts with internal contents. Forty-five patients were retrospectively evaluated. US and CT findings of epidermal cysts were assessed in regard to location, size, shape, number, echogenicity, posterior sound enhancement, internal density, septa, mural nodule and calcification, perilesional infiltration, contrast enhancement, and internal contents. All 45 patients (M:F=29:16; US in 26, CT in 19) had only one cyst, and they were located in the buttocks (n=19), back (n=13), inguinal (n=4), posterior neck (n=3), perineum (n=2), abdominal wall (n=2), presternal (n=1), and axilla (n=1). Of 26 patients who underwent US, there were 8 cases of homogeneously hypoechoic mass (30.8%), 8 of inhomogeneously hypoechoic mass (30.8%), 7 of homogeneously hypoechoic mass with internal hypoechoic lines and echogenic spots (26.9%) and 3 of homogeneously hypoechoic mass with internal echogenic spots (11.5%). Posterior sound enhancement was noted in 21 patients (80.8%). Of 19 patients who underwent CT, there were 14 cases of simple cyst (73.7%) and 5 of abscess-like lesion (26.3%). Overlying skin thickening (n=13), contrast enhancement of cystic wall (n=11), perilesional infiltration (n=7), and internal septa (n=6) were demonstrated. The internal contents of the cysts were keratinous (n=27, 60.0%) or greasy (n=15, 33.3%) material. There was no statistical significance between the echogenicity of the cysts and the internal contents (p > 0.2). Epidermal cysts showed homogeneous or inhomogeneous hypoechoic mass with posterior sound enhancement on US. There was no relationship between the echogenicity of the cysts and the internal contents. In the case of ruptured cyst, an abscess-like lesion with wall enhancement and perilesional infiltration was noted on CT scan

  5. The Comparison of Propagation Model for Terrestrial Trunked Radio (TETRA

    Directory of Open Access Journals (Sweden)

    Ayu Kartika R

    2013-12-01

    Full Text Available A system of digital radio Terrestrial Trunked Radio (TETRA is designed for communication which need specialility, better privacy, better quality of audio with speed transmission data and access capacity to the internet and telephone network. TETRA system of TMO and DMO operation mode which has wide coverage and reliable than the interference so that the TETRA planning needs a propagation model which corresponding with environment. Therefore, this research compare a pathloss value of calculation of propagation model such as Free Space Loss, Wickson, Bacon, CEPT SE21, Ericsson (9999, ITU-R SM 2028 and Okumura Hata based on the environment are clutter urban, sub urban dan rural. The calculation of pathloss provide that Bacon propagation model is an corresponding model for DMO operation mode with a frequency of 380 MHz, height handhelds 1.5 m and 2 m with pathloss value of 76.82 dB at a distance of 100 m and 113.63 dB at a distance of 1 km while the 400 MHz frequency pathloss value of 77.08 dB at a distance of 100 m and 113.6 dB at a distance of 1 km. The propagation model which corresponding to the TMO operation mode with a frequency of 400 MHz distance of 1 km, the transmitter antenna height (hb 30 m and receiver antenna height (hm 1.5 m is a model of Ericsson (9999 on urban clutter with pathloss value of 96.4 dB, the model ITU-R SM2028 in suburban clutter with a pathloss value of 101.13 dB, and the model ITU-R SM2028 on rural clutter with pathloss value of 83.59 dB. Keywords: TETRA, propagation model, urban, suburban, rural

  6. Combined exposure of Japanese quails to cyanotoxins, Newcastle virus and lead: oxidative stress responses.

    Science.gov (United States)

    Paskova, Veronika; Veronika, Paskova; Paskerova, Hana; Hana, Paskerova; Pikula, Jiri; Jiri, Pikula; Bandouchova, Hana; Hana, Bandouchova; Sedlackova, Jana; Jana, Sedlackova; Hilscherova, Klara; Klara, Hilscherova

    2011-10-01

    Wild birds are continually exposed to many anthropogenic and natural stressors in their habitats. Over the last decades, mass mortalities of wild birds constitute a serious problem and may possibly have more causations such as natural toxins including cyanotoxins, parasitic diseases, industrial chemicals and other anthropogenic contaminants. This study brings new knowledge on the effects of controlled exposure to multiple stressors in birds. The aim was to test the hypothesis that influence of cyanobacterial biomass, lead and antigenic load may combine to enhance the effects on birds, including modulation of antioxidative and detoxification responses. Eight treatment groups of model species Japanese quail (Coturnix coturnix japonica) were exposed to various combinations of these stressors. The parameters of detoxification and oxidative stress were studied in liver and heart after 30 days of exposure. The antioxidative enzymatic defense in birds seems to be activated quite efficiently, which was documented by the elevated levels and activities of antioxidative and detoxification compounds and by the low incidence of damage to lipid membranes. The greatest modulations of glutathione level and activities of glutathione-S-transferase, glutathione peroxidase, glutathione reductase, superoxide dismutase, catalase and lipid peroxidation were shown mostly in the groups with combined multiple exposures. The results indicate that the antioxidative system plays an important role in the protective response of the tissues to applied stressors and that its greater induction helps to protect the birds from more serious damage. Most significant changes of these "defense" parameters in case of multiple stressors suggest activation of this universal mechanism in situation with complex exposure and its crucial role in protection of the bird health in the environment. Copyright © 2011 Elsevier Inc. All rights reserved.

  7. The impact of eggshell colour and spot area in Japanese quails: II. Slaughter and carcass characteristic

    Directory of Open Access Journals (Sweden)

    Sema Alasahan

    Full Text Available ABSTRACT This study was carried out to investigate the effects of eggshell colour and spot properties (colour and size of the spot area on growth performance and carcass traits of Japanese quail (Coturnix coturnix japonica eggs. Study material were allocated to five groups according to their eggshell and spot colours: black spots on greyish white coloured eggshell (I, blue spots on greyish white coloured eggshell (II, diffuse brown spots on greyish brown coloured eggshell (III, brown spots on light green colored eggshell (IV, and small brown spots on greyish brown coloured eggshell (V. The size of the spotted area was determined in each egg group using digital image analysis. The groups did not differ for body weight and length of the shank at the end of the growth period. However, the groups differed significantly for carcass yield after slaughter (not eviscerated and carcass yield. These parameters were highest in Group I (82.08 and 76.09% and lowest in Group III (80.20 and 73.86%. Digital image analysis demonstrated that heart length, cardiac fat area, gizzard width, and intestine length varied between the groups. Cardiac fat area was largest in Group III (0.86 cm2 and smallest in Group V (0.65 cm2. Gizzard width was greatest in Group I (2.63 cm and smallest in Group V (2.47 cm. Intestine length was greatest in Group V (78.45 cm and smallest in Group IV (72.39 cm. Body weight, shank length, and slaughter and carcass weight do not vary in relation to eggshell colour or the size of the spotted area. The lengths of intestine and heart, gizzard width, and cardiac fat area do vary in relation to eggshell colour or the size of the spotted area.

  8. Comparison of animal and plant proteins for young pen-reared bobwhite quail

    Science.gov (United States)

    Nestler, R.B.; Llewellyn, L.M.; Rensberger, M.J.

    1945-01-01

    Bobwhite quail chicks, when given a choice of balanced diets in which the essential difference was the protein supplement, showed preferences for one diet containing 49 per cent peanut oil meal, another containing a mixture of 9 per cent meat and bone scraps (50% protein) with 38 per cent soybean oil meal, and a third (control) diet containing a mixture of 16 per cent dried buttermilk with 42 per cent soybean oil meal, in contrast to diets containing sardine meal or menhaden fish meal. ....Feeding tests during the first five weeks of life showed that diets containing 14 per cent sardine fish meal consistently gave high live weights, low mortality, and high efficiency of feed utilization. Diets with 9 to 10 per cent menhaden meal produced nearly as good results....Live weights, survival, and efficiency of feed utilization were markedly better on a diet containing 9 per cent meat and bone scrap (50% protein) than on one with 9 per cent meat scrap (55% protein), but not as good as with diets containing fish meal without meat....The chicks grew and survived more successfully on diets containing either soybean oil meal or peanut oil meal as the sole protein supplement, than on diets containing either linseed oil meal, cottonseed oil meal, or dried buttermilk as the sole protein concentrate. None of these was as satisfactory as the diets containing fish meal.....All chicks died on diets containing either linseed oil meal, cottonseed oil meal, or dried buttermilk as the sole source of protein. All three of these concentrates, however, gave satisfactory results, when used as 10 per cent of the diet. In fact, survival and efficiency of feed utilization were nearly as good on a diet containing 10 per cent dried buttermilk, 10 per cent linseed oil meal, 10 per cent peanut oil meal, and 27 per cent soybean oil meal, as on diets containing fish meal.

  9. Growing and laying performance of Japanese quail fed diet supplemented with different concentrations of acetic acid

    Directory of Open Access Journals (Sweden)

    Youssef A. Attia

    2013-04-01

    Full Text Available In order to evaluate the effect of acetic acid on growing and laying performance of Japanese Quail (JQ, 180 15-day-old JQ were divided into 4 groups. During the growing (15-42 days of age and laying (43-84 days of age periods, the groups fed the same basal diets supplemented with 0, 1.5, 3 and 6% of acetic acid. Each diet was fed to five replicates of 9 JQ (3 males:6 females during the growing period. During the laying period, 128 birds were housed in 32 cages (4 birds per cage, 1 male and 3 females, 8 replicates per treatment. Birds were housed in wire cages (46L×43W×20H cm in an open room. Acetic acid supplementation at 3% in the diets significantly increased the growth and laying rate and the Haugh unit score. The liver percentage significantly decreased with acetic acid at 6%. Acetic acid at 3% significantly increased hemoglobin concentrations at 6 weeks of age and increased weight of day old chicks hatched. Acetic acid affected the immune system as manifested by an excess of cellular reactions in the intestine as well as lymphoid hyperplasia in the spleen tissue. Degenerative changes in the covering epithelium of the intestinal villi were noted at the 6% concentration of acetic acid. Hepatocyte vacuolation and fatty changes were also observed at this concentration of treatment. In conclusion, 3% acetic acid may be used as a feed supplement for JQ during the growing and laying period to improve the productive performance.

  10. Osteoclast cell-surface specializations and nuclear kinetics during egg-laying in Japanese quail

    International Nuclear Information System (INIS)

    Miller, S.C.

    1981-01-01

    Medullary bone deposits serve as a reservoir of labile calcium for egg-shell calcification in birds. Quantitative transmission-electron-microscope methods and light-microscope autoradiographic cell-population-kinetic analyses were used to determine changes in cell-surface specializations and population dynamics of medullary bone osteoclasts during egg-laying in Japanese quail. Prior to egg-shell formation, from 0 to about 8 hours after the previous oviposition, very few osteoclast profiles had ruffled borders. The appearance of ruffled borders coincided with the beginning of egg-shell calcification, about 9-10 hours after the previous oviposition. During egg-shell calcification, about 10-21 hours after the previous oviposition, most osteoclast profiles had ruffled borders. Ruffled borders disappeared at the completion of egg-shell calcification and commencement of egg-shell pigmentation. Thus, functional activities of medullary bone osteoclasts appear to be closely synchronized with egg-shell calcification during egg-laying. From 1 to 48 hours after a single injection of 3H-thymidine (3H-TdR), very few labeled osteoclast nuclei were seen during egg-laying. Following multiple injections of 3H-TdR, the percentage of labeled nuclei reached a peak at about 170 hours after the first injection. At this peak-labeling time, relatively few of the osteoclast profiles that had labeled nuclei had two or more; although the average number of nuclei per osteoclast profile was about 3.6. These kinetic data suggest that the medullary bone osteoclast population has a prolonged rate of turnover compared to rapid changes in cell activities associated with each 24-hour egg-laying cycle; and collectively they would suggest that rapid changes in osteoclast functions occur independently of changes in cell-population dynamics

  11. Organizing effects of sex steroids on brain aromatase activity in quail.

    Directory of Open Access Journals (Sweden)

    Charlotte A Cornil

    2011-04-01

    Full Text Available Preoptic/hypothalamic aromatase activity (AA is sexually differentiated in birds and mammals but the mechanisms controlling this sex difference remain unclear. We determined here (1 brain sites where AA is sexually differentiated and (2 whether this sex difference results from organizing effects of estrogens during ontogeny or activating effects of testosterone in adulthood. In the first experiment we measured AA in brain regions micropunched in adult male and female Japanese quail utilizing the novel strategy of basing the microdissections on the distribution of aromatase-immunoreactive cells. The largest sex difference was found in the medial bed nucleus of the stria terminalis (mBST followed by the medial preoptic nucleus (POM and the tuberal hypothalamic region. A second experiment tested the effect of embryonic treatments known to sex-reverse male copulatory behavior (i.e., estradiol benzoate [EB] or the aromatase inhibitor, Vorozole on brain AA in gonadectomized adult males and females chronically treated as adults with testosterone. Embryonic EB demasculinized male copulatory behavior, while vorozole blocked demasculinization of behavior in females as previously demonstrated in birds. Interestingly, these treatments did not affect a measure of appetitive sexual behavior. In parallel, embryonic vorozole increased, while EB decreased AA in pooled POM and mBST, but the same effect was observed in both sexes. Together, these data indicate that the early action of estrogens demasculinizes AA. However, this organizational action of estrogens on AA does not explain the behavioral sex difference in copulatory behavior since AA is similar in testosterone-treated males and females that were or were not exposed to embryonic treatments with estrogens.

  12. Effect of needle puncture and electro-acupuncture on mucociliary clearance in anesthetized quails

    Directory of Open Access Journals (Sweden)

    Wang Tianshan

    2006-02-01

    Full Text Available Abstract Background Acupuncture therapy for obstructive respiratory diseases has been effectively used in clinical practice and the acupuncture points or acupoints of Zhongfu and Tiantu are commonly-used acupoints to treat patients with the diseases. Since the impaired mucociliary clearance is among the most important features of airway inflammation in most obstructive respiratory diseases, the effect of needle puncture and electro-acupuncture at the specific acupoints on tracheal mucociliary clearance was investigated in anesthetized quails. Methods Mucociliary transport velocity on tracheal mucosa was measured through observing the optimal pathway, and fucose and protein contents in tracheal lavages were determined with biochemical methods. In the therapeutic group, needle puncture or electro-acupuncture stimulation to the acupoints was applied without or with constant current output in 2 mA and at frequency of 100 Hz for 60 minutes. In the sham group, electro-acupuncture stimulation to Liangmen was applied. Results Our present experiments demonstrated that the electro-acupuncture stimulation to Zhongfu and Tiantu significantly increased tracheal mucociliary transport velocity and decreased the content of protein in the tracheal lavage, compared with the control group. Moreover, either needle puncture or electro-acupuncture stimulation to Zhongfu and Tiantu significantly reverted the human neutrophil elastase-induced decrease in tracheal mucociliary transport velocity and human neutrophil elastase -induced increase in the contents of fucose and protein in the tracheal lavage, compared with the control group. Conclusion These results suggest that either needle puncture or electro-acupuncture stimulation to the effective acupoints significantly improves both airway mucociliary clearance and the airway surface liquid and that the improvements maybe ascribed to both the special function of the points and the substantial stimulation of electricity.

  13. On the influence of storage duration on rheological properties of liquid egg products and response of eggs to impact loading - Japanese quail eggs

    Czech Academy of Sciences Publication Activity Database

    Kumbár, V.; Trnka, Jan; Nedomová, Š.; Buchar, J.

    2015-01-01

    Roč. 166, May (2015), s. 86-94 ISSN 0260-8774 Institutional support: RVO:61388998 Keywords : egg quality * japanese quail * haugh units * storage duration * non-Newtonian fluid * non-destructive impact * surface displacement Subject RIV: BI - Acoustics Impact factor: 3.199, year: 2015

  14. The effect of nano-selenium particles and sodium selenite on humoral immunity indices of quails using foods contaminated with aflatoxin B1

    Directory of Open Access Journals (Sweden)

    Ebrahim Talebi

    2017-08-01

    Full Text Available This experiment was conducted to evaluate the ability of inhibition of aflatoxin B1 by various sources of selenium and to compare the effect of nano selenium and sodium selenite on humoral immunity of quails. The experiment was performed in a completely randomized design (CRD using six treatments and four replicates of ten quail chicks per replicate. Two hundred forty quails were divided in six groups vis. control: without aflatoxin B1 and without selenium. Group2: 1ppm aflatoxin B1 and without selenium. Group3: 1 ppm aflatoxin B1 and 0.3 ppm nano selenium. Group4: 1 ppm aflatoxin B1 and 0.3 ppm sodium selenite. Group5: 1 ppm aflatoxin B1 and 0.6 ppm nano selenium. Group6: 1ppm aflatoxin B1 and 0.6 ppm sodium selenite. To evaluate the humoral immunity response 0.2­ml of sheep red blood cell (SRBC solution was injected into breast muscle of quails at day 35 and blood sampling was conducted after a week. Newcastle vaccine was injected at day 28 and the antibody titer was determined after two weeks. The highest level of titer of antibody against the SRBC solution was related to the group which received 0.06 ppm nano selenium (p

  15. Polychlorinated biphenyls as inducers of hepatic porphyria in Japanese quail, with special reference to δ-aminolevulinic acid synthetase activity, fluorescence, and residues in the liver

    NARCIS (Netherlands)

    Vos, J.G.; Strik, J.T.W.A.; Holsteyn, C.W.M. van; Pennings, J.H.

    1971-01-01

    Male Japanese quail were orally dosed, daily for 7 days, with 1000, 500, 250, 100, 50, and 0 mg PCB (Aroclor 1260) per kg body weight. The birds receiving 1000 mg/kg died. A dose-related increase in liver and liver: body weight ratio was found. Macroscopic and microscopic examination under

  16. Species specificity of social reinstatement in Japanese quail Coturnix japonica genetically selected for high or low levels of social reinstatement behaviour.

    Science.gov (United States)

    Mills, A D; Jones, R B; Faure, J M

    1995-05-01

    Divergent lines of Japanese quail Coturnix japonica showing high (HSR) or low (LSR) levels of social reinstatement (SR) behaviour (as measured in a treadmill apparatus) have been developed. However, it was not known if selection had influenced social reinstatement tendencies in a general or a species-specific fashion. Therefore, the present study compared the SR behaviour of quail chicks of the HSR and LSR lines and of a Control line when the goal box of the treadmill was empty or when it contained small, same-species groups of either Japanese quail, domestic fowl or Guinea fowl chicks. The results clearly demonstrated that the SR behaviour of Japanese quail chicks is species-specific and that this specificity has not been influenced during genetic selection, over sixteen generations, of the HSR and LSR lines. The HSR chicks showed more locomotor activity in the treadmill than did those of the other lines regardless of the nature of the goal-box stimulus. The results are discussed in terms of general activity, underlying fearfulness and social motivation.

  17. Effects of the usage of dried brewing yeast in the diets on the performance, egg traits and blood parameters in quails.

    Science.gov (United States)

    Yalçın, S; Erol, H; Ozsoy, B; Onbaşılar, I; Yalçın, S

    2008-12-01

    This experiment was carried out to determine the effects of the usage of dried brewing yeast in quail diets on laying performance, egg traits and blood parameters. A total of 240 Japanese quails (Coturnix coturnix japonica) aged 10 weeks were randomly allocated into one control group and three treatment groups. Each group was divided into five replicates as subgroups, comprising 12 quails each. Dried brewing yeast (Saccharomyces cerevisiae) was used at the levels of 1.5%, 3.0% and 4.5% in the diets of the first, second and third treatment groups, respectively. Soyabean meal was replaced with dried brewing yeast. The diets were formulated to be isocaloric and isonitrogenous. The experimental period lasted 18 weeks. Dietary treatments did not significantly affect body weight, daily feed intake, daily protein intake, egg production, egg weight, feed efficiency, mortality, egg shell thickness, egg albumen index, egg yolk index, egg Haugh unit, the percentages of egg shell, albumen and yolk, excreta moisture and small intestinal pH. Inclusion of 3% and 4.5% dried brewing yeast in diets reduced egg yolk cholesterol concentration as mg per yolk and mg per g yolk (P brewing yeast was significantly lower (P brewing yeast resulted in significant increases (P brewing yeast. It is concluded that dried brewing yeast can be used up to 4.5% in the diets of laying quails without adverse effects on the measured parameters.

  18. Soapwort extract supplementation alters antioxidant status of serum, liver and heart tissues in growing Japanese quails reared under chronic intermittent cold stress

    Directory of Open Access Journals (Sweden)

    Bestami Dalkilic

    2017-01-01

    Full Text Available Antioxidant effect of dietary soapwort extract supplementation was studied in growing Japanese quails suffering from chronic intermittent cold stress. For this purpose, a total of ninety 15-d-old quails were divided into three groups with three replicates. Chronic intermittent cold stress was applied every night between 22.00 to 06.00 h; starting at 14 °C for the first week, and gradually weekly lowered to 8 °C. Three groups were fed with corn-soy based standard diets supplemented with 0, 50, and 100 ppm soapwort extract for four weeks. At the end of the study, three males and three females were slaughtered to determine total antioxidant and oxidant status of serum, malondialdehyde, glutathione, glutathione peroxidase activity, superoxide dismutase of liver and heart tissues. Although the dietary soapwort extract had no effect on serum total antioxidant capacity, it significantly lowered the total oxidant status of serum in cold stressed quails. Glutathione and superoxide dismutase enzyme activity of liver and heart tissues were similar among groups. While the dietary soapwort extract had no effect on glutathione peroxidase activity of the heart tissue, it significantly increased glutathione peroxidase activity in the liver tissue. In relation to the control group, malondialdehyde concentrations in the liver and heart tissues were significantly lower in soapwort extract groups. These data suggest that dietary soapwort extract could alleviate the detrimental effects of oxidative stress in growing Japanese quails exposed to cold stress.

  19. Divergent selection for shape of growth curve in Japanese quail. 3. Onset of sexual maturity and basic characteristics of early lay

    Czech Academy of Sciences Publication Activity Database

    Hyánková, L.; Novotná, Božena

    2007-01-01

    Roč. 48, č. 5 (2007), s. 551-558 ISSN 0007-1668 R&D Projects: GA ČR(CZ) GA523/99/1262 Institutional research plan: CEZ:AV0Z50390512 Keywords : embryonicdevelopment * postnatal development * Japanese quail Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.071, year: 2007

  20. Trunk muscle activation and associated lumbar spine joint shear forces under different levels of external forward force applied to the trunk

    NARCIS (Netherlands)

    Kingma, I.; Staudenmann, D.; van Dieen, J.H.

    2007-01-01

    High anterior intervertebral shear loads could cause low back injuries and therefore the neuromuscular system may actively counteract these forces. This study investigated whether, under constant moment loading relative to L3L4, an increased externally applied forward force on the trunk results in a