Identification of QS-21 as an Inflammasome-activating Molecular Component of Saponin Adjuvants*
Marty-Roix, Robyn; Vladimer, Gregory I.; Pouliot, Kimberly; Weng, Dan; Buglione-Corbett, Rachel; West, Kim; MacMicking, John D.; Chee, Jonathan D.; Wang, Shixia; Lu, Shan; Lien, Egil
2016-01-01
Many immunostimulants act as vaccine adjuvants via activation of the innate immune system, although in many cases it is unclear which specific molecules contribute to the stimulatory activity. QS-21 is a defined, highly purified, and soluble saponin adjuvant currently used in licensed and exploratory vaccines, including vaccines against malaria, cancer, and HIV-1. However, little is known about the mechanisms of cellular activation induced by QS-21. We observed QS-21 to elicit caspase-1-dependent IL-1β and IL-18 release in antigen-presenting cells such as macrophages and dendritic cells when co-stimulated with the TLR4-agonist adjuvant monophosphoryl lipid A. Furthermore, our data suggest that the ASC-NLRP3 inflammasome is responsible for QS-21-induced IL-1β/IL-18 release. At higher concentrations, QS-21 induced macrophage and dendritic cell death in a caspase-1-, ASC-, and NLRP3-independent manner, whereas the presence of cholesterol rescued cell viability. A nanoparticulate adjuvant that contains QS-21 as part of a heterogeneous mixture of saponins also induced IL-1β in an NLRP3-dependent manner. Interestingly, despite the role NLRP3 plays for cellular activation in vitro, NLRP3-deficient mice immunized with HIV-1 gp120 and QS-21 showed significantly higher levels of Th1 and Th2 antigen-specific T cell responses and increased IgG1 and IgG2c compared with wild type controls. Thus, we have identified QS-21 as a nonparticulate single molecular saponin that activates the NLRP3 inflammasome, but this signaling pathway may contribute to decreased antigen-specific responses in vivo. PMID:26555265
Die verband tussen genade en werke in 1QS se reddingsbegrip
Directory of Open Access Journals (Sweden)
J.W. Semmelink
1995-09-01
Full Text Available The relationship between faith and works in the soteriology of 1QS. An analysis was made of 1QS to construct its view on grace and works in salvation. The author contends that Qumran makes much of works and that E P Sanders understated this element. Salvation according to 1QS can best be described by the modem term "synergism".
Identification of QS-21 as an Inflammasome-activating Molecular Component of Saponin Adjuvants.
Marty-Roix, Robyn; Vladimer, Gregory I; Pouliot, Kimberly; Weng, Dan; Buglione-Corbett, Rachel; West, Kim; MacMicking, John D; Chee, Jonathan D; Wang, Shixia; Lu, Shan; Lien, Egil
2016-01-15
Many immunostimulants act as vaccine adjuvants via activation of the innate immune system, although in many cases it is unclear which specific molecules contribute to the stimulatory activity. QS-21 is a defined, highly purified, and soluble saponin adjuvant currently used in licensed and exploratory vaccines, including vaccines against malaria, cancer, and HIV-1. However, little is known about the mechanisms of cellular activation induced by QS-21. We observed QS-21 to elicit caspase-1-dependent IL-1β and IL-18 release in antigen-presenting cells such as macrophages and dendritic cells when co-stimulated with the TLR4-agonist adjuvant monophosphoryl lipid A. Furthermore, our data suggest that the ASC-NLRP3 inflammasome is responsible for QS-21-induced IL-1β/IL-18 release. At higher concentrations, QS-21 induced macrophage and dendritic cell death in a caspase-1-, ASC-, and NLRP3-independent manner, whereas the presence of cholesterol rescued cell viability. A nanoparticulate adjuvant that contains QS-21 as part of a heterogeneous mixture of saponins also induced IL-1β in an NLRP3-dependent manner. Interestingly, despite the role NLRP3 plays for cellular activation in vitro, NLRP3-deficient mice immunized with HIV-1 gp120 and QS-21 showed significantly higher levels of Th1 and Th2 antigen-specific T cell responses and increased IgG1 and IgG2c compared with wild type controls. Thus, we have identified QS-21 as a nonparticulate single molecular saponin that activates the NLRP3 inflammasome, but this signaling pathway may contribute to decreased antigen-specific responses in vivo. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Wave-equation Qs Inversion of Skeletonized Surface Waves
Li, Jing
2017-02-08
We present a skeletonized inversion method that inverts surface-wave data for the Qs quality factor. Similar to the inversion of dispersion curves for the S-wave velocity model, the complicated surface-wave arrivals are skeletonized as simpler data, namely the amplitude spectra of the windowed Rayleigh-wave arrivals. The optimal Qs model is the one that minimizes the difference in the peak frequencies of the predicted and observed Rayleigh wave arrivals using a gradient-based wave-equation optimization method. Solutions to the viscoelastic wave-equation are used to compute the predicted Rayleigh-wave arrivals and the misfit gradient at every iteration. This procedure, denoted as wave-equation Qs inversion (WQs), does not require the assumption of a layered model and tends to have fast and robust convergence compared to full waveform inversion (FWI). Numerical examples with synthetic and field data demonstrate that the WQs method can accurately invert for a smoothed approximation to the subsurface Qs distribution as long as the Vs model is known with sufficient accuracy.
Skeletonized wave-equation Qs tomography using surface waves
Li, Jing
2017-08-17
We present a skeletonized inversion method that inverts surface-wave data for the Qs quality factor. Similar to the inversion of dispersion curves for the S-wave velocity model, the complicated surface-wave arrivals are skeletonized as simpler data, namely the amplitude spectra of the windowed Rayleigh-wave arrivals. The optimal Qs model is then found that minimizes the difference in the peak frequencies of the predicted and observed Rayleigh wave arrivals using a gradient-based wave-equation optimization method. Solutions to the viscoelastic wave-equation are used to compute the predicted Rayleigh-wave arrivals and the misfit gradient at every iteration. This procedure, denoted as wave-equation Qs tomography (WQs), does not require the assumption of a layered model and tends to have fast and robust convergence compared to Q full waveform inversion (Q-FWI). Numerical examples with synthetic and field data demonstrate that the WQs method can accurately invert for a smoothed approximation to the subsur-face Qs distribution as long as the Vs model is known with sufficient accuracy.
Wave-equation Qs Inversion of Skeletonized Surface Waves
Li, Jing; Dutta, Gaurav; Schuster, Gerard T.
2017-01-01
We present a skeletonized inversion method that inverts surface-wave data for the Qs quality factor. Similar to the inversion of dispersion curves for the S-wave velocity model, the complicated surface-wave arrivals are skeletonized as simpler data, namely the amplitude spectra of the windowed Rayleigh-wave arrivals. The optimal Qs model is the one that minimizes the difference in the peak frequencies of the predicted and observed Rayleigh wave arrivals using a gradient-based wave-equation optimization method. Solutions to the viscoelastic wave-equation are used to compute the predicted Rayleigh-wave arrivals and the misfit gradient at every iteration. This procedure, denoted as wave-equation Qs inversion (WQs), does not require the assumption of a layered model and tends to have fast and robust convergence compared to full waveform inversion (FWI). Numerical examples with synthetic and field data demonstrate that the WQs method can accurately invert for a smoothed approximation to the subsurface Qs distribution as long as the Vs model is known with sufficient accuracy.
Development of a minimal saponin vaccine adjuvant based on QS-21
Fernández-Tejada, Alberto; Chea, Eric K.; George, Constantine; Pillarsetty, Nagavarakishore; Gardner, Jeffrey R.; Livingston, Philip O.; Ragupathi, Govind; Lewis, Jason S.; Tan, Derek S.; Gin, David Y.
2014-07-01
Adjuvants are materials added to vaccines to enhance the immunological response to an antigen. QS-21 is a natural product adjuvant under investigation in numerous vaccine clinical trials, but its use is constrained by scarcity, toxicity, instability and an enigmatic molecular mechanism of action. Herein we describe the development of a minimal QS-21 analogue that decouples adjuvant activity from toxicity and provides a powerful platform for mechanistic investigations. We found that the entire branched trisaccharide domain of QS-21 is dispensable for adjuvant activity and that the C4-aldehyde substituent, previously proposed to bind covalently to an unknown cellular target, is also not required. Biodistribution studies revealed that active adjuvants were retained preferentially at the injection site and the nearest draining lymph nodes compared with the attenuated variants. Overall, these studies have yielded critical insights into saponin structure-function relationships, provided practical synthetic access to non-toxic adjuvants, and established a platform for detailed mechanistic studies.
Semisynthesis of Analogues of the Saponin Immunoadjuvant QS-21.
Fernández-Tejada, Alberto; Walkowicz, William E; Tan, Derek S; Gin, David Y
2017-01-01
Saponins are triterpene glycoside natural products that exhibit many different biological properties, including activation and modulation of the immune system, and have therefore attracted significant interest as immunological adjuvants for use in vaccines. QS-21 is the most widely used and promising saponin adjuvant but suffers from several liabilities, such as scarcity, dose-limiting toxicity, and hydrolytic instability. Chemical synthesis has emerged as a powerful approach to obtain homogeneous, pure samples of QS-21 and to improve its properties and therapeutic profile by providing access to optimized, synthetic saponin variants. Herein, we describe a general method for the semisynthesis of these molecules from QS-21, with detailed synthetic protocols for two saponin variants developed in our recent work.
Hrin, Tamara N.; Fahmy, Ameen F. M.; Segedinac, Mirjana D.; Milenković, Dušica D.
2016-08-01
Many studies dedicated to the teaching and learning of organic chemistry courses have emphasized that high school students have shown significant difficulties in mastering the concepts of this discipline. Therefore, the aim of our study was to help students to overcome these difficulties by applying systemic synthesis questions, [SSynQs], as the instructional method in our intervention. This work shows that students from the group exposed to the new teaching method achieved higher scores on final testing than students from the control group, who were taught by the traditional method, when students' achievements in conventional, linear questions [LQs] and in [SSynQs] were studied. These results were followed by observation of lower levels of mental effort by students from the intervention group, and higher levels of mental effort in the control group, invested during solving both types of questions. This correlation between achievement and mental effort resulted in high instructional efficiency for the applied method in the intervention group, [SSynQs], and low instructional efficiency for the traditional teaching and learning method applied in the control group. A systemic triangular relation between achievement, mental effort, and instructional efficiency, established by each group and gender, emphasized that the application of [SSynQs] was more suited to female students than for male students because of [SSynQs] characteristics as teaching and learning tools and because of learning style and ability differences between genders.
Natural and synthetic saponin adjuvant QS-21 for vaccines against cancer
Ragupathi, Govind; Gardner, Jeffrey R; Livingston, Philip O; Gin, David Y
2013-01-01
One of the most widely used and potent immunological adjuvants is a mixture of soluble triterpene glycosides purified from the soap bark tree (Quillaja saponaria). Despite challenges in production, quality control, stability and toxicity, the QS-21 fraction from this extract has exhibited exceptional adjuvant properties for a range of antigens. It possesses an ability to augment clinically significant antibody and T-cell responses to vaccine antigens against a variety of infectious diseases, degenerative disorders and cancers. The recent synthesis of active molecules of QS-21 has provided a robust method to produce this leading vaccine adjuvant in high purity as well as to produce novel synthetic QS-21 congeners designed to induce increased immune responsiveness and decreased toxicity. PMID:21506644
QS Spiral: Visualizing Periodic Quantified Self Data
DEFF Research Database (Denmark)
Larsen, Jakob Eg; Cuttone, Andrea; Jørgensen, Sune Lehmann
2013-01-01
In this paper we propose an interactive visualization technique QS Spiral that aims to capture the periodic properties of quantified self data and let the user explore those recurring patterns. The approach is based on time-series data visualized as a spiral structure. The interactivity includes ...
Skeletonized wave-equation Qs tomography using surface waves
Li, Jing; Dutta, Gaurav; Schuster, Gerard T.
2017-01-01
We present a skeletonized inversion method that inverts surface-wave data for the Qs quality factor. Similar to the inversion of dispersion curves for the S-wave velocity model, the complicated surface-wave arrivals are skeletonized as simpler data
ASPMT(QS): Non-Monotonic Spatial Reasoning with Answer Set Programming Modulo Theories
Wałęga, Przemysław Andrzej; Bhatt, Mehul; Schultz, Carl
2015-01-01
The systematic modelling of \\emph{dynamic spatial systems} [9] is a key requirement in a wide range of application areas such as comonsense cognitive robotics, computer-aided architecture design, dynamic geographic information systems. We present ASPMT(QS), a novel approach and fully-implemented prototype for non-monotonic spatial reasoning ---a crucial requirement within dynamic spatial systems-- based on Answer Set Programming Modulo Theories (ASPMT). ASPMT(QS) consists of a (qualitative) s...
The THE-QS World University Rankings, 2004 – 2009
Directory of Open Access Journals (Sweden)
Richard Holmes
2010-06-01
Full Text Available This paper reviews the origin, development and demise of the Times Higher Education Supplement (now Times Higher Education – QS Quacquarelli Symonds (QS World University Rankings between 2004 and 2009. It describes the structure and methodology of the rankings, their public impact and various criticisms that have been made. It also analyses changes that were introduced between 2005 and 2009 and concludes by noting the development of two distinct ranking systems by the magazine Times Higher Education (THE and by its former partner, the consulting company Quacquarelli Symonds.
2010-10-01
..., DEPARTMENT OF COMMERCE (CONTINUED) SHELLFISH FISHERIES OF THE EXCLUSIVE ECONOMIC ZONE OFF ALASKA Quota... the Internet or requested from the Regional Administrator. (ii) An application for crab QS or PQS may... be notified by an IAD, that the applicant did not meet the burden of proof to change the information...
Almeida, Tânia; Pinto, Glória; Correia, Barbara; Santos, Conceição; Gonçalves, Sónia
2013-12-01
Cork oak is an economically important forest species showing a great tolerance to high temperatures and shortage of water. However, the mechanisms underlying this plasticity are still poorly understood. Among the stress regulators, transcription factors (TFs) are especially important since they can control a wide range of stress-inducible genes, which make them powerful targets for genetic engineering of stress tolerance. Here we evaluated the influence of increasing temperatures (up to 55 °C) or drought (18% field capacity, FC) on the expression profile of an R2R3-MYB transcription factor of cork oak, the QsMYB1. QsMYB1 was previously identified as being preferentially expressed in cork tissues and as having an associated alternative splicing mechanism, which results in two different transcripts (QsMYB1.1 and QsMYB1.2). Expression analysis by reverse transcription quantitative PCR (RT-qPCR) revealed that increasing temperatures led to a gradual down-regulation of QsMYB1 transcripts with more effect on QsMYB1.1 abundance. On the other hand, under drought condition, expression of QsMYB1 variants, mainly the QsMYB1.2, was transiently up-regulated shortly after the stress imposition. Recovery from each stress has also resulted in a differential response by both QsMYB1 transcripts. Several physiological and biochemical parameters (plant water status, chlorophyll fluorescence, lipid peroxidation and proline content) were determined in order to monitor the plant performance under stress and recovery. In conclusion, this report provides the first evidence that QsMYB1 TF may have a putative function in the regulatory network of cork oak response to heat and drought stresses and during plant recovery. Copyright © 2013 Elsevier Masson SAS. All rights reserved.
The crowded magnetosphere of the post common envelope binary QS Virginis
Parsons, S. G.; Hill, C. A.; Marsh, T. R.; Gansicke, B. T.; Watson, C. A.; Steeghs, D.; Dhillon, V. S.; Littlefair, S. P.; Copperwheat, C. M.; Schreiber, M. R.; Zorotovic, M.
2016-01-01
We present high-speed photometry and high-resolution spectroscopy of the eclipsing post-common-envelope binary QS Virginis (QS Vir). Our Ultraviolet and Visual Echelle Spectrograph (UVES) spectra span multiple orbits over more than a year and reveal the presence of several large prominences passing in front of both the M star and its white dwarf companion, allowing us to triangulate their positions. Despite showing small variations on a time-scale of days, they persist for more than a year an...
International Nuclear Information System (INIS)
Riantana, R.; Darsono, D.; Azimut, H.B.; Triyono, A.
2016-01-01
Calibration of the android censor was done by placing the device in a mounting at side of accelerograph TDL 303 QS that will be a means of comparison. Leveling of both devices was set same, so that the state of the device can be assumed same anyway. Then applied vibrations in order to have the maximum amplitude value of both censor, so it can be found equality of the coefficient of proportionality both of them. The results on both devices obtain the Peak Ground Acceleration (PGA) as follows, on the x axis (EW) android censor is obtained PGA -2.4478145 gal than at TDL 303 QS obtained PGA -2.5504 gal, the y-axis (NS) on the censor android obtained PGA 3.0066964 gal than at TDL 303 QS obtained PGA 3.2073 gal, the z-axis (UD) on the android censor obtained PGA -14.0702377 gal than at TDL 303 QS obtained PGA -13.2927 gal, A correction value for android accelerometer censor is ± 0.1 gal for the x-axis (EW), ± 0.2 gal for the y-axis (NS), and ± 0.7 gal for the z-axis (UD). (paper)
Hypopigmentation Induced by Frequent Low-Fluence, Large-Spot-Size QS Nd:YAG Laser Treatments.
Wong, Yisheng; Lee, Siong See Joyce; Goh, Chee Leok
2015-12-01
The Q-switched 1064-nm neodymium-doped yttrium aluminum garnet (QS 1064-nm Nd:YAG) laser is increasingly used for nonablative skin rejuvenation or "laser toning" for melasma. Multiple and frequent low-fluence, large-spot-size treatments are used to achieve laser toning, and these treatments are associated with the development of macular hypopigmentation as a complication. We present a case series of three patients who developed guttate hypomelanotic macules on the face after receiving laser toning treatment with QS 1064-nm Nd:YAG.
Lee, Victor R.
2013-01-01
The Quantified Self (QS) movement is a growing global effort to use new mobile and wearable technologies to automatically obtain personal data about everyday activities. The social and material infrastructure associated with the Quantified Self (QS) movement provides a number of ideas that educational technologists should consider incorporating…
Samoudi, Mojtaba; Omid Yeganeh, Negar; Shahbani Zahiri, Hossein; Shariati, Parvin; Hajhosseini, Reza
2015-01-01
Background: Coenzyme Q 10 (CoQ 10 ) is an isoprenoid component used widely in nutraceutical industries. Farnesyl diphosphate synthase (FPPS) is a responsible enzyme for biosynthesis of farnesyl diphosphate (FPP), a key precursor for CoQs production. This research involved investigating the effect of FPPS over-expression on CoQs production in engineered CoQ 10 -producing Escherichia coli (E. coli). Methods: Two CoQ 10 -producing strains, as referred to E. coli Ba and E. coli Br, were transform...
Bigaeva, Emilia; Doorn, Eva van; Liu, Heng; Hak, Eelko
2016-01-01
BACKGROUND AND OBJECTIVES: QS-21 shows in vitro hemolytic effect and causes side effects in vivo. New saponin adjuvant formulations with better toxicity profiles are needed. This study aims to evaluate the safety and tolerability of QS-21 and the improved saponin adjuvants (ISCOM, ISCOMATRIX and
Directory of Open Access Journals (Sweden)
Olatunde Nathaniel Ayinde
2018-01-01
Full Text Available Stakeholders in the educational sector over the century have devoted substantial resources in seeking ways of improving students’ academic performance, yet, the desired improved academic performance has not been achieved. By appraising the relationship between the performance of Quantity Surveying (QS students in Building Construction and Construction Measurement courses; the study identified a major curriculum drafting deficiency in the QS programmes in Nigeria which if addressed could help achieve the much needed improved students’ academic performance. The specific objectives of the study were to determine the performance of QS students in Building construction and construction Measurement Courses; and to determine whether a relationship exist in the performances of QS students in the two subject areas. Purposive sampling technique was used to select Federal Polytechnic Ede, Osun State for the study. Random sampling technique was used to select 241 students who provide data for the study. Close ended questionnaire was used to collect data for the study and data was analyzed using frequency, percentile and correlation analysis. Finding indicates that 43% of the respondents on the average put up good performances in Building Construction Courses while only 19% of the respondents on the average had good grades in Construction Measurement Courses. Results also showed that a significant relationship exist between the performance of QS students in Building Construction and Construction Measurement courses as 83.3% (five out of six pair courses shows significant positive linear correlation. The study recommends that a quick curriculum re-adjustment should be initiated so as to enhance improved academic performance by QS Students especially in Construction Measurement courses.
Pseudoscalar-photon mixing and the large scale alignment of QsO ...
Indian Academy of Sciences (India)
physics pp. 679-682. Pseudoscalar-photon mixing and the large scale alignment of QsO optical polarizations. PANKAJ JAIN, sUKANTA PANDA and s sARALA. Physics Department, Indian Institute of Technology, Kanpur 208 016, India. Abstract. We review the observation of large scale alignment of QSO optical polariza-.
DEFF Research Database (Denmark)
Kim, Eun-Mi; Min Woo, Han; Tian, Tian
2017-01-01
as it is self-regulated and does not require the addition of inducer compounds, which reduce operational costs for inducer. In this study, a QS system was developed for inducer-free production of the biofuel compound bisabolene from engineered E. coli. Seven variants of the Sensor plasmid, which carry the lux......I-luxR genes, and four variants of the Response plasmid, which carry bisabolene producing pathway genes under the control of the PluxI promoter, were designed for optimization of bisabolene production. Furthermore, a chromosome-integrated QS strain was engineered with the best combination of Sensor...
Samoudi, Mojtaba; Omid Yeganeh, Negar; Shahbani Zahiri, Hossein; Shariati, Parvin; Hajhosseini, Reza
2015-01-01
Background: Coenzyme Q 10 (CoQ 10 ) is an isoprenoid component used widely in nutraceutical industries. Farnesyl diphosphate synthase (FPPS) is a responsible enzyme for biosynthesis of farnesyl diphosphate (FPP), a key precursor for CoQs production. This research involved investigating the effect of FPPS over-expression on CoQs production in engineered CoQ 10 -producing Escherichia coli (E. coli). Methods: Two CoQ 10 -producing strains, as referred to E. coli Ba and E. coli Br, were transformed by the encoding gene for FPPS (ispA) under the control of either the trc or P BAD promoters. Results: Over-expression of ispA under the control of P BAD promoter led to a relative increase in CoQ 10 production only in recombinant E. coli Br although induction by arabinose resulted in partial reduction of CoQ 10 production in both recombinant E. coli Ba and E. coli Br strains. Over-expression of ispA under the control of stronger trc promoter, however, led to a severe decrease in CoQ 10 production in both recombinant E. coli Ba and E. coli Br strains, as reflected by reductions from 629±40 to 30±13 and 564±28 to 80±14 μg/g Dried Cell Weight (DCW), respectively. The results showed high level of FPP reduces endogenous CoQ 8 production as well and that CoQs are produced in a complimentary manner, as the increase in production of one decreases the production of the other. Conclusion: The reduction in CoQ 10 production can be a result of Dds inhibition by high FPP concentration. Therefore, more effort is needed to verify the role of intermediate metabolite concentration and to optimize production of CoQ 10 . PMID:26306151
Soh, Kay Cheng
2012-01-01
University ranking has become ritualistic in higher education. Ranking results are taken as bona fide by rank users. Ranking systems usually use large data sets from highly heterogeneous universities of varied backgrounds. This poses the problem of Simpson's Paradox and the lurking variables causing it. Using QS 2011-2012 Ranking data, the dual…
Chaos Q-S synchronization between Rossler system and the new unified chaotic system
International Nuclear Information System (INIS)
Yan Zhenya
2005-01-01
In this Letter, we investigate the Q-S synchronization between two different chaotic systems: the Rossler system and the new unified Lorenz-Chen-Lu system based on the backstepping design method and Lyapunov stability theory. Moreover numerical simulations are used to verify the effectiveness of the proposed controller
Directory of Open Access Journals (Sweden)
Luk Luk Nur Mufidah
2012-07-01
Full Text Available God creates human in the best kind of human creation as not only a passion, as Satan (Syetan has, not only has a sense as an angel has. Human lives with minds, feelings, wills and hearts (the Arabico is Aql, Nafs and Qalb so that he/she is able to change and cultivate the surrounding environment and to strive to meet the needs of life and achieve his/her goal. In the process of human effort is urgently needed to improve their quality of intelligence whether for intellect, emotional or spiritual. It explains In the QS. Maryam: 12-15 that Allah reveals how God gives good education to prophet of Yahya a.s to improve the intellect, emotional and spiritual. Based on the QS. Maryam: 12-15, there are several processes that must be passed by someone in order that he/she has a high IQ, EQ and SQ. To obtain the Intellect Intelligence (IQ, the Emotional Intelligence (EQ and the Spiritual Intelligence (SQ, human has to implement the seven concepts contained in Qs. Maryam: 12-15, namely: Concepts of Strong Educational, Concepts of Wisdom, Concept of Compassion, Concept of Tazkiyah, Concept of Taqwa, Concept of Birrul Walidain, Concept of Moderation or concepts of Arrogant Disobedience.
Zineldin, Mosad
2006-01-01
To examine the major factors affecting patients' perception of cumulative satisfaction and to address the question whether patients in Egypt and Jordan evaluate quality of health care similarly or differently. A conceptual model including behavioural dimensions of patient-physician relationships and patient satisfaction has been developed. As the empirical research setting, this study concerns three hospitals in Egypt and Jordan. The survey instrument in a questionnaire form was designed to achieve the research objectives. A total of 48 items (attributes) of the newly developed five quality dimensions were identified to be the most relevant. A total of 224 complete and usable questionnaires were received from the in-patients. Hospital C has above-average total and dimensional qualities and patients are the most satisfied in accordance with all dimensions of services. Hospitals A and B have under-average total qualities as the majority of patients are not satisfied with services. Comparing hospitals A and B, in the majority of dimensions (with the exception of Q5), the quality in hospital B is higher than in hospital A. Patients' satisfaction with different service quality dimensions is correlated with their willingness to recommend the hospital to others. A cure to improve the quality for health-care services can be an application of total relationship management and the 5Qs model together with customer orientation strategy. The result can be used by the hospitals to reengineer and redesign creatively their quality management processes and the future direction of their more effective health-care quality strategies. In this research a study is described involving a new instrument and a new method which assure a reasonable level of relevance, validity and reliability, while being explicitly change-oriented. This study argues that a patient's satisfaction is a cumulative construct, summing satisfaction with five different qualities (5Qs) of the hospital: quality of
DEFF Research Database (Denmark)
Eggermont, Alexander M M; Suciu, Stefan; Rutkowski, Piotr
2013-01-01
The GM2 ganglioside is an antigen expressed in the majority of melanomas. The GM2-KLH/QS-21 vaccine induces high immunoglobulin M (IgM) and IgG antibody responses. The EORTC 18961 trial compared the efficacy of GM2-KLH/QS-21 vaccination versus observation....
Directory of Open Access Journals (Sweden)
Sundstrom Johan
2006-03-01
Full Text Available Abstract Background Most studies on risk factors for development of coronary heart disease (CHD have been based on the clinical outcome of CHD. Our aim was to identify factors that could predict the development of ECG markers of CHD, such as abnormal Q/QS patterns, ST segment depression and T wave abnormalities, in 70-year-old men, irrespective of clinical outcome. Methods Predictors for development of different ECG abnormalities were identified in a population-based study using stepwise logistic regression. Anthropometrical and metabolic factors, ECG abnormalities and vital signs from a health survey of men at age 50 were related to ECG abnormalities identified in the same cohort 20 years later. Results At the age of 70, 9% had developed a major abnormal Q/QS pattern, but 63% of these subjects had not been previously hospitalized due to MI, while 57% with symptomatic MI between age 50 and 70 had no major Q/QS pattern at age 70. T wave abnormalities (Odds ratio 3.11, 95% CI 1.18–8.17, high lipoprotein (a levels, high body mass index (BMI and smoking were identified as significant independent predictors for the development of abnormal major Q/QS patterns. T wave abnormalities and high fasting glucose levels were significant independent predictors for the development of ST segment depression without abnormal Q/QS pattern. Conclusion T wave abnormalities on resting ECG should be given special attention and correlated with clinical information. Risk factors for major Q/QS patterns need not be the same as traditional risk factors for clinically recognized CHD. High lipoprotein (a levels may be a stronger risk factor for silent myocardial infarction (MI compared to clinically recognized MI.
Genito, Christopher J; Beck, Zoltan; Phares, Timothy W; Kalle, Fanta; Limbach, Keith J; Stefaniak, Maureen E; Patterson, Noelle B; Bergmann-Leitner, Elke S; Waters, Norman C; Matyas, Gary R; Alving, Carl R; Dutta, Sheetij
2017-07-05
Malaria caused by Plasmodium falciparum continues to threaten millions of people living in the tropical parts of the world. A vaccine that confers sterile and life-long protection remains elusive despite more than 30years of effort and resources invested in solving this problem. Antibodies to a malaria vaccine candidate circumsporozoite protein (CSP) can block invasion and can protect humans against malaria. We have manufactured the Falciparum Malaria Protein-013 (FMP013) vaccine based on the nearly full-length P. falciparum CSP 3D7 strain sequence. We report here immunogenicity and challenge data on FMP013 antigen in C57BL/6 mice formulated with two novel adjuvants of the Army Liposome Formulation (ALF) series and a commercially available adjuvant Montanide ISA 720 (Montanide) as a control. ALF is a liposomal adjuvant containing a synthetic monophosphoryl lipid A (3D-PHAD®). In our study, FMP013 was adjuvanted with ALF alone, ALF containing aluminum hydroxide (ALFA) or ALF containing QS-21 (ALFQ). Adjuvants ALF and ALFA induced similar antibody titers and protection against transgenic parasite challenge that were comparable to Montanide. ALFQ was superior to the other three adjuvants as it induced higher antibody titers with improved boosting after the third immunization, higher serum IgG2c titers, and enhanced protection. FMP013+ALFQ also augmented the numbers of splenic germinal center-derived activated B-cells and antibody secreting cells compared to Montanide. Further, FMP013+ALFQ induced antigen-specific IFN-γ ELISPOT activity, CD4 + T-cells and a T H 1-biased cytokine profile. These results demonstrate that soluble CSP can induce a potent and sterile protective immune response when formulated with the QS-21 containing adjuvant ALFQ. Comparative mouse immunogenicity data presented here were used as the progression criteria for an ongoing non-human primate study and a regulatory toxicology study in preparation for a controlled human malaria infection (CHMI
International Nuclear Information System (INIS)
Yang Yunqing; Chen Yong
2009-01-01
In this paper, we investigate the generalized Q-S synchronization between the generalized Lorenz canonical form and the Roessler system. Firstly, we transform an arbitrary generalized Lorenz system to the generalized Lorenz canonical form, and the relation between the parameter of the generalized Lorenz system and the parameter of the generalized Lorenz canonical form are shown. Secondly, we extend the scheme present by [Yan ZY. Chaos 2005;15:023902] to study the generalized Q-S synchronization between the generalized Lorenz canonical form and the Roessler system, the more general controller is obtained. By choosing different parameter in the generalized controller obtained here, without much extra effort, we can get the controller of synchronization between the Chen system and the Roessler system, the Lue system and the Roessler system, the classic Lorenz system and the Roessler system, the Hyperbolic Lorenz system and the Roessler system, respectively. Finally, numerical simulations are used to perform such synchronization and verify the effectiveness of the controller.
Q-S synchronization in 3D Henon-like map and generalized Henon map via a scalar controller
International Nuclear Information System (INIS)
Yan Zhenya
2005-01-01
In this Letter, a generalized, systematic and automatic backstepping scheme is developed to investigate the Q-S synchronization of two identical 3a discrete-time dynamical systems and two different 3D discrete-time dynamical systems. With the aid of symbolic-numeric computation, we use the proposed scheme to illustrate chaos synchronization between two identical 3D generalized Henon map and Q-S synchronization between two different 3D generalized Henon map and Henon-like map via a scalar controller, respectively. Moreover numerical simulations are used to verify the effectiveness of the proposed scheme. In addition, the scheme can be also applied to investigate the tracking problem in the discrete-time systems and to generate automatically the scalar controller in computer with the aid of symbolic-numeric computation
Hieu, D T; Luong, T T; Anh, P T; Ngoc, D H; Duong, L Q
2003-10-01
To compare the safety, efficacy and acceptability of quinacrine sterilization (QS), tubectomy and vasectomy in Vietnam. This study was initiated in January 1998 and completed in February 2000. A sample of 9 districts in 5 provinces, where the prevalence of QS was known to be high, was selected. Every person sterilized in these 9 districts between January 1, 1988 and March 31, 1998 was identified and systematically interviewed by family planning clinicians who had received special training for this project. A total of 15,982 sterilization users were identified and 15,190 were interviewed and examined, including a gynecologic exam, if needed: a follow-up rate of 95%. Of those interviewed, 9,753 used tubectomy, 3,734 used QS and 1,703 used vasectomy. All three methods were found to be safe, although morbidity associated with tubectomy was more serious than with QS or vasectomy. No deaths were reported. After more than 5 years of follow-up, tubectomy had the lowest failure rate: 1.0%, followed by 4.1% with vasectomy. A pregnancy rate of 13.2% was reported with quinacrine, although only a small fraction of these failures were confirmed. A strong preference for QS was found. QS has an important role to play in sterilization services in Vietnam.
Quorum Sensing Inhibition and Structure–Activity Relationships of β-Keto Esters
Directory of Open Access Journals (Sweden)
Stephanie Forschner-Dancause
2016-07-01
Full Text Available Traditional therapeutics to treat bacterial infections have given rise to multi-drug resistant pathogens, which pose a major threat to human and animal health. In several pathogens, quorum sensing (QS—a cell-cell communication system in bacteria—controls the expression of genes responsible for pathogenesis, thus representing a novel target in the fight against bacterial infections. Based on the structure of the autoinducers responsible for QS activity and other QS inhibitors, we hypothesize that β-keto esters with aryl functionality could possess anti-QS activity. A panel of nineteen β-keto ester analogs was tested for the inhibition of bioluminescence (a QS-controlled phenotype in the marine pathogen Vibrio harveyi. Initial screening demonstrated the need of a phenyl ring at the C-3 position for antagonistic activity. Further additions to the phenyl ring with 4-substituted halo groups or a 3- or 4-substituted methoxy group resulted in the most active compounds with IC50 values ranging from 23 µM to 53 µM. The compounds additionally inhibit green fluorescent protein production by E. coli JB525. Evidence is presented that aryl β-keto esters may act as antagonists of bacterial quorum sensing by competing with N-acyl homoserine lactones for receptor binding. Expansion of the β-keto ester panel will enable us to obtain more insight into the structure–activity relationships needed to allow for the development of novel anti-virulence agents.
Examining obligations to society for QS Stars best ranked universities in social responsibility
Directory of Open Access Journals (Sweden)
Păunescu Carmen
2017-12-01
Full Text Available Developing the local, regional, even national communities is often central to a university’s mission. This is a two-way process and both society and university itself should benefit from this collaboration. Universities around the world have been in the past decades required to leave their ivory tower and to become more involved in addressing the needs of the society and thus more relevant for the communities which they serve. They are expected to take a leadership role in implementation of the required change by contributing to community development through knowledge, innovations, skills and jobs. By taking a leading role in society and continuously innovating, universities will support communities with achieving a sustainable growth and therefore will contribute to increasing the well-being of society at large. The current paper aims to assess the university obligations to society by analyzing 27 universities around the world best ranked in social responsibility according to QS Stars University Rating 2016. In the paper, we discuss the extent to which different attributes of the university social responsibility are reflected among the initiatives and projects run by the universities included in the study. Also, an exploratory factor analysis was employed to identify underlying variables that explain the pattern of correlations between university social responsibility initiatives. Following the QS Stars methodology, the dimensions used to evaluate social responsibility of sampled universities included: community investment and development, social work and disaster relief, regional human capital development, and environmental impact. The results show that the level of involvement in social responsibility actions is high for all the universities included in the study. Also, the types of initiatives vary in terms of nature, intensity and impact for each one of the dimensions analyzed. Our research findings offer useful insights for both
Zhou, Jin; Lyu, Yihua; Richlen, Mindy; Anderson, Donald M; Cai, Zhonghua
2016-01-01
Algae are ubiquitous in the marine environment, and the ways in which they interact with bacteria are of particular interest in marine ecology field. The interactions between primary producers and bacteria impact the physiology of both partners, alter the chemistry of their environment, and shape microbial diversity. Although algal-bacterial interactions are well known and studied, information regarding the chemical-ecological role of this relationship remains limited, particularly with respect to quorum sensing (QS), which is a system of stimuli and response correlated to population density. In the microbial biosphere, QS is pivotal in driving community structure and regulating behavioral ecology, including biofilm formation, virulence, antibiotic resistance, swarming motility, and secondary metabolite production. Many marine habitats, such as the phycosphere, harbour diverse populations of microorganisms and various signal languages (such as QS-based autoinducers). QS-mediated interactions widely influence algal-bacterial symbiotic relationships, which in turn determine community organization, population structure, and ecosystem functioning. Understanding infochemicals-mediated ecological processes may shed light on the symbiotic interactions between algae host and associated microbes. In this review, we summarize current achievements about how QS modulates microbial behavior, affects symbiotic relationships, and regulates phytoplankton chemical ecological processes. Additionally, we present an overview of QS-modulated co-evolutionary relationships between algae and bacterioplankton, and consider the potential applications and future perspectives of QS.
V773 Cas, QS Aql, AND BR Ind: ECLIPSING BINARIES AS PARTS OF MULTIPLE SYSTEMS
Energy Technology Data Exchange (ETDEWEB)
Zasche, P.; Juryšek, J.; Nemravová, J.; Wolf, M.; Korčáková, D. [Astronomical Institute, Charles University in Prague, Faculty of Mathematics and Physics, CZ-180 00, Praha 8, V Holešovičkách 2 (Czech Republic); Uhlař, R. [Private Observatory, Pohoří 71, CZ-254 01, Jílové u Prahy (Czech Republic); Svoboda, P. [Private Observatory, Výpustky 5, CZ-614 00, Brno (Czech Republic); Hoňková, K. [Variable Star and Exoplanet Section of Czech Astronomical Society, Vsetínská 941/78, CZ-757 01, Valašské Meziříčí (Czech Republic); Mašek, M.; Prouza, M. [Institute of Physics, The Czech Academy of Sciences, Na Slovance 1999/2, CZ-182 21, Praha (Czech Republic); Čechura, J.; Šlechta, M., E-mail: zasche@sirrah.troja.mff.cuni.cz [Astronomical Institute, The Czech Academy of Sciences, CZ-251 65, Ondřejov (Czech Republic)
2017-01-01
Eclipsing binaries remain crucial objects for our understanding of the universe. In particular, those that are components of multiple systems can help us solve the problem of the formation of these systems. Analysis of the radial velocities together with the light curve produced for the first time precise physical parameters of the components of the multiple systems V773 Cas, QS Aql, and BR Ind. Their visual orbits were also analyzed, which resulted in slightly improved orbital elements. What is typical for all these systems is that their most dominant source is the third distant component. The system V773 Cas consists of two similar G1-2V stars revolving in a circular orbit and a more distant component of the A3V type. Additionally, the improved value of parallax was calculated to be 17.6 mas. Analysis of QS Aql resulted in the following: the inner eclipsing pair is composed of B6V and F1V stars, and the third component is of about the B6 spectral type. The outer orbit has high eccentricity of about 0.95, and observations near its upcoming periastron passage between the years 2038 and 2040 are of high importance. Also, the parallax of the system was derived to be about 2.89 mas, moving the star much closer to the Sun than originally assumed. The system BR Ind was found to be a quadruple star consisting of two eclipsing K dwarfs orbiting each other with a period of 1.786 days; the distant component is a single-lined spectroscopic binary with an orbital period of about 6 days. Both pairs are moving around each other on their 148 year orbit.
DEFF Research Database (Denmark)
Sabbatini, Paul J; Ragupathi, Govind; Hood, Chandra
2007-01-01
PURPOSE: To characterize the safety and immunogenicity of a heptavalent antigen-keyhole limpet hemocyanin (KLH) plus QS21 vaccine construct in patients with epithelial ovarian, fallopian tube, or peritoneal cancer in second or greater complete clinical remission. EXPERIMENTAL DESIGN: Eleven......). RESULTS: Eleven patients were included in the safety analysis; 9 of 11 patients remained on study for at least 2 weeks past fourth vaccination and were included in the immunologic analysis (two withdrew, disease progression). The vaccine was well tolerated. Self-limited and mild fatigue (maximum grade 2...... patients in this pilot trial received a heptavalent vaccine s.c. containing GM2 (10 microg), Globo-H (10 microg), Lewis Y (10 microg), Tn(c) (3 microg), STn(c) (3 microg), TF(c) (3 microg), and Tn-MUC1 (3 microg) individually conjugated to KLH and mixed with adjuvant QS21(100 microg). Vaccinations were...
Selection of Functional Quorum Sensing Systems by Lysogenic Bacteriophages in Pseudomonas aeruginosa
Directory of Open Access Journals (Sweden)
Miguel A. Saucedo-Mora
2017-08-01
Full Text Available Quorum sensing (QS in Pseudomonas aeruginosa coordinates the expression of virulence factors, some of which are used as public goods. Since their production is a cooperative behavior, it is susceptible to social cheating in which non-cooperative QS deficient mutants use the resources without investing in their production. Nevertheless, functional QS systems are abundant; hence, mechanisms regulating the amount of cheating should exist. Evidence that demonstrates a tight relationship between QS and the susceptibility of bacteria against the attack of lytic phages is increasing; nevertheless, the relationship between temperate phages and QS has been much less explored. Therefore, in this work, we studied the effects of having a functional QS system on the susceptibility to temperate bacteriophages and how this affects the bacterial and phage dynamics. We find that both experimentally and using mathematical models, that the lysogenic bacteriophages D3112 and JBD30 select QS-proficient P. aeruginosa phenotypes as compared to the QS-deficient mutants during competition experiments with mixed strain populations in vitro and in vivo in Galleria mellonella, in spite of the fact that both phages replicate better in the wild-type background. We show that this phenomenon restricts social cheating, and we propose that temperate phages may constitute an important selective pressure toward the conservation of bacterial QS.
Dereymaeker, Anneleen; Pillay, Kirubin; Vervisch, Jan; Van Huffel, Sabine; Naulaers, Gunnar; Jansen, Katrien; De Vos, Maarten
2017-09-01
Sleep state development in preterm neonates can provide crucial information regarding functional brain maturation and give insight into neurological well being. However, visual labeling of sleep stages from EEG requires expertise and is very time consuming, prompting the need for an automated procedure. We present a robust method for automated detection of preterm sleep from EEG, over a wide postmenstrual age ([Formula: see text] age) range, focusing first on Quiet Sleep (QS) as an initial marker for sleep assessment. Our algorithm, CLuster-based Adaptive Sleep Staging (CLASS), detects QS if it remains relatively more discontinuous than non-QS over PMA. CLASS was optimized on a training set of 34 recordings aged 27-42 weeks PMA, and performance then assessed on a distinct test set of 55 recordings of the same age range. Results were compared to visual QS labeling from two independent raters (with inter-rater agreement [Formula: see text]), using Sensitivity, Specificity, Detection Factor ([Formula: see text] of visual QS periods correctly detected by CLASS) and Misclassification Factor ([Formula: see text] of CLASS-detected QS periods that are misclassified). CLASS performance proved optimal across recordings at 31-38 weeks (median [Formula: see text], median MF 0-0.25, median Sensitivity 0.93-1.0, and median Specificity 0.80-0.91 across this age range), with minimal misclassifications at 35-36 weeks (median [Formula: see text]). To illustrate the potential of CLASS in facilitating clinical research, normal maturational trends over PMA were derived from CLASS-estimated QS periods, visual QS estimates, and nonstate specific periods (containing QS and non-QS) in the EEG recording. CLASS QS trends agreed with those from visual QS, with both showing stronger correlations than nonstate specific trends. This highlights the benefit of automated QS detection for exploring brain maturation.
Gideon, Nicole; Hawkes, Nick; Mond, Jonathan; Saunders, Rob; Tchanturia, Kate; Serpell, Lucy
2016-01-01
Objective The aim of this study was to develop and validate a short form of the Eating Disorder Examination Questionnaire (EDE-Q) for routine, including session by session, outcome assessment. Method The current, 28-item version (6.0) of the EDE-Q was completed by 489 individuals aged 18–72 with various eating disorders recruited from three UK specialist eating disorder services. Rasch analysis was carried out on factors identified by means of principal component analysis, which in combination with expert ratings informed the development of an EDE-Q short form. The shortened questionnaire’s reliability, validity and sensitivity was assessed based on online data collected from students of a UK university and volunteers with a history of eating disorders recruited from a national eating disorders charity aged 18–74 (N = 559). Results A 12-item short form, the Eating Disorder Examination Questionnaire Short (EDE-QS) was derived. The new measure showed high internal consistency (Cronbach’s α = .913) and temporal stability (ICC = .93; p eating disorder and comorbid psychopathology. It was sufficiently sensitive to distinguish between people with and without eating disorders. Discussion The EDE-QS is a brief, reliable and valid measure of eating disorder symptom severity that performs similarly to the EDE-Q and that lends itself for the use of sessional outcome monitoring in treatment and research. PMID:27138364
Directory of Open Access Journals (Sweden)
Asroful Kadafi
2017-11-01
The emotional development of students in early teens showed a sensitive and recreative nature (critical, emotions are often negative and temperamental. This negative passion is evidenced by the findings in the field of Indonesian teenagers, such as Tawuran, promiscuity, students who dare to do nasty with school friends (Tirto, 2013. Many factors are the cause, one of which is still the weak character of academic responsibility that students have. This problem becomes a serious problem in the world of education Indonesia. Therefore, it is natural for educational practitioners to take solutive steps to overcome the problem. One education practitioner who has a strategic position to handle the case is Counselor. Counselors are deemed able to provide practical solutions through Reality Group Counseling services by integrating spiritual values (Islam to foster student academic responsibilities. Reality group counseling emphasizes the growth of personal responsibility. This advice is also in line with Islamic values that encourage individuals always to be responsible for every action as reflected in the QS. Al Muddassir: 38.
Directory of Open Access Journals (Sweden)
Nicole Gideon
Full Text Available The aim of this study was to develop and validate a short form of the Eating Disorder Examination Questionnaire (EDE-Q for routine, including session by session, outcome assessment.The current, 28-item version (6.0 of the EDE-Q was completed by 489 individuals aged 18-72 with various eating disorders recruited from three UK specialist eating disorder services. Rasch analysis was carried out on factors identified by means of principal component analysis, which in combination with expert ratings informed the development of an EDE-Q short form. The shortened questionnaire's reliability, validity and sensitivity was assessed based on online data collected from students of a UK university and volunteers with a history of eating disorders recruited from a national eating disorders charity aged 18-74 (N = 559.A 12-item short form, the Eating Disorder Examination Questionnaire Short (EDE-QS was derived. The new measure showed high internal consistency (Cronbach's α = .913 and temporal stability (ICC = .93; p < .001. It was highly correlated with the original EDE-Q (r = .91 for people without ED; r = .82 for people with ED and other measures of eating disorder and comorbid psychopathology. It was sufficiently sensitive to distinguish between people with and without eating disorders.The EDE-QS is a brief, reliable and valid measure of eating disorder symptom severity that performs similarly to the EDE-Q and that lends itself for the use of sessional outcome monitoring in treatment and research.
Mining the Quantified Self: Personal Knowledge Discovery as a Challenge for Data Science.
Fawcett, Tom
2015-12-01
The last several years have seen an explosion of interest in wearable computing, personal tracking devices, and the so-called quantified self (QS) movement. Quantified self involves ordinary people recording and analyzing numerous aspects of their lives to understand and improve themselves. This is now a mainstream phenomenon, attracting a great deal of attention, participation, and funding. As more people are attracted to the movement, companies are offering various new platforms (hardware and software) that allow ever more aspects of daily life to be tracked. Nearly every aspect of the QS ecosystem is advancing rapidly, except for analytic capabilities, which remain surprisingly primitive. With increasing numbers of qualified self participants collecting ever greater amounts and types of data, many people literally have more data than they know what to do with. This article reviews the opportunities and challenges posed by the QS movement. Data science provides well-tested techniques for knowledge discovery. But making these useful for the QS domain poses unique challenges that derive from the characteristics of the data collected as well as the specific types of actionable insights that people want from the data. Using a small sample of QS time series data containing information about personal health we provide a formulation of the QS problem that connects data to the decisions of interest to the user.
Relationship between sleep and acid gastro-oesophageal reflux in neonates.
Ammari, Mohamed; Djeddi, Djamal; Léké, André; Delanaud, Stéphane; Stéphan-Blanchard, Erwan; Bach, Véronique; Telliez, Frédéric
2012-02-01
The aim of the present study was to investigate the impact of gastro-oesophageal acid reflux on sleep in neonates and, reciprocally, the influence of wakefulness (W) and sleep stages on the characteristics of the reflux (including the retrograde bolus migration of oesophageal acid contents). The pH and multichannel intraluminal impedance were measured during nocturnal polysomnography in 25 infants hospitalised for suspicion of gastro-oesophageal reflux. Two groups were constituted according to whether or not the infants displayed gastro-oesophageal reflux (i.e. a reflux group and a control group). There were no differences between the reflux and control groups in terms of sleep duration, sleep structure and sleep state change frequency. Vigilance states significantly influenced the gastro-oesophageal reflux pattern: the occurrence of gastro-oesophageal reflux episodes was greater during W (59 ± 32%) and active sleep (AS; 35 ± 30%) than during quiet sleep (QS; 6 ± 11%), whereas the mean duration of gastro-oesophageal reflux episodes was higher in QS than in W and AS. The percentage of retrograde bolus migrations of distal oesophageal acid content was significantly higher in AS (62 ± 26%) than in W (42 ± 26%) and QS (4.5 ± 9%). In neonates, gastro-oesophageal reflux occurred more frequently during W, whereas the physiological changes associated with sleep state increase the physiopathological impact of the gastro-oesophageal reflux. The duration of oesophagus-acid contact was greater during sleep; AS facilitated the retrograde migration of oesophageal acid content, and QS was characterised by the risk of prolonged acid mucosal contact. © 2011 European Sleep Research Society.
Broad spectrum pro-quorum-sensing molecules as inhibitors of virulence in vibrios.
Directory of Open Access Journals (Sweden)
Wai-Leung Ng
Full Text Available Quorum sensing (QS is a bacterial cell-cell communication process that relies on the production and detection of extracellular signal molecules called autoinducers. QS allows bacteria to perform collective activities. Vibrio cholerae, a pathogen that causes an acute disease, uses QS to repress virulence factor production and biofilm formation. Thus, molecules that activate QS in V. cholerae have the potential to control pathogenicity in this globally important bacterium. Using a whole-cell high-throughput screen, we identified eleven molecules that activate V. cholerae QS: eight molecules are receptor agonists and three molecules are antagonists of LuxO, the central NtrC-type response regulator that controls the global V. cholerae QS cascade. The LuxO inhibitors act by an uncompetitive mechanism by binding to the pre-formed LuxO-ATP complex to inhibit ATP hydrolysis. Genetic analyses suggest that the inhibitors bind in close proximity to the Walker B motif. The inhibitors display broad-spectrum capability in activation of QS in Vibrio species that employ LuxO. To the best of our knowledge, these are the first molecules identified that inhibit the ATPase activity of a NtrC-type response regulator. Our discovery supports the idea that exploiting pro-QS molecules is a promising strategy for the development of novel anti-infectives.
DEFF Research Database (Denmark)
Rector, D M; Poe, G R; Kristensen, Morten Pilgaard
1995-01-01
We assessed the correspondence of 660 nm light reflectance changes from the dorsal hippocampus with slow wave electroencephalographic (EEG) activity during quiet sleep (QS) and rapid eye movement (REM) sleep in four cats. An optic probe, attached to a charge-coupled-device (CCD) video camera...... as EEG changes. Dividing the image into 10 subregions revealed that reflectance changes at the rhythmical slow wave activity band (RSA, 4-6 Hz) persisted in localized regions during QS and REM sleep, but regional changes showed considerable wave-by-wave independence between areas and from slow wave...
DEFF Research Database (Denmark)
Fong, July; Yuan, Mingjun; Jakobsen, Tim Holm
2017-01-01
Since its discovery 22 years ago, the bacterial cell-to-cell communication system, termed quorum sensing (QS), has shown potential as antipathogenic target. Previous studies reported that ajoene from garlic inhibits QS in opportunistic human pathogen Pseudomonas aeruginosa. In this study, screening...
DEFF Research Database (Denmark)
Jakobsen, Tim Holm; Bragason, Steinn Kristinn; Phipps, Richard Kerry
2012-01-01
of traditional antibiotics to treat infections caused by bacterial biofilms and multidrug-resistant bacteria. Several QSIs of natural origin have been identified, and in this study, several common food products and plants were extracted and screened for QSI activity in an attempt to isolate and characterize...... to transcend problems with selective pressures for antibiotic resistance, is to interrupt bacterial communication, also known as quorum sensing (QS), by means of signal antagonists, the so-called QS inhibitors (QSIs). Furthermore, QSI agents offer a potential solution to the deficiencies associated with use......-diode array detector-mass spectrometry (LC-DAD-MS) and nuclear magnetic resonance (NMR) spectroscopy as iberin—an isothiocyanate produced by many members of the Brassicaceae family. Real-time PCR (RT-PCR) and DNA microarray studies showed that iberin specifically blocks expression of QS-regulated genes in P...
Anatomical nuances of the internal carotid artery in relation to the quadrangular space.
Dolci, Ricardo L L; Ditzel Filho, Leo F S; Goulart, Carlos R; Upadhyay, Smita; Buohliqah, Lamia; Lazarini, Paulo R; Prevedello, Daniel M; Carrau, Ricardo L
2018-01-01
OBJECTIVE The aim of this study was to evaluate the anatomical variations of the internal carotid artery (ICA) in relation to the quadrangular space (QS) and to propose a classification system based on the results. METHODS A total of 44 human cadaveric specimens were dissected endonasally under direct endoscopic visualization. During the dissection, the anatomical variations of the ICA and their relationship with the QS were noted. RESULTS The space between the paraclival ICAs (i.e., intercarotid space) can be classified as 1 of 3 different shapes (i.e., trapezoid, square, or hourglass) based on the trajectory of the ICAs. The ICA trajectories also directly influence the volumetric area of the QS. Based on its geometry, the QS was classified as one of the following: 1) Type A has the smallest QS area and is associated with a trapezoid intercarotid space, 2) Type B corresponds to the expected QS area (not minimized or enlarged) and is associated with a square intercarotid space, and 3) Type C has the largest QS area and is associated with an hourglass intercarotid space. CONCLUSIONS The different trajectories of the ICAs can modify the area of the QS and may be an essential parameter to consider for preoperative planning and defining the most appropriate corridor to reach Meckel's cave. In addition, ICA trajectories should be considered prior to surgery to avoid injuring the vessels.
Ravindran, D; Ramanathan, S; Arunachalam, K; Jeyaraj, G P; Shunmugiah, K P; Arumugam, V R
2018-02-12
Serratia marcescens is an important multidrug-resistant human pathogen. The pathogenicity of S. marcescens mainly depends on the quorum sensing (QS) mechanism, which regulates the virulence factors production and biofilm formation. Hence, targeting QS mechanism in S. marcescens will ultimately pave the way to combat its pathogenicity. Thus, the present study is intended to evaluate the efficacy of Vetiveria zizanioides root extract-mediated silver nanoparticles (AgNPs) as a potent anti-QS and antibiofilm agent against S. marcescens. The AgNPs were synthesized using V. zizanioides aqueous root extract and the physiochemical properties of V. zizanioides-based AgNPs (VzAgNPs) were evaluated using analytical techniques such as ultraviolet-visible absorption spectroscopy, X-ray diffraction, Fourier transform infrared spectroscopy, dynamic light scattering and scanning and transmission electron microscopic techniques. VzAgNPs were found to attenuate the QS-dependent virulence factors, namely prodigiosin, protease, lipase, exopolysaccharide productions and biofilm formation of S. marcescens, without inhibiting its growth. Further, the transcriptomic analysis confirmed the down-regulation of QS-dependent genes, which encode for the production of virulence factors and biofilm formation. The current study confirms VzAgNPs as an ideal anti-QS and antibiofilm agent against S. marcescens. This is the first approach that validates the anti-QS and antibiofilm potential of phytosynthesized VzAgNPs against the nosocomial pathogen, S. marcescens. As VzAgNPs exhibits potent antivirulent activities, it could be used to treat hospital-acquired S. marcescens infections. © 2018 The Society for Applied Microbiology.
Quorum sensing Inhibitors as anti-pathogenic drugs
DEFF Research Database (Denmark)
Rasmussen, Thomas Bovbjerg; Givskov, Michael Christian
2006-01-01
as well as elevated tolerance to the activity of the innate immune system. Gram-negative bacteria commonly use N-acyl homoserine lactones (AHL) as QS signal molecules. The use of signal molecule based drugs to attenuate bacterial pathogenecity rather than bacterial growth is attractive for several reasons......, particularly considering the emergence of increasingly antibiotic-resistant bacteria. Compounds capable of this type of interference have been termed anti-pathogenic drugs. A large variety of synthetic AHL analogues and natural products libraries have been screened and a number of QS inhibitors (QSI) have been...
Mulik, Jyoti; Sukumaran, Soniya; Srinivas, Tatiparthi; Vijapure, Tejal
2017-07-15
Ecostatus of Ulhas estuary, one of the most polluted estuaries along the industrialized and urbanized northwest coast of India, was evaluated by six widely accepted benthic indices viz. H'(log 2 ), AMBI, M-AMBI, BENTIX, BOPA and BO2A to test their efficiency in a tropical setting. The mesohaline zone, which presented eutrophic conditions, was classified as 'bad' by all indices due to the azoic status. Despite significant correlations obtained between indices, there were discrepancies in the accurate level of EcoQS assigned to each station. AMBI was observed to be most efficient in indicating a clear spatial variability from a 'poor' to 'bad' ecological quality status in the middle and upstream zones to an improved status in the downstream region. Limitations of all indices are discussed in light of their suitability for assessing the estuarine environmental condition. The present results could provide a fillip to environmental improvement initiatives currently being undertaken in the estuary. Copyright © 2017 Elsevier Ltd. All rights reserved.
Mechanisms of quorum sensing and strategies for quorum sensing disruption in aquaculture pathogens.
Zhao, J; Chen, M; Quan, C S; Fan, S D
2015-09-01
In many countries, infectious diseases are a considerable threat to aquaculture. The pathogenicity of micro-organisms that infect aquaculture systems is closely related to the release of virulence factors and the formation of biofilms, both of which are regulated by quorum sensing (QS). Thus, QS disruption is a potential strategy for preventing disease in aquaculture systems. QS inhibitors (QSIs) not only inhibit the expression of virulence-associated genes but also attenuate the virulence of aquaculture pathogens. In this review, we discuss QS systems in important aquaculture pathogens and focus on the relationship between QS mechanisms and bacterial virulence in aquaculture. We further elucidate QS disruption strategies for targeting aquaculture pathogens. Four main types of QSIs that target aquaculture pathogens are discussed based on their mechanisms of action. © 2014 John Wiley & Sons Ltd.
Al-Shabib, Nasser A; Husain, Fohad Mabood; Ahmed, Faheem; Khan, Rais Ahmad; Ahmad, Iqbal; Alsharaeh, Edreese; Khan, Mohd Shahnawaz; Hussain, Afzal; Rehman, Md Tabish; Yusuf, Mohammad; Hassan, Iftekhar; Khan, Javed Masood; Ashraf, Ghulam Md; Alsalme, Ali Mohammed; Al-Ajmi, Mohamed F; Tarasov, Vadim V; Aliev, Gjumrakch
2016-12-05
Bacterial spoilage of food products is regulated by density dependent communication system called quorum sensing (QS). QS control biofilm formation in numerous food pathogens and Biofilms formed on food surfaces act as carriers of bacterial contamination leading to spoilage of food and health hazards. Agents inhibiting or interfering with bacterial QS and biofilm are gaining importance as a novel class of next-generation food preservatives/packaging material. In the present study, Zinc nanostructures were synthesised using Nigella sativa seed extract (NS-ZnNPs). Synthesized nanostructures were characterized hexagonal wurtzite structure of size ~24 nm by UV-visible, XRD, FTIR and TEM. NS-ZnNPs demonstrated broad-spectrum QS inhibition in C. violaceum and P. aeruginosa biosensor strains. Synthesized nanostructures inhibited QS regulated functions of C. violaceum CVO26 (violacein) and elastase, protease, pyocyanin and alginate production in PAO1 significantly. NS-ZnNPs at sub-inhibitory concentrations inhibited the biofilm formation of four-food pathogens viz. C. violaceum 12472, PAO1, L. monocytogenes, E. coli. Moreover, NS-ZnNPs was found effective in inhibiting pre-formed mature biofilms of the four pathogens. Therefore, the broad-spectrum inhibition of QS and biofilm by biogenic Zinc oxide nanoparticles and it is envisaged that these nontoxic bioactive nanostructures can be used as food packaging material and/or as food preservative.
The Quantified Self: Fundamental Disruption in Big Data Science and Biological Discovery.
Swan, Melanie
2013-06-01
individual body becomes a more knowable, calculable, and administrable object through QS activity, and individuals have an increasingly intimate relationship with data as it mediates the experience of reality.
Méndez Beltrán, Jairo Andrés
2015-01-01
Dado el interés que se presenta con los temas de gobierno corporativo, este trabajo busca describir si la divulgación on-line de los contenidos de los códigos de buen gobierno, es determinante en el posicionamiento que tienen las Instituciones de Educación Superior (IES) en el ranking QS. Partiendo de una muestra de 20 IES, se recolectaron un conjunto de datos dicotómicos para 30 variables independientes y se relacionaron con la variable dependiente denominada posicionamiento en el ranking. A...
Quorum-Sensing Blockade As A Strategy for Enhancing Host Defences Against Bacterial Pathogens
DEFF Research Database (Denmark)
Bjarnsholt, Thomas; Givskov, Michael Christian
2007-01-01
Conventional antibiotics target the growth and the basal life processes of bacteria leading to growth arrest and cell death. The selective force that is inherently linked to this mode of action eventually selects out antibiotic-resistant variants. The most obvious alternative to antibiotic...... rise to a new 'drug target rush'. Recently, QS has been shown to be involved in the development of tolerance to various antimicrobial treatments and immune modulation. The regulation of virulence via QS confers a strategic advantage over host defences. Consequently, a drug capable of blocking QS...
Quorum-sensing blockade as a strategy for enhancing host defences against bacterial pathogens
DEFF Research Database (Denmark)
Bjarnsholt, Thomas; Givskov, Michael Christian
2007-01-01
Conventional antibiotics target the growth and the basal life processes of bacteria leading to growth arrest and cell death. The selective force that is inherently linked to this mode of action eventually selects out antibiotic-resistant variants. The most obvious alternative to antibiotic...... rise to a new 'drug target rush'. Recently, QS has been shown to be involved in the development of tolerance to various antimicrobial treatments and immune modulation. The regulation of virulence via QS confers a strategic advantage over host defences. Consequently, a drug capable of blocking QS...
Directory of Open Access Journals (Sweden)
Suvi Manner
2018-05-01
Full Text Available Owing to the failure of conventional antibiotics in biofilm control, alternative approaches are urgently needed. Inhibition of quorum sensing (QS represents an attractive target since it is involved in several processes essential for biofilm formation. In this study, a compound library of natural product derivatives (n = 3040 was screened for anti-quorum sensing activity using Chromobacterium violaceum as reporter bacteria. Screening assays, based on QS-mediated violacein production and viability, were performed in parallel to identify non-bactericidal QS inhibitors (QSIs. Nine highly active QSIs were identified, while 328 compounds were classified as moderately actives and 2062 compounds as inactives. Re-testing of the highly actives at a lower concentration against C. violaceum, complemented by a literature search, led to the identification of two flavonoid derivatives as the most potent QSIs, and their impact on biofilm maturation in Escherichia coli and Pseudomonas aeruginosa was further investigated. Finally, effects of these leads on swimming and swarming motility of P. aeruginosa were quantified. The identified flavonoids affected all the studied QS-related functions at micromolar concentrations. These compounds can serve as starting points for further optimization and development of more potent QSIs as adjunctive agents used with antibiotics in the treatment of biofilms.
Siddiqui, Muhammad Faisal; Sakinah, Mimi; Singh, Lakhveer; Zularisam, A W
2012-10-31
Exploring novel biological anti-quorum sensing (QS) agents to control membrane biofouling is of great worth in order to allow sustainable performance of membrane bioreactors (MBRs) for wastewater treatment. In recent studies, QS inhibitors have provided evidence of alternative route to control membrane biofouling. This study investigated the role of Piper betle extract (PBE) as an anti-QS agent to mitigate membrane biofouling. Results demonstrated the occurrence of the N-acyl-homoserine-lactone (AHL) autoinducers (AIs), correlate QS activity and membrane biofouling mitigation. The AIs production in bioreactor was confirmed using an indicator strain Agrobacterium tumefaciens (NTL4) harboring plasmid pZLR4. Moreover, three different AHLs were found in biocake using thin layer chromatographic analysis. An increase in extracellular polymeric substances (EPS) and transmembrane pressure (TMP) was observed with AHL activity of the biocake during continuous MBR operation, which shows that membrane biofouling was in close relationship with QS activity. PBE was verified to mitigate membrane biofouling via inhibiting AIs production. SEM analysis further confirmed the effect of PBE on EPS and biofilm formation. These results exhibited that PBE could be a novel agent to target AIs for mitigation of membrane biofouling. Further work can be carried out to purify the active compound of Piper betle extract to target the QS to mitigate membrane biofouling. Copyright © 2012 Elsevier B.V. All rights reserved.
Ideals as Anchors for Relationship Experiences
Frye, Margaret; Trinitapoli, Jenny
2015-01-01
Research on young-adult sexuality in sub-Saharan Africa typically conceptualizes sex as an individual-level risk behavior. We introduce a new approach that connects the conditions surrounding the initiation of sex with subsequent relationship well-being, examines relationships as sequences of interdependent events, and indexes relationship experiences to individually held ideals. New card-sort data from southern Malawi capture young women’s relationship experiences and their ideals in a seque...
DEFF Research Database (Denmark)
Smyth, Alan R; Cifelli, Paramita M; Ortori, Catharine A
2010-01-01
Pseudomonas aeruginosa forms biofilms in the cystic fibrosis lung. Quorum sensing (QS) controls biofilm maturation, immune evasion, antibiotic tolerance and virulence factor production. Garlic shows QS inhibitory activity in vitro and in animal models. We report the first clinical trial in man of...
Quorum Sensing Regulation of Competence and Bacteriocins in Streptococcus pneumoniae and mutans
Shanker, Erin; Federle, Michael J.
2017-01-01
The human pathogens Streptococcus pneumoniae and Streptococcus mutans have both evolved complex quorum sensing (QS) systems that regulate the production of bacteriocins and the entry into the competent state, a requirement for natural transformation. Natural transformation provides bacteria with a mechanism to repair damaged genes or as a source of new advantageous traits. In S. pneumoniae, the competence pathway is controlled by the two-component signal transduction pathway ComCDE, which directly regulates SigX, the alternative sigma factor required for the initiation into competence. Over the past two decades, effectors of cellular killing (i.e., fratricides) have been recognized as important targets of the pneumococcal competence QS pathway. Recently, direct interactions between the ComCDE and the paralogous BlpRH pathway, regulating bacteriocin production, were identified, further strengthening the interconnections between these two QS systems. Interestingly, a similar theme is being revealed in S. mutans, the primary etiological agent of dental caries. This review compares the relationship between the bacteriocin and the competence QS pathways in both S. pneumoniae and S. mutans, and hopes to provide clues to regulatory pathways across the genus Streptococcus as a potential tool to efficiently investigate putative competence pathways in nontransformable streptococci. PMID:28067778
Quorum sensing communication between bacteria and human cells: signals, targets and functions
Directory of Open Access Journals (Sweden)
Angelika eHolm
2014-06-01
Full Text Available Both direct and long-range interactions between pathogenic Pseudomonas aeruginosa bacteria and their eukaryotic hosts are important in the outcome of infections. For cell-to-cell communication, these bacteria employ the quorum sensing (QS system to pass on information of the density of the bacterial population and collectively switch on virulence factor production, biofilm formation and resistance development. Thus, QS allows bacteria to behave as a community to perform tasks which would be impossible for individual cells, e.g. to overcome defense and immune systems and establish infections in higher organisms. This review highlights these aspects of QS and our own recent research on how P.aeruginosa communicates with human cells using the small QS signal molecules N-acyl homoserine lactones (AHL. We focus on how this conversation changes the behavior and function of neutrophils, macrophages and epithelial cells and on how the signaling machinery in human cells responsible for the recognition of AHL. Understanding the bacteria-host relationships at both cellular and molecular levels is essential for the identification of new targets and for the development of novel strategies to fight bacterial infections in the future.
Cortelli, Sheila C; Costa, Fernando O; Rodrigues, Edson; Cota, Luis O M; Cortelli, Jose R
2015-08-01
Nitrite is a biologic factor relevant to oral and systemic homeostasis. Through an oral bacteria reduction process, it was suggested that periodontal therapy and chlorhexidine (CHX) rinse could affect nitrite levels, leading to negative effects, such as an increase in blood pressure. This 6-month randomized clinical trial evaluated the effects of periodontal therapeutic protocols on salivary nitrite and its relation to subgingival bacteria. One hundred patients with periodontitis were allocated randomly to debridement procedures in four weekly sections (quadrant scaling [QS]) or within 24 hours (full-mouth scaling [FMS]) in conjunction with a 60-day CHX (QS + CHX and FMS + CHX), placebo (QS + placebo and FMS + placebo), or no mouthrinse (QS + none and FMS + none) use. Real-time polymerase chain reaction determined total bacterial, Aggregatibacter actinomycetemcomitans, Porphyromonas gingivalis, Tannerella forsythia, Treponema denticola, Streptococcus oralis, and Actinomyces naeslundii levels. Salivary nitrite concentration was determined with Griess reagent. Data were analyzed statistically at baseline and 3 and 6 months by analysis of variance, Kruskal-Wallis, Mann-Whitney U, and Spearman correlation tests (P periodontal pockets. The relationship between nitrite and bacterial levels appears weak. Short-term scaling exhibited a greater influence on nitrite concentrations then long-term CHX use.
Plakofuranolactone as a Quorum Quenching Agent from the Indonesian Sponge Plakortis cf. lita
Directory of Open Access Journals (Sweden)
Valeria Costantino
2017-02-01
Full Text Available There is an urgent need for novel strategies to fight drug resistance and multi-drug resistance. As an alternative to the classic antibiotic therapy, attenuation of the bacteria virulence affecting their Quorum sensing (QS system is a promising approach. Quorum sensing (QS is a genetic regulation system that allows bacteria to communicate with each other and coordinate group behaviors. A new γ-lactone that is capable of inhibiting the LasI/R QS system, plakofuranolactone (1, was discovered in the extract of the marine sponge Plakortis cf. lita, and its structure, including absolute configuration, was determined by NMR spectroscopy, MS spectrometry, and quantum-mechanical prediction of optical rotation. The quorum quenching activity of plakofuranolactone was evaluated using reporter gene assays for long- and short-chain signals (E. coli pSB1075, E. coli pSB401, and C. violeaceum CV026 and was confirmed by measuring the total protease activity (a virulence factor which is under control of the LasI/R system of the wild-type P. aeruginosa PAO1. Further research will be pursued to assess the potential of plakofuranolactone as a new antivirulence lead compound and a chemical tool to increase the knowledge in this field.
Elwick, Kyleen; Mayes, Carrie; Hughes-Stamm, Sheree
2018-02-17
In cases such as mass disasters or missing persons, human remains are challenging to identify as they may be fragmented, burnt, been buried, decomposed, and/or contain inhibitory substances. This study compares the performance of a relatively new STR kit in the US market (Investigator® 24plex QS kit; Qiagen) with the GlobalFiler® PCR Amplification kit (Thermo Fisher Scientific) when genotyping highly inhibited and low level DNA samples. In this study, DNA samples ranging from 1 ng to 7.8 pg were amplified to define the sensitivity of two systems. In addition, DNA (1 ng and 0.1 ng input amounts) was spiked with various concentrations of five inhibitors common to human remains (humic acid, melanin, hematin, collagen, calcium). Furthermore, bone (N = 5) and tissue samples from decomposed human remains (N = 6) were used as mock casework samples for comparative analysis with both STR kits. The data suggest that the GlobalFiler® kit may be slightly more sensitive than the Investigator® kit. On average STR profiles appeared to be more balanced and average peak heights were higher when using the GlobalFiler® kit. However, the data also show that the Investigator® kit may be more tolerant to common PCR inhibitors. While both STR kits showed a decrease in alleles as the inhibitor concentration increased, more complete profiles were obtained when the Investigator® kit was used. Of the 11 bone and decomposed tissue samples tested, 8 resulted in more complete and balanced STR profiles when amplified with the GlobalFiler® kit. Copyright © 2018 Elsevier B.V. All rights reserved.
Raškovic, M.; Makovec Brencic, M.; Ferligoj, A.; Fransoo, J.C.
2013-01-01
While relationship learning has been addressed in marketing theory, it has not yet been explored as a possible dimension of the second-order construct of relationship quality (RQ). This construct has so far been mostly conceptualized to consist of trust and commitment, sometimes also satisfaction;
20 CFR 222.36 - Relationship as grandchild or stepgrandchild.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as grandchild or stepgrandchild... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.36 Relationship as grandchild or stepgrandchild. A claimant will have the relationship of grandchild or stepgrandchild of an employee, or the...
Directory of Open Access Journals (Sweden)
Kelei Zhao
Full Text Available Quorum-sensing (QS allows bacterial communication to coordinate the production of extracellular products essential for population fitness at higher cell densities. It has been generally accepted that a significant time duration is required to reach appropriate cell density to activate the relevant quiescent genes encoding these costly but beneficial public goods. Which regulatory genes are involved and how these genes control bacterial communication at the early phases are largely un-explored. By determining time-dependent expression of QS-related genes of the opportunistic pathogen Pseudomonas aerugionsa, we show that the induction of social cooperation could be critically influenced by environmental factors to optimize the density of population. In particular, small regulatory RNAs (RsmY and RsmZ serving as early responders, can promote the expression of dependent genes (e.g. lasR to boost the synthesis of intracellular enzymes and coordinate instant cooperative behavior in bacterial cells. These early responders, acting as a rheostat to finely modulate bacterial cooperation, which may be quickly activated under environment threats, but peter off when critical QS dependent genes are fully functional for cooperation. Our findings suggest that RsmY and RsmZ critically control the timing and levels of public goods production, which may have implications in sociomicrobiology and infection control.
Soni, Divya; Smoum, Reem; Breuer, Aviva; Mechoulam, Raphael; Steinberg, Doron
2015-08-12
Bacterial populations communicate through the cell density-dependent mechanism of quorum sensing (QS). Vibrio harveyi, one of the best studied model organisms for QS, was used to explore effects of the synthetic cannabinoid HU-210 on QS and different QS-regulated physiological processes in bacteria. Analysis of QS-regulated bioluminescence in wild-type and mutant strains of V. harveyi revealed that HU-210 affects the autoinducer-2 (AI-2) pathway, one of three known QS cascades of V. harveyi. Furthermore, QS-mediated biofilm formation and swimming motility in the mutant strain BB152 (AI-1(-), AI-2(+)) were significantly reduced in the presence of HU-210. HU-210 inhibited QS-mediated virulence factor production without any inhibitory effect on bacterial growth. It also alters the expression of several genes, which are regulated by QS, specifically downregulating the genes of the AI-2 QS cascade. First evidence is being provided for interference of bacterial signal-transduction systems by a synthetic cannabinoid. The effect of HU-210 was specific to the AI-2 cascade in V. harveyi. AI-2 is known as a "universal autoinducer" and interference with its activity opens a broad spectrum of applications for synthetic cannabinoids in future research as a potential anti-QS agent.
Feminisme Kisah Maryam dalam al-Qur’ân dan Rekonstruksi Pemahaman Gender Perspektif Pragmatik
Directory of Open Access Journals (Sweden)
Fathurrosyid Fathurrosyid
2016-03-01
Full Text Available This article discusses the story of Maryam in the Qur’ân with a pragmatic approach. This is because Maryam is textually a phenomenal figure, she even overcomes the social status of women such as ‘Âishah and Fâtimah, so the name is documented in a special chapter popularly known as Surat Maryam. The article concludes that the construction of the theory of pragmatics against the Qur’ân is a discipline that examines the Qur’ân from the perspective of the relationship between linguistic context that is both dyadic and non-linguistic context that is triadic. The form of feminism is the story of Mary in the perspective of speech acts and implicatures in pragmatic approach of the Qur’ân that includes access to voice disappointment and resistance against misogynistic traditions contained in Q.S. Âli ‘Imrân [03]: 36, gets access to educational rights contained in Q.S. Âli ‘Imrân [03]: 37, access to implement spiritual teachings in public areas in Q.S. Âli ‘Imrân [03]: 43, access to performs an injunction against the practice of sexual harassment in Q.S. Maryam [19]: 18 and a mother’s responsibility to provide security and comfort for the baby, so that the baby did not die of starvation due to malnutrition he suffered.
20 CFR 222.22 - Relationship as divorced spouse.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as divorced spouse. 222.22 Section 222.22 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...
Directory of Open Access Journals (Sweden)
E. Botha
2011-06-01
Full Text Available Nonfinancial assets like relationships are increasingly important to managers. Communication managers in particular are focusing on measuring and managing organisational relationships as a means to quantify the return on investment (ROI of public relations and communication strategies. Measuring relationships offers communication managers a way to evaluate its contribution to the organisation. A commonly agreed upon definition of these relationships, however, does not exist. If we consider communication management is a managerial function, it must first refine its instruments of measurement. This study looks at the three-stage model of organisational relationships (relationship antecedents, maintenance strategies and relationship outcomes proposed by Grunig & Huang (2000 to firstly review the development of the model. Secondly, the study takes an in-depth look at each relationship outcomes of trust, commitment, satisfaction and control mutuality. Lastly, we assess the reliability and validity of the use of current relationship outcome measures through a survey of 154 organisational relationships. Previous studies that have utilized these outcomes in the measurement of organisational relationships do not discuss the possible interaction (or relationship among these outcomes. This study contributes to current literature by both providing an improved framework for the measurement of relationship outcomes and hypothesizing about how these outcomes interact with one another. It also discusses the managerial implications of managing relationships through the constant measurement of trust, commitment, satisfaction and control mutuality
Bacterial Quorum Sensing Stabilizes Cooperation by Optimizing Growth Strategies.
Bruger, Eric L; Waters, Christopher M
2016-11-15
Communication has been suggested as a mechanism to stabilize cooperation. In bacteria, chemical communication, termed quorum sensing (QS), has been hypothesized to fill this role, and extracellular public goods are often induced by QS at high cell densities. Here we show, with the bacterium Vibrio harveyi, that QS provides strong resistance against invasion of a QS defector strain by maximizing the cellular growth rate at low cell densities while achieving maximum productivity through protease upregulation at high cell densities. In contrast, QS mutants that act as defectors or unconditional cooperators maximize either the growth rate or the growth yield, respectively, and thus are less fit than the wild-type QS strain. Our findings provide experimental evidence that regulation mediated by microbial communication can optimize growth strategies and stabilize cooperative phenotypes by preventing defector invasion, even under well-mixed conditions. This effect is due to a combination of responsiveness to environmental conditions provided by QS, lowering of competitive costs when QS is not induced, and pleiotropic constraints imposed on defectors that do not perform QS. Cooperation is a fundamental problem for evolutionary biology to explain. Conditional participation through phenotypic plasticity driven by communication is a potential solution to this dilemma. Thus, among bacteria, QS has been proposed to be a proximate stabilizing mechanism for cooperative behaviors. Here, we empirically demonstrate that QS in V. harveyi prevents cheating and subsequent invasion by nonproducing defectors by maximizing the growth rate at low cell densities and the growth yield at high cell densities, whereas an unconditional cooperator is rapidly driven to extinction by defectors. Our findings provide experimental evidence that QS regulation prevents the invasion of cooperative populations by QS defectors even under unstructured conditions, and they strongly support the role of
Rivera, Ivan Romero; Mendonça, Maria Alayde; Andrade, José Lázaro; Moises, Valdir; Campos, Orlando; Silva, Célia Camelo; Carvalho, Antonio Carlos
2013-09-01
There is no definitive and reliable echocardiographic method for estimating the pulmonary vascular resistance (PVR) to differentiate persistent vascular disease from dynamic pulmonary hypertension. The aim of this study was to analyze the relationship between the pulmonary venous blood flow velocity-time integral (VTIpv) and PVR. Eighteen patients (10 females; 4 months to 22 years of age) with congenital heart disease and left to right shunt were studied. They underwent complete cardiac catheterization, including measurements of the PVR and Qp:Qs ratio, before and after 100% oxygen inhalation. Simultaneous left inferior pulmonary venous flow VTIpv was obtained by Doppler echocardiography. The PVR decreased significantly from 5.0 ± 2.6 W to 2.8 ± 2.2 W (P = 0.0001) with a significant increase in the Qp:Qs ratio, from 3.2 ± 1.4 to 4.9 ± 2.4 (P = 0.0008), and the VTIpv increased significantly from 22.6 ± 4.7 cm to 28.1 ± 6.2 cm (P = 0.0002) after 100% oxygen inhalation. VTIpv correlated well with the PVR and Qp:Qs ratio (r = -0.74 and 0.72, respectively). Diagnostic indexes indicated a sensitivity of 86%, specificity of 75%, accuracy of 83%, a positive predictive value of 92% and a negative predictive value of 60%. The VTIpv correlated well with the PVR. The measurement of this index before and after oxygen inhalation may become a useful noninvasive test for differentiating persistent vascular disease from dynamic and flow-related pulmonary hypertension. © 2013, Wiley Periodicals, Inc.
DEFF Research Database (Denmark)
Ellegaard, K; Bliddal, H; Møller Døhn, U
2014-01-01
PURPOSE: To test the reliability and validity of a 3D US erosion score in RA using MRI as the gold standard. MATERIALS AND METHODS: RA patients were examined with 3D US and 3 T MRI over the 2nd and 3rd metacarpophalangeal joints. 3D blocks were evaluated by two investigators. The erosions were...... estimated according to a semi-quantitative score (SQS) (0 - 3) and a quantitative score (QS) (mm²). MRI was evaluated according to the RAMRIS score. For the estimation of reliability, intra-class correlation coefficients (ICC) were used. Validity was tested using Spearman's rho (rs). The sensitivity...... and specificity were also calculated. RESULTS: 28 patients with RA were included. The ICC for the inter-observer reliability in the QS was 0.41 and 0.13 for the metacarpal bone and phalangeal bone, respectively, and 0.86 and 0.16, respectively, in the SQS. The ICC for the intra-observer reliability in the QS...
Buwalda, Nienke; Braspenning, Jozé; van Roosmalen, Sanne; van Dijk, Nynke; Visser, Mechteld
2017-07-21
Quality assurance programs in medical education are introduced to gain insight into the quality of such programs and to trigger improvements. Although of utmost importance, research on the implementation of such programs is scarce. The Dutch General Practice (GP) specialty training institutes used an implementation strategy to implement a quality system (QS), and we aimed to study the success of this strategy and to learn about additional facilitators and barriers. Seventeen structured interviews were conducted with the directors and quality coordinators (QCs) of the eight Dutch GP training institutes. A five-stage process model of implementation was used to structure these interviews and analyze the data. Two researchers analyzed the data with a framework approach. The strategy supported the institutes in implementing the QS. However, after the introduction of the QS, staff experienced the QS as demanding, although they noticed almost no concrete short-term results. Moreover, they experienced difficulties in integrating the QS into their local situation. Collectively working with the QS and following common deadlines did create a sense of commitment towards each other that appeared to be a true stimulus to the introduction of the QS. The implementation strategy focused mainly on the introduction of the QS in the GP specialty training, and it was, as such, rather successful. An important barrier concerned the acceptance of the QS and the integration of the QS into local structures, which suggests that there is a need for guidance on the translation of the QS to local contexts. All in all, we recommend more focus on the benefits of a QS.
Functions and regulation of quorum-sensing in Agrobacterium tumefaciens
Directory of Open Access Journals (Sweden)
Denis eFaure
2014-01-01
Full Text Available In Agrobacterium tumefaciens, horizontal transfer and vegetative replication of oncogenic Ti plasmids involve a cell-to-cell communication process called quorum-sensing (QS. The determinants of the QS-system belong to the LuxR/LuxI class. The LuxI-like protein TraI synthesizes N-acyl-homoserine lactone molecules which act as diffusible QS-signals. Beyond a threshold concentration, these molecules bind and activate the LuxR-like transcriptional regulator TraR, thereby initiating the QS-regulatory pathway. For the last twenty years, A. tumefaciens has stood as a prominent model in the understanding of the LuxR/LuxI type of QS systems. A number of studies also unveiled features which are unique to A. tumefaciens QS, some of them being directly related to the phytopathogenic lifestyle of the bacteria. In this review we will present the current knowledge of QS in A. tumefaciens at both the genetic and molecular levels. We will also describe how interactions with plant host modulate the QS pathway of A. tumefaciens, and discuss what could be the advantages for the agrobacteria to use such a tightly regulated QS-system to disseminate the Ti plasmids.
Yee Meng Chong; Kah Yan How; Wai Fong Yin; Kok Gan Chan
2018-01-01
The quorum sensing (QS) system has been used by many opportunistic pathogenic bacteria to coordinate their virulence determinants in relation to cell-population density. As antibiotic-resistant bacteria are on the rise, interference with QS has been regarded as a novel way to control bacterial infections. As such, many plant-based natural products have been widely explored for their therapeutic roles. These natural products may contain anti-QS compounds that could block QS signals generation ...
DEFF Research Database (Denmark)
Prol García, María Jesús; D'Alvise, Paul; Gram, Lone
2013-01-01
Quorum sensing (QS) regulates Phaeobacter gallaeciensis antagonism in broth systems; however, we demonstrate here that QS is not important for antagonism in algal cultures. QS mutants reduced Vibrio anguillarum to the same extent as the wild type. Consequently, a combination of probiotic Phaeobac...... Phaeobacter and QS inhibitors is a feasible strategy for aquaculture disease control....
Directory of Open Access Journals (Sweden)
Deok Ho Kwon
Full Text Available Rapid resistance detection is necessary for the adaptive management of acaricide-resistant populations of Tetranychus urticae. Detection of phenotypic and genotypic resistance was conducted by employing residual contact vial bioassay (RCV and quantitative sequencing (QS methods, respectively. RCV was useful for detecting the acaricide resistance levels of T. urticae, particularly for on-site resistance detection; however, it was only applicable for rapid-acting acaricides (12 out of 19 tested acaricides. QS was effective for determining the frequencies of resistance alleles on a population basis, which corresponded to 12 nonsynonymous point mutations associated with target-site resistance to five types of acaricides [organophosphates (monocrotophos, pirimiphos-methyl, dimethoate and chlorpyrifos, pyrethroids (fenpropathrin and bifenthrin, abamectin, bifenazate and etoxazole]. Most field-collected mites exhibited high levels of multiple resistance, as determined by RCV and QS data, suggesting the seriousness of their current acaricide resistance status in rose cultivation areas in Korea. The correlation analyses revealed moderate to high levels of positive relationships between the resistance allele frequencies and the actual resistance levels in only five of the acaricides evaluated, which limits the general application of allele frequency as a direct indicator for estimating actual resistance levels. Nevertheless, the resistance allele frequency data alone allowed for the evaluation of the genetic resistance potential and background of test mite populations. The combined use of RCV and QS provides basic information on resistance levels, which is essential for choosing appropriate acaricides for the management of resistant T. urticae.
20 CFR 222.35 - Relationship as stepchild.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as stepchild. 222.35 Section 222.35 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY... the relationship of stepchild of an employee, and will be considered a child for annuity but not for...
20 CFR 222.23 - Relationship as surviving divorced spouse.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as surviving divorced spouse. 222.23 Section 222.23 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried...
The response of type 2 quorum sensing in Klebsiella pneumoniae to a fluctuating culture environment.
Zhu, Hu; Liu, Hui-Jun; Ning, Shou-Jiao; Gao, Yu-Li
2012-04-01
Bacterial cells communicate with one another using chemical signaling molecules. This phenomenon is termed quorum sensing (QS). QS in Klebsiella pneumoniae is mediated by the synthesis of interspecies autoinducer 2 (AI-2), a furanosyl borate diester molecule. The response of Type 2 QS to environmental cues such as carbon sources, the initial pH of the medium, and boracic acid was investigated in the present study using a Vibrio harveyi BB170 reporter assay and quantitative reverse transcription-polymerase chain reaction (qRT-PCR) analysis. The results show that glucose can affect AI-2 synthesis to the greatest extent, and 3.0% glucose can stimulate K. pneumoniae to produce more AI-2, with a four times increase in activity compared with that of the control culture. According to our previous research, Type 2 QS in K. pneumoniae is luxS dependent. Therefore, the close relationship between glucose concentration and luxS transcription level was confirmed with qRT-PCR technology. The results show that the response of QS to a fluctuating glucose concentration was observed as a change in the amount of luxS RNA transcripts. A maximum of luxS transcription appeared during the exponential growth phase when the glucose concentration was 30.0 g/L. At the same time, AI-2 production was also slightly impacted by the low initial pH. It is noteworthy that the addition of boracic acid at microdosage (0.1 g/L) can also induce AI-2 synthesis. Presumably, in K. pneumoniae, the 4,5-dihydroxy-2,3-pentanedione cyclizes by the addition of borate and loss of water, is hydrated, and is converted to the final AI-2 signaling molecule.
20 CFR 222.24 - Relationship as remarried widow(er).
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as remarried widow(er). 222.24 Section 222.24 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...
Antonenko, Y N; Avetisyan, A V; Bakeeva, L E; Chernyak, B V; Chertkov, V A; Domnina, L V; Ivanova, O Yu; Izyumov, D S; Khailova, L S; Klishin, S S; Korshunova, G A; Lyamzaev, K G; Muntyan, M S; Nepryakhina, O K; Pashkovskaya, A A; Pletjushkina, O Yu; Pustovidko, A V; Roginsky, V A; Rokitskaya, T I; Ruuge, E K; Saprunova, V B; Severina, I I; Simonyan, R A; Skulachev, I V; Skulachev, M V; Sumbatyan, N V; Sviryaeva, I V; Tashlitsky, V N; Vassiliev, J M; Vyssokikh, M Yu; Yaguzhinsky, L S; Zamyatnin, A A; Skulachev, V P
2008-12-01
Synthesis of cationic plastoquinone derivatives (SkQs) containing positively charged phosphonium or rhodamine moieties connected to plastoquinone by decane or pentane linkers is described. It is shown that SkQs (i) easily penetrate through planar, mitochondrial, and outer cell membranes, (ii) at low (nanomolar) concentrations, posses strong antioxidant activity in aqueous solution, BLM, lipid micelles, liposomes, isolated mitochondria, and cells, (iii) at higher (micromolar) concentrations, show pronounced prooxidant activity, the "window" between anti- and prooxidant concentrations being very much larger than for MitoQ, a cationic ubiquinone derivative showing very much lower antioxidant activity and higher prooxidant activity, (iv) are reduced by the respiratory chain to SkQH2, the rate of oxidation of SkQH2 being lower than the rate of SkQ reduction, and (v) prevent oxidation of mitochondrial cardiolipin by OH*. In HeLa cells and human fibroblasts, SkQs operate as powerful inhibitors of the ROS-induced apoptosis and necrosis. For the two most active SkQs, namely SkQ1 and SkQR1, C(1/2) values for inhibition of the H2O2-induced apoptosis in fibroblasts appear to be as low as 1x10(-11) and 8x10(-13) M, respectively. SkQR1, a fluorescent representative of the SkQ family, specifically stains a single type of organelles in the living cell, i.e. energized mitochondria. Such specificity is explained by the fact that it is the mitochondrial matrix that is the only negatively-charged compartment inside the cell. Assuming that the Deltapsi values on the outer cell and inner mitochondrial membranes are about 60 and 180 mV, respectively, and taking into account distribution coefficient of SkQ1 between lipid and water (about 13,000 : 1), the SkQ1 concentration in the inner leaflet of the inner mitochondrial membrane should be 1.3x10(8) times higher than in the extracellular space. This explains the very high efficiency of such compounds in experiments on cell cultures. It is
Directory of Open Access Journals (Sweden)
I. A. Kozlov
2007-01-01
Full Text Available Objective: to study the time course of changes in the respiratory biomechanics, extravascular water of the lung (EVWL and its oxygenizing function and their relationship at different stages of surgical interventions under extracorporeal circulation (EC. Subjects and methods. 29 patients aged 37 to 72 years were examined during uncomplicated operations under EC. The parameters of artificial ventilation (AV and lung biomechanics were recorded in real time on a Servo-I monitoring apparatus. PaO2/FiO2, Qs/Qt, and body mass index (BMI were calculated. The EVWL index (EVWLI was determined by the transpulmonary thermodilution technique. Studies were conducted at stages: 1 after tracheal intubation and the initiation of AV; 2 before sternotomy; 3 after sternal uniting at the end of surgery. Results. Pressures in the airways and their resistance were statistically significantly unchanged. There were significant reductions in Cdyn and Cst at the end of surgery (Stage 3. The mean values of PaO2/FiO2, Qs/Qt, and EVWLI did not undergo considerable changes. There was a significant correlation between PaO2/FiO2 and Qs/Qt (r=-0.5 to -0.8; p<0.05. At Stage 1, BMI proved to be a significant predictor of the level of PaO2/FiO2 and Qs/Qt (r=-0.5 and 0.65; p<0.05. A significant moderate relationship between Qs/Qt and Cdyn was found at Stage 3 (r=-0.44; p<0.05. There were no statistically significant correlations between the parameters of respiratory biomechanics, PaO2/FiO2, Qs/Qt, and EVWLI. At the end of surgery, pulmonary oxygenizing dysfunction (POD was detected in 5 (17.2% patients with increased BMI. Alveolar mobilization with a steady-state effect was used to correct POD. Conclusion. When cardiac surgery is uncomplicated and the AV and EC protocols are carefully followed, the rate of intraoperative POD is not greater than 20%, its leading causes are obesity and, most likely, microatelectasis under AV. Key words: pulmonary oxygenizing dysfunction
Thornhill, Starla G; McLean, Robert J C
2018-01-01
In most bacteria, a global level of regulation, termed quorum sensing (QS), exists involving intercellular communication via the production and response to cell density-dependent signal molecules. QS has been associated with a number of important features in bacteria including virulence regulation and biofilm formation. Consequently, there is considerable interest in understanding, detecting, and inhibiting QS. N-acylated homoserine lactones (AHLs) are used as extracellular QS signals by a variety of Gram-negative bacteria. Chromobacterium violaceum, commonly found in soil and water, produces the characteristic purple pigment violacein, regulated by AHL-mediated QS. Based on this readily observed pigmentation phenotype, C. violaceum strains can be used to detect various aspects of AHL-mediated QS activity. In another commonly used bioassay organism, Agrobacterium tumefaciens, QS can be detected by the use of a reporter gene such as lacZ. Here, we describe several commonly used approaches incorporating C. violaceum and A. tumefaciens that can be used to detect AHL and QS inhibitors. Due to the inherent low susceptibility of biofilm bacteria to antimicrobial agents, biofilm dispersion, whereby bacteria reenter the planktonic community, is another increasingly important area of research. At least one signal, distinct from traditional QS, has been identified and there are a variety of other environmental factors that also trigger dispersion. We describe a microtiter-based experimental strategy whereby potential biofilm dispersion compounds can be screened.
Directory of Open Access Journals (Sweden)
Aynur Aybey
2014-10-01
Full Text Available Psychotropic drugs are known to have antimicrobial activity against several groups of microorganisms. The antidepressant agents such as duloxetine, paroxetine, hydroxyzine and venlafaxine are shown to act as efflux pump inhibitors in bacterial cells. In order to the investigation of the effects of psychotropic drugs were determined for clinically significant pathogens by using standart broth microdillusion method. The anti-quorum sensing (anti-QS activity of psychotropic drugs was tested against four test pathogens using the agar well diffusion method. All drugs showed strong inhibitory effect on the growth of S. typhimurium. Additionally, quorum sensing-regulated behaviors of Pseudomonas aeruginosa, including swarming, swimming and twitching motility and alkaline protease production were investigated. Most effective drugs on swarming, swimming and twitching motility and alkaline protease production, respectively, were paroxetine and duloxetine; duloxetine; hydroxyzine and venlafaxine; paroxetine and venlafaxine; venlafaxine. Accordingly, psychotropic drugs were shown strongly anti-QS activity by acting as bacterial efflux pump inhibitors and effection on motility and alkaline protease production of P. aeruginosa.
Personality and social relationships: As thick as thieves
Mund, Marcus; Jeronimus, Bertus F.; Neyer, Franz J.; Johansen, Christoffer
2017-01-01
This chapter shows that personality traits and social relationships are deeply entwined in a bidirectional way: Individuals select relationships partly based on their personality traits but at the same time develop across the lifespan partly in response to changes in their social environment. Life
Majerczyk, Charlotte D; Brittnacher, Mitchell J; Jacobs, Michael A; Armour, Christopher D; Radey, Matthew C; Bunt, Richard; Hayden, Hillary S; Bydalek, Ryland; Greenberg, E Peter
2014-11-01
Burkholderia pseudomallei, Burkholderia thailandensis, and Burkholderia mallei (the Bptm group) are close relatives with very different lifestyles: B. pseudomallei is an opportunistic pathogen, B. thailandensis is a nonpathogenic saprophyte, and B. mallei is a host-restricted pathogen. The acyl-homoserine lactone quorum-sensing (QS) systems of these three species show a high level of conservation. We used transcriptome sequencing (RNA-seq) to define the quorum-sensing regulon in each species, and we performed a cross-species analysis of the QS-controlled orthologs. Our analysis revealed a core set of QS-regulated genes in all three species, as well as QS-controlled factors shared by only two species or unique to a given species. This global survey of the QS regulons of B. pseudomallei, B. thailandensis, and B. mallei serves as a platform for predicting which QS-controlled processes might be important in different bacterial niches and contribute to the pathogenesis of B. pseudomallei and B. mallei. Copyright © 2014, American Society for Microbiology. All Rights Reserved.
Majerczyk, Charlotte D.; Brittnacher, Mitchell J.; Jacobs, Michael A.; Armour, Christopher D.; Radey, Matthew C.; Bunt, Richard; Hayden, Hillary S.; Bydalek, Ryland
2014-01-01
Burkholderia pseudomallei, Burkholderia thailandensis, and Burkholderia mallei (the Bptm group) are close relatives with very different lifestyles: B. pseudomallei is an opportunistic pathogen, B. thailandensis is a nonpathogenic saprophyte, and B. mallei is a host-restricted pathogen. The acyl-homoserine lactone quorum-sensing (QS) systems of these three species show a high level of conservation. We used transcriptome sequencing (RNA-seq) to define the quorum-sensing regulon in each species, and we performed a cross-species analysis of the QS-controlled orthologs. Our analysis revealed a core set of QS-regulated genes in all three species, as well as QS-controlled factors shared by only two species or unique to a given species. This global survey of the QS regulons of B. pseudomallei, B. thailandensis, and B. mallei serves as a platform for predicting which QS-controlled processes might be important in different bacterial niches and contribute to the pathogenesis of B. pseudomallei and B. mallei. PMID:25182491
Teacher-child relationships as dynamic systems.
O'Connor, Erin
2010-06-01
The purpose of the present study was to examine factors associated with the quality of the teacher-child relationship from first through fifth grade using data from phases I, II and III of the National Institutes of Child Health and Human Development Study of Early Child Care and Youth Development, a prospective study of 1364 children from birth through sixth grade. On average, children evidenced moderately high quality relationships with teachers in fifth grade. However, there was extensive variation in fifth grade relationship quality across children. Children who received more support and stimulation at home and whose parents had higher quality interactions with the school had higher quality relationships. Additionally, children in classrooms with more positive environments and better management had higher quality relationships. Lastly, females, European-American children, children with lower levels of behavior problems and children who had higher quality relationships with their teachers in kindergarten also had higher quality relationships with teachers. On average, children evidenced decreases in the quality of their relationships with teachers from first through fifth grade. Interestingly, children whose parents had more contact with their schools, who were in schools where teachers received higher salaries and in classrooms that had more positive emotional climates and that were better managed evidenced slower rates of decline in relationship quality. Implications for theory and practice are discussed.
Quality surveillance at nuclear power plants
International Nuclear Information System (INIS)
Deviney, D.E.
1990-01-01
Quality surveillance (QS) of nuclear power plants has been occurring for a number of years and is growing in importance as a management tool for assuring that power plants are operated and maintained safely. Quality surveillance can be identified by many terms, such as monitoring, assessment, technical audits, and others. The name given to the function is not important. Quality surveillance at nuclear power plants developed out of a need. Historically, audits were performed to verify compliance to quality program requirements. Verification of day-to-day implementation of activities was not being performed. This left a void in verification activities since inspections were mainly directed at hardware verification. Quality surveillance, therefore, was born out of a need to fill this void in verification. This paper discusses quality surveillance definition; objectives of QS, activities considered for QS, personnel performing QS. As in any human endeavor, people and the attitudes of those people make a program succeed or fail. In the case of QS this is even more critical because of the overview and exposure given to the nuclear industry. Properly trained and experienced personnel performing QS combined with the right attitude contribute to the successful performance of a QS. This is only one side of the success equation, however; acceptance of and actions taken by plant management establish the total success of a QS program
Relationship Quality as Predictor of B2B Customer Loyalty
Directory of Open Access Journals (Sweden)
Shaimaa S. B. Ahmed Doma
2013-02-01
Full Text Available Relationship marketing has become extremely important recently due to the fierce competition in today's marketplace. Companies are required to build long-term profitable relationship with customers and to achieve customer loyalty. Also, switching behaviors frequently occur among most of targeted customers. Fewer studies, however, discuss the effects of relationship quality efforts on customer loyalty. Therefore, this study is aimed to investigate the impact of relationship quality on customer loyalty in B2B context in the Egyptian shipping services sector. Building on prior research, we propose relationship quality as a higher construct comprising trust, commitment and satisfaction. An analytical model is developed as a guideline to test the relationships between relationship quality dimensions and customer loyalty.
Scarascia, Giantommaso; Wang, Tiannyu; Hong, Pei-Ying
2016-01-01
Sulfate-reducing bacteria (SRB) are one of the main protagonist groups of biocorrosion in the seawater environment. Given their principal role in biocorrosion, it remains a crucial task to develop strategies to reduce the abundance of SRBs. Conventional approaches include the use of biocides and antibiotics, which can impose health, safety, and environmental concerns. This review examines an alternative approach to this problem. This is achieved by reviewing the role of quorum sensing (QS) in SRB populations and its impact on the biofilm formation process. Genome databases of SRBs are mined to look for putative QS systems and homologous protein sequences representative of autoinducer receptors or synthases. Subsequently, this review puts forward the potential use of quorum quenchers as natural biocides against SRBs and outlines the potential strategies for the implementation of this approach.
Scarascia, Giantommaso
2016-12-15
Sulfate-reducing bacteria (SRB) are one of the main protagonist groups of biocorrosion in the seawater environment. Given their principal role in biocorrosion, it remains a crucial task to develop strategies to reduce the abundance of SRBs. Conventional approaches include the use of biocides and antibiotics, which can impose health, safety, and environmental concerns. This review examines an alternative approach to this problem. This is achieved by reviewing the role of quorum sensing (QS) in SRB populations and its impact on the biofilm formation process. Genome databases of SRBs are mined to look for putative QS systems and homologous protein sequences representative of autoinducer receptors or synthases. Subsequently, this review puts forward the potential use of quorum quenchers as natural biocides against SRBs and outlines the potential strategies for the implementation of this approach.
Neurodevelopment in newborns: a sample entropy analysis of electroencephalogram
International Nuclear Information System (INIS)
Zhang, Dandan; Ding, Haiyan; Liu, Yunfeng; Ding, Haishu; Zhou, Congle; Ye, Datian
2009-01-01
The present paper investigates the neural ontogeny of newborns in view of electroencephalogram (EEG) complexity during active sleep (AS) and quiet sleep (QS). Sample entropy (SampEn) is applied to EEG recordings from 168 newborns with postmenstrual age (PMA) ranging from 25 to 60 weeks. The relationship between neurodevelopment and PMA is then explored according to the statistical analysis of the median and interquartile range of SampEn curves. It is found that SampEn of EEG during AS is higher than that during QS. SampEn increases during both AS and QS before about 42 weeks in PMA while it ceases its increase in QS and even decreases in AS after newborns reaching term age. A distinct decrease in the interquartile range of SampEn is found with increasing PMA (from 25 to about 50 weeks), followed by maintenance of low fluctuation in SampEn curves. The study in this paper sets the stage for exhaustive investigation of the SampEn of EEG during brain maturation in newborns. And it could be hoped that SampEn in sleep EEG might be a useful parameter against which delays and aberrations in brain maturation might be tested. The SampEn changes during brain maturation also offer functional clues about neurodevelopment, based on which further explorations could be done. The significance of this paper is the discovery of the decrease in EEG complexity after newborns reaching term. Although some potential neurophysiologic reasons are given, this new discovery might require more study to investigate. In addition, the fluctuation of EEG complexity is analyzed for the first time, which helps to understand the EEG maturation in neurodevelopment
Zhi, Xiangyun; Abdullah, Iman Tajer; Gazioglu, Ozcan; Manzoor, Irfan; Shafeeq, Sulman; Kuipers, Oscar P; Hiller, N Luisa; Andrew, Peter W; Yesilkaya, Hasan
2018-04-23
Microbes communicate with each other by using quorum sensing (QS) systems and modulate their collective 'behavior' for in-host colonization and virulence, biofilm formation, and environmental adaptation. The recent increase in genome data availability reveals the presence of several putative QS sensing circuits in microbial pathogens, but many of these have not been functionally characterized yet, despite their possible utility as drug targets. To increase the repertoire of functionally characterized QS systems in bacteria, we studied Rgg144/Shp144 and Rgg939/Shp939, two putative QS systems in the important human pathogen Streptococcus pneumoniae. We find that both of these QS circuits are induced by short hydrophobic peptides (Shp) upon sensing sugars found in the respiratory tract, such as galactose and mannose. Microarray analyses using cultures grown on mannose and galactose revealed that the expression of a large number of genes is controlled by these QS systems, especially those encoding for essential physiological functions and virulence-related genes such as the capsular locus. Moreover, the array data revealed evidence for cross-talk between these systems. Finally, these Rgg systems play a key role in colonization and virulence, as deletion mutants of these QS systems are attenuated in the mouse models of colonization and pneumonia.
Switch of SpnR function from activating to inhibiting quorum sensing by its exogenous addition
International Nuclear Information System (INIS)
Takayama, Yuriko; Kato, Norihiro
2016-01-01
The opportunistic human pathogen Serratia marcescens AS-1 produces the N-hexanoylhomoserine lactone (C6HSL) receptor SpnR, a homologue of LuxR from Vibrio fischeri, which activates pig clusters to produce the antibacterial prodigiosin. In this study, we attempted to artificially regulate quorum sensing (QS) by changing the role of SpnR in N-acylhomoserine lactone (AHL)-mediated QS. SpnR was obtained as a fusion protein tagged with maltose-binding protein (MBP) from overexpression in Escherichia coli, and its specific affinity to C6HSL was demonstrated by quartz crystal microbalance analysis and AHL-bioassay with Chromobacterium violaceum CV026. Prodigiosin production was effectively inhibited by externally added MBP-SpnR in both wild-type AS-1 and the AHL synthase-defective mutant AS-1(ΔspnI). For the mutant, the induced amount of prodigiosin was drastically reduced to approximately 4% with the addition of 18 μM MBP-SpnR to the liquid medium, indicating 81% trapping of C6HSL. A system for inhibiting QS can be constructed by adding exogenous AHL receptor to the culture broth to keep the concentration of free AHL low, whereas intracellular SpnR naturally functions as the activator in response to QS. - Highlights: • Quorum sensing (QS) regulates the expression of some bacterial genes. • We added an AHL receptor to culture media to inhibit QS in Serratia marcescens AS-1. • The exogenous receptor effectively bound C6HSL and inhibited QS. • This approach can be used to artificially regulate AHL-mediated QS.
Switch of SpnR function from activating to inhibiting quorum sensing by its exogenous addition
Energy Technology Data Exchange (ETDEWEB)
Takayama, Yuriko [Department of Innovation Systems Engineering, Graduate School of Engineering, Utsunomiya University, 7-1-2 Yoto, Utsunomiya, Tochigi 321-8585 (Japan); CREST, Japan Science and Technology Agency, 7-1-2 Yoto, Utsunomiya, Tochigi 321-8585 (Japan); Kato, Norihiro, E-mail: katon@cc.utsunomiya-u.ac.jp [CREST, Japan Science and Technology Agency, 7-1-2 Yoto, Utsunomiya, Tochigi 321-8585 (Japan); Department of Material and Environmental Chemistry, Graduate School of Engineering, Utsunomiya University, 7-1-2 Yoto, Utsunomiya, Tochigi 321-8585 (Japan)
2016-09-02
The opportunistic human pathogen Serratia marcescens AS-1 produces the N-hexanoylhomoserine lactone (C6HSL) receptor SpnR, a homologue of LuxR from Vibrio fischeri, which activates pig clusters to produce the antibacterial prodigiosin. In this study, we attempted to artificially regulate quorum sensing (QS) by changing the role of SpnR in N-acylhomoserine lactone (AHL)-mediated QS. SpnR was obtained as a fusion protein tagged with maltose-binding protein (MBP) from overexpression in Escherichia coli, and its specific affinity to C6HSL was demonstrated by quartz crystal microbalance analysis and AHL-bioassay with Chromobacterium violaceum CV026. Prodigiosin production was effectively inhibited by externally added MBP-SpnR in both wild-type AS-1 and the AHL synthase-defective mutant AS-1(ΔspnI). For the mutant, the induced amount of prodigiosin was drastically reduced to approximately 4% with the addition of 18 μM MBP-SpnR to the liquid medium, indicating 81% trapping of C6HSL. A system for inhibiting QS can be constructed by adding exogenous AHL receptor to the culture broth to keep the concentration of free AHL low, whereas intracellular SpnR naturally functions as the activator in response to QS. - Highlights: • Quorum sensing (QS) regulates the expression of some bacterial genes. • We added an AHL receptor to culture media to inhibit QS in Serratia marcescens AS-1. • The exogenous receptor effectively bound C6HSL and inhibited QS. • This approach can be used to artificially regulate AHL-mediated QS.
Nickzad, Arvin; Déziel, Eric
2016-01-01
Quorum sensing (QS) is a cell density-dependent mechanism which enables a population of bacteria to coordinate cooperative behaviors in response to the accumulation of self-produced autoinducer signals in their local environment. An emerging framework is that the adaptive significance of QS in the regulation of production of costly extracellular metabolites ("public goods") is to maintain the homeostasis of cooperation. We investigated this model using the phytopathogenic bacterium Burkholderia glumae, which we have previously demonstrated uses QS to regulate the production of rhamnolipids, extracellular surface-active glycolipids promoting the social behavior called "swarming motility." Using mass spectrometric quantification and chromosomal lux-based gene expression, we made the unexpected finding that when unrestricted nutrient resources are provided, production of rhamnolipids is carried out completely independently of QS regulation. This is a unique observation among known QS-controlled factors in bacteria. On the other hand, under nutrient-limited conditions, QS then becomes the main regulating mechanism, significantly enhancing the specific rhamnolipids yield. Accordingly, decreasing nutrient concentrations amplifies rhamnolipid biosynthesis gene expression, revealing a system where QS-dependent regulation is specifically triggered by the growth rate of the population, rather than by its cell density. Furthermore, a gradual increase in QS signal specific concentration upon decrease of specific growth rate suggests a reduction in quorum threshold, which reflects an increase in cellular demand for production of QS-dependent target gene product at low density populations. Integration of growth rate with QS as a decision-making mechanism for biosynthesis of costly metabolites, such as rhamnolipids, could serve to assess the demand and timing for expanding the carrying capacity of a population through spatial expansion mechanisms, such as swarming motility, thus
International Nuclear Information System (INIS)
Nakajima, Kenichi; Inaki, Anri; Hiramatsu, Takashi; Hasegawa, Minoru; Fujimoto, Manabu; Takehara, Kazuhiko; Kinuya, Seigo
2009-01-01
Esophageal complications are common in patients with systemic sclerosis (SSc). The relationship between gastroesophageal reflux (GER) symptoms and dysmotility was examined in endoscopically confirmed patients suspected of having reflux esophagitis. A total of 32 patients with limited and diffuse type SSc (lSSc, dSSc) were examined based on a structured questionnaire score (QS) of GER symptoms, retention fraction of esophageal scintigraphy at 90 s (R 90 ) and gastric emptying time. The QS was significantly higher in the reflux esophagitis group than in the non-esophagitis group (5.4±3.5, 1.4±2.9, P=0.003). When the non-esophagitis group was further divided into lSSc and dSSc groups, R 90 was higher in the reflux esophagitis group (31±18%) and the non-esophagitis group with dSSc (34±32%) than in the non-esophagitis group with lSSc (8±3%, P=0.02). Both high R 90 ≥15% and QS≥4 indicated reflux esophagitis. Conversely, both normal R 90 and QS indicated no reflux esophagitis. A combination of esophageal scintigraphy and structured questionnaire demonstrated different aspects of esophageal dysfunction, namely dysmotility and GER. Patients with high QS and dysmotility may be indicated for further evaluation including endoscopic examination and medical treatment.(author)
Directory of Open Access Journals (Sweden)
Yee Meng Chong
2018-04-01
Full Text Available The quorum sensing (QS system has been used by many opportunistic pathogenic bacteria to coordinate their virulence determinants in relation to cell-population density. As antibiotic-resistant bacteria are on the rise, interference with QS has been regarded as a novel way to control bacterial infections. As such, many plant-based natural products have been widely explored for their therapeutic roles. These natural products may contain anti-QS compounds that could block QS signals generation or transmission to combat QS pathogens. In this study, we report the anti-QS activities of four different Chinese herbal plant extracts: Poria cum Radix pini, Angelica dahurica, Rhizoma cibotii and Schizonepeta tenuifolia, on Pseudomonas aeruginosa PAO1. All the plants extracted using hexane, chloroform and methanol were tested and found to impair swarming motility and pyocyanin production in P. aeruginosa PAO1, particularly by Poria cum Radix pini. In addition, all the plant extracts also inhibited violacein production in C. violaceum CV026 up to 50% while bioluminescence activities were reduced in lux-based E. coli biosensors, pSB401 and pSB1075, up to about 57%. These anti-QS properties of the four medicinal plants are the first documentation that demonstrates a potential approach to attenuate pathogens’ virulence determinants.
Melkina, Olga E; Koval, Vasilii S; Ivanov, Alexander A; Zhuze, Alexei L; Zavilgelsky, Gennadii B
2018-03-01
DNA sequence-specific fluorescent dimeric bisbenzimidazoles DBP(n) and DBPA(n), noncovalently interacting with A-T pairs in the minor groove of double-stranded DNA were used for studying and monitoring the expression of histone-like H-NS-dependent promoters. Histone-like H-NS selectively binds to AT-rich segments of DNA and silences a large number of genes in bacterial chromosomes. The H-NS-dependent promoters of Quorum Sensing (QS)-regulated lux operons of the marine bacteria mesophilic Aliivibrio fischeri, psychrophilic Aliivibrio logei were used. Escherichia coli lux biosensors were constructed by cloning fragments bearing QS-regulated promoters into the vector, thereby placing each fragment upstream of the promoterless Photorhabdus luminescens luxCDABE genes. It was shown that the dimeric bisbenzimidazoles DBP(n) and DBPA(n) counteract the H-NS silencing activity. Thus, the presence of DBP(n) or DBPA(n) in the medium leads to an approximately 10-100-fold increase in the level of transcription of QS promoters in E. coli hns + . The largest decrease in the level of H-NS repression was observed using ligands containing a linker with a length of ca. 18Å, such as DBP(2) and DBPA(2). Ligands containing linkers with n=1 and 3 are an order of magnitude less active; ligands with n=4 are inactive. DBPA(2) exhibits activity starting with a concentration of 0.5μM; the minimum concentration of DBP(2) is 5-7 times higher. It is suggested that A-T pairs located at five nucleotide pair intervals, which correspond to the linker length in highly active ligands with n=2, play a key role in the structure of H-NS-binding sites in QS-regulated promoters. Copyright © 2017 Elsevier GmbH. All rights reserved.
DEFF Research Database (Denmark)
Stacy, Danielle M.; Le Quement, Sebastian T.; Hansen, Casper L.
2013-01-01
triazole-containing analogs of natural N-acyl l-homoserine lactone (AHL) signals as non-native QS agonists and antagonists in Gram-negative bacteria. We synthesized 72 triazole derivatives of five broad structure types in high yields and purities using efficient Cu(i)-catalyzed azide–alkyne couplings...
QStatin, a Selective Inhibitor of Quorum Sensing in Vibrio Species.
Kim, Byoung Sik; Jang, Song Yee; Bang, Ye-Ji; Hwang, Jungwon; Koo, Youngwon; Jang, Kyung Ku; Lim, Dongyeol; Kim, Myung Hee; Choi, Sang Ho
2018-01-30
Pathogenic Vibrio species cause diseases in diverse marine animals reared in aquaculture. Since their pathogenesis, persistence, and survival in marine environments are regulated by quorum sensing (QS), QS interference has attracted attention as a means to control these bacteria in aquatic settings. A few QS inhibitors of Vibrio species have been reported, but detailed molecular mechanisms are lacking. Here, we identified a novel, potent, and selective Vibrio QS inhibitor, named QStatin [1-(5-bromothiophene-2-sulfonyl)-1H-pyrazole], which affects Vibrio harveyi LuxR homologues, the well-conserved master transcriptional regulators for QS in Vibrio species. Crystallographic and biochemical analyses showed that QStatin binds tightly to a putative ligand-binding pocket in SmcR, the LuxR homologue in V. vulnificus , and changes the flexibility of the protein, thereby altering its transcription regulatory activity. Transcriptome analysis revealed that QStatin results in SmcR dysfunction, affecting the expression of SmcR regulon required for virulence, motility/chemotaxis, and biofilm dynamics. Notably, QStatin attenuated representative QS-regulated phenotypes in various Vibrio species, including virulence against the brine shrimp ( Artemia franciscana ). Together, these results provide molecular insights into the mechanism of action of an effective, sustainable QS inhibitor that is less susceptible to resistance than other antimicrobial agents and useful in controlling the virulence of Vibrio species in aquacultures. IMPORTANCE Yields of aquaculture, such as penaeid shrimp hatcheries, are greatly affected by vibriosis, a disease caused by pathogenic Vibrio infections. Since bacterial cell-to-cell communication, known as quorum sensing (QS), regulates pathogenesis of Vibrio species in marine environments, QS inhibitors have attracted attention as alternatives to conventional antibiotics in aquatic settings. Here, we used target-based high-throughput screening to identify
Radiolanthanide labeled compounds as radiopharmaceuticals for radio-synoviorthesis
Czech Academy of Sciences Publication Activity Database
Melichar, František; Kropáček, Martin; Šrank, Jiří; Mirzajevová, Marcela; Beran, Miloš; Zimová, Jana; Eigner-Henke, Kateřina; Forsterová, Michaela; Kraft, O.
2007-01-01
Roč. 6, č. 1 (2007), s. 45-45 ISSN 1450-1147 R&D Projects: GA AV ČR 1QS100480501 Institutional research plan: CEZ:AV0Z10480505 Keywords : radiosynoviorthesis * holmium-166 Subject RIV: FR - Pharmacology ; Medidal Chemistry
Directory of Open Access Journals (Sweden)
Werther Brunow de Carvalho
Full Text Available Five patients with ages ranging from 6 months to 3 years were analyzed. All received inhaled nitric oxide (NO - 20 parts per million (ppm and oxygen (0(2 - at a concentration of 90-95% by means of an oxygen hood. Mean Pulmonary Artery Pressure (MPAP, Mean Aortic Pressure (MAoP, Pulmonary Vascular Resistance (PVR and Systemic Vascular Resistance (SVR were measured and the calculation of their relationship to pulmonary/systemic flow (Qp/Qs was performed by the catheterization' of the femoral artery vein. Three patients presented reduction in PVR and increase in Qp/Qs. There were no systemic alterations or any side effect from using NO.
Directory of Open Access Journals (Sweden)
Giantommaso Scarascia
2016-12-01
Full Text Available Sulfate-reducing bacteria (SRB are one of the main protagonist groups of biocorrosion in the seawater environment. Given their principal role in biocorrosion, it remains a crucial task to develop strategies to reduce the abundance of SRBs. Conventional approaches include the use of biocides and antibiotics, which can impose health, safety, and environmental concerns. This review examines an alternative approach to this problem. This is achieved by reviewing the role of quorum sensing (QS in SRB populations and its impact on the biofilm formation process. Genome databases of SRBs are mined to look for putative QS systems and homologous protein sequences representative of autoinducer receptors or synthases. Subsequently, this review puts forward the potential use of quorum quenchers as natural biocides against SRBs and outlines the potential strategies for the implementation of this approach.
Simmons, J; Roberge, L; Kendrick, S B; Richards, B
1995-03-01
The biomedical model that has long been central to medical practice is gradually being expanded to a broader biopsychosocial model. Relationship-building skills commensurate with the new paradigm need to be understood by educators and taught to medical practitioners. The person-centered, or humanistic, model of psychologist Carl Rogers provides a theoretical approach for the development of effective biopsychosocial relationships. The Barrett-Lennard Relationship Inventory (BLRI) was developed in 1962 as an assessment instrument for the person-centered model. In this article, the person-centered model and the use of the BLRI as an assessment instrument of this model are discussed. Current and potential uses of the BLRI are explored.
Directory of Open Access Journals (Sweden)
J. P. L. Johnson
2016-08-01
τc(qs* and increasing transport rates. Model parameters are calibrated based on laboratory flume experiments that explore transport disequilibrium. The τc(qs* equation is then incorporated into a simple morphodynamic model. The evolution of τc(qs* is a negative feedback on morphologic change, while also allowing reaches to equilibrate to sediment supply at different slopes. Finally, τc(qs* is interpreted to be an important but nonunique state variable for morphodynamics, in a manner consistent with state variables such as temperature in thermodynamics.
Tan, Li Ying; Yin, Wai-Fong; Chan, Kok-Gan
2013-03-20
Various parts of Piper nigrum, Piper betle and Gnetum gnemon are used as food sources by Malaysians. The purpose of this study is to examine the anti-quorum sensing (anti-QS) properties of P. nigrum, P. betle and G. gnemon extracts. The hexane, chloroform and methanol extracts of these plants were assessed in bioassays involving Pseudomonas aeruginosa PA01, Escherichia coli [pSB401], E. coli [pSB1075] and Chromobacterium violaceum CV026. It was found that the extracts of these three plants have anti-QS ability. Interestingly, the hexane, chloroform and methanol extracts from P. betle showed the most potent anti-QS activity as judged by the bioassays. Since there is a variety of plants that serve as food sources in Malaysia that have yet to be tested for anti-QS activity, future work should focus on identification of these plants and isolation of the anti-QS compounds.
Boolean network model of the Pseudomonas aeruginosa quorum sensing circuits.
Dallidis, Stylianos E; Karafyllidis, Ioannis G
2014-09-01
To coordinate their behavior and virulence and to synchronize attacks against their hosts, bacteria communicate by continuously producing signaling molecules (called autoinducers) and continuously monitoring the concentration of these molecules. This communication is controlled by biological circuits called quorum sensing (QS) circuits. Recently QS circuits and have been recognized as an alternative target for controlling bacterial virulence and infections without the use of antibiotics. Pseudomonas aeruginosa is a Gram-negative bacterium that infects insects, plants, animals and humans and can cause acute infections. This bacterium has three interconnected QS circuits that form a very complex and versatile QS system, the operation of which is still under investigation. Here we use Boolean networks to model the complete QS system of Pseudomonas aeruginosa and we simulate and analyze its operation in both synchronous and asynchronous modes. The state space of the QS system is constructed and it turned out to be very large, hierarchical, modular and scale-free. Furthermore, we developed a simulation tool that can simulate gene knock-outs and study their effect on the regulons controlled by the three QS circuits. The model and tools we developed will give to life scientists a deeper insight to this complex QS system.
2012-05-21
..., and for species caught incidentally in the whiting fishery (including lingcod, Pacific cod, canary..., depending on the formula used, there may be new QS permit owners, while some current QS permit owners who.... The current regulations give QS permit owners with excess QS two years after QS transfer begins to...
Composition, anti-quorum sensing and antimicrobial activity of essential oils from Lippia alba
Directory of Open Access Journals (Sweden)
Jesus Olivero-Verbel
2014-09-01
Full Text Available Many Gram-negative pathogens have the ability to produce N-acylhomoserine lactones (AHLs as signal molecules for quorum sensing (QS. This cell-cell communication system allows them to coordinate gene expression and regulate virulence. Strategies to inhibit QS are promising for the control of infectious diseases or antibiotic resistant bacterial pathogens. The aim of the present study was to evaluate the anti-quorum sensing (anti-QS and antibacterial potential of five essential oils isolated from Lippia alba on the Tn-5 mutant of Chromobacterium violaceum CV026, and on the growth of the gram-positive bacteria S. aureus ATCC 25923. The anti-QS activity was detected through the inhibition of the QS-controlled violacein pigment production by the sensor bacteria. Results showed that two essential oils from L. alba, one containing the greatest geranial:neral and the other the highest limonene:carvone concentrations, were the most effective QS inhibitors. Both oils also had small effects on cell growth. Moreover, the geranial/neral chemotype oil also produced the maximum zone of growth inhibition against S. aureus ATCC 25923. These data suggest essential oils from L. alba have promising properties as QS modulators, and present antibacterial activity on S. aureus.
Microbial Regulation in Gorgonian Corals
Directory of Open Access Journals (Sweden)
Laura D. Mydlarz
2012-06-01
Full Text Available Gorgonian corals possess many novel natural products that could potentially mediate coral-bacterial interactions. Since many bacteria use quorum sensing (QS signals to facilitate colonization of host organisms, regulation of prokaryotic cell-to-cell communication may represent an important bacterial control mechanism. In the present study, we examined extracts of twelve species of Caribbean gorgonian corals, for mechanisms that regulate microbial colonization, such as antibacterial activity and QS regulatory activity. Ethanol extracts of gorgonians collected from Puerto Rico and the Florida Keys showed a range of both antibacterial and QS activities using a specific Pseudomonas aeruginosa QS reporter, sensitive to long chain AHLs and a short chain N-acylhomoserine lactones (AHL biosensor, Chromobacterium violaceium. Overall, the gorgonian corals had higher antimicrobial activity against non-marine strains when compared to marine strains. Pseudopterogorgia americana, Pseusopterogorgia acerosa, and Pseudoplexuara flexuosa had the highest QS inhibitory effect. Interestingly, Pseudoplexuara porosa extracts stimulated QS activity with a striking 17-fold increase in signal. The stimulation of QS by P. porosa or other elements of the holobiont may encourage colonization or recruitment of specific microbial species. Overall, these results suggest the presence of novel stimulatory QS, inhibitory QS and bactericidal compounds in gorgonian corals. A better understanding of these compounds may reveal insight into coral-microbial ecology and whether a therapeutic potential exists.
The Rise Of BIM in Malaysia And Its Impact Towards Quantity Surveying Practices
Directory of Open Access Journals (Sweden)
Zainon Nurshuhada
2016-01-01
Full Text Available Building Information Modeling (BIM is a new buzzword that is gaining a momentum within the construction industry in Malaysia, and worldwide. BIM is a way of working that involves the automation of the entire project team using a 4D model that can do many of the traditional fuctions of a Quatity Surveyor (QS. As BIM is removing more of the traditional work of QS, there are rising fears that it could threaten the viability of the QS professions especially for small firms that still rely on producing bills of quantities. This paper aims to review the challenges and opportunities gained from BIM advancement in QS profession, especially in Malaysia. Despite of serious cost and commercial challenges of BIM implementation, BIM will work wonder as a tool that will cut the amount of time QS have to spend on analysis and provides opportunities to direct QS talents towards being more efficient. This is resulting to better project coordination with a lot less conflict, a more sustainable building in the final instance and also throughout the process, as less time is spent on each stage.
Soni, Divya; Smoum, Reem; Breuer, Aviva; Mechoulam, Raphael; Steinberg, Doron
2015-01-01
Background Bacterial populations communicate through the cell density-dependent mechanism of quorum sensing (QS). Vibrio harveyi, one of the best studied model organisms for QS, was used to explore effects of the synthetic cannabinoid HU-210 on QS and different QS-regulated physiological processes in bacteria. Results Analysis of QS-regulated bioluminescence in wild-type and mutant strains of V. harveyi revealed that HU-210 affects the autoinducer-2 (AI-2) pathway, one of three known QS casca...
Emotional intelligence and human relationship management as ...
African Journals Online (AJOL)
... human relationship management as predictors of organizational commitment. ... The study seeks to explain the interactive and relative effects of emotional ... Simple random sampling technique was used in selecting 300 participants from ...
Damping of Quasi-stationary Waves Between Two Miscible Liquids
Duval, Walter M. B.
2002-01-01
Two viscous miscible liquids with an initially sharp interface oriented vertically inside a cavity become unstable against oscillatory external forcing due to Kelvin-Helmholtz instability. The instability causes growth of quasi-stationary (q-s) waves at the interface between the two liquids. We examine computationally the dynamics of a four-mode q-s wave, for a fixed energy input, when one of the components of the external forcing is suddenly ceased. The external forcing consists of a steady and oscillatory component as realizable in a microgravity environment. Results show that when there is a jump discontinuity in the oscillatory excitation that produced the four-mode q-s wave, the interface does not return to its equilibrium position, the structure of the q-s wave remains imbedded between the two fluids over a long time scale. The damping characteristics of the q-s wave from the time history of the velocity field show overdamped and critically damped response; there is no underdamped oscillation as the flow field approaches steady state. Viscous effects serve as a dissipative mechanism to effectively damp the system. The stability of the four-mode q-s wave is dependent on both a geometric length scale as well as the level of background steady acceleration.
Tan, Li Ying; Yin, Wai-Fong; Chan, Kok-Gan
2013-01-01
Various parts of Piper nigrum, Piper betle and Gnetum gnemon are used as food sources by Malaysians. The purpose of this study is to examine the anti-quorum sensing (anti-QS) properties of P. nigrum, P. betle and G. gnemon extracts. The hexane, chloroform and methanol extracts of these plants were assessed in bioassays involving Pseudomonas aeruginosa PA01, Escherichia coli [pSB401], E. coli [pSB1075] and Chromobacterium violaceum CV026. It was found that the extracts of these three plants have anti-QS ability. Interestingly, the hexane, chloroform and methanol extracts from P. betle showed the most potent anti-QS activity as judged by the bioassays. Since there is a variety of plants that serve as food sources in Malaysia that have yet to be tested for anti-QS activity, future work should focus on identification of these plants and isolation of the anti-QS compounds. PMID:23519352
Piper nigrum, Piper betle and Gnetum gnemon- Natural Food Sourcewith Anti-Quorum Sensing Properties
Directory of Open Access Journals (Sweden)
Li Ying Tan
2013-03-01
Full Text Available Various parts of Piper nigrum, Piper betle and Gnetum gnemon are used as food sources by Malaysians. The purpose of this study is to examine the anti-quorum sensing (anti-QS properties of P. nigrum, P. betle and G. gnemon extracts. The hexane, chloroform and methanol extracts of these plants were assessed in bioassays involving Pseudomonas aeruginosa PA01, Escherichia coli [pSB401], E. coli [pSB1075] and Chromobacterium violaceum CV026. It was found that the extracts of these three plants have anti-QS ability. Interestingly, the hexane, chloroform and methanol extracts from P. betle showed the most potent anti-QS activity as judged by the bioassays. Since there is a variety of plants that serve as food sources in Malaysia that have yet to be tested for anti-QS activity, future work should focus on identification of these plants and isolation of the anti-QS compounds.
20 CFR 222.30 - When determinations of relationship as child are made.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When determinations of relationship as child... RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.30 When determinations of... determination will be made regarding a claimant's relationship as the child of the employee when the claimant...
Directory of Open Access Journals (Sweden)
Anton Hartmann
2013-01-01
Full Text Available The majority of the marine algal species, though completing their life cycle in seawater, are rarely susceptible to fouling, making them an important source of quorum sensing (QS inhibitory substances. The separation and characterization of QS inhibitors are crucial for any potential application. Thirty marine macroalgae were tested for QS inhibition activity by using Chromobacterium violaceum CV026 as the reporter strain, and among them, Asparagopsis taxiformis showed antibacterial, as well as antiquorum, sensing activities. Cinnamaldehyde (75 mM and methanol were used as positive and negative controls, respectively. The antiquorum sensing activity of A. taxiformis was further confirmed using the sensor strain, Serratia liquefaciens MG44, having green fluorescent protein (gfp. Methanolic extract of the alga was fractionated by solid phase extraction (SPE, and each fraction was tested for QS inhibition. Two types of activities were observed—zone of clearance (antibacterial activity and zone of inhibition with or without finger-like projections (QS inhibition. Out of five SPE cartridges, Bond Elut PH showed clear separation of these two fractions. The Ion Cyclotron Resonance Fourier Transformation Mass Spectrometer (ICR-FT/MS analysis of the fractions further supported the bioassay results. The presence of strong QS inhibitory compound in A. taxiformis indicates its potential use in antifouling preparations.
Attenuation of S-waves in the lithosphere of the Sea of Crete according to OBS observations
Kovachev, S. A.; Kuzin, I. P.; Shoda, O. Yu.; Soloviev, S. L.
1991-11-01
Five OBS were installed in the Sea of Crete in 1987. During a period of nine days 430 local earthquakes were recorded. Hypocentres were determined for 85 microearthquakes. A correlation between magnitude ML and duration of seismic events on the records of the ocean bottom seismographs (OBS) was found from data of 14 shocks recorded simultaneously by OBS and some land-based Greek stations. A magnitude-frequency relationship for earthquakes recorded by OBS was obtained in the magnitude range ML = 2-4. Amplitude curves describing the attenuation of body waves in the lithosphere of the Sea of Crete were compiled. Assessment of quality factor Qs was made by comparison of empirical and theoretical amplitude curves. The values of Qs for the lithosphere of the Sea of Crete were calculated and found equal to 200-300. Low values of Qs and consequently strong attenuation of S-waves in the lithosphere of the Sea of Crete could be explained by extension of the lithosphere accompanied by its partial contamination with melted magma.
The role of quorum sensing in the pathogenicity of the cunning aggressor Pseudomonas aeruginosa
DEFF Research Database (Denmark)
Bjarnsholt, Thomas; Givskov, Michael Christian
2007-01-01
that bacteria preferentially live in communities in the form of primitive organisms in which the behavior of individual cells is coordinated by cell-cell communication, known as quorum sensing (QS). Bacteria use QS for regulation of the processes involved in their interaction with each other, their environment...... in the protective mechanisms of P. aeruginosa and show how disruption of the QS can be used as an approach to control this cunning aggressor....
Directory of Open Access Journals (Sweden)
Hayder Mohammed Salim Al-Maamori
2018-04-01
Full Text Available Effects of time-dependent deformation (TDD on a tunnel constructed using the micro-tunneling technique in Queenston shale (QS are investigated employing the finite element method. The TDD and strength parameters of the QS were measured from tests conducted on QS specimens soaked in water and lubricant fluids (LFs used in micro-tunneling such as bentonite and polymer solutions. The numerical model was verified using the results of TDD tests performed on QS samples, field measurements of some documented projects, and the closed-form solutions to circular tunnels in swelling rock. The verified model was then employed to conduct a parametric study considering important micro-tunneling design parameters, such as depth and diameter of the tunnel, in situ stress ratio (Ko, and the time lapse prior to replacing LFs with permanent cement grout around the tunnel. It was revealed that the time lapse plays a vital role in controlling deformations and associated stresses developed in the tunnel lining. The critical case of a pipe or tunnel in which the maximum tensile stress develops at its springline occurs when it is constructed at shallow depths in the QS layer. The results of the parametric study were used to suggest recommendations for the construction of tunnels in QS employing micro-tunneling. Keywords: Numerical model, Micro-tunneling, Queenston shale (QS, Lubricant fluids (LFs
Chitosan nanoparticles enhances the anti-quorum sensing activity of kaempferol.
Ilk, Sedef; Sağlam, Necdet; Özgen, Mustafa; Korkusuz, Feza
2017-01-01
Quorum sensing (QS) is a cell density dependent expression of species in bacteria mediated by compounds called autoinducers (AI). Several processes responsible for successful establishment of bacterial infection are mediated by QS. Inhibition of QS is therefore being considered as a new target for antimicrobial chemotherapy. Flavonoid compounds are strong antioxidant and antimicrobial agents but their applications are limited due to their poor dissolution and bioavailability. Our objective was to investigate the effect of kaempferol loaded chitosan nanoparticles on modulating QS mediated by AI in model bioassay test systems. For this purpose, kaempferol loaded nanoparticles were synthesized and characterized in terms of hydrodynamic diameter, hydrogen bonding, amorphous transformation and antioxidant activity. QS inhibition in time dependent manner of nanoparticles was measured in violacein pigment producing using the biosensor strain Chromobacterium violaceum CV026 mediated by AI known as acylated homoserine lactone (AHL). Our results indicated that the average kaempferol loaded chitosan/TPP nanoparticle size and zeta potential were 192.27±13.6nm and +35mV, respectively. The loading and encapsulation efficiency of kaempferol into chitosan/TPP nanoparticles presented higher values between 78 and 93%. Kaempferol loaded chitosan/TPP nanoparticle during the 30 storage days significantly inhibited the production of violacein pigment in Chromobacterium violaceum CV026. The observation that kaempferol encapsulated chitosan nanoparticles can inhibit QS related processes opens up an exciting new strategy for antimicrobial chemotherapy as stable QS-based anti-biofilm agents. Copyright © 2016 Elsevier B.V. All rights reserved.
Anti-Quorum Sensing Potential of Potato Rhizospheric Bacteria
Directory of Open Access Journals (Sweden)
Adeleh Sobhanipour
2017-01-01
Full Text Available The occurrence of antibiotic-resistant pathogenic bacteria is becoming a serious problem. The rise of multiresistance strains has forced the pharmaceutical industry to come up with new generation of more effective and potent antibiotics, therefore creating development of antivirulence compounds. Due to extensive usage of cell-to-cell bacterial communication (QS systems to monitor the production of virulence factors, disruption of QS system results in creation of a promising strategy for the control of bacterial infection. Numerous natural quorum quenching (QQ agents have been identified. In addition, many microorganisms are capable of producing smaller molecular QS inhibitors and/or macromolecular QQ enzymes. In present survey, anti QS activity of 1280 rhizosphere bacteria was assessed using the Pectobacterium carotovorum as AHL-donor and Chromobacterium violaceum CV026 as biosensor system. The results showed that 61 strains had highly AHL-degrading activity. Both Lux I and Lux R activity were affected by some isolates, suggesting that the rhizobacteria target both QS signal and receptor. These soil microorganisms with their anti-QS activity have the potential to be novel therapeutic agents for reducing virulence and pathogenicity of antibiotic resistant bacteria.
Directory of Open Access Journals (Sweden)
J. G. Santos
2016-01-01
Full Text Available Introduction: Lung ventilation/perfusion scintigraphy with planar images (V/QS-planar is very useful for the diagnosis and follow-up of pulmonary thromboembolism (PTE. Acquiring tomographic images (V/QS-SPECT is a recent development with potential to increase the technique's accuracy. The purpose of this work is to evaluate the added benefits of V/QS-SPECT studies as opposed to traditional planar imaging. Patients and methods: We prospectively revised 53 V/QS-planar and V/QS-SPECT exams, performed according to the European Association of Nuclear Medicine guidelines. We evaluated the exams independently, by consensus of two Nuclear Medicine physicians. For both methods, we gave each lung a score expressing the dimension and extension of perfusion defects with normal ventilation. For each lung, we compared the scores with the paired Wilcoxon test, estimating the 95% confidence interval (95CI for the respective difference. Results: We performed V/QS-SPECT exams without technical difficulties. The paired Wilcoxon test estimated the score difference to be â0.75 (95CI of â1.0 to â0.5; p-value = 9.6 Ã 10â7, expressing a statistically significant difference of about 1 subsegmental defect between both methods, with V/QS-SPECT detecting more defects. Discussion: The results demonstrate that V/QS-SPECT identifies a slightly larger number of perfusion defects than V/QS-planar, suggesting a higher sensitivity of this technique. However, more studies are necessary to evaluate the clinical meaning of this fact. Conclusion: V/QS-SPECT demonstrates a higher capability to identify perfusion defects. This method looks promising, allowing for a greater role of this exam in pulmonary thromboembolism diagnosis and follow-up. Keywords: Pulmonary thromboembolism, Lung, Scintigraphy, Single-photon emission-computed tomography (SPECT
GAY RELATIONSHIPS AS ALTERNATIVE FORMS OF FAMILY-MARRIAGE LIFE
Directory of Open Access Journals (Sweden)
Ewa Perlińska
2006-01-01
Full Text Available My research and deliberation made in this study show that homosexuality is only one of the signs of human diversity - one from innumerable number of personality features. Therefore, one cannot talk about "gay identity", "homosexual personality", because, as far as I am concerned, it doesn't exist. Artificially generted gay population is only a group of peple being much different from one another and having only one common feature - their sexual orientation. Besides they differ from one another as much as one man from another. Gay relationships take on countless forms, but all of them, as the results of my research indicate, fulfil the majority of family in traditional point of view functions. The deliberation points out at one more conclusion - one cannot examine gay relationships as a separate model of family-marriage life. It should be forgotten about their different psyhosexual orientation and treat their trlationships, together with other interpersonal relationships, equally. Only from such position one can discern in their specific alternative models of family-marriage life.
DEFF Research Database (Denmark)
Bjarnsholt, Thomas; Jensen, P.O.; Burmolle, M.
2005-01-01
to otherwise lethal doses of antibiotics and are protected from bactericidal activity of polymorphonuclear leukocytes (PMNs). P. aeruginosa controls the expression of many of its virulence factors by means of a cell-cell communication system termed quorum sensing (QS). In the present report it is demonstrated...... that biofilm bacteria in which QS is blocked either by mutation or by administration of QS inhibitory drugs are sensitive to treatment with tobramycin and H2O2, and are readily phagocytosed by PMNs, in contrast to bacteria with functional QS systems. In contrast to the wild-type, QS-deficient biofilms led...... to an immediate respiratory-burst activation of the PMNs in vitro. In vivo QS-deficient mutants provoked a higher degree of inflammation. It is suggested that quorum signals and QS-inhibitory drugs play direct and opposite roles in this process. Consequently, the faster and highly efficient clearance of QS-deficient...
A new correction method for determination on carbohydrates in lignocellulosic biomass.
Li, Hong-Qiang; Xu, Jian
2013-06-01
The accurate determination on the key components in lignocellulosic biomass is the premise of pretreatment and bioconversion. Currently, the widely used 72% H2SO4 two-step hydrolysis quantitative saccharification (QS) procedure uses loss coefficient of monosaccharide standards to correct monosaccharide loss in the secondary hydrolysis (SH) of QS and may result in excessive correction. By studying the quantitative relationships of glucose and xylose losses during special hydrolysis conditions and the HMF and furfural productions, a simple correction on the monosaccharide loss from both PH and SH was established by using HMF and furfural as the calibrators. This method was used to the component determination on corn stover, Miscanthus and cotton stalk (raw materials and pretreated) and compared to the NREL method. It has been proved that this method can avoid excessive correction on the samples with high-carbohydrate contents. Copyright © 2013 Elsevier Ltd. All rights reserved.
The physical basis of bacterial quorum communication
2015-01-01
This book aims to educate physical scientists and quantitatively-oriented biologists on the application of physical experimentation and analysis, together with appropriate modeling, to understanding and interpreting microbial chemical communication and especially quorum sensing (QS). Quorum sensing describes a chemical communication behavior that is nearly universal among bacteria. Individual cells release a diffusible small molecule (an autoinducer) into their environment. A high concentration of this autoinducer serves as a signal of high population density, triggering new patterns of gene expression throughout the population. However QS is often much more complex than simple census-taking. Many QS bacteria produce and detect multiple autoinducers, which generate quorum signal cross talk with each other and with other bacterial species. QS gene regulatory networks operate in physically complex environments and respond to a range of inputs in addition to autoinducer signals. While many individual QS systems ...
[Enzymes for disrupting bacterial communication, an alternative to antibiotics?
Rémy, B; Plener, L; Elias, M; Daudé, D; Chabrière, E
2016-11-01
Quorum sensing (QS) is used by bacteria to communicate and synchronize their actions according to the cell density. In this way, they produce and secrete in the surrounding environment small molecules dubbed autoinducers (AIs) that regulate the expression of certain genes. The phenotypic traits regulated by QS are diverse and include pathogenicity, biofilm formation or resistance to anti-microbial treatments. The strategy, aiming at disrupting QS, known as quorum quenching (QQ), has emerged to counteract bacterial virulence and involves QS-inhibitors (QSI) or QQ-enzymes degrading AIs. Differently from antibiotics, QQ aims at blocking cell signaling and does not alter bacterial survival. This considerably decreases the selection pressure as compared to bactericide treatments and may reduce the occurrence of resistance mechanisms. QQ-enzymes are particularly appealing as they may disrupt molecular QS-signal without entering the cell and in a catalytic way. This review covers several aspects of QQ-based medical applications and the potential subsequent emergence of resistance is discussed. Copyright © 2016 Académie Nationale de Pharmacie. All rights reserved.
Quantum optical properties in plasmonic systems
Energy Technology Data Exchange (ETDEWEB)
Ooi, C. H. Raymond [Department of Physics, University of Malaya, 50603, Kuala Lumpur (Malaysia)
2015-04-24
Plasmonic metallic particle (MP) can affect the optical properties of a quantum system (QS) in a remarkable way. We develop a general quantum nonlinear formalism with exact vectorial description for the scattered photons by the QS. The formalism enables us to study the variations of the dielectric function and photon spectrum of the QS with the particle distance between QS and MP, exciting laser direction, polarization and phase in the presence of surface plasmon resonance (SPR) in the MP. The quantum formalism also serves as a powerful tool for studying the effects of these parameters on the nonclassical properties of the scattered photons. The plasmonic effect of nanoparticles has promising possibilities as it provides a new way for manipulating quantum optical properties of light in nanophotonic systems.
Relationship intention and satisfaction as predictors of wholesale ...
African Journals Online (AJOL)
Building long term relationships and satisfying customer expectations could be an ... between customer relationships, customer satisfaction and customer loyalty. ... marketing efforts only towards customers who have relationship intentions.
Fournier, Benoit; Brassard, Audrey; Shaver, Phillip R
2011-07-01
This study examines men's domestic aggression as a function of attachment insecurities, considering the mediating roles of the demand-withdraw communication pattern and relationship satisfaction. The sample included 55 Canadian men undergoing counseling for relationship difficulties including aggression. The men completed questionnaires assessing physical and psychological aggression, the two dimensions of attachment insecurity (anxiety over abandonment and avoidance of intimacy), the demand-withdraw communication pattern, relationship satisfaction, and social desirability (a control measure). As predicted, there was an association between attachment anxiety and aggression (both physical and psychological), which was mediated by the man demands/woman withdraws (MD/WW) pattern (as reported by the men). There was no evidence of mediation by the woman demands/man withdraws pattern, as reported by the men. Relationship satisfaction mediated the association between attachment anxiety and psychological (but not physical) aggression, but did not mediate the link between avoidance and aggression (physical or psychological). Limitations and clinical implications are discussed.
Packiavathy, Issac Abraham Sybiya Vasantha; Priya, Selvam; Pandian, Shunmugiah Karutha; Ravi, Arumugam Veera
2014-04-01
Urinary tract infection is caused primarily by the quorum sensing (QS)-dependent biofilm forming ability of uropathogens. In the present investigation, an anti-quorum sensing (anti-QS) agent curcumin from Curcuma longa (turmeric) was shown to inhibit the biofilm formation of uropathogens, such as Escherichia coli, Pseudomonas aeruginosa PAO1, Proteus mirabilis and Serratia marcescens, possibly by interfering with their QS systems. The antibiofilm potential of curcumin on uropathogens as well as its efficacy in disturbing the mature biofilms was examined under light microscope and confocal laser scanning microscope. The treatment with curcumin was also found to attenuate the QS-dependent factors, such as exopolysaccharide production, alginate production, swimming and swarming motility of uropathogens. Furthermore, it was documented that curcumin enhanced the susceptibility of a marker strain and uropathogens to conventional antibiotics. Copyright © 2012 Elsevier Ltd. All rights reserved.
Customer trust as mediator in the creation of customer relationship intention
Directory of Open Access Journals (Sweden)
Dimyati Mohamad
2018-03-01
Full Text Available As in all service industries, banks need to be able to provide their customers with personalized services in order to ensure that they build and maintain long-term relationships which are mutually beneficial. As such, banks must adopt a relational marketing approach based on effective communication and the building of trust with the current customers instead of focusing on acquiring new customers. The current research provides insights into how banks can build trust and maintain their relations with existing customers by testing several predictors of customer trust and customer relationship intention. Thus, the purpose of this study is to examine economic content, resource content and social content as the predictors of trust and relationship intention, and trust as a predictor of relationship intention. In addition, this study also analyzes the role of trust in mediating among economic content, resource content, and social content as a predictor of relationship intention of state owned bank customers in East Java. The sample of the study is formed of 120 customers of three state-owned banks from East Java. The research variables consist of three exogenous variables: economic content, resource content, and social content. The endogenous variables are trust and relationship intention. The data was collected using a questionnaire with multiple items measured using Likert scales. The model was analyzed using SEM with AMOS version 18.0. The result shows that economic content, resource content and social content are positive and significant predictors of trust and relationship intention. The role of economic content, resource content, social content as direct predictors is higher than the mediating role of trust of state owned bank customers.
CRM AS A SUPPORT FOR KNOWLEDGE MANAGEMENT AND CUSTOMER RELATIONSHIP
Silvana Toriani; Maria Terezinha Angeloni
2011-01-01
This paper aims to analyze the role of Customer Relationship Management (CRM) as a support for Knowledge Management (KM) and the Customer Relationship Strategy Definition in an Information Technology (IT) Company. This work is based on theories of KM, IT, and Relationship Marketing. Our survey uses a descriptive approach, in which data is gathered by means of content analysis of semi-structured interviews. The study results have shown us that the company implements an effective system for CRM...
Directory of Open Access Journals (Sweden)
Jennifer M. Smith
2007-12-01
Full Text Available Two adjacent regions within the transactivation domain of p53 are sufficient to support sequence-specific transactivation when fused to a heterologous DNA binding domain. It has been hypothesized that these two subdomains of p53 may contribute to the expression of distinct p53-responsive genes. Here we have used oligonucleotide microarrays to identify transcripts induced by variants of p53 with point mutations within subdomains 1, 2, or 1 and 2 (QS1, QS2, QS1/QS2, respectively. The expression of 254 transcripts was increased in response to wild-type p53 expression but most of these transcripts were poorly induced by these variants of p53. Strikingly, a number of known p53regulated transcripts including TNFRSF10B, BAX, BTG2, POLH were increased to wild-type levels by p53QS1 and p53QS2 but not p53QS1/QS2, indicating that either sub domain 1 or 2 is sufficient for p53-dependent expression of a small subset of p53-responsive genes. Unexpectedly, there was no evidence for p53QS1- or p53QS2-specific gene expression. Taken together, we found heterogeneity in the requirement for transactivation subdomains 1 and 2 of p53 without any subdomain-specific contribution to p53-induced gene expression.
Relationship between availability of contraceptive products and pharmacists as information sources.
Cook, Elizabeth A; Farris, Karen B; Chrischilles, Elizabeth; Aquilino, Mary
2012-01-01
To describe the relationship between the availability and accessibility of contraceptives in Iowa pharmacies and the extent to which pharmacists act as an information source regarding contraceptives. Descriptive, exploratory, nonexperimental study. Iowa in fall 2008. 282 pharmacists at Iowa community pharmacies. Cross-sectional survey. Contraceptive availability score, contraceptive accessibility score, and total access score. Regression analyses tested the relationships between the pharmacist information source score and the contraceptive availability, accessibility, and total access scores, controlling for geography, ownership, staff size, and average number of prescriptions per day. Significant positive relationships between the pharmacist information source score and product accessibility, product availability, and total access were observed. The relationship appeared to be driven primarily by product availability, and all were significantly influenced by pharmacy type. Significant negative relationships were found between product accessibility and independent/small chain pharmacies and mass merchandiser/grocery store pharmacies relative to large chain pharmacies. A significant negative relationship was found between independent/small chain pharmacies and the product availability score. Significant relationships were found between pharmacists' ability to act as sources of information for contraceptive products and the availability, accessibility, and overall access to contraceptives in the pharmacy.
Perspectives on Literacy as a Tool for Sustainable Social Relationship
Directory of Open Access Journals (Sweden)
Osalusi F. M.
2014-01-01
Full Text Available This study investigated perspectives on literacy as a tool for sustainable relationship among people. The study was conducted due to the significant role of literacy as an instrument of empowerment to improve relationship with other people by sharing information, ideas and knowledge to meet variety of purposes. The study adopted descriptive research design of the survey type. A sample of 1675 respondents that comprised of 1032 literates and 643 illiterates was selected through purposive and simple random sampling techniques from two local government areas of Ekiti state, Nigeria. An instrument tagged ‘Perception of Literacy for Social Relationship Questionnaire (PLHLSRQ’ was used to collect data from the respondents. The instrument was validated by experts and tested for reliability at 0.71 coefficients through test-re-test method. Data collected were statistically analysed using mean, standard deviation and student t-test at 0.05 level of significance. The result of the study showed a significant difference between literates and illiterates’ perspectives on literacy as a tool for sustainable social relationship. The study also revealed significant gender difference in perspectives on literacy for sustainable social relationship. Based on the findings, it was recommended among others that government should organise more awareness and sensitization programmes and seminars to purposefully attract illiterate commercial drivers and riders to literacy programmes.
Seismic Attenuation Tomography of the Rupture Zone of the 2010 Maule, Chile, Earthquake
Torpey, M. E.; Russo, R. M.; Panning, M. P.
2014-12-01
We used measurements of differential S to P seismic attenuation in the rupture zone of the 2010 Mw 8.8 Maule, Chile earthquake (33°S-38°S) to characterize the seismic attenuation structure of the South American crust and upper mantle wedge. We used data obtained from the IRIS CHAMP rapid-response temporary seismic network, filtered between 0.7-20 Hz. For events with large signal to noise ratios, we visually identified the P and S arrivals on the seismograms and used an evolving time window to determine 400 individual Qs and t* values and their uncertainties using a spectral ratio method. Using a phase pair method allows us to neglect the source-time function and instrument response of each P-S phase pair. Assuming a constant Qp/Qs ratio for a given P-S phase pair, we evaluated the 400 spectral ratios and discarded portions of the evolving time window that incorporate multipathed phases. We recalculated the Qs and standard deviation of the retained window and excluded measurements with standard deviations larger than half of the Qs value. We also excluded measurements that span frequency windows longer than 10 Hz as they contain noise that contaminates Qs measurements. We examined ~200 local events yielding a total of 1,076 path-integrated Qs measurements. Qs values are low (100-400) for the majority of ray paths evaluated, however we observe a spatial distribution of low path-integrated Qs values (100-300) in the northeastern portion of the rupture zone and higher values (300-600) in the southwest. We divided the rupture zone into cubes and implemented a bounded linear inequality least squares inversion (0<Qs<1200) to solve for Qs in individual model regions. We used a constant starting model of Qs=450 and solved for perturbations to the model using our observed δt* values and a radial-earth velocity model (IASPI91). Our ray coverage provides good resolution extending to depths of ~75 km in the mantle wedge.
Directory of Open Access Journals (Sweden)
Kyle L. Asfahl
2018-01-01
Full Text Available In the opportunistic pathogen Pseudomonas aeruginosa, quorum sensing (QS via acyl-homoserine lactone (AHL signals coordinates virulence gene expression. AHL signals must reach a critical threshold before enough is bound by cognate regulators LasR and RhlR to drive transcription of target genes. In addition, three anti-activator proteins, QteE, QscR, and QslA, sequester QS regulators to increase the threshold for induction and delay expression of QS target genes. It remains unclear how multiple anti-activators work together to achieve the quorum threshold. Here, we employed a combination of mutational, kinetic, phenotypic, and transcriptomic analysis to examine regulatory effects and interactions of the three distinct anti-activators. We observed combinatorial, additive effects on QS gene expression. As measured by reporter gene fusion, individual deletion of each anti-activator gene increased lasB expression and QS-controlled virulence factor production. Deletion of qslA in combination with the deletion of any other anti-activator gene resulted in the greatest increase and earliest activation of lasB gene expression. Western analysis revealed that relative increases in soluble LasR in anti-activator mutants correlate with increased lasB expression and QS-controlled virulence factor production. RNA-seq of the previously uncharacterized QslA and QteE regulons revealed overlapping, yet distinct groups of differentially expressed genes. Simultaneous inactivation of qteE and qslA had the largest effect on gene expression with 999 genes induced and 798 genes repressed in the double mutant vs. wild-type. We found that LasR and RhlR-activated QS genes formed a subset of the genes induced in the qteE, qslA, and double mutant. The activation of almost all of these QS genes was advanced from stationary phase to log phase in the qteE qslA double mutant. Taken together, our results identify additive effects of anti-activation on QS gene expression, likely
Regulation Involved in Colonization of Intercellular Spaces of Host Plants in Ralstonia solanacearum
Directory of Open Access Journals (Sweden)
Yasufumi Hikichi
2017-06-01
Full Text Available A soil-borne bacterium Ralstonia solanacearum invading plant roots first colonizes the intercellular spaces of the root, and eventually enters xylem vessels, where it replicates at high levels leading to wilting symptoms. After invasion into intercellular spaces, R. solanacearum strain OE1-1 attaches to host cells and expression of the hrp genes encoding components of the type III secretion system (T3SS. OE1-1 then constructs T3SS and secrets effectors into host cells, inducing expression of the host gene encoding phosphatidic acid phosphatase. This leads to suppressing plant innate immunity. Then, OE1-1 grows on host cells, inducing quorum sensing (QS. The QS contributes to regulation of OE1-1 colonization of intercellular spaces including mushroom-type biofilm formation on host cells, leading to its virulence. R. solanacearum strains AW1 and K60 produce methyl 3-hydroxypalmitate (3-OH PAME as a QS signal. The methyltransferase PhcB synthesizes 3-OH PAME. When 3-OH PAME reaches a threshold level, it increases the ability of the histidine kinase PhcS to phosphorylate the response regulator PhcR. This results in elevated levels of functional PhcA, the global virulence regulator. On the other hand, strains OE1-1 and GMI1000 produce methyl 3-hydroxymyristate (3-OH MAME as a QS signal. Among R. solanacearum strains, the deduced PhcB and PhcS amino acid sequences are related to the production of QS signals. R. solanacearum produces aryl-furanone secondary metabolites, ralfuranones, which are extracellularly secreted and required for its virulence, dependent on the QS. Interestingly, ralfuranones affect the QS feedback loop. Taken together, integrated signaling via ralfuranones influences the QS, contributing to pathogen virulence.
Almeida, Tânia; Menéndez, Esther; Capote, Tiago; Ribeiro, Teresa; Santos, Conceição; Gonçalves, Sónia
2013-01-15
The molecular processes associated with cork development in Quercus suber L. are poorly understood. A previous molecular approach identified a list of genes potentially important for cork formation and differentiation, providing a new basis for further molecular studies. This report is the first molecular characterization of one of these candidate genes, QsMYB1, coding for an R2R3-MYB transcription factor. The R2R3-MYB gene sub-family has been described as being involved in the phenylpropanoid and lignin pathways, both involved in cork biosynthesis. The results showed that the expression of QsMYB1 is putatively mediated by an alternative splicing (AS) mechanism that originates two different transcripts (QsMYB1.1 and QsMYB1.2), differing only in the 5'-untranslated region, due to retention of the first intron in one of the variants. Moreover, within the retained intron, a simple sequence repeat (SSR) was identified. The upstream regulatory region of QsMYB1 was extended by a genome walking approach, which allowed the identification of the putative gene promoter region. The relative expression pattern of QsMYB1 transcripts determined by reverse transcription quantitative polymerase chain reaction (RT-qPCR) revealed that both transcripts were up-regulated in cork tissues; the detected expression was several times higher in newly formed cork harvested from trees producing virgin, second or reproduction cork when compared with wood. Moreover, the expression analysis of QsMYB1 in several Q. suber organs showed very low expression in young branches and roots, whereas in leaves, immature acorns or male flowers, no expression was detected. These preliminary results suggest that QsMYB1 may be related to secondary growth and, in particular, with the cork biosynthesis process with a possible alternative splicing mechanism associated with its regulatory function. Copyright © 2012 Elsevier GmbH. All rights reserved.
One-stop shop assessment for atrial septal defect closure using 256-slice coronary CT angiography
Energy Technology Data Exchange (ETDEWEB)
Yamasaki, Yuzo; Kamitani, Takeshi; Sagiyama, Koji; Yamanouchi, Torahiko; Honda, Hiroshi [Kyushu University, Department of Clinical Radiology, Graduate School of Medical Sciences, 3-1-1 Maidashi, Higashi-ku, Fukuoka (Japan); Nagao, Michinobu; Kawanami, Satoshi [Kyushu University, Department of Molecular Imaging and Diagnosis, Graduate School of Medical Sciences, Fukuoka (Japan); Sakamoto, Ichiro [Kyushu University, Department of Cardiovascular Medicine, Graduate School of Medical Sciences, Fukuoka (Japan); Yamamura, Kenichiro [Kyushu University, Department of Pediatrics, Graduate School of Medical Sciences, Fukuoka (Japan); Yabuuchi, Hidetake [Kyushu University, Department of Health Sciences, Graduate School of Medical Sciences, Fukuoka (Japan)
2017-02-15
To investigate the feasibility and accuracy of measurement of the pulmonary to systemic blood flow ratio (Qp/Qs) and defect and rim sizes in secundum atrial septal defects (ASDs) using 256-slice CT, compared to the reference transoesophageal echocardiography (TEE) and right heart catheterization (RHC) measurements. Twenty-three consecutive adult patients with secundum ASDs who underwent retrospective ECG-gated coronary CT angiography (CCTA), TEE and RHC were enrolled in this study. Right ventricular (RV) and left ventricular (LV) stroke volumes (SV) were calculated by biventricular volumetry of CCTA. Qp/Qs-CT was defined as RVSV/LVSV. The sizes of the defect and rim were measured by multi-planar reconstruction CT images. Correlations between Qp/Qs-CT and Qp/Qs-RHC and between the defect diameter obtained by CT and TEE were analyzed by Pearson's coefficient analysis. Rim sizes by CT and TEE were compared by paired t-test. Qp/Qs-CT was significantly correlated with Qp/Qs-RHC (r = 0.83, p < 0.0001), and the defect diameter by CT was significantly correlated with that by TEE (r = 0.95, p < 0.0001). There was no significant difference between CT and TEE in measurements of rim size. 256-slice CCTA allows measuring Qp/Qs and size of defects and rims in patients with secundum ASDs, accomplishing pretreatment evaluation non-invasively and comprehensively. (orig.)
One-stop shop assessment for atrial septal defect closure using 256-slice coronary CT angiography
International Nuclear Information System (INIS)
Yamasaki, Yuzo; Kamitani, Takeshi; Sagiyama, Koji; Yamanouchi, Torahiko; Honda, Hiroshi; Nagao, Michinobu; Kawanami, Satoshi; Sakamoto, Ichiro; Yamamura, Kenichiro; Yabuuchi, Hidetake
2017-01-01
To investigate the feasibility and accuracy of measurement of the pulmonary to systemic blood flow ratio (Qp/Qs) and defect and rim sizes in secundum atrial septal defects (ASDs) using 256-slice CT, compared to the reference transoesophageal echocardiography (TEE) and right heart catheterization (RHC) measurements. Twenty-three consecutive adult patients with secundum ASDs who underwent retrospective ECG-gated coronary CT angiography (CCTA), TEE and RHC were enrolled in this study. Right ventricular (RV) and left ventricular (LV) stroke volumes (SV) were calculated by biventricular volumetry of CCTA. Qp/Qs-CT was defined as RVSV/LVSV. The sizes of the defect and rim were measured by multi-planar reconstruction CT images. Correlations between Qp/Qs-CT and Qp/Qs-RHC and between the defect diameter obtained by CT and TEE were analyzed by Pearson's coefficient analysis. Rim sizes by CT and TEE were compared by paired t-test. Qp/Qs-CT was significantly correlated with Qp/Qs-RHC (r = 0.83, p < 0.0001), and the defect diameter by CT was significantly correlated with that by TEE (r = 0.95, p < 0.0001). There was no significant difference between CT and TEE in measurements of rim size. 256-slice CCTA allows measuring Qp/Qs and size of defects and rims in patients with secundum ASDs, accomplishing pretreatment evaluation non-invasively and comprehensively. (orig.)
Directory of Open Access Journals (Sweden)
Joemar C. Taganna
2008-06-01
Full Text Available The problem on the widespread occurrence of antibiotic resistant strains of bacteria calls for novel methods of control of bacterial activity. One of the new viable alternatives to antibiotics is the use of substances that inhibit quorum sensing (QS – a bacterial communication system that has been known to regulate the expression of virulence genes during infection. In this study, epigallocatechin gallate (EGCG from green tea, Camellia sinensis L. (Kuntze was tested for its ability to inhibit QS in a test organism, Chromobacterium violaceum. This microorganism produces a violet-colored substance, violacein, through QS. This study aimed to detect inhibition of QS-regulated violacein production in C. violaceum by EGCG and to determine the dynamics of QS inhibition relative to the concentration of EGCG. The effect of increasing concentration of EGCG on both violacein production and cell density of treated and untreated C. violaceum was determined in a 96-well-microplate format and read at 570nm and 620nm for violacein production and growth, respectively. The results show that addition of EGCG increased the growth of the organism while there is concentration-dependent decrease in the QS-controlled production of violacein. This study thus establishes that EGCG is a potential QS inhibitor and can be further studied and developed for its use as an anti-pathogenic but non-toxic drug.
QStatin, a Selective Inhibitor of Quorum Sensing in Vibrio Species
Directory of Open Access Journals (Sweden)
Byoung Sik Kim
2018-01-01
Full Text Available Pathogenic Vibrio species cause diseases in diverse marine animals reared in aquaculture. Since their pathogenesis, persistence, and survival in marine environments are regulated by quorum sensing (QS, QS interference has attracted attention as a means to control these bacteria in aquatic settings. A few QS inhibitors of Vibrio species have been reported, but detailed molecular mechanisms are lacking. Here, we identified a novel, potent, and selective Vibrio QS inhibitor, named QStatin [1-(5-bromothiophene-2-sulfonyl-1H-pyrazole], which affects Vibrio harveyi LuxR homologues, the well-conserved master transcriptional regulators for QS in Vibrio species. Crystallographic and biochemical analyses showed that QStatin binds tightly to a putative ligand-binding pocket in SmcR, the LuxR homologue in V. vulnificus, and changes the flexibility of the protein, thereby altering its transcription regulatory activity. Transcriptome analysis revealed that QStatin results in SmcR dysfunction, affecting the expression of SmcR regulon required for virulence, motility/chemotaxis, and biofilm dynamics. Notably, QStatin attenuated representative QS-regulated phenotypes in various Vibrio species, including virulence against the brine shrimp (Artemia franciscana. Together, these results provide molecular insights into the mechanism of action of an effective, sustainable QS inhibitor that is less susceptible to resistance than other antimicrobial agents and useful in controlling the virulence of Vibrio species in aquacultures.
LIFE SKILLS ORIENTATION IN MADRASAH CURRICULUM
Directory of Open Access Journals (Sweden)
Ahmadi Ahmadi
2016-02-01
Full Text Available This article intends to elaborate a charge include life skills opportunities in both madrasah curriculum of ibtidaiyah, tsanawiyah and aliyah. The approach used is the science of Islamic education. Some important concepts in Islam that allows it to be analyzed and used as the basis of life skills-based curriculum contained in QS. Al-Ghâsyiyah [88]: 17-20, QS. Fâthir [35]: 39, QS. Al-Jâtsiyah [45]: 12-13, QS. Al-A‟râf [7]: 56-85 and QS. Al-Hujurât [49]: 1, 13, 18. Ethical values (Rasul Muhammad Islam that allows elaborating life skills is shiddiq, amanah, fathanah and tabligh. The fourth value is assumed to equip graduates of madrassas that he later had a number of personal, social, academic, vocational and soft. The fourth value is assumed to equip graduates of madrassas that he later had the skills. A number of core Islamic values should be in synergy with the age issues such as democracy, globalization, the mastery of science, technology and information (the environment.
CROWDSOURCING AS A CUSTOMER RELATIONSHIP BUILDING TOOL
Chwiałkowska, Agnieszka
2013-01-01
This article aims at introducing the idea of crowdsourcing and describing how businesses can use it in marketing and for building and maintaining strong positive relationships with their potential and current customers. It presents several case studies of its successful implementation by companies both in Poland and worldwide. Furthermore, the article describes possible benefits and pitfalls that businesses, which decide to introduce crowdsourcing, can face as well as motivations of people wh...
20 CFR 222.31 - Relationship as child for annuity and lump-sum payment purposes.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as child for annuity and lump... UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.31 Relationship as... the employee. For procedures on how a determination of the person's relationship to the employee is...
DEFF Research Database (Denmark)
Ellegaard, Karen; Terslev, Lene; Christensen, Robin
2014-01-01
images. The SRM, predictive validity and discriminative ability for both systems were calculated using DAS28 as the measure of disease improvement. RESULTS: Fourty-six patients with RA (80% females) were included. The mean Doppler activity at baseline was QS:24.4% (SD=17.7%) and SQS:2.0 (SD=0.......6). A decrease in Doppler activity was seen for both systems after anti-TNF-α therapy. Sensitivity to change was seen, SRM=-0.52 (95%CI; -0.83 to -0.21; QS) and -0.24 (-0.53 to -0.05; SQS). Predictive value was poor (QS rs=-0.24; SQS rs=-0.05). Construct validity was; QS: rs=0.29, SQS: rs=0.23. CONCLUSIONS: Both...
29 CFR 784.154 - Relationship to other operations as affecting exemption.
2010-07-01
... Exemptions Provisions Relating to Fishing and Aquatic Products Marketing, Storing, Packing for Shipment, and Distributing § 784.154 Relationship to other operations as affecting exemption. Employment in marketing... 29 Labor 3 2010-07-01 2010-07-01 false Relationship to other operations as affecting exemption...
Preclinical Evaluation of the Synthetic Adjuvant SQS-21 and its Constituent Isomeric Saponins
Ragupathi, Govind; Damani, Payal; Deng, Kai; Adams, Michelle M.; Hang, Jianfeng; George, Constantine; Livingston, Philip O.; Gin, David Y.
2010-01-01
The saponin fraction QS-21 from Quillaja saponaria has been demonstrated to be a potent immunological adjuvant when mixed with keyhole limpet hemocyanin conjugate vaccines, as well as with other classes of subunit antigen vaccines. QS-21 adjuvant is composed of two isomers that include the apiose and xylose forms in a ratio of 65:35, respectively. The chemical syntheses of these two isomers in pure form have recently been disclosed. Herein we describe detailed in vivo immunological evaluations of these synthetic QS-21 isomeric constituents, employing the GD3-KLH melanoma antigen. With this vaccine construct, high antibody titers against GD3 ganglioside and KLH were elicited when GD3-KLH was co-administered with adjuvant, either as the individual separate synthetic QS-21 isomers (SQS-21-Api or SQS-21-Xyl), or as its reconstituted 65:35 isomeric mixture (SQS-21). These antibody titer levels were comparable to that elicited by vaccinations employing naturally derived QS-21 (PQS-21). Moreover, toxicities of the synthetic saponin adjuvants were also found to be comparable to that of naturally derived PQS-21. These findings demonstrate unequivocally that the adjuvant activity of QS-21 resides in these two principal isomeric forms, and not in trace contaminants within the natural extracts. This lays the foundation for future exploration of structure-function correlations to enable the discovery of novel saponins with increased potency, enhanced stability, and attenuated toxicity. PMID:20450868
Srinivasan, Ramanathan; Devi, Kannan Rama; Kannappan, Arunachalam; Pandian, Shunmugiah Karutha; Ravi, Arumugam Veera
2016-12-04
Piper betle, a tropical creeper plant belongs to the family Piperaceae. The leaves of this plant have been well known for their therapeutic, religious and ceremonial value in South and Southeast Asia. It has also been reported to possess several biological activities including antimicrobial, antioxidant, antinociceptive, antidiabetic, insecticidal and gastroprotective activities and used as a common ingredient in indigenous medicines. In Indian system of ayurvedic medicine, P. betle has been well recognized for its antiseptic properties and is commonly applied on wounds and lesions for its healing effects. To evaluate the anti-quorum sensing (anti-QS) and antibiofilm efficacy of P. betle and its bioactive metabolite phytol against Serratia marcescens. The P. betle ethyl acetate extract (PBE) was evaluated for its anti-QS efficacy against S. marcescens by assessing the prodigiosin and lipase production at 400 and 500µgml -1 concentrations. In addition, the biofilm biomass quantification assay was performed to evaluate the antibiofilm activity of PBE against S. marcescens. Besides, the influence of PBE on bacterial biofilm formation was assessed through microscopic techniques. The biofilm related phenomenons like exopolysaccharides (EPS) production, hydrophobicity and swarming motility were also examined to support the antibiofilm activity of PBE. Transcriptional analysis of QS regulated genes in S. marcescens was also done. Characterization of PBE was done by separation through column chromatography and identification of active metabolites by gas chromatography -mass spectrometry. The major compounds of active fractions such as hexadecanoic acid, eugenol and phytol were assessed for their anti-QS activity against S. marcescens. Further, the in vitro bioassays such as protease, biofilm and HI quantification were also carried out to confirm the anti-QS and antibiofilm potential of phytol in PBE. PBE inhibits QS mediated prodigiosin pigment production in S. marcescens
Chemostat cultivation as a tool for studies on sugar transport in yeasts
Weusthuis, R.A.; Pronk, J.T.; Broek, van den P.J.A.
1994-01-01
Chemostat cultivation enables investigations into the effects of individual environmental parameters on sugar transport in yeasts. Various means are available to manipulate the specific rate of sugar uptake (q(s)) in sugar-limited chemostat cultures. A straightforward way to manipulate q, is
Fournier, Benoit; Brassard, Audrey; Shaver, Phillip R.
2011-01-01
This study examines men's domestic aggression as a function of attachment insecurities, considering the mediating roles of the demand-withdraw communication pattern and relationship satisfaction. The sample included 55 Canadian men undergoing counseling for relationship difficulties including aggression. The men completed questionnaires assessing…
Directory of Open Access Journals (Sweden)
Huiming Tang
2018-03-01
Full Text Available Quorum sensing (QS regulates the behavior of bacterial populations and promotes their adaptation and survival under stress. As QS is responsible for the virulence of vast majority of bacteria, quorum quenching (QQ, the interruption of QS, has become an attractive therapeutic strategy. However, the role of QS in stress tolerance and the efficiency of QQ under stress in bacteria are seldom explored. In this study, we demonstrated that QS-regulated catalase (CAT expression and biofilm formation help Pseudomonas aeruginosa PAO1 resist nicotine stress. CAT activity and biofilm formation in wild type (WT and ΔrhlR strains are significantly higher than those in the ΔlasR strain. Supplementation of ΔlasI strain with 3OC12-HSL showed similar CAT activity and biofilm formation as those of the WT strain. LasIR circuit rather than RhlIR circuit is vital to nicotine tolerance. Acylase I significantly decreased the production of virulence factors, namely elastase, pyocyanin, and pyoverdine under nicotine stress compared to the levels observed in the absence of nicotine stress. Thus, QQ is more efficient under stress. To our knowledge, this is the first study to report that QS contributes to nicotine tolerance in P. aeruginosa. This work facilitates a better application of QQ for the treatment of bacterial infections, especially under stress.
Tang, Huiming; Zhang, Yunyun; Ma, Yifan; Tang, Mengmeng; Shen, Dongsheng; Wang, Meizhen
2018-01-01
Quorum sensing (QS) regulates the behavior of bacterial populations and promotes their adaptation and survival under stress. As QS is responsible for the virulence of vast majority of bacteria, quorum quenching (QQ), the interruption of QS, has become an attractive therapeutic strategy. However, the role of QS in stress tolerance and the efficiency of QQ under stress in bacteria are seldom explored. In this study, we demonstrated that QS-regulated catalase (CAT) expression and biofilm formation help Pseudomonas aeruginosa PAO1 resist nicotine stress. CAT activity and biofilm formation in wild type (WT) and Δ rhlR strains are significantly higher than those in the Δ lasR strain. Supplementation of Δ lasI strain with 3OC12-HSL showed similar CAT activity and biofilm formation as those of the WT strain. LasIR circuit rather than RhlIR circuit is vital to nicotine tolerance. Acylase I significantly decreased the production of virulence factors, namely elastase, pyocyanin, and pyoverdine under nicotine stress compared to the levels observed in the absence of nicotine stress. Thus, QQ is more efficient under stress. To our knowledge, this is the first study to report that QS contributes to nicotine tolerance in P. aeruginosa . This work facilitates a better application of QQ for the treatment of bacterial infections, especially under stress.
Directory of Open Access Journals (Sweden)
Simona Zgaga
2013-02-01
Full Text Available Relationship termination happens relatively often in emerging adulthood but is nevertheless as distressing then as it is later in life. We examined the relationship between coping strategies and posttraumatic growth in a sample of 260 emerging adults whose heterosexual romantic relationships were terminated at most two years before participating in the study. Participants completed The Posttraumatic Growth Inventory, The COPE Inventory and Emotion Approach Coping scale. For the purposes of the study we also conceptualized a new coping inventory, related specifically to coping with relationship termination. While controlling for gender and age the coping strategies explained 34 % of variability in posttraumatic growth. Statistically significant predictors of posttraumatic growth were problem-oriented coping strategies, coping strategies, oriented towards emotions and other people, acceptance and positive self-motivation as well as coping strategies that allow some distancing from the stressor. Results indicate that posttraumatic growth is related to problem-oriented and also to emotion-oriented coping strategies, which is reasonable since relationship termination is a stressor that cannot be eliminated. It is important that an individual who is facing it can cope well with the unpleasant emotions deriving from relationship termination.
Directory of Open Access Journals (Sweden)
Jailton Lobo da Costa Lima
2018-03-01
Full Text Available Introduction: Biofilm production is an important mechanism for the survival of Pseudomonas aeruginosa and its relationship with antimicrobial resistance represents a challenge for patient therapeutics. P. aeruginosa is an opportunistic pathogen frequently associated to nosocomial infections, especially in imunocompromised hosts. Objectives: Analyze the phenotypic biofilm production in P. aeruginosa isolates, describe clonal profiles, and analyze quorum sensing (QS genes and the occurrence of mutations in the LasR protein of non-biofilm producing isolates. Methods: Isolates were tested for biofilm production by measuring cells adherence to the microtiter plates. Clonal profile analysis was carried out through ERIC-PCR, QS genes were by specific PCR. Results: The results showed that 77.5% of the isolates were considered biofilm producers. The results of genotyping showed 38 distinct genetic profiles. As for the occurrence of the genes, 100% of the isolates presented the lasR, rhlI and rhlR genes, and 97.5%, presented the lasI gene. In this study nine isolates were not biofilm producers. However, all presented the QS genes. Amplicons related to genes were sequenced in three of the nine non-biofilm-producing isolates (all presenting different genetic similarity profile and aligned to the sequences of those genes in P. aeruginosa strain PAO1 (standard biofilm-producing strain. Alignment analysis showed an insertion of three nucleotides (T, C and G causing the addition of an amino acid valine in the sequence of the LasR protein, in position 53. Conclusion: The modeling of the resulting LasR protein showed a conformational change in its structure, suggesting that this might be the reason why these isolates are unable to produce biofilm. Keywords: Pseudomonas aeruginosa, Biofilm, Multiresistance, Quorum sensing (QS
CRM AS A SUPPORT FOR KNOWLEDGE MANAGEMENT AND CUSTOMER RELATIONSHIP
Directory of Open Access Journals (Sweden)
Silvana Toriani
2011-05-01
Full Text Available This paper aims to analyze the role of Customer Relationship Management (CRM as a support for Knowledge Management (KM and the Customer Relationship Strategy Definition in an Information Technology (IT Company. This work is based on theories of KM, IT, and Relationship Marketing. Our survey uses a descriptive approach, in which data is gathered by means of content analysis of semi-structured interviews. The study results have shown us that the company implements an effective system for CRM, in which the system users transform data into information and knowledge in order to support decision-making and strategy definition.
Post-secretional activation of Protease IV by quorum sensing in Pseudomonas aeruginosa.
Oh, Jungmin; Li, Xi-Hui; Kim, Soo-Kyong; Lee, Joon-Hee
2017-06-30
Protease IV (PIV), a key virulence factor of Pseudomonas aeruginosa is a secreted lysyl-endopeptidase whose expression is induced by quorum sensing (QS). We found that PIV expressed in QS mutant has severe reduction of activity in culture supernatant (CS), even though it is overexpressed to high level. PIV purified from the QS mutant (M-PIV) had much lower activity than the PIV purified from wild type (P-PIV). We found that the propeptide cleaved from prepro-PIV was co-purified with M-PIV, but never with P-PIV. Since the activity of M-PIV was restored by adding the CS of QS-positive and PIV-deficient strain, we hypothesized that the propeptide binds to and inhibits PIV, and is degraded to activate PIV by a QS-dependent factor. In fact, the CS of the QS-positive and PIV-deficient strain was able to degrade the propeptide. Since the responsible factor should be a QS-dependently expressed extracellular protease, we tested QS-dependent proteases of P. aeruginosa and found that LasB (elastase) can degrade the propeptide and activate M-PIV. We purified the propeptide of PIV and confirmed that the propeptide can bind to and inhibit PIV. We suggest that PIV is post-secretionally activated through the extracellular degradation of the propeptide by LasB, a QS-dependent protease.
Myers, Scott A.
2017-01-01
In this brief forum article, the author suggests studying the instructor-student relationship as a superior-subordinate relationship offers an alternative way to view how student learning occurs in the college classroom, and can provide instructional communication researchers with the opportunity to explore how structural and institutional…
Music exposure and maturation of late preterm sleep-wake cycles: a randomised crossover trial.
Stokes, Adia; Agthe, Alexander G; El Metwally, Dina
2018-04-01
To determine the effect of music on sleep-wake cycle (SWC) patterns in late preterm neonates. In a masked crossover study, infants between 32 and 36 6/7 weeks gestation were randomised to music exposure either during the first six or last six hours of a 12-hour observation period. SWC characteristics were determined by continuous amplitude-integrated electroencephalography (aEEG) read by two coders masked to exposure sequence. Analysis was performed in paired comparisons. ANOVA was used to assess the effects of music exposure, period and crossover on SWC outcomes: (i) Burdjalov Scores (BS) during active sleep (AS) (ii) per cent and duration of quiet sleep (QS). Thirty infants were studied. A total of 222 QS cycles (median seven per patient; range five to 12) were analysed. Music exposure was associated with higher BS (F = 10.60, p = 0.0019) in AS and decreased interruptions during QS. The advanced postconceptual age (PCA) SWC pattern during AS was equivalent to a one-week mean. Number, duration and ratio of QS cycles did not change with music exposure. Music exposure elicits an increasing PCA pattern in AS and fewer interruptions in QS. Music may benefit sleep in late preterm infants. ©2017 Foundation Acta Paediatrica. Published by John Wiley & Sons Ltd.
Cognitions as mediators in the relationship between self-compassion and affect
Arimitsu, Kohki; Hofmann, Stefan G.
2015-01-01
Previous studies suggest that self-compassion is related to numerous facets of mental health, but the role of cognitions in this relationship remains unknown. To examine the mediating role of cognitions in the relationship between self-compassion and anxiety, depression, and life satisfaction when controlling for self-esteem in Japanese people, we conducted two studies. Study 1 (N = 231) examined the relationship between self-compassion and affect by modeling negative automatic thoughts as a ...
Cognitions as mediators in the relationship between self-compassion and affect
Arimitsu, Kohki; Hofmann, Stefan G.
2014-01-01
Previous studies suggest that self-compassion is related to numerous facets of mental health, but the role of cognitions in this relationship remains unknown. To examine the mediating role of cognitions in the relationship between self-compassion and anxiety, depression, and life satisfaction when controlling for self-esteem in Japanese people, we conducted two studies. Study 1 (N = 231) examined the relationship between self-compassion and affect by modeling negative automatic thoughts as a mediator; Study 2 (N = 233) tested whether positive and negative automatic thoughts meditate this relationship. Results suggested that both self-compassion and self-esteem increased positive automatic thoughts and decreased trait anxiety, whereas only self-esteem increased life satisfaction and decreased depression directly. Positive automatic thoughts increased life satisfaction and decreased depression and trait anxiety, and positive automatic thoughts mediated the relationship between self-compassion and negative affect. These findings suggest that both positive and negative automatic thoughts mediate the relationship between self-compassion and affect in Japanese people. PMID:25395717
Interference of quorum sensing in urinary pathogen Serratia marcescens by Anethum graveolens.
Salini, Ramesh; Pandian, Shunmugiah Karutha
2015-08-01
Serratia marcescens is an opportunistic turned obligate pathogen frequently associated with urinary tract infections (UTI) and are multidrug resistant at most instances. Quorum sensing (QS) system, a population-dependent global regulatory system, controls the pathogenesis machinery of S. marcescens as it does in other pathogens. In the present study, methanol extract of a common herb and spice, Anethum graveolens (AGME) was assessed for its anti-QS potential against the clinical isolate of S. marcescens. AGME notably reduced the biofilm formation and QS-dependent virulence factors production in a concentration-dependent manner (64-1024 μg mL(-1)). The light and confocal microscopic images clearly evidenced the antibiofilm activity of AGME (256 μg mL(-1)) at its minimal biofilm inhibitory concentration. Besides, in support of biochemical assays, the expression analysis of QS-regulated genes fimC, bsmA and flhD which are crucial for initial adhesion and motility confirmed their downregulation upon exposure to AGME. LC-MS analysis of AGME revealed 3-O-methyl ellagic acid (3-O-ME) as one of its active principles having nearly similar antibiofilm activity and a reduced inhibition of prodigiosin (27%) and protease (15%) compared to AGME [prodigiosin (47%) and protease (50%)]. UFLC analysis revealed that 0.355 mg g(-1) of 3-O-ME was present in the AGME. AGME and the 3-O-ME significantly interfered the QS system of a QS model strain S. marcescens MG1 and its mutant S. marcescens MG44 which in turn corroborates the anti-QS mechanism of AGME. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Shuyang Sun
Full Text Available Protozoan grazing is a major mortality factor faced by bacteria in the environment. Vibrio cholerae, the causative agent of the disease cholera, is a natural inhabitant of aquatic ecosystems, and its survival depends on its ability to respond to stresses, such as predation by heterotrophic protists. Previous results show that grazing pressure induces biofilm formation and enhances a smooth to rugose morphotypic shift, due to increased expression of Vibrio polysaccharide (VPS. In addition to negatively controlling vps genes, the global quorum sensing (QS regulator, HapR, plays a role in grazing resistance as the ΔhapR strain is efficiently consumed while the wild type (WT is not. Here, the relative and combined contributions of VPS and QS to grazing resistance were investigated by exposing VPS and HapR mutants and double mutants in VPS and HapR encoding genes at different phases of biofilm development to amoeboid and flagellate grazers. Data show that the WT biofilms were grazing resistant, the VPS mutants were less resistant than the WT strain, but more resistant than the QS mutant strain, and that QS contributes to grazing resistance mainly in mature biofilms. In addition, grazing effects on biofilms of mixed WT and QS mutant strains were investigated. The competitive fitness of each strain in mixed biofilms was determined by CFU and microscopy. Data show that protozoa selectively grazed the QS mutant in mixed biofilms, resulting in changes in the composition of the mixed community. A small proportion of QS mutant cells which comprised 4% of the mixed biofilm biovolume were embedded in grazing resistant WT microcolonies and shielded from predation, indicating the existence of associational protection in mixed biofilms.
Environmental Attitude as a Mediator of the Relationship between ...
African Journals Online (AJOL)
Environmental Attitude as a Mediator of the Relationship between Self-concept, Environmental Self-Efficacy and Responsible Environmental Behaviour among Residents of High Density Areas in Ibadan Metropolis, Nigeria.
Why Quorum Sensing Controls Private Goods
Directory of Open Access Journals (Sweden)
Martin Schuster
2017-05-01
Full Text Available Cell-cell communication, also termed quorum sensing (QS, is a widespread process that coordinates gene expression in bacterial populations. The generally accepted view is that QS optimizes the cell density-dependent benefit attained from cooperative behaviors, often in the form of secreted products referred to as “public goods.” This view is challenged by an increasing number of cell-associated products or “private goods” reported to be under QS-control for which a collective benefit is not apparent. A prominent example is nucleoside hydrolase from Pseudomonas aeruginosa, a periplasmic enzyme that catabolizes adenosine. Several recent studies have shown that private goods can function to stabilize cooperation by co-regulated public goods, seemingly explaining their control by QS. Here we argue that this property is a by-product of selection for other benefits rather than an adaptation. Emphasizing ecophysiological context, we propose alternative explanations for the QS control of private goods. We suggest that the benefit attained from private goods is associated with high cell density, either because a relevant ecological condition correlates with density, or because the private good is, directly or indirectly, involved in cooperative behavior. Our analysis helps guide a systems approach to QS, with implications for antivirulence drug design and synthetic biology.
Corporate Relationship Management as a Driver of Socially Responsible Behavior
Juul Andersen, Torben
2011-01-01
How was CSR effectuated by Scandinavian management; does CSR make a difference/corporate relationship management drove CSR, as corporations grow and internationalize the need for CSR increases, there has been a shift towards in CSR requirements over the past decade/CSR can extend the scope of corporate risk management, corporate relationship management is good risk management, CSR can pay off in the long run.
Directory of Open Access Journals (Sweden)
Muhamad Nizar
2014-12-01
Full Text Available Indonesia Quality Standard (QS for ambient SO2 for 1 hour time average i.e. 900 μg/m3(equivalent to 360μg/m3in24 hour time average regulated in the Government Regulation No. 41 of 1999 is the most loose compared to the ambient SO2 standards of other countries in the world including WHO QS guideline. This QS is not expected to guarantee the protection of public health in Indonesia. Therefore more stringent QS alternative for ambient SO2 is required. This research examines benefit values in public health aspect if Indonesia tightens its ambient SO2 QS. Two alternative QS for SO2 are used i.e196 μg/m3(equivalent to 78μg/m3in24 hour time average referring to U.S. EPA and 750μg/m3(equivalent to 360μg/m3in24 hour time average referring to PUSARPEDAL. First step is to map distribution of SO2 ambient concentrations in Indonesia. The result indicates that Provinces of Jakarta and Banten have exceeded both alternative QS while Provinces of Yogyakarta, West Java, Central Java, East Java, Bali, and North Sumatra only exceed the alternative QS of 196μg/m3. From the public health aspect, by attaining to the alternative QS of 750μg/m3, Jakarta and Banten will reduce incidence of ARI by 95% and 98%. By attaining to the alternative QS of 196μg/m3, East Java, Bali and North Sumatra will reduce the incidence of ARI by 59%, 51%, and 5%.
Ferreira, C R C; Magalhaes, D R B; Lippes, J
2006-04-01
Using sonography, the bicornate and septate uterus as causes of failure of quinacrine sterilization (QS) are explored. Whether QS can be effectively performed on women with a bicornate or septate uterus is a question answered by a presentation of three such cases. Three cases presented were part of a prospective nonrandomized study of QS in 205 women requesting sterilization at the Family Planning Clinic, School of Medicine of the Federal University of Minas Gerais, Belo Horizonte, Brazil. Sonography was performed on all patients before, during and after QS. Quinacrine was packaged as seven pellets in a modified Copper-T IUD inserter (Sipharm, Sisseln, Switzerland). Each woman received the first transcervical insertion of 252 mg of quinacrine during the follicular phase of the menstrual cycle, usually immediately after menses. One month later, a second insertion was similarly performed. Patients were advised to use an alternate method of birth control for 12 weeks to allow time for scarring of the oviducts. A blood pregnancy test was done before the QS procedure. The diagnosis of a septate or bicornuate uterus was made by sonography in three of the 205 patients in the study. It was obvious that quinacrine had to be inserted into the two horns of such an anomalous uterus if the dissolved drug was to enter both fallopian tubes. Quinacrine dissolved into "lakes of quinacrine," and sonographically could be seen at the top of the uterine fundus. For this clinical trial of 205 patients, there were 546 woman-years of follow-up, and the Pearl index was 0.73 per 100 woman-years (95% confidence limits: 0.02, 1.4). The bicornate or septate uterus can be a cause of failure of QS if undetected. Advantages of sonography prior to, during and after QS are apparent in the three patients with septate uteri. Sonography is advantageous when performing QS by demonstrating an anomaly of the uterus, which required separate insertions of quinacrine into each horn of a septate uterus and
Heterogeneity in quorum sensing-regulated bioluminescence of Vibrio harveyi.
Anetzberger, Claudia; Pirch, Torsten; Jung, Kirsten
2009-07-01
Quorum sensing (QS) refers to the ability of bacterial populations to read out the local environment for cell density and to collectively activate gene expression. Vibrio harveyi, one of the best characterized model organisms in QS, was used to address the question how single cells behave within a QS-activated community in a homogeneous environment. Analysis of the QS-regulated bioluminescence of a wild type strain revealed that even at high cell densities only 69% of the cells of the population produced bioluminescence, 25% remained dark and 6% were dead. Moreover, light intensities greatly varied from cell to cell at high population density. Addition of autoinducer to a bright liquid culture of V. harveyi increased the percentage of luminescent cells up to 98%, suggesting that V. harveyi produces and/or keeps the autoinducers at non-saturating concentrations. In contrast, all living cells of a constitutive QS-active mutant (DeltaluxO) produced light. We also found that QS affects biofilm formation in V. harveyi. Our data provide first evidence that a heterogeneous population produces more biofilm than a homogeneous one. It is suggested that even a QS-committed population of V. harveyi takes advantage of heterogeneity, which extends the current view of QS-regulated uniformity.
Directory of Open Access Journals (Sweden)
Iqbal Ahmad
2017-04-01
Full Text Available Quorum sensing (QS is a global gene regulatory mechanism in bacteria for various traits including virulence factors. Disabling QS system with anti-infective agent is considered as a potential strategy to prevent bacterial infection. Mangifera indica L. (mango has been shown to possess various biological activities including anti-QS. This study investigates the efficacy of leaf extracts on QS-regulated virulence factors and biofilm formation in Gram negative pathogens. Mango leaf (ML extract was tested for QS inhibition and QS-regulated virulence factors using various indicator strains. It was further correlated with the biofilm inhibition and confirmed by electron microscopy. Phytochemical analysis was carried out using ultra performance liquid chromatography (UPLC and gas chromatography–mass spectrometry (GC-MS analysis. In vitro evaluation of anti-QS activity of ML extracts against Chromobacterium violaceum revealed promising dose-dependent interference in violacein production, by methanol extract. QS inhibitory activity is also demonstrated by reduction in elastase (76%, total protease (56%, pyocyanin (89%, chitinase (55%, exopolysaccharide production (58% and swarming motility (74% in Pseudomonas aeruginosa PAO1 at 800 μg/ml concentration. Biofilm formation by P. aeruginosa PAO1 and Aeromonas hydrophila WAF38 was reduced considerably (36–82% over control. The inhibition of biofilm was also observed by scanning electron microscopy. Moreover, ML extracts significantly reduced mortality of Caenorhabditis elegans pre-infected with PAO1 at the tested concentration. Phytochemical analysis of active extracts revealed very high content of phenolics in methanol extract and a total of 14 compounds were detected by GC-MS and UPLC. These findings suggest that phytochemicals from the ML could provide bioactive anti-infective and needs further investigation to isolate and uncover their therapeutic efficacy.
Husain, Fohad M.; Ahmad, Iqbal; Al-thubiani, Abdullah S.; Abulreesh, Hussein H.; AlHazza, Ibrahim M.; Aqil, Farrukh
2017-01-01
Quorum sensing (QS) is a global gene regulatory mechanism in bacteria for various traits including virulence factors. Disabling QS system with anti-infective agent is considered as a potential strategy to prevent bacterial infection. Mangifera indica L. (mango) has been shown to possess various biological activities including anti-QS. This study investigates the efficacy of leaf extracts on QS-regulated virulence factors and biofilm formation in Gram negative pathogens. Mango leaf (ML) extract was tested for QS inhibition and QS-regulated virulence factors using various indicator strains. It was further correlated with the biofilm inhibition and confirmed by electron microscopy. Phytochemical analysis was carried out using ultra performance liquid chromatography (UPLC) and gas chromatography–mass spectrometry (GC-MS) analysis. In vitro evaluation of anti-QS activity of ML extracts against Chromobacterium violaceum revealed promising dose-dependent interference in violacein production, by methanol extract. QS inhibitory activity is also demonstrated by reduction in elastase (76%), total protease (56%), pyocyanin (89%), chitinase (55%), exopolysaccharide production (58%) and swarming motility (74%) in Pseudomonas aeruginosa PAO1 at 800 μg/ml concentration. Biofilm formation by P. aeruginosa PAO1 and Aeromonas hydrophila WAF38 was reduced considerably (36–82%) over control. The inhibition of biofilm was also observed by scanning electron microscopy. Moreover, ML extracts significantly reduced mortality of Caenorhabditis elegans pre-infected with PAO1 at the tested concentration. Phytochemical analysis of active extracts revealed very high content of phenolics in methanol extract and a total of 14 compounds were detected by GC-MS and UPLC. These findings suggest that phytochemicals from the ML could provide bioactive anti-infective and needs further investigation to isolate and uncover their therapeutic efficacy. PMID:28484444
Quorum sensing antagonism from marine organisms
DEFF Research Database (Denmark)
Skindersø, Mette Elena; Ettinger-Epstein, P.; Rasmussen, Thomas Bovbjerg
2008-01-01
target for the control of infectious bacteria. We present the results of screening of 284 extracts of marine organisms from the Great Barrier Reef, Australia, for their inhibition of QS. Of the 284 extracts, 64 (23%) were active in a general, LuxR-derived QS screen, and of these 36 (56%) were also active...... in a specific Pseudomonas aeruginosa QS screen. Extracts of the marine sponge Luffariella variabilis proved active in both systems. The secondary metabolites manoalide, manoalide monoacetate, and secomanoalide isolated from the sponge showed strong QS inhibition of a lasB::gfp(ASV) fusion, demonstrating...... the potential for further identification of specific QS antagonists from marine organisms....
Yusufaly, Tahir I.; Boedicker, James Q.
2017-08-01
Microbial communities frequently communicate via quorum sensing (QS), where cells produce, secrete, and respond to a threshold level of an autoinducer (AI) molecule, thereby modulating gene expression. However, the biology of QS remains incompletely understood in heterogeneous communities, where variant bacterial strains possess distinct QS systems that produce chemically unique AIs. AI molecules bind to ‘cognate’ receptors, but also to ‘non-cognate’ receptors found in other strains, resulting in inter-strain crosstalk. Understanding these interactions is a prerequisite for deciphering the consequences of crosstalk in real ecosystems, where multiple AIs are regularly present in the same environment. As a step towards this goal, we map crosstalk in a heterogeneous community of variant QS strains onto an artificial neural network model. This formulation allows us to systematically analyze how crosstalk regulates the community’s capacity for flexible decision making, as quantified by the Boltzmann entropy of all QS gene expression states of the system. In a mean-field limit of complete cross-inhibition between variant strains, the model is exactly solvable, allowing for an analytical formula for the number of variants that maximize capacity as a function of signal kinetics and activation parameters. An analysis of previous experimental results on the Staphylococcus aureus two-component Agr system indicates that the observed combination of variant numbers, gene expression rates and threshold concentrations lies near this critical regime of parameter space where capacity peaks. The results are suggestive of a potential evolutionary driving force for diversification in certain QS systems.
Thermal Comfort at the Street Corridor Around Public Places, Case Study Alun-Alun Malang City
Winansih, Erna; Antariksa, Antariksa; Surjono, Surjono; Leksono, Amin Setyo
2015-01-01
Malang as the second largest city in East Java province become crowded recently. The congestion almost happens everyday. The scenery of the street corridor is full of iron stacks. It is said that Malang city is less comfortable and less walkable. The decrease of this environment encourages to conduct the study (Q.S. 16:90, Q.S. 96:1-5, Q.S. 30:41). The study aimed to analyze the thermal comfort at pedestrian ways around Malang city squares, the street corridor of Merdeka Alun-Alun (MAA) and t...
The Rise Of BIM in Malaysia And Its Impact Towards Quantity Surveying Practices
Zainon Nurshuhada; Mohd-Rahim Faizul Azli; Salleh Hafez
2016-01-01
Building Information Modeling (BIM) is a new buzzword that is gaining a momentum within the construction industry in Malaysia, and worldwide. BIM is a way of working that involves the automation of the entire project team using a 4D model that can do many of the traditional fuctions of a Quatity Surveyor (QS). As BIM is removing more of the traditional work of QS, there are rising fears that it could threaten the viability of the QS professions especially for small firms that still rely on pr...
Software Tools for Emittance Measurement and Matching for 12 GeV CEBAF
Energy Technology Data Exchange (ETDEWEB)
Turner, Dennis L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States)
2016-05-01
This paper discusses model-driven setup of the Continuous Electron Beam Accelerator Facility (CEBAF) for the 12GeV era, focusing on qsUtility. qsUtility is a set of software tools created to perform emittance measurements, analyze those measurements, and compute optics corrections based upon the measurements.qsUtility was developed as a toolset to facilitate reducing machine configuration time and reproducibility by way of an accurate accelerator model, and to provide Operations staff with tools to measure and correct machine optics with little or no assistance from optics experts.
A novel compound to maintain a healthy oral plaque ecology in vitro
Janus, M.M.; Crielaard, W.; Zaura, E.; Keijser, B.J.; Brandt, B.W.; Krom, B.P.
2016-01-01
Objective: Dental caries is caused by prolonged episodes of low pH due to acid production by oral biofilms. Bacteria within such biofilms communicate via quorum sensing (QS). QS regulates several phenotypic biofilm parameters, such as biofilm formation and the production of virulence factors. In
Kasper, Stephen H; Bonocora, Richard P; Wade, Joseph T; Musah, Rabi Ann; Cady, Nathaniel C
2016-04-15
The opportunistic pathogen Pseudomonas aeruginosa utilizes multiple quorum sensing (QS) pathways to coordinate an arsenal of virulence factors. We previously identified several cysteine-based compounds inspired by natural products from the plant Petiveria alliacea which are capable of antagonizing multiple QS circuits as well as reducing P. aeruginosa biofilm formation. To understand the global effects of such compounds on virulence factor production and elucidate their mechanism of action, RNA-seq transcriptomic analysis was performed on P. aeruginosa PAO1 exposed to S-phenyl-l-cysteine sulfoxide, the most potent inhibitor from the prior study. Exposure to this inhibitor down-regulated expression of several QS-regulated virulence operons (e.g., phenazine biosynthesis, type VI secretion systems). Interestingly, many genes that were differentially regulated pertain to the related metabolic pathways that yield precursors of pyochelin, tricarboxylic acid cycle intermediates, phenazines, and Pseudomonas quinolone signal (PQS). Activation of the MexT-regulon was also indicated, including the multidrug efflux pump encoded by mexEF-oprN, which has previously been shown to inhibit QS and pathogenicity. Deeper investigation of the metabolites involved in these systems revealed that S-phenyl-l-cysteine sulfoxide has structural similarity to kynurenine, a precursor of anthranilate, which is critical for P. aeruginosa virulence. By supplementing exogenous anthranilate, the QS-inhibitory effect was reversed. Finally, it was shown that S-phenyl-l-cysteine sulfoxide competitively inhibits P. aeruginosa kynureninase (KynU) activity in vitro and reduces PQS production in vivo. The kynurenine pathway has been implicated in P. aeruginosa QS and virulence factor expression; however, this is the first study to show that targeted inhibition of KynU affects P. aeruginosa gene expression and QS, suggesting a potential antivirulence strategy.
International Nuclear Information System (INIS)
Ashry, Kh.M.
2005-01-01
Normal intrauterine growth and development is dependent on many factors of which hormonal factors have been implicated. The aim of the present work was to study the relationship of neonatal leptin and insulin to birth weight and gender difference as well as their relationship to maternal levels. Serum leptin level was assessed by competitive enzyme immunoassay and insulin level by radioimmunoassay in the cord blood of sixty neonates and the venous blood of their mothers. The neonates were classified according to their birth weight into: 23 appropriate for gestational age (AGA) (12 females and 11 males); 20 large for gestational age (LGA) (11 females and 9 males) and 17 small for gestational age (SGA) (9 femals and 8 males). Our results revealed a highly significant increase in maternal serum levels of leptin and insulin (24.1±11.8 ng/ml and 22.3±5.8 μ U/ml, respectively) when compared to neonatal levels (10.0 ± 7.4ng/ml and 7.4±4.3 μ U/ml, p<0.001, respectively). Cord blood leptin and insulin levels showed statistically significant differences between all weight classes with the highest levels in LGA neonates
DEFF Research Database (Denmark)
Christensen, Louise; van Gennip, Maria; Jakobsen, Tim H
2012-01-01
Quorum sensing (QS)-deficient Pseudomonas aeruginosa biofilms formed in vitro are more susceptible to tobramycin than QS-proficient P. aeruginosa biofilms, and combination treatment with a QS inhibitor (QSI) and tobramycin shows synergistic effects on the killing of in vitro biofilms. We extended...
The doctor-patient relationship as a toolkit for uncertain clinical decisions.
Diamond-Brown, Lauren
2016-06-01
Medical uncertainty is a well-recognized problem in healthcare, yet how doctors make decisions in the face of uncertainty remains to be understood. This article draws on interdisciplinary literature on uncertainty and physician decision-making to examine a specific physician response to uncertainty: using the doctor-patient relationship as a toolkit. Additionally, I ask what happens to this process when the doctor-patient relationship becomes fragmented. I answer these questions by examining obstetrician-gynecologists' narratives regarding how they make decisions when faced with uncertainty in childbirth. Between 2013 and 2014, I performed 21 semi-structured interviews with obstetricians in the United States. Obstetricians were selected to maximize variation in relevant physician, hospital, and practice characteristics. I began with grounded theory and moved to analytical coding of themes in relation to relevant literature. My analysis renders it evident that some physicians use the doctor-patient relationship as a toolkit for dealing with uncertainty. I analyze how this process varies for physicians in different models of care by comparing doctors' experiences in models with continuous versus fragmented doctor-patient relationships. My key findings are that obstetricians in both models appealed to the ideal of patient-centered decision-making to cope with uncertain decisions, but in practice physicians in fragmented care faced a number of challenges to using the doctor-patient relationship as a toolkit for decision-making. These challenges led to additional uncertainties and in some cases to poor outcomes for doctors and/or patients; they also raised concerns about the reproduction of inequality. Thus organization of care delivery mitigates the efficacy of doctors' use of the doctor-patient relationship toolkit for uncertain decisions. These findings have implications for theorizing about decision-making under conditions of medical uncertainty, for understanding
Zineldin, Mosad; Camgöz-Akdağ, Hatice; Vasicheva, Valiantsina
2011-01-01
This paper aims to examine the major factors affecting cumulative summation, to empirically examine the major factors affecting satisfaction and to address the question whether patients in Kazakhstan evaluate healthcare similarly or differently from patients in Egypt and Jordan. A questionnaire, adapted from previous research, was distributed to Kazakhstan inpatients. The questionnaire contained 39 attributes about five newly-developed quality dimensions (5Qs), which were identified to be the most relevant attributes for hospitals. The questionnaire was translated into Russian to increase the response rate and improve data quality. Almost 200 usable questionnaires were returned. Frequency distribution, factor analysis and reliability checks were used to analyze the data. The three biggest concerns for Kazakhstan patients are: infrastructure; atmosphere; and interaction. Hospital staffs concern for patients' needs, parking facilities for visitors, waiting time and food temperature were all common specific attributes, which were perceived as concerns. These were shortcomings in all three countries. Improving health service quality by applying total relationship management and the 5Qs model together with a customer-orientation strategy is recommended. Results can be used by hospital staff to reengineer and redesign creatively their quality management processes and help move towards more effective healthcare quality strategies. Patients in three countries have similar concerns and quality perceptions. The paper describes a new instrument and method. The study assures relevance, validity and reliability, while being explicitly change-oriented. The authors argue that patient satisfaction is a cumulative construct, summing satisfaction as five different qualities (5Qs): object; processes; infrastructure; interaction and atmosphere.
Family Atmosphere and Relationships as Predictors of Heroin Addiction.
Mirković-Hajdukov, Mitra; Spahić, Tamara Efendić; Softić, Rusmir; Bećirović, Elvir; Šimić, Josip
2017-05-01
Studies show that dysfunctional family relationships are important predictors of addictions to all psychoactive substances. To establish if there is a connection between family relations and heroin addiction and if found to exist, what is the quality of this connection. This research was conducted on the sample comprised of 160 subjects divided into two groups. The first group consisted of 61 heroin addicts treated at the Tuzla University Clinical Centre Psychiatric Hospital. The second group consisted of 99 subjects who were students at the Tuzla University Faculties of Philosophy and Electrical Engineering and who were not using any psychoactive substances. The subjects were tested with the Quality of Family Interactions Scale (KOBI) which measures the interactions between children and parents in two dimensions, described in literature as 'acceptance' and 'rejection'. The research team established statistically significant differences between the heroin addicts and the students, the non-users, in terms of their family relationships. The results show that the addicts families were characterized by lack of understanding, by conflicts, rejection, non-acceptance by parents, while the non-users families were characterized by understanding, acceptance by parents and good communication. There is a connection between inter-family relationships and addiction. Namely, rejection and non-acceptance of children/persons by their families and parents, bad communication and dysfunctional family relationships are significant predictors of heroin addiction.
Using customer contact centres as relationship marketing instruments
van der Aa, Zanna; Bloemer, Josée; Henseler, Jörg
2015-01-01
This article investigates whether, to what extent and how customer contact centres influence customer–firm relationships through customer contact centre quality. The proposed model compiles direct and indirect effects of this form of quality on focal relationship marketing constructs, including
A Monte Carlo implementation of the predictor-corrector Quasi-Static method
International Nuclear Information System (INIS)
Hackemack, M. W.; Ragusa, J. C.; Griesheimer, D. P.; Pounders, J. M.
2013-01-01
The Quasi-Static method (QS) is a useful tool for solving reactor transients since it allows for larger time steps when updating neutron distributions. Because of the beneficial attributes of Monte Carlo (MC) methods (exact geometries and continuous energy treatment), it is desirable to develop a MC implementation for the QS method. In this work, the latest version of the QS method known as the Predictor-Corrector Quasi-Static method is implemented. Experiments utilizing two energy-groups provide results that show good agreement with analytical and reference solutions. The method as presented can easily be implemented in any continuous energy, arbitrary geometry, MC code. (authors)
Directory of Open Access Journals (Sweden)
Matteo Ramazzotti
Full Text Available Nine human neurodegenerative diseases, including Huntington's disease and several spinocerebellar ataxia, are associated to the aggregation of proteins comprising an extended tract of consecutive glutamine residues (polyQs once it exceeds a certain length threshold. This event is believed to be the consequence of the expansion of polyCAG codons during the replication process. This is in apparent contradiction with the fact that many polyQs-containing proteins remain soluble and are encoded by invariant genes in a number of eukaryotes. The latter suggests that polyQs expansion and/or aggregation might be counter-selected through a genetic and/or protein context. To identify this context, we designed a software that scrutinize entire proteomes in search for imperfect polyQs. The nature of residues flanking the polyQs and that of residues other than Gln within polyQs (insertions were assessed. We discovered strong amino acid residue biases robustly associated to polyQs in the 15 eukaryotic proteomes we examined, with an over-representation of Pro, Leu and His and an under-representation of Asp, Cys and Gly amino acid residues. These biases are conserved amongst unrelated proteins and are independent of specific functional classes. Our findings suggest that specific residues have been co-selected with polyQs during evolution. We discuss the possible selective pressures responsible of the observed biases.
Seismic attenuation structure beneath Nazca Plate subduction zone in southern Peru
Jang, H.; Kim, Y.; Clayton, R. W.
2017-12-01
We estimate seismic attenuation in terms of quality factors, QP and QS using P and S phases, respectively, beneath Nazca Plate subduction zone between 10°S and 18.5°S latitude in southern Peru. We first relocate 298 earthquakes with magnitude ranges of 4.0-6.5 and depth ranges of 20-280 km. We measure t*, which is an integrated attenuation through the seismic raypath between the regional earthquakes and stations. The measured t* are inverted to construct three-dimensional attenuation structures of southern Peru. Checkerboard test results for both QP and QS structures ensure good resolution in the slab-dip transition zone between flat and normal slab subduction down to a depth of 200 km. Both QP and QS results show higher attenuation continued down to a depth of 50 km beneath volcanic arc and also beneath the Quimsachata volcano, the northernmost young volcano, located far east of the main volcanic front. We also observe high attenuation in mantle wedge especially beneath the normal subduction region in both QP and QS (100-130 in QP and 100-125 in QS) and slightly higher QP and QS beneath the flat-subduction and slab-dip transition regions. We plan to relate measured attenuation in the mantle wedge to material properties such as viscosity to understand the subduction zone dynamics.
Spreading Sequence Design and Theoretical Limits for Quasisynchronous CDMA Systems
Directory of Open Access Journals (Sweden)
Fan Pingzhi
2004-01-01
Full Text Available For various quasisynchronous (QS CDMA systems such as LAS-CDMA system which emerged recently, in order to reduce or eliminate the multiple access interference and multipath interference, it is required to design a set of spreading sequences which are mutually orthogonal within a designed shift zone, called orthogonal zone. For traditional orthogonal sequences, such as Walsh sequences and orthogonal Gold sequences, the orthogonality can only be achieved at the inphase point; in other words, the orthogonality is destroyed whenever there is a relative shift between the sequences, that is, their orthogonal zone is 0. In this paper, new concepts of generalized orthogonality (GO and generalized quasiorthogonality (GQO for spreading sequence design in both direct sequence (DS QS-CDMA systems and time/frequency hopping (TH/FH QS-CDMA systems are presented. Besides, selected GO/GQO sequence designs and general theoretical periodic and aperiodic limits, together with several applications in QS-CDMA systems, are also reviewed and analyzed.
Directory of Open Access Journals (Sweden)
Bindu Subhadra
2016-02-01
Full Text Available Acinetobacter is an important nosocomial, opportunistic human pathogen that is gradually gaining more attention as a major health threat worldwide. Quorum sensing (QS is a cell-cell communication system in which specific signaling molecules called autoinducers accumulate in the medium as the population density grows and control various physiological processes including production of virulence factors, biofilm and development of antibiotic resistance. The complex QS machinery in Acinetobacter is mediated by a two-component system which is homologous to the typical LuxI/LuxR system found in Gram-negative bacteria. This cell signaling system comprises of a sensor protein that functions as autoinducer synthase and a receptor protein which binds to the signal molecules, acyl homoserine lactones inducing a cascade of reactions. Lately, disruption of QS has emerged as an anti-virulence strategy with great therapeutic potential. Here, we depict the current understanding of the existing QS network in Acinetobacter and describe important anti-virulent strategies developed in order to effectively tackle this pathogen. In addition, the prospects of quorum quenching to control Acinetobacter infections is also been discussed.
Directory of Open Access Journals (Sweden)
Rahmawati Rahmawati
2017-06-01
Full Text Available This study empirically examines the antecedents and consequences of organization justice consisting of distributive justice, procedural justice, and interactional justice. The hypothesis of this study are mentoring function positive effect on organization justice, organizational justice positive effect on quality of supervisor-auditor relationship, mentoring function positive effect on quality of supervisor-auditor relationship. In additional, this study also hypothesized that organization justice as mediation between mentoring functions and quality of supervisor-auditor relationship. This study is a survey of 228 government internal auditors of Financial and Development Supervisory Agency-Badan Pengawasan Keuangan dan Pembangunan (BPKP in Java-Bali Indonesia. The technique of collecting data using questionnaires. Test hypotheses using path analysis with SEM-AMOS. The results showed that mentoring function positive effect on organization justice, organizational justice positive effect on quality of supervisor-auditor relationship, mentoring function positive effect on quality of supervisor-auditor relationship. The study also provide an empirical finding that organization justice as mediation between mentoring functions and quality of supervisor-auditor relationship. The study provides recommendations to the BPKP in solving the problems faced by the government in realizing good and clean governance. This study is the first empirically examines the potential benefit of organization justice as a mediation between mentoring function and quality of supervisor-auditor relationship.
Exercise as Labour: Quantified Self and the Transformation of Exercise into Labour
Directory of Open Access Journals (Sweden)
Chris Till
2014-08-01
Full Text Available The recent increase in the use of digital self-tracking devices has given rise to a range of relations to the self often discussed as quantified self (QS. In popular and academic discourse, this development has been discussed variously as a form of narcissistic self-involvement, an advanced expression of panoptical self-surveillance and a potential new dawn for e-health. This article proposes a previously un-theorised consequence of this large-scale observation and analysis of human behaviour; that exercise activity is in the process of being reconfigured as labour. QS will be briefly introduced, and reflected on, subsequently considering some of its key aspects in relation to how these have so far been interpreted and analysed in academic literature. Secondly, the analysis of scholars of “digital labour” and “immaterial labour” will be considered, which will be discussed in relation to what its analysis of the transformations of work in contemporary advanced capitalism can offer to an interpretation of the promotion and management of the self-tracking of exercise activities. Building on this analysis, it will be proposed that a thermodynamic model of the exploitation of potential energy underlies the interest that corporations have shown in self-tracking and that “gamification” and the promotion of an entrepreneurial selfhood is the ideological frame that informs the strategy through which labour value is extracted without payment. Finally, the potential theoretical and political consequences of these insights will be considered.
Directory of Open Access Journals (Sweden)
Nina Yusrina Muhamad Yunos
2014-06-01
Full Text Available Quorum sensing (QS is a bacterial cell-to-cell communication system controlling QS-mediated genes which is synchronized with the population density. The regulation of specific gene activity is dependent on the signaling molecules produced, namely N-acyl homoserine lactones (AHLs. We report here the identification and characterization of AHLs produced by bacterial strain ND07 isolated from a Malaysian fresh water sample. Molecular identification showed that strain ND07 is clustered closely to Pseudomonas cremoricolorata. Spent culture supernatant extract of P. cremoricolorata strain ND07 activated the AHL biosensor Chromobacterium violaceum CV026. Using high resolution triple quadrupole liquid chromatography-mass spectrometry, it was confirmed that P. cremoricolorata strain ND07 produced N-octanoyl-l-homoserine lactone (C8-HSL and N-decanoyl-l-homoserine lactone (C10-HSL. To the best of our knowledge, this is the first documentation on the production of C10-HSL in P. cremoricolorata strain ND07.
Banerjee, Malabika; Moulick, Soumitra; Bhattacharya, Kunal Kumar; Parai, Debaprasad; Chattopadhyay, Subrata; Mukherjee, Samir Kumar
2017-12-01
Quorum-sensing (QS) is known to play an essential role in regulation of virulence factors and toxins during Pseudomonas aeruginosa infection which may frequently cause antibiotic resistance and hostile outcomes of inflammatory injury. Therefore, it is an urgent need to search for a novel agent with low risk of resistance development that can target QS and inflammatory damage prevention as well. Andrographis paniculata, a herbaceous plant under the family Acanthaceae, native to Asian countries and also cultivated in Scandinavia and some parts of Europe, has a strong traditional usage with its known antibacterial, anti-inflammatory, antipyretic, antiviral and antioxidant properties. In this study, three different solvent extracts (viz., chloroform, methanol and aqueous) of A. paniculata were examined for their anti-QS and anti-inflammatory activities. Study was carried out to assess the effect on some selected QS-regulatory genes at transcriptional level using Real Time-PCR. In addition, ability to attenuate MAPK pathways upon P. aeruginosa infection was performed to check its potential anti-inflammatory activity. Chloroform and methanol extracts showed significant reduction (p paniculata extracts inhibit QS in P. aeruginosa and exhibit anti-inflammatory activities, therefore it represents itself as a prospective therapeutic agent against P. aeruginosa infection. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Pol Huedo
2018-04-01
Full Text Available Stenotrophomonas maltophilia is an opportunistic Gram-negative pathogen with increasing incidence in clinical settings. The most critical aspect of S. maltophilia is its frequent resistance to a majority of the antibiotics of clinical use. Quorum Sensing (QS systems coordinate bacterial populations and act as major regulatory mechanisms of pathogenesis in both pure cultures and poly-microbial communities. Disruption of QS systems, a phenomenon known as Quorum Quenching (QQ, represents a new promising paradigm for the design of novel antimicrobial strategies. In this context, we review the main advances in the field of QS in S. maltophilia by paying special attention to Diffusible Signal Factor (DSF signaling, Acyl Homoserine Lactone (AHL responses and the controversial Ax21 system. Advances in the DSF system include regulatory aspects of DSF synthesis and perception by both rpf-1 and rpf-2 variant systems, as well as their reciprocal communication. Interaction via DSF of S. maltophilia with unrelated organisms including bacteria, yeast and plants is also considered. Finally, an overview of the different QQ mechanisms involving S. maltophilia as quencher and as object of quenching is presented, revealing the potential of this species for use in QQ applications. This review provides a comprehensive snapshot of the interconnected QS network that S. maltophilia uses to sense and respond to its surrounding biotic or abiotic environment. Understanding such cooperative and competitive communication mechanisms is essential for the design of effective anti QS strategies.
Women's hair as a cue to desired relationship and parenting characteristics.
Matz, David C; Hinsz, Verlin B
2017-10-30
We investigated how women's hair color (blond, brown, black) and length (short, medium, long) influences males' judgments about the women's age, health, physical attractiveness, relationship potential, and parenting capability. Results, which are generally consistent with evolutionary psychology approaches, indicate that hair color and, to a lesser extent, length can affect perceptions of personal characteristics. More specifically, we found that lighter hair (blond and brown) compared to darker hair (black) is generally associated with perceptions of youth, health and attractiveness, and generally leads to more positive perceptions of relationship and parenting potential. Furthermore, the relationships between variables suggest that characteristics directly related to reproductive potential may be inferred from more obvious indirect characteristics. These results suggest that males are able to make complex judgments about women concerning their desirable relationship and parenting potential based on discernable characteristics such as hair color and length.
Social relationships as a major determinant in the valuation of health states.
Frick, Ulrich; Irving, Hyacinth; Rehm, Jürgen
2012-03-01
To empirically determine the impact of the capacity to sustain social relationships on valuing health states. 68 clinical experts conducted a health state valuation exercise in five sites using pairwise comparison, ranking, and person trade-off as elicitation methods. 23,840 pairwise comparisons of a total of 379 health states were analyzed by conditional logistic regression. Social relationships had a clear monotonic association with perceived disability: the more limited the capacity to sustain social relationships, the more disabling the resulting health state valuations. The highest level of limitations with respect to social relationships was associated with slightly lower impact on health state valuations compared to the highest level of limitations in physical functioning. Social relationships showed an independent contribution to health state valuations and should be included in health state measures.
Selection pressure on human STR loci and its relevance in repeat expansion disease
Shimada, Makoto K.
2016-06-11
Short Tandem Repeats (STRs) comprise repeats of one to several base pairs. Because of the high mutability due to strand slippage during DNA synthesis, rapid evolutionary change in the number of repeating units directly shapes the range of repeat-number variation according to selection pressure. However, the remaining questions include: Why are STRs causing repeat expansion diseases maintained in the human population; and why are these limited to neurodegenerative diseases? By evaluating the genome-wide selection pressure on STRs using the database we constructed, we identified two different patterns of relationship in repeat-number polymorphisms between DNA and amino-acid sequences, although both patterns are evolutionary consequences of avoiding the formation of harmful long STRs. First, a mixture of degenerate codons is represented in poly-proline (poly-P) repeats. Second, long poly-glutamine (poly-Q) repeats are favored at the protein level; however, at the DNA level, STRs encoding long poly-Qs are frequently divided by synonymous SNPs. Furthermore, significant enrichments of apoptosis and neurodevelopment were biological processes found specifically in genes encoding poly-Qs with repeat polymorphism. This suggests the existence of a specific molecular function for polymorphic and/or long poly-Q stretches. Given that the poly-Qs causing expansion diseases were longer than other poly-Qs, even in healthy subjects, our results indicate that the evolutionary benefits of long and/or polymorphic poly-Q stretches outweigh the risks of long CAG repeats predisposing to pathological hyper-expansions. Molecular pathways in neurodevelopment requiring long and polymorphic poly-Q stretches may provide a clue to understanding why poly-Q expansion diseases are limited to neurodegenerative diseases. © 2016, Springer-Verlag Berlin Heidelberg.
Harada, Kenji; Toyono, Manotomo; Tamura, Masamichi
2004-06-01
Transthoracic Doppler echocardiography provides noninvasive measurements of coronary blood flow in the left anterior descending coronary artery (LAD). This method has the potential to show the effects of acute changes in loading conditions on blood flow. Coil closure of patent ductus arteriosus (PDA) is a model of acute changes in blood pressure and left ventricular (LV) preload that influences coronary blood flow. We applied this technique to assess the coronary blood flow changes for patients with PDA before and immediately after PDA coil closure. We examined 9 patients (1.8 +/- 1.1 years) with simple PDA and 8 age-matched healthy children. LV dimensions and LV mass were measured. Maximum peak flow velocity and flow volume in the LAD were measured. Pulmonary to systemic flow ratios (Qp/Qs) were obtained by cardiac catheterization. After PDA coil closure, LV end-diastolic dimension decreased, and systolic and diastolic blood pressures increased significantly. The maximum peak flow velocity, LAD flow volume, and the ratio of LAD flow volume to LV mass increased significantly. The changes in maximum peak flow velocity and the ratio of LAD flow volume to LV mass (F/M) correlated positively with the changes in diastolic pressure and Qp/Qs. In 5 patients who had Qp/Qs > 1.5, the mean F/M was significantly lower compared with control subjects, but they increased to normal values after coil closure of PDA. PDA coil closure increases diastolic pressure and decreases Qp/Qs, resulting in improvement of myocardial perfusion. These findings provide new insights into the relationship between cardiac function and coronary circulation in pediatric patients with heart diseases associated with PDA.
Anti-quorum sensing activity of essential oils from Colombian plants.
Jaramillo-Colorado, Beatriz; Olivero-Verbel, Jesus; Stashenko, Elena E; Wagner-Döbler, Irene; Kunze, Brigitte
2012-01-01
Essential oils from Colombian plants were characterised by GC-MS, and assayed for anti-quorum sensing activity in bacteria sensor strains. Two major chemotypes were found for Lippia alba, the limonene-carvone and the citral (geranial-neral). For other species, the main components included α-pinene (Ocotea sp.), β-pinene (Swinglea glutinosa), cineol (Elettaria cardamomun), α-zingiberene (Zingiber officinale) and pulegone (Minthostachys mollis). Several essential oils presented promising inhibitory properties for the short chain AHL quorum sensing (QS) system, in Escherichia coli containing the biosensor plasmid pJBA132, in particular Lippia alba. Moderate activity as anti-QS using the same plasmid, were also found for selected constituents of essential oils studied here, such as citral, carvone and α-pinene, although solely at the highest tested concentration (250 µg mL(-1)). Only citral presented some activity for the long chain AHL QS system, in Pseudomonas putida containing the plasmid pRK-C12. In short, essential oils from Colombian flora have promising properties as QS modulators.
Recent progresses on AI-2 bacterial quorum sensing inhibitors.
Zhu, Peng; Li, Minyong
2012-01-01
Quorum sensing (QS) is a communication procedure that predominates gene expression in response to cell density and fluctuations in the neighboring environment as a result of discerning molecules termed autoinducers (AIs). It has been embroiled that QS can govern bacterial behaviors such as the secretion of virulence factors, biofilm formation, bioluminescence production, conjugation, sporulation and swarming motility. Autoinducer 2 (AI-2), a QS signaling molecule brought up to be involved in interspecies communication, exists in both gram-negative and -positive bacteria. Therefore, novel approaches to interrupt AI-2 quorum sensing are being recognized as next generation antimicrobials. In the present review article, we summarized recent progresses on AI-2 bacterial quorum sensing inhibitors and discussed their potential as the antibacterial agents.
Thermal Comfort At The Street Corridor Around Public Places, Case Study Alun-Alun Malang City
Directory of Open Access Journals (Sweden)
Erna Winansih
2016-01-01
Full Text Available Malang as the second largest city in East Java province become crowded recently. The congestion almost happens everyday. The scenery of the street corridor is full of iron stacks. It is said that Malang city is less comfortable and less walkable. The decrease of this environment encourages to conduct the study (Q.S. 16:90, Q.S. 96:1-5, Q.S. 30:41. The study aimed to analyze the thermal comfort at pedestrian ways around Malang city squares, the street corridor of Merdeka Alun-Alun (MAA and the Tugu Alun-Alun (TAA. The temperature and relative humidity were measured by multinorm instrument. The THI (Temperature Humidity Index method was used to analyze the thermal comfort. The results showed that the THI average at TAA (27 were more comfortable than at MAA (27,5. The south side of the MAA corridor became the most comfortable with the THI value of 26,4, which the side covered by trees canopy (Q.S. 7:58. It needs to conduct next research (Q.S. 13:11, because of the change of the activities at these street corridors.
Yusufaly, Tahir; Boedicker, James
Microbial communities frequently communicate via quorum sensing (QS), where cells produce, secrete, and respond to a threshold level of an autoinducer (AI) molecule, thereby modulating density-dependent gene expression. However, the biology of QS remains incompletely understood in heterogeneous communities, where crosstalk between distinct QS systems leads to novel effects. Such knowledge is necessary both for understanding signaling in real microbial communities, and for the rational design of synthetic communities with designer properties. As a step towards this goal, we investigate the effects of crosstalk between Gram-negative bacteria communicating via LuxI/LuxR-type QS systems, with acyl-homoserine lactone (AHL) AI molecules. After mapping QS in a heterogeneous community onto an artificial neural network model, we systematically analyze how heterogeneity regulates the community's capability for stable yet flexible decision making. We find that there are preferred distributions of interactions which provide optimal tradeoffs between capacity, or the number of different decisions a population can make, and robustness, or the tolerance of the community to disturbances. We compare our results to inferences made from experimental data, and critically discuss implications for the biological significance of crosstalk.
Identification of Quorum Sensing Signal Molecule of Lactobacillus delbrueckii subsp. bulgaricus.
Pang, Xiaoyang; Liu, Cuiping; Lyu, Pengcheng; Zhang, Shuwen; Liu, Lu; Lu, Jing; Ma, Changlu; Lv, Jiaping
2016-12-14
Many bacteria in nature use quorum sensing (QS) to regulate gene expression. The quorum sensing system plays critical roles in the adaptation of bacteria to the surrounding environment. Previous studies have shown that during high-density fermentation, the autolysis of lactic acid bacteria was regulated by the QS system, and the two-component system (TCS, LBUL_RS00115/LBUL_RS00110) is involved in the autolysis of Lactobacillus delbrueckii subsp. bulgaricus. However, the QS signal molecule, which regulates this pathway, has not been identified. In this study, we compared the genome of Lactobacillus bulgaricus ATCC BAA-365 with the locus of seven lactobacillus QS systems; the position of the QS signal molecule of Lactobacillus bulgaricus ATCC BAA-365 was predicted by bioinformatics tool. Its function was identified by in vitro experiments. Construction of TCS mutant by gene knockout of LBUL_RS00115 confirmed that the signal molecule regulates the density of the flora by the TCS (LBUL_RS00115/LBUL_RS00110). This study indicated that quorum quenching and inhibition based on the signal molecule might serve as an approach to reduce the rate of autolysis of LAB and increase the number of live bacteria in fermentation.
Scientists and Mathematicians Collaborating to Build Quantitative Skills in Undergraduate Science
Rylands, Leanne; Simbag, Vilma; Matthews, Kelly E.; Coady, Carmel; Belward, Shaun
2013-01-01
There is general agreement in Australia and beyond that quantitative skills (QS) in science, the ability to use mathematics and statistics in context, are important for science. QS in the life sciences are becoming ever more important as these sciences become more quantitative. Consequently, undergraduates studying the life sciences require better…
DEFF Research Database (Denmark)
Villanueva, Luis Guillermo; Schmid, Silvan
2014-01-01
Silicon nitride (SiN) micro- and nanomechanical resonators have attracted a lot of attention in various research fields due to their exceptionally high quality factors (Qs). Despite their popularity, the origin of the limiting loss mechanisms in these structures has remained controversial. In thi...
Bodies as means for continuing post-death relationships.
Leichtentritt, Ronit D; Mahat Shamir, Michal; Barak, Adi; Yerushalmi, Ayelet
2016-05-01
Secondary analysis of data from 30 people in three interview studies shows that bereaved people use their own and the deceased's body in their continuing efforts to maintain a relationship with the departed. Following the continuing bond perspective, the study reveals three body-associated strategies for maintaining post-death relationships: (a) the presence of the deceased in the bereaved's body, (b) body-associated actions and activities, and (c) sensing and caring for the deceased's body. The conceptual dimension of embodiment is used to interpret results. Attention is also given to the bereaved's sense of disembodiment due to social rejection of these strategies for maintaining post-death relationships. Implications for health psychologists are offered. © The Author(s) 2014.
Engaging the Student as a Customer: A Relationship Marketing Approach
Bowden, Jana Lay-Hwa.
2011-01-01
Increasingly organizations are recognizing the value of establishing close relationships with their customers. Despite this, research has not deeply explored how the intangible aspects of relational exchange such as customer satisfaction, as well as affective commitment, calculative commitment, and trust, combine to determine loyalty in the…
Directory of Open Access Journals (Sweden)
Carla Cresoni-Pereira
2006-03-01
Full Text Available The aim of the present study was to determine whether wild adult Anastrepha obliqua (Macquart, 1835 females are able to associate a compound (quinine sulphate - QS not related to their habitual diet with a protein-enriched food. Females were first fed on diets based on brewer yeast and sucrose containing or not QS. The groups were then allowed to choose between their original diets and a diet with or without QS, depending on the previous treatment, and between a diet based on agar and a diet containing agar and QS. When the nutritional value of the diets was adequate, the females did not show any preference for the diet with or without QS. With respect to the agar diet and the agar + QS diet, females previously fed on a nutritive diet containing QS preferred the diet containing QS, indicating an association between the compound and the nutritional value of the diet. The importance of this behavioral strategy is discussed.O objetivo do presente estudo foi determinar se fêmeas adultas selvagens de Anastrepha obliqua (Macquart, 1835 são capazes de associar um composto (sulfato de quinino-SQ não-relacionado à sua dieta habitual com um alimento rico em proteínas. Primeiro, as fêmeas foram alimentadas com dietas à base de lêvedo de cerveja e sacarose contendo ou não SQ. Os grupos foram então colocados para escolher entre sua dieta original e dietas com ou sem SQ, dependendo do tratamento prévio, e entre uma dieta à base de agar somente e outra à base de agar e SQ. Quando o valor nutricional das dietas era adequado, as fêmeas não mostraram nenhuma preferência para a dieta com ou sem SQ. Em relação às dietas de agar e agar+SQ, fêmeas previamente alimentadas com uma dieta nutritiva contendo SQ preferiram a dieta contendo SQ, indicando uma associação entre o composto e o valor nutricional da dieta. A importância desta estratégia comportamental é discutida.
Quorum Sensing Regulation in Aeromonas hydrophila
DEFF Research Database (Denmark)
Garde, Christian; Bjarnsholt, Thomas; Givskov, Michael
2010-01-01
We present detailed results on the C4-HSL-mediated quorum sensing (QS) regulatory system of the opportunistic Gram-negative bacterium Aeromonas hydrophila. This bacterium contains a particularly simple QS system that allows for a detailed modeling of kinetics. In a model system (i.e., the Escheri......We present detailed results on the C4-HSL-mediated quorum sensing (QS) regulatory system of the opportunistic Gram-negative bacterium Aeromonas hydrophila. This bacterium contains a particularly simple QS system that allows for a detailed modeling of kinetics. In a model system (i...
3-D seismic velocity and attenuation structures in the geothermal field
Energy Technology Data Exchange (ETDEWEB)
Nugraha, Andri Dian [Global Geophysics Research Group, Faculty of Mining and Petroleum Engineering, Institute of Technology Bandung, Jalan Ganesha No. 10 Bandung, 40132 (Indonesia); Syahputra, Ahmad [Geophyisical Engineering, Faculty of Mining and Petroleum Engineering, Institute of Technology Bandung, Jalan Ganesha No. 10 Bandung, 40132 (Indonesia); Fatkhan,; Sule, Rachmat [Applied Geophysics Research Group, Faculty of Mining and Petroleum Engineering, Institute of Technology Bandung, Jalan Ganesha No. 10 Bandung, 40132 (Indonesia)
2013-09-09
We conducted delay time tomography to determine 3-D seismic velocity structures (Vp, Vs, and Vp/Vs ratio) using micro-seismic events in the geothermal field. The P-and S-wave arrival times of these micro-seismic events have been used as input for the tomographic inversion. Our preliminary seismic velocity results show that the subsurface condition of geothermal field can be fairly delineated the characteristic of reservoir. We then extended our understanding of the subsurface physical properties through determining of attenuation structures (Qp, Qs, and Qs/Qp ratio) using micro-seismic waveform. We combined seismic velocities and attenuation structures to get much better interpretation of the reservoir characteristic. Our preliminary attanuation structures results show reservoir characterization can be more clearly by using the 3-D attenuation model of Qp, Qs, and Qs/Qp ratio combined with 3-D seismic velocity model of Vp, Vs, and Vp/Vs ratio.
Organization Tenure as a Moderator of the Job Satisfaction-Job Performance Relationship.
Norris, Dwight R.; Niebuhr, Robert E.
1984-01-01
Examined organization tenure as a moderator of the job satisfaction-job performance relationship with technical employees (N=116) in a medium-sized industrial firm. Results provided support for a moderating influence of organization tenure on the relationship between job performance and overall satisfaction, satisfaction with work, and…
Factors Influencing Students' Perceptions of Their Quantitative Skills
Matthews, Kelly E.; Hodgson, Yvonne; Varsavsky, Cristina
2013-01-01
There is international agreement that quantitative skills (QS) are an essential graduate competence in science. QS refer to the application of mathematical and statistical thinking and reasoning in science. This study reports on the use of the Science Students Skills Inventory to capture final year science students' perceptions of their QS across…
Culture and Social Relationship as Factors of Affecting Communicative Non-verbal Behaviors
Akhter Lipi, Afia; Nakano, Yukiko; Rehm, Mathias
The goal of this paper is to link a bridge between social relationship and cultural variation to predict conversants' non-verbal behaviors. This idea serves as a basis of establishing a parameter based socio-cultural model, which determines non-verbal expressive parameters that specify the shapes of agent's nonverbal behaviors in HAI. As the first step, a comparative corpus analysis is done for two cultures in two specific social relationships. Next, by integrating the cultural and social parameters factors with the empirical data from corpus analysis, we establish a model that predicts posture. The predictions from our model successfully demonstrate that both cultural background and social relationship moderate communicative non-verbal behaviors.
Caregiver Self-Esteem as a Predictor of Patient Relationship Satisfaction: A Longitudinal Study.
Mroz, Emily L; Poulin, Michael J; Grant, Pei C; Depner, Rachel M; Breier, Jennifer; Byrwa, David J; Wright, Scott T
2018-03-01
Longitudinal assessment of patient-caregiver relationships will determine whether caregiver self-esteem determines patient relationship satisfaction at end of life. Research on close relationships and caregiving supports the idea that informal caregivers' self-esteem may influence their relationships with their terminally ill loved ones. However, this connection has not yet been investigated longitudinally, nor has it been applied specifically to care recipients' relationship satisfaction. A sample of 24 caregivers and 24 patients in a hospice home care program were recruited. Multiple patient and caregiver interviews were used to conduct a longitudinal study to measure fluctuations in patient health, changes in patient and caregiver relationship satisfaction, and self-esteem over a three-month period. An interaction between caregiver self-esteem and patient relationship satisfaction demonstrated the role that self-esteem plays between caregivers and patients enrolled in hospice care. Specifically, for patients with caregivers with low self-esteem, patient relationship satisfaction significantly decreased as the patient's physical health decreased, whereas for patients whose caregivers had high self-esteem, patient relationship satisfaction marginally increased during poorer physical health. High self-esteem may allow caregivers to overcome feelings of burden and maladaptive anticipatory grief to remain satisfied in their relationship with the patient. Caregiver self-esteem appears to play a role in fostering patient relationship satisfaction at the end of life.
Effects of antibiotics on quorum sensing in pseudomonas aeruginosa
DEFF Research Database (Denmark)
Skindersø, Mette Elena; Alhede, Morten; Phipps, Richard Kerry
2008-01-01
in animal infection models. Treatment of cystic fibrosis (CF) patients chronically infected with P. aeruginosa with the macrolide antibiotic azithromycin (AZM) has been demonstrated to improve the clinical outcome. Several studies indicate that AZM may accomplish its beneficial action in CF patients....... Three of the antibiotics tested, AZM, ceftazidime (CFT), and ciprofloxacin (CPR), were very active in the assay and were further examined for their effects on QS-regulated virulence factor production in P. aeruginosa. The effects of the three antibiotics administered at subinhibitory concentrations were...... by impeding QS, thereby reducing the pathogenicity of P. aeruginosa. This led us to investigate whether QS inhibition is a common feature of antibiotics. We present the results of a screening of 12 antibiotics for their QS-inhibitory activities using a previously described QS inhibitor selector 1 strain...
Directory of Open Access Journals (Sweden)
Silvio Romero Beltrão
2015-04-01
Full Text Available This work is interdisciplinary and aims to examine the adequacy of the patient-physician relationship to the requirements of validity of legal business. The doctor-patient relationship needs a complete overview on the elements and requirements that constitute its validity in law. As a starting point analyzes the doctor-patient relationship as a legal fact, to then verify the validity requirements of the patient medical legal business, capable agent, object and lawful manner prescribed by law. Investigating the manifestation of the will as the main element of the legal transaction to define the end of the study the importance of the doctor-patient relationship by law, based on the General Theory of Civil Law.
Constrained relationship agency as the risk factor for intimate ...
African Journals Online (AJOL)
We used structural equation modelling to identify and measure constrained relationship agency (CRA) as a latent variable, and then tested the hypothesis that CRA plays a significant role in the pathway between IPV and transactional sex. After controlling for CRA, receiving more material goods from a sexual partner was ...
Brackman, Gilles; Celen, Shari; Baruah, Kartik; Bossier, Peter; Van Calenbergh, Serge; Nelis, Hans J; Coenye, Tom
2009-12-01
The increase of disease outbreaks caused by Vibrio species in aquatic organisms as well as in humans, together with the emergence of antibiotic resistance in Vibrio species, has led to a growing interest in alternative disease control measures. Quorum sensing (QS) is a mechanism for regulating microbial gene expression in a cell density-dependent way. While there is good evidence for the involvement of auto-inducer 2 (AI-2)-based interspecies QS in the control of virulence in multiple Vibrio species, only few inhibitors of this system are known. From the screening of a small panel of nucleoside analogues for their ability to disturb AI-2-based QS, an adenosine derivative with a p-methoxyphenylpropionamide moiety at C-3' emerged as a promising hit. Its mechanism of inhibition was elucidated by measuring the effect on bioluminescence in a series of Vibrio harveyi AI-2 QS mutants. Our results indicate that this compound, as well as a truncated analogue lacking the adenine base, block AI-2-based QS without interfering with bacterial growth. The active compounds affected neither the bioluminescence system as such nor the production of AI-2, but most likely interfered with the signal transduction pathway at the level of LuxPQ in V. harveyi. The most active nucleoside analogue (designated LMC-21) was found to reduce the Vibrio species starvation response, to affect biofilm formation in Vibrio anguillarum, Vibrio vulnificus and Vibrio cholerae, to reduce pigment and protease production in V. anguillarum, and to protect gnotobiotic Artemia from V. harveyi-induced mortality.
International Nuclear Information System (INIS)
Tao, Li; Huo, Zhipeng; Dai, Songyuan; Zhu, Jun; Zhang, Changneng; Pan, Xu; Huang, Yang; Yang, Shangfeng; Zhang, Bing; Yao, Jianxi
2015-01-01
Long-term stability is essential for the application and commercialization of dye-sensitized solar cells (DSCs). A quasi-solid-state DSC (QS-DSC) with excellent long-term stability is fabricated using ionic gel electrolyte (IGE) with N,N′-methylenebisdodecanamide as low molecular mass organogelator (LMOG). The gel to solution transition temperature (T gel ) of this IGE is 127 °C, well above the working temperature of the device, which contributes to the thermal properties of the IGE and the device. The electrochemical properties of the IGE and the kinetic processes of electron transport and recombination of the QS-DSC are investigated by means of electrochemical impedance spectroscopy (EIS) and controlled intensity modulated photocurrent/photovoltage spectroscopy (IMPS/IMVS). Due to the obstructed diffusion of redox species caused by the network of IGE, the electron recombination at the TiO 2 photoelectrode/electrolyte interface in the QS-DSC is accelerated. More importantly, compared with the ionic liquid electrolyte (ILE) based DSC, the QS-DSC based on the IGE exhibits excellent thermal and light-soaking stabilities during the accelerated aging tests for 1000 h. Especially, there is almost no degradation in the short-circuit current density (J sc ) in the IGE based QS-DSC, while the J sc of the ILE based DSC decreased to 85–94% of their initial values. - Highlights: • A novel IGE with high T gel is obtained by using a diamide derivative as LMOG. • The IGE based QS-DSC is very stable during the accelerated aging tests. • The influences of gelation on the electron kinetic processes are investigated
Energy Technology Data Exchange (ETDEWEB)
Tao, Li [Key Laboratory of Novel Thin Film Solar Cells, Division of Solar Energy Materials and Engineering, Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); Huo, Zhipeng, E-mail: zhipenghuo@163.com [Key Laboratory of Novel Thin Film Solar Cells, Division of Solar Energy Materials and Engineering, Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); Dai, Songyuan, E-mail: sydai@ncepu.edu.cn [Key Laboratory of Novel Thin Film Solar Cells, Division of Solar Energy Materials and Engineering, Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); Beijing Key Lab of Novel Thin Film Solar Cells, North China Electric Power University, Beijing 102206 (China); Zhu, Jun; Zhang, Changneng; Pan, Xu; Huang, Yang [Key Laboratory of Novel Thin Film Solar Cells, Division of Solar Energy Materials and Engineering, Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui 230031 (China); Yang, Shangfeng [Hefei National Laboratory for Physical Sciences at Microscale, Department of Materials Science and Engineering, University of Science and Technology of China (USTC), Hefei 230026 (China); Zhang, Bing; Yao, Jianxi [Beijing Key Lab of Novel Thin Film Solar Cells, North China Electric Power University, Beijing 102206 (China)
2015-02-15
Long-term stability is essential for the application and commercialization of dye-sensitized solar cells (DSCs). A quasi-solid-state DSC (QS-DSC) with excellent long-term stability is fabricated using ionic gel electrolyte (IGE) with N,N′-methylenebisdodecanamide as low molecular mass organogelator (LMOG). The gel to solution transition temperature (T{sub gel}) of this IGE is 127 °C, well above the working temperature of the device, which contributes to the thermal properties of the IGE and the device. The electrochemical properties of the IGE and the kinetic processes of electron transport and recombination of the QS-DSC are investigated by means of electrochemical impedance spectroscopy (EIS) and controlled intensity modulated photocurrent/photovoltage spectroscopy (IMPS/IMVS). Due to the obstructed diffusion of redox species caused by the network of IGE, the electron recombination at the TiO{sub 2} photoelectrode/electrolyte interface in the QS-DSC is accelerated. More importantly, compared with the ionic liquid electrolyte (ILE) based DSC, the QS-DSC based on the IGE exhibits excellent thermal and light-soaking stabilities during the accelerated aging tests for 1000 h. Especially, there is almost no degradation in the short-circuit current density (J{sub sc}) in the IGE based QS-DSC, while the J{sub sc} of the ILE based DSC decreased to 85–94% of their initial values. - Highlights: • A novel IGE with high T{sub gel} is obtained by using a diamide derivative as LMOG. • The IGE based QS-DSC is very stable during the accelerated aging tests. • The influences of gelation on the electron kinetic processes are investigated.
International Nuclear Information System (INIS)
Yiannikas, J.; Moodie, D.S.; Gill, C.C.; Sterba, R.; McIntyre, R.; Buonocore, E.
1984-01-01
Pre- and postoperative structural changes and pulmonary to systemic flow (QP/QS) ratios were assessed using digital angiography in 34 patients documented to have a left to right shunt at cardiac catheterization. There were 16 men and 18 women whose ages ranged from 4 months to 60 years. The radiographic single mask mode was used for all digital subtraction angiographic studies with a typical radiographic sequence being 80 to 100 kV, 5 to 10 mA/frame at six frames/s for 15 seconds. Renografin-76 was used as a bolus injection at 0.5 to 1.0 ml/kg via an arm vein in most patients. The level of the left to right shunt and any associated anomalies were noted and compared with results from cardiac catheterization. Digital subtraction angiographic flow curves were generated from the pulmonary arteries, and QP/QS ratios were calculated pre- and postoperatively using the gamma variate fit method and compared with the QP/QS ratio from first pass radionuclide studies. A strong correlation between preoperative digital subtraction angiographically derived QP/QS ratio and radionuclide-derived QP/QS ratio was found, with an r value equal to 0.89, p less than 0.0001. Postoperatively, all patients had a QP/QS ratio less than 1.2:1.0 for both digital subtraction angiography and radionuclide studies. The level of left to right shunt was accurately assessed in all patients, and its absence observed postoperatively. Associated anomalies, such as a persistent left superior vena cava, coarctation of the aorta and partial anomalous venous return, were identified in all cases
Bruning, Stephen D.
2002-01-01
Determines whether student-university relationship attitudes and satisfaction evaluations distinguished those who returned to a university from those who did not. Shows that respondent relationship attitudes differentiate those who returned to the university from those who did not, which provides a quantitative illustration of the benefits of…
Measurement of left-to-right shunts by gated radionuclide angiography: concise communication
International Nuclear Information System (INIS)
Rigo, P.; Chevigne, M.
1982-01-01
Gated cardiac blood-pool scans allow comparison of left- and right-ventricular stroke volume. We have applied these measurements to the quantification of left-to-right shunts (QP/QS) in nine patients with atrial septal defects, one patients with partial anomalous pulmonary venous return, four patients with ventricular septal defects, and two patients with patent ductus arteriosus. None of these patients had combined lesions. QP/QS was measured as the right-ventricular (RV) stroke counts divided by the left-ventricular (LV) stroke counts and as the LV stroke counts divided by the RV stroke counts in patients with RV and LV diastolic volume overload respectively. All patients had also QP/QS measurements by oximetry and first-pass radionuclide angiography. The stroke-count measurements indicated the overloaded ventricle in all patients. QP/QS determined by equilibrium gated studies correlated well with those obtained by oximetry (r . 0.79). Reproducibility of the equilibrium measurements was good. We conclude that gated cardiac blood-pool scans can measure left-to-right shunts and can distinguish between shunts with RV and LV volume overload
Abu-Nimer, Mohammed; Nasser, Ilham; Ouboulahcen, Seddik
2016-01-01
Quranic schools (QS) play a central role in the education system in the Islamic world. Despite their relatively small numbers, QS teachers play a major role in introducing Islamic values to the public. Thus, working with QS becomes a key strategy in influencing local Islamic discourse. This article introduces a case study of a program integrating…
Rivera Almeyda, Oscar G.
In this investigation, the processing-structure-property relations are correlated for solid state additively manufactured (SSAM) Inconel 625 (IN 625) and a SSAM aluminum alloy 2219 (AA2219). This is the first research of these materials processed by a new SSAM method called additive friction stir (AFS). The AFS process results in a refined grain structure by extruding solid rod through a rotating tool generating heat and severe plastic deformation. In the case of the AFS IN625, the IN625 alloy is known for exhibiting oxidation resistance and temperature mechanical stability, including strength and ductility. This study is the first to investigate the beneficial grain refinement and densification produced by AFS in IN625 that results in advantageous mechanical properties (YS, UTS, epsilonf) at both quasi-static and high strain rate. Electron Backscatter Diffraction (EBSD) observed dynamic recrystallization and grain refinement during the layer deposition in the AFS specimens, where the results identified fine equiaxed grain structures formed by dynamic recrystallization (DRX) with even finer grain structures forming at the layer interfaces. The EBSD quantified grains as fine as 0.27 microns in these interface regions while the average grain size was approximately 1 micron. Additionally, this is the first study to report on the strain rate dependence of AFS IN625 through quasi-static (QS) (0.001/s) and high strain rate (HR) (1500/s) tensile experiments using a servo hydraulic frame and a direct tension-Kolsky bar, respectively, which captured both yield and ultimate tensile strengths increasing as strain rate increased. Fractography performed on specimens showed a ductile fracture surface on both QS, and HR. Alternatively, the other AFS material system investigated in this study, AA2219, is mostly used for aerospace applications, specifically for rocket fuel tanks. EBSD was performed in the cross-section of the AA2219, also exhibiting DRX with equiaxed microstructure
Quorum Sensing Regulation of Adhesion in Serratia Marcescens MG1 is surface dependent
DEFF Research Database (Denmark)
Labbate, M.; Zhu, H.; Thung, L.
2007-01-01
in a non-QS-controlled fashion. Therefore, the expression of these two genes appears to be cocontrolled by regulators other than the QS system for mediation of attachment to HCE cells. We also found that QS in S. marcescens regulates other potential cell surface adhesins, including exopolysaccharide...... and the outer membrane protein OmpX. We concluded that S. marcescens MG1 utilizes different regulatory systems and adhesins in attachment to biotic and abiotic surfaces and that QS is a main regulatory pathway in adhesion to an abiotic surface but not in adhesion to a biotic surface....
DEFF Research Database (Denmark)
Hansen, Mette Reimert; Le Quement, Sebastian Thordal; Jakobsen, Tim Holm
2014-01-01
‐homoserine lactones. With the goal of identifying non‐native compounds capable of modulating bacterial QS, a virtual library of N‐dipeptido L‐homoserine lactones was screened in silico with two different crystal structures of LasR. The 30 most promising hits were synthesized on HMBA‐functionalized PEGA resin...
Harnessing the Power of Sibling Relationships as a Tool for Optimizing Social-Emotional Development
Stormshak, Elizabeth A.; Bullock, Bernadette M.; Falkenstein, Corinna A.
2009-01-01
Sibling relationships provide one of the most stable and powerful developmental contexts for the transmission of both prosocial and antisocial behavior. As a source of support and skill development, sibling relationships can build competence in self-regulation and emotional understanding. However, sibling relationships marked by antisocial…
Shear wave velocity versus quality factor: results from seismic noise recordings
Boxberger, Tobias; Pilz, Marco; Parolai, Stefano
2017-08-01
The assessment of the shear wave velocity (vs) and shear wave quality factor (Qs) for the shallow structure below a site is necessary to characterize its site response. In the past, methods based on the analysis of seismic noise have been shown to be very efficient for providing a sufficiently accurate estimation of the vs versus depth at reasonable costs for engineering seismology purposes. In addition, a slight modification of the same method has proved to be able to provide realistic Qs versus depth estimates. In this study, data sets of seismic noise recorded by microarrays of seismic stations in different geological environments of Europe and Central Asia are used to calculate both vs and Qs versus depth profiles. Analogous to the generally adopted approach in seismic hazard assessment for mapping the average shear wave velocity in the uppermost 30 m (vs30) as a proxy of the site response, this approach was also applied to the quality factor within the uppermost 30 m (Qs30). A slightly inverse correlation between both parameters is found based on a methodological consistent determination for different sites. Consequently, a combined assessment of vs and Qs by seismic noise analysis has the potential to provide a more comprehensive description of the geological structure below a site.
Harnessing the power of sibling relationships as a tool for optimizing social-emotional development.
Stormshak, Elizabeth A; Bullock, Bernadette M; Falkenstein, Corinna A
2009-01-01
Sibling relationships provide one of the most stable and powerful developmental contexts for the transmission of both prosocial and antisocial behavior. As a source of support and skill development, sibling relationships can build competence in self-regulation and emotional understanding. However, sibling relationships marked by antisocial behavior, substance use, and conflict place children at risk for a host of negative outcomes. Family relationship features, particularly parenting practices and discord, contribute strongly to both the quality of sibling relationships and children's well-being. Our review of intervention strategies reveals that the potential of sibling relationships to promote socioemotional development may be best realized through family-centered approaches that build prosocial sibling interactions, curtail child behavior problems, and strengthen parenting.
International Nuclear Information System (INIS)
Rancourt, D.G.
1994-01-01
We develop the methodology of quadrupole splitting distribution (QSD) analysis by evaluating the influences of absorber thickness, absorber texture, and the asumed Lorentzian width on the extracted QSD. We then present the first study to describe the Moessbauer spectra of members of a mineral family in terms of QSDs. The Fe 2+ QSD and its characteristics (average QS, peak QS, skewness, and standard deviation) show gradual trends with changing Fe/(Fe+Mg) in a synthetic Al-deficient phlogopite-annite series. Al-deficient natural samples of phlogopite and annite show similar behaviour. The Fe 2+ QSDs can be interpreted as population distribuitions of local distortion environments (LDEs) and, as such, contain much information that will become more accessible as theoretical calculations linking particular LDEs to corresponding QS values are developed. (orig.)
Heart rate variability during sleep in healthy term newborns in the early postnatal period
International Nuclear Information System (INIS)
Doyle, O M; Korotchikova, I; Boylan, G B; Lightbody, G; Marnane, W; Kerins, D
2009-01-01
Normative time- and frequency-domain heart rate variability (HRV) measures were extracted during quiet sleep (QS) and active sleep (AS) periods in 30 healthy babies. All newborn infants studied were less than 12 h old and the sleep state was classified using multi-channel video EEG. Three bands were extracted from the heart rate (HR) spectrum: very low frequency (VLF), 0.01–0.04 Hz; low frequency (LF), 0.04–0.2 Hz, and high frequency (HF), >0.2 Hz. All metrics were averaged across all patients and per sleep state to produce a table of normative values. A noticeable peak corresponding to activity in the RSA band was found in 80% patients during QS and 0% of patients during AS, although some broadband activity was observed. The majority of HRV metrics showed a statistically significant separation between QS and AS. It can be concluded that (i) activity in the RSA band is present during QS in the healthy newborn, in the first 12 h of life, (ii) HRV measures are affected by sleep state and (iii) the averaged HRV metrics reported here could assist the interpretation of HRV data from newborns with neonatal illnesses
Directory of Open Access Journals (Sweden)
M. Hema
2017-10-01
Full Text Available Vibrio cholerae is a Gram-negative pathogen which causes acute diarrhoeal disease, cholera by the expression of virulence genes through quorum sensing (QS mechanism. The QS circuit of V. cholerae is controlled by the global quorum regulator, LuxO, which at low cell density (LCD state produces major virulence factors such as, toxin co-regulated pilus (TCP and cholera toxin (CT to mediate infection. On the contrary, at the high cell density (HCD state the virulent genes are downregulated and the vibrios are detached from the host intestinal epithelial cells, promoted by HapA protease. Hence, targeting the global regulator LuxO would be a promising approach to modulate the QS to curtail V. cholerae pathogenesis. In our earlier studies, LuxO targeted ligand, 2,3 pyrazine dicarboxylic acid (PDCA and its derivatives having desired pharmacophore properties were chemically synthesized and were shown to have biofilm inhibition as well as synergistic activity with the conventionally used antibiotics. In the present study, the QS modulatory effect of the PDCA derivative with pyrrolidine moiety designated as PDCApy against the V. cholerae virulence gene expression was analyzed at various growth phases. The data significantly showed a several fold reduction in the expression of the genes, tcp and ct whereas the expression of hapR was upregulated at the LCD state. In addition, PDCApy reduced the adhesion and invasion of the vibrios onto the INT407 intestinal cell lines. Collectively, our data suggest that PDCApy could be a potential QS modulator (QSM for the antivirulence therapeutic approach.
Torreggiani, Armida; Domènech, Jordi; Orihuela, Ruben; Ferreri, Carla; Atrian, Sílvia; Capdevila, Mercè; Chatgilialoglu, Chryssostomos
2009-06-08
Metallothioneins (MTs) are sulfur-rich proteins capable of binding metal ions to give metal clusters. The metal-MT aggregates used in this work were Zn- and Cd-QsMT, where QsMT is an MT from the plant Quercus suber. Reactions of reductive reactive species (H(*) atoms and e(aq)(-)), produced by gamma irradiation of water, with Zn- and Cd-QsMT were carried out in both aqueous solutions and vesicle suspensions, and were characterized by different approaches. By using a biomimetic model based on unsaturated lipid vesicle suspensions, the occurrence of tandem protein/lipid damage was shown. The reactions of reductive reactive species with methionine residues and/or sulfur-containing ligands afford diffusible sulfur-centred radicals, which migrate from the aqueous phase to the lipid bilayer and transform the cis double bond of the oleate moiety into the trans isomer. Tailored experiments allowed the reaction mechanism to be elucidated in some detail. The formation of sulfur-centred radicals is accompanied by the modification of the metal-QsMT complexes, which were monitored by various spectroscopic and spectrometric techniques (Raman, CD, and ESI-MS). Attack of the H(*) atom and e(aq)(-) on the metal-QsMT aggregates can induce significant structural changes such as partial deconstruction and/or rearrangement of the metal clusters and breaking of the protein backbone. Substantial differences were observed in the behaviour of the Zn- and Cd-QsMT aggregates towards the reactive species, depending on the different folding of the polypeptide in these two cases.
Constrained relationship agency as the risk factor for intimate ...
African Journals Online (AJOL)
gender inequality (UNDP, 2015; Southern Africa Regional .... Table 1: Weighted transactional sex consonance score items ..... gendered relationship norms and economic power dynamics from the ... may limit a woman's ability to exit a violent relationship, or .... validate and contextualize quantitative findings: A case study of.
Kuo, Patty Beyrong; Woo, Hongryun; Bang, Na Mi
2017-01-01
The authors examined the relationship between research self-efficacy, motivation, and productivity, as well as advisory relationship as a moderator, among 190 counselor education doctoral students. Research self-efficacy and motivation predicted productivity. Advisory relationship moderated the relationship between intrinsic and failure avoidance…
Sex as a Moderator of the Beauty-Good Relationship.
Schneider, Paul A.; And Others
The relationship between physical attractiveness and social competence is complex. A study was undertaken to assess the relationship between ratings of physical attractiveness and ratings of conversational skill. Sixty male and 60 female undergraduates viewed tapes depicting 18 heterosocial interactions. Subjects were asked to rate physical…
Zhou, Jian-Ying; Yan, Jin-Mei; Li, Jian; Li, Dong-Zhi
2016-06-01
Nondeletional α-thalassemia (α-thal) is the result of point mutations in critical regions of the α-globin genes, affecting mRNA processing, mRNA translation, or α-globin stability. Hb Constant Spring (Hb CS, HBA2: c.427T > C) is the most common nondeletional α-thal that results from a nucleotide substitution at the termination codon of the α2-globin gene. Hb Quong Sze (Hb QS, HBA2: c.377T > C) is another nondeletional α-thal in South China with the missense mutation at codon 125 of the α2-globin gene making this hemoglobin (Hb) variant highly unstable. Although homozygosity for Hb CS (α(CS)α/α(CS)α) or Hb QS (α(QS)α/α(QS)α) has been reported, clinical pictures vary from severe hemolysis that developed early in life to only mild anemia, no clinical phenotypic data of compound heterozygosity for Hb CS/Hb QS (α(CS)α/α(QS)α) has been described. In this report we describe an adult case with such a compound heterozygosity who presented with a mild α-thal.
DEFF Research Database (Denmark)
Schwenteit, Johanna; Gram, Lone; Nielsen, Kristian Fog
2011-01-01
The Gram-negative fish pathogenic bacterium Aeromonas salmonicida possesses the LuxIRtype quorum sensing (QS) system, termed AsaIR. In this study the role of QS in A. salmonicida subsp. achromogenes virulence and pigment production was investigated. Five wild-type Asa strains induced the N......Ideficient mutant was 20-fold higher than that of the isogenic wt strain and the mean day to death of the mutant was significantly prolonged. Furthermore, the expression of two virulence factors (a toxic protease, AsaP1, and a cytotoxic factor) and a brown pigment were reduced in the mutant. AsaP1 productionwas...... virulence in fish and QS has not previously been associated with A. salmonicida infections in fish. Furthermore, AsaP1 production has not previously been shown to be QS regulated. The simplicity of the A. salmonicida subsp. achromogenes LuxIR-type QS system and the observation that synthetic QSI can inhibit...
A practical approach for the calculation of the activation energy of the sintering
Directory of Open Access Journals (Sweden)
Pouchly Vaclav
2016-01-01
Full Text Available Newly developed software for calculation of activation energy (Qs in the following of sintering using the Wang and Raj model is presented. To demonstrate the practical potential of the software and to evaluate the behaviour of the Qs during the sintering process, alumina and cubic zirconia ceramic compacts were prepared from nanometric powders. The results obtained with both materials are in agreement with previously published data calculated by different approaches. In the interval of interest (relative densities from 60 % to almost 100 % of theoretical density, both materials show similar behaviour. Three distinct regions can be seen: the initial constant values of Qs 868 kJ/mol and 762 kJ/mol for alumina and cubic zirconia, respectively; a region containing linear drop of Qs and the final region of constant Qs values 625 kJ/mol and 645 kJ/mol for alumina and cubic zirconia, respectively.
Srinivasan, Ramanathan; Vigneshwari, Loganathan; Rajavel, Tamilselvam; Durgadevi, Ravindran; Kannappan, Arunachalam; Balamurugan, Krishnaswamy; Pandima Devi, Kasi; Veera Ravi, Arumugam
2018-04-01
Urinary tract infections are the utmost common bacterial infections caused by Proteus mirabilis, Pseudomonas aeruginosa, Escherichia coli, and Serratia marcescens. These uropathogens resist the action of several antibiotics due to their ability to form biofilms. Most of these bacterial pathogens use the quorum sensing (QS) machinery to co-ordinate their cells and regulate several virulence factors and biofilm formation. On the other hand, the anti-quorum sensing (anti-QS) and antibiofilm potential of silver nanoparticles have been well reported against certain bacterial pathogens, but to the best of our knowledge, no report is available against the pathogenicity of uropathogens in particular S. marcescens and P. mirabilis. Therefore, the present study is primarily focused on the anti-QS and antibiofilm potential of Piper betle-based synthesized silver nanoparticles (PbAgNPs) against S. marcescens and P. mirabilis. Initially, the silver nanoparticles were synthesized by the aqueous extract of P. betle and characterized by UV-absorbance spectroscopy, XRD, FT-IR, SEM, TEM, and DLS. The synthesized silver nanoparticles were assessed for their anti-QS activity and the obtained results revealed that the PbAgNPs inhibited the QS-mediated virulence factors such as prodigiosin, protease, biofilm formation, exopolysaccharides and hydrophobicity productions in uropathogens. The gene expression analysis divulged the downregulation of fimA, fimC, flhD, and bsmB genes in S. marcescens and flhB, flhD, and rsbA genes in P. mirabilis, respectively. The in vivo Caenorhabditis elegans assays revealed the non-toxic and anti-adherence efficiency of PbAgNPs. Furthermore, the non-toxic effect of PbAgNPs was also confirmed through peripheral blood mononuclear cells and normal lung epithelial cells. Therefore, the contemporary study demonstrates the use of PbAgNPs as a possible alternative toward conventional antibiotics in controlling QS and biofilm-related uropathogen infections.
Professional development as learning in relationships
Noworolnik-Mastalska, Monika
2013-01-01
The article presents a clasification of selected leading conceptions within professional development, using socio-cultural perspective of learning in different relationships. Beside drawing on the classical social theory of learning through interactions with others, another dimensions of learning are added: related to the self, personal dimension of learning through professional identity development and societal dimension, where learning results from the ability to respond comprehensively to ...
Ruark, Allison; Kajubi, Phoebe; Ruteikara, Sam; Green, Edward C; Hearst, Norman
2018-04-01
Despite evidence that a greater focus on couples could strengthen HIV prevention efforts, little health-related research has explored relationship functioning and relationship quality among couples in Africa. Using data from 162 couples (324 individuals) resident in a peri-urban Ugandan community, we assessed actor and partner effects of sexual risk behaviors on relationship quality, using psychometric measures of dyadic adjustment, sexual satisfaction, commitment, intimacy, and communication. For women and men, poor relationship quality was associated with having concurrent sexual partners and suspecting that one's partner had concurrent sexual partners (actor effects). Women's poor relationship quality was also associated with men's sexual risk behaviors (partner effects), although the inverse partner effect was not observed. These findings suggest that relationship quality is linked to HIV risk, particularly through the pathway of concurrent sexual partnerships, and that positive relationship attributes such as sexual satisfaction, intimacy, and constructive communication can help couples to avoid risk.
THE EDUCATION RELATIONSHIP DEVELOPMENT BETWEEN CHINA AND INDONESIA AS ASEAN MEMBER
Directory of Open Access Journals (Sweden)
Adi Maulana
2018-02-01
Full Text Available China and ASEAN have long history on their relationship. One of ASEAN countries, Indonesia, along with China are two big countries in Asia with similar national interests and objectives in partnership, which are peace and prosperity of G20, APEC, 10+1, and 10+3, in which Indonesia is an active participant. One of the cooperation between China and ASEAN is through education. Indonesia may promote student exchange as well as proposing the idea of students exchange in various forums such as ASEAN-China free-trade, culture, tourism, education and many others. However, the data shown that the proportion of ASEAN students in China do not reflect the proportion of population of each ASEAN countries. Indonesia, the largest country by population, only sends the second biggest number of students to China behind Thailand, which puts the most students in China Education. This paper discusses the ups and downs of Indonesia-China relationship in education. SWOT analysis is used to see Indonesia-China relationship in the perspective of ASEAN. It can be concluded that cooperation among countries is inevitable measure facing the more challenging world. However the rough past has created mistrust and prejudice on both sides. But the need to collaborate has shown to be beneficial in promoting education cooperation.
S-parts of terms of integer linear recurrence sequences
Bugeaud, Y.; Evertse, J.H.
2017-01-01
Let S = {q1 , . . . , qs } be a finite, non-empty set of distinct prime numbers. For a non-zero integer m, write m = q1^ r1 . . . qs^rs M, where r1 , . . . , rs are non-negative integers and M is an integer relatively prime to q1 . . . qs. We define the S-part [m]_S of m by [m]_S := q1^r1 . . .
Programming the Linpack Benchmark for the IBM PowerXCell 8i Processor
Directory of Open Access Journals (Sweden)
Michael Kistler
2009-01-01
Full Text Available In this paper we present the design and implementation of the Linpack benchmark for the IBM BladeCenter QS22, which incorporates two IBM PowerXCell 8i1 processors. The PowerXCell 8i is a new implementation of the Cell Broadband Engine™2 architecture and contains a set of special-purpose processing cores known as Synergistic Processing Elements (SPEs. The SPEs can be used as computational accelerators to augment the main PowerPC processor. The added computational capability of the SPEs results in a peak double precision floating point capability of 108.8 GFLOPS. We explain how we modified the standard open source implementation of Linpack to accelerate key computational kernels using the SPEs of the PowerXCell 8i processors. We describe in detail the implementation and performance of the computational kernels and also explain how we employed the SPEs for high-speed data movement and reformatting. The result of these modifications is a Linpack benchmark optimized for the IBM PowerXCell 8i processor that achieves 170.7 GFLOPS on a BladeCenter QS22 with 32 GB of DDR2 SDRAM memory. Our implementation of Linpack also supports clusters of QS22s, and was used to achieve a result of 11.1 TFLOPS on a cluster of 84 QS22 blades. We compare our results on a single BladeCenter QS22 with the base Linpack implementation without SPE acceleration to illustrate the benefits of our optimizations.
International Nuclear Information System (INIS)
Tafaghodi, M.; Tabasi, S. Abolghasem Sajadi; Kharazizdeh, M.
2008-01-01
Several antigens, adjuvants and delivery systems have been evaluated for induction of protective immune responses against leishmaniasis, but have mostly been inefficient. In this study, poly (d,1-lactide-co-glycolide) (PLGA) nanospheres as antigen delivery system and Quillaja saponins (QS) as an immunoadjuvant have been used to increase the immune responses against Autoclaved Lieshmania major (ALM). PLGA nanospheres were prepared using a double emulsion (W/O/W) technique. The internal aqueous phase contained ALM and saponin, while the oily phase contained the solution of PLGA in dichloromethane and the external aqueous phase was polyvinylacohol (PVA) 7.5% (W/V) solution. Particulate characteristics were studied by scanning electron microscope and particle size analyzer. The encapsulation efficiency was determined by Lowry method and the release profile of antigen and saponin from nanospheres was evaluated for one week. Nanospheres were spherical in shape having smooth surfaces. Mean diameters for nanospheres loaded with ALM and ALM+QS were 300+-123 nm and 294+-106 nm respectively. Encapsulation efficiencies for ALM and QS were found 71+-14.8% and 55.8+- 23.1% respectively. Evaluation of the release profiles of ALM and QS from nanospheres in one week showed that 44.8 +-0.8% of ALM and 29.5+- 0.21% of QS had been released from naospheres. In conclusion, the prepared nanospheres with desirable size, encapsulation efficiency, and slow rate of release, had acceptable features for future in vivo studies. (author)
Directory of Open Access Journals (Sweden)
White DE
2016-12-01
Full Text Available Deborah E White,1 Jill M Norris,1 Karen Jackson,2 Farah Khandwala3 1Faculty of Nursing, University of Calgary, 2Workforce Research and Evaluation, Alberta Health Services, 3Cancer Care Services, Alberta Health Services, Calgary, AB, Canada Background: Health care organizations are utilizing quality and safety (QS teams as a mechanism to optimize care. However, there is a lack of evidence-informed best practices for creating and sustaining successful QS teams. This study aimed to understand what health care leaders viewed as barriers and facilitators to establishing/implementing and measuring the impact of Canadian acute care QS teams.Methods: Organizational senior leaders (SLs and QS team leaders (TLs participated. A mixed-methods sequential explanatory design included surveys (n=249 and interviews (n=89. Chi-squared and Fisher’s exact tests were used to compare categorical variables for region, organization size, and leader position. Interviews were digitally recorded and transcribed for constant comparison analysis.Results: Five qualitative themes overlapped with quantitative data: (1 resources, time, and capacity; (2 data availability and information technology; (3 leadership; (4 organizational plan and culture; and (5 team composition and processes. Leaders from larger organizations more often reported that clear objectives and physician champions facilitated QS teams (p<0.01. Fewer Eastern respondents viewed board/senior leadership as a facilitator (p<0.001, and fewer Ontario respondents viewed geography as a barrier to measurement (p<0.001. TLs and SLs differed on several factors, including time to meet with the team, data availability, leadership, and culture.Conclusion: QS teams need strong, committed leaders who align initiatives to strategic directions of the organization, foster a quality culture, and provide tools teams require for their work. There are excellent opportunities to create synergy across the country to address each
Institute of Scientific and Technical Information of China (English)
XU Zhiqiang; ZHOU Qixing; LIU Weitao
2009-01-01
In northeastern China,large area of vegetable land has been simultaneously polluted by cadmium (Cd) and lead (Pb).Joint effects of Cd and Pb on Chinese cabbage (Brassica pekinensis L.) were investigated using the seed germination and sand culture method.Four Chinese cabbage cultivars including Kangbingjinchun (KB),Dongyangchunxia (DY),Qinglvwang (QL) and Qiangshi (QS) from Shenyang in northeastern China were adopted in this study.The results showed that there were positive linear relationships between the inhibitory rate of biomass,root and shoot elongation and the concentrations of Cd and Pb.In particular,root elongation was more sensitive to joint stress of Cd and Pb.The activity of superoxide dismutase (SOD) and the content of malondialdehyde (MDA),soluble protein (SP) and proline (PRO) changed significantly with increasing exposure concentration of Cd and Pb.The decrement in the activity of antioxidative enzymes,the content of SP and accumulation of MDA were relatively low in KB and QS.PRO played an important role in resisting Cd and Pb stress.
Energy Technology Data Exchange (ETDEWEB)
Kim, Yang Min [Sejong General Hospital, Bucheon (Korea, Republic of)
2006-08-15
Determination of pulmonary to systemic blood flow ratio (QP/QS) is important for the management of patients with left-to-right shunt. This study was performed to assess the agreement of Qp/Qs ratio using the radionuclide method and oxymetry, to investigate the factors influencing the agreement, and to know how interchangeable the results of each technique. We compared the Qp/Qs measured by single-pass radionuclide angiocardiography and oxymetry during catheterization in 207 patients who underwent both studies. In radionuclide method, Qp/Qs was calculated from the pulmonary time-activity curves using a gamma variate fit. The correlation and Bland-Altman analysis were performed according to the levels of shunt and associated lesions. The mean Qp/Qs was 1.83 {+-} 0.50 by radionuclide, and 1.74 {+-} 0.51 by oxymetry. The overall correlation coefficient was 0.86 ({rho} 0.001), and Bland-Altman range of agreement encompassing 4SD was 1.05. For atrial septal defect, ventricular septal defect, patent ductus arteriosus, tricuspid and mitral insufficiency, the correlation coefficient was 0.78, 0.90, 0.84, 0.63 and 0.44 and Bland-Altman range was 1.52, 0.74, 0.96, 1.57 and 1.50, respectively. There is good agreement but wide variance between the Qp/Qs ratios by radionuclide method and oxymetry. Associated atrioventricular valvar insufficiency decreases the correlation coefficient and widens the variance. Wide overall variance suggests that Qp/Qs measurements by two techniques should not be used interchangeably.
International Nuclear Information System (INIS)
Kim, Yang Min
2006-01-01
Determination of pulmonary to systemic blood flow ratio (QP/QS) is important for the management of patients with left-to-right shunt. This study was performed to assess the agreement of Qp/Qs ratio using the radionuclide method and oxymetry, to investigate the factors influencing the agreement, and to know how interchangeable the results of each technique. We compared the Qp/Qs measured by single-pass radionuclide angiocardiography and oxymetry during catheterization in 207 patients who underwent both studies. In radionuclide method, Qp/Qs was calculated from the pulmonary time-activity curves using a gamma variate fit. The correlation and Bland-Altman analysis were performed according to the levels of shunt and associated lesions. The mean Qp/Qs was 1.83 ± 0.50 by radionuclide, and 1.74 ± 0.51 by oxymetry. The overall correlation coefficient was 0.86 (ρ 0.001), and Bland-Altman range of agreement encompassing 4SD was 1.05. For atrial septal defect, ventricular septal defect, patent ductus arteriosus, tricuspid and mitral insufficiency, the correlation coefficient was 0.78, 0.90, 0.84, 0.63 and 0.44 and Bland-Altman range was 1.52, 0.74, 0.96, 1.57 and 1.50, respectively. There is good agreement but wide variance between the Qp/Qs ratios by radionuclide method and oxymetry. Associated atrioventricular valvar insufficiency decreases the correlation coefficient and widens the variance. Wide overall variance suggests that Qp/Qs measurements by two techniques should not be used interchangeably
Upgrading tantalum and niobium oxides content in Bangka tin slag with double leaching
Soedarsono, J. W.; Permana, S.; Hutauruk, J. K.; Adhyputra, R.; Rustandi, A.; Maksum, A.; Widana, K. S.; Trinopiawan, K.; Anggraini, M.
2018-03-01
Tantalum has become one of the 14 types of critical materials where the level of its availability is assumed as the midterm critical metal. Benefits of the element tantalum in the electronics field increased the deficit balance of supply / demand, as more variations of electronic products developed. The tantalum experts calculated the level of availability until 2020. Base on the previous studies, tin slag is a secondary source of tantalum and niobium. This study uses tin slag from Bangka, Indonesia, abbreviated, Bangka Tin Slag (BTS). BTS was roasted, water quenched and sieved, abbreviated BTS-RQS.BTS was roasted, water quenched and sieved, abbreviated BTS-RQS.BTS-RQS was roasted at a temperature 700□C given sample code BTS-R700QS, while roasted at 800°C given sample code BTS-R800QS.A variable leaching experiment on BTS-R700QS was solvent concentration variable and on BTS-R800QS was time variable. The entire residue was characterized by X-Ray Fluorescence (XRF), and the optimum results are on the BTS-R800QS leaching into 5 M NaOH for 20 min followed by 5M HCl for 50 min, with content of Ta2O5 and Nb2O51.56% and 1.11%, respectively. The result of XRF measurement showed was the increasing of TNO content due to the increasing solvent concentration and time of acid leaching. The discussion of thermodynamics this study used was HSC Chemistry 6 as a supporting data.
Global voltage control for the LEP RF system
International Nuclear Information System (INIS)
Ciapala, E.; Butterworth, A.; Peschardt, E.
1993-01-01
The LEG RF system is installed as independent 16 cavity units. In addition to the eight copper cavity units originally installed 12 units with super-conducting cavities are being added for the LEP200 energy upgrade. The total RF voltage determines the synchrotron tune (Qs) and must be controlled precisely during energy ramping. Local function generators in each of the RF units are pre-loaded such that when triggered simultaneously by ramp timing events transmitted over the general timing system the total voltage varies to give the Qs function required. A disadvantage is that loss of RF in a unit at any time after the loading process cannot be corrected. As the number of RF units increases automatic control of the total RF voltage and its distribution around LEP becomes desirable. A global voltage control system, based on a central VME controller, has recently been installed. It has direct and rapid access to the RF units over the LEP time division multiplexing system. Initial tests on operation and performance at fixed energy and during energy ramping are described, as well as the implementation of a Qs loop in which Qs can be set directly using on-line synchrotron frequency measurements
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When determination of relationship as...' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS...) Divorced spouse. The claimant's relationship as the divorced spouse of an employee is determined when the...
Quorum Quenching in Culturable Phyllosphere Bacteria from Tobacco
Directory of Open Access Journals (Sweden)
Guoqiang Zhuang
2013-07-01
Full Text Available Many Gram-negative plant pathogenic bacteria employ a N-acylhomoserine lactone (AHL-based quorum sensing (QS system to regulate their virulence traits. A sustainable biocontrol strategy has been developed using quorum quenching (QQ bacteria to interfere with QS and protect plants from pathogens. Here, the prevalence and the diversity of QQ strains inhabiting tobacco leaf surfaces were explored. A total of 1177 leaf-associated isolates were screened for their ability to disrupt AHL-mediated QS, using the biosensor Chromobacterium violaceum CV026. One hundred and sixty-eight strains (14% are capable of interfering with AHL activity. Among these, 106 strains (63% of the culturable quenchers can enzymatically degrade AHL molecules, while the remaining strains might use other QS inhibitors to interrupt the chemical communication. Moreover, almost 79% of the QQ strains capable of inactivating AHLs enzymatically have lactonase activity. Further phylogenetic analysis based on 16S rDNA revealed that the leaf-associated QQ bacteria can be classified as Bacillus sp., Acinetobacter sp., Lysinibacillus sp., Serratia sp., Pseudomonas sp., and Myroides sp. The naturally occurring diversity of bacterial quenchers might provide opportunities to use them as effective biocontrol reagents for suppressing plant pathogen in situ.
The mind-body relationship in psychotherapy: Grounded cognition as an explanatory framework
Directory of Open Access Journals (Sweden)
Nuwan Dominic Leitan
2014-05-01
Full Text Available As a discipline, psychology is defined by its location in the ambiguous space between mind and body, but theories underpinning the application of psychology in psychotherapy are largely silent on this fundamental metaphysical issue. This is a remarkable state of affairs, given that psychotherapy is typically a real-time meeting between two embodied agents, with the goal of facilitating behavior change in one party. The overarching aim of this paper is to problematize the mind-body relationship in psychotherapy in the service of encouraging advances in theory and practice. The paper briefly explores various psychotherapeutic approaches to help explicate relationships between mind and body from these perspectives. Themes arising from this analysis include a tendency toward dualism (separation of mind and body from the conceptualization of human functioning, exclusivism (elimination of either mind or body from the conceptualization of human functioning, or mind-body monism (conceptualization of mind and body as a single, holistic system. We conclude that the literature, as a whole, does not demonstrate consensus, regarding the relationship between mind and body in psychotherapy. We then introduce a contemporary, holistic, psychological conceptualization of the relationship between mind and body, and argue for its potential utility as an organizing framework for psychotherapeutic theory and practice. The holistic approach we explore, grounded cognition, arises from a long philosophical tradition, is influential in current cognitive science, and presents a coherent empirically testable framework integrating subjective and objective perspectives. Finally, we demonstrate how this grounded cognition perspective might lead to advances in the theory and practice of psychotherapy.
The mind-body relationship in psychotherapy: grounded cognition as an explanatory framework.
Leitan, Nuwan D; Murray, Greg
2014-01-01
As a discipline, psychology is defined by its location in the ambiguous space between mind and body, but theories underpinning the application of psychology in psychotherapy are largely silent on this fundamental metaphysical issue. This is a remarkable state of affairs, given that psychotherapy is typically a real-time meeting between two embodied agents, with the goal of facilitating behavior change in one party. The overarching aim of this paper is to problematize the mind-body relationship in psychotherapy in the service of encouraging advances in theory and practice. The paper briefly explores various psychotherapeutic approaches to help explicate relationships between mind and body from these perspectives. Themes arising from this analysis include a tendency toward dualism (separation of mind and body from the conceptualization of human functioning), exclusivism (elimination of either mind or body from the conceptualization of human functioning), or mind-body monism (conceptualization of mind and body as a single, holistic system). We conclude that the literature, as a whole, does not demonstrate consensus, regarding the relationship between mind and body in psychotherapy. We then introduce a contemporary, holistic, psychological conceptualization of the relationship between mind and body, and argue for its potential utility as an organizing framework for psychotherapeutic theory and practice. The holistic approach we explore, "grounded cognition," arises from a long philosophical tradition, is influential in current cognitive science, and presents a coherent empirically testable framework integrating subjective and objective perspectives. Finally, we demonstrate how this "grounded cognition" perspective might lead to advances in the theory and practice of psychotherapy.
The mind-body relationship in psychotherapy: grounded cognition as an explanatory framework
Leitan, Nuwan D.; Murray, Greg
2014-01-01
As a discipline, psychology is defined by its location in the ambiguous space between mind and body, but theories underpinning the application of psychology in psychotherapy are largely silent on this fundamental metaphysical issue. This is a remarkable state of affairs, given that psychotherapy is typically a real-time meeting between two embodied agents, with the goal of facilitating behavior change in one party. The overarching aim of this paper is to problematize the mind–body relationship in psychotherapy in the service of encouraging advances in theory and practice. The paper briefly explores various psychotherapeutic approaches to help explicate relationships between mind and body from these perspectives. Themes arising from this analysis include a tendency toward dualism (separation of mind and body from the conceptualization of human functioning), exclusivism (elimination of either mind or body from the conceptualization of human functioning), or mind–body monism (conceptualization of mind and body as a single, holistic system). We conclude that the literature, as a whole, does not demonstrate consensus, regarding the relationship between mind and body in psychotherapy. We then introduce a contemporary, holistic, psychological conceptualization of the relationship between mind and body, and argue for its potential utility as an organizing framework for psychotherapeutic theory and practice. The holistic approach we explore, “grounded cognition,” arises from a long philosophical tradition, is influential in current cognitive science, and presents a coherent empirically testable framework integrating subjective and objective perspectives. Finally, we demonstrate how this “grounded cognition” perspective might lead to advances in the theory and practice of psychotherapy. PMID:24904486
Zhu, Hu; Wang, Shou-Xian; Zhang, Shuai-Shuai; Cao, Chun-Xu
2011-01-01
This study aimed to search for novel quorum sensing (QS) inhibitors from mushroom and to analyze their inhibitory activity, with a view to their possible use in controlling detrimental infections. The bioactive metabolites produced by mushroom cultivation were tested for their abilities to inhibit QS-regulated behavior. All mushroom strains were cultivated in potato-dextrose medium by large-scale submerged fermentation. The culture supernatant was condensed into 0.2 vol by freeze-drying. The condensed supernatant was sterilized by filtration through a 0.22-μm membrane filter and added to Chromobacterium violaceum CV026 cultures, which were used to monitor QS inhibition. Inhibitory activity was measured by quantifying violacein production using a microplate reader. The results have revealed that, of 102 mushroom strains, the bioactive metabolites produced by 14 basidiomycetes were found to inhibit violacein production, a QS-regulated behavior in C. violaceum. Higher fungi can produce QS-inhibitory compounds. Copyright © 2011 S. Karger AG, Basel.
The effect of quorum sensing system for growth competitiveness on Shigella flexneri.
Xu, Ping; Yang, Jing; Lu, Li-lan; Feng, Er-ling; Wang, Heng-liang; Lu, Ying; Zhu, Li
2015-05-01
Quorum sensing (QS) regulates the onset of bacterial social responses related to cell density. Comparison between the gene sequences of all components of QS system of Escherichia coli and Shigella strains, shows that the QS system is generally lost or mutated in Shigella. Since AI-2 is produced and processed by the lsr operon, we analyzed the potential function of the lsr operon. We first detected AI-2 in Shigella flexneri 2a strain 301 through the reporter bacteria Vibrio harveyi BB170, indicating that S. flexneri can produce AI-2. Then, the lsr operon of E. coli MG1655 was cloned into S. flexneri using the Golden Gate method. Colony counting experiments showed that the QS system recovery strain had growth advantage over the wild-type strain when they were mixed and cultured. The preliminary comparative proteomics analysis showed that the lsr operon could be expressed and the abundance of stress response proteins also changed when the QS system was introduced into S. flexneri.
The impact of email as a communicative medium on the doctor-patient relationship
DEFF Research Database (Denmark)
Jensen, Matilde Nisbeth; Fage-Butler, Antoinette Mary
Background and objective: Although theoretical perspectives on the doctor-patient relationship have characteristically assumed the temporal and physical co-presence of doctor and patient, the advent of email in doctor-patient communication has brought with it a different communicative reality. New...... technologies come with significant implications as, amongst other things, they impose practices and identities on participants (Malater 2007). The purpose of this integrative literature review is thus to investigate how the advent of email as a medium of communication affects the doctor-patient relationship...... of the medium, convenience, freedom from the clinical gaze, pseudo-anonymity and greater opportunities for reflection, whilst doctors express concerns about confidentiality, time and the challenge of conveying empathy electronically. Implications: The impact of email on the doctor-patient relationship has...
Chen, Shih-Chih; Jong, Din; Lai, Min-Tsai
2014-09-01
Numerous types of self-service technologies have prevailed due to innovations in network and information technology. To hospitals, patient intentions to continue to use the e-appointment system are crucial. Previous investigations discussed only the relationships between the technology readiness of users and their continuance intentions, and ignored the most important mediator, relationship quality. This study explored the relationships among technology readiness, relationship quality, and continuance intention. The research results demonstrated that both optimism and innovativeness significantly and positively influenced continuance intention through the mediating effect of relationship quality. However, discomfort and insecurity hid not significantly influence relationship quality or continuance intention. Finally, theoretical contributions, managerial implications and future research directions were discussed.
Kouros, Chrystyna D.; Papp, Lauren M.; Goeke-Morey, Marcie C.; Cummings, E. Mark
2015-01-01
Using a daily diary method, this study examined concurrent and time-lagged relations between marital and parent-child relationship qualities, providing a test of the spillover and compensatory hypotheses. Additionally, this study tested both mothers’ and fathers’ depressive symptoms as moderators of these daily linkages. Participants were 203 families, in which mothers and fathers completed daily diaries for 15 days. At the end of each reporting day, parents independently rated the emotional quality of their relationship with their spouse and with their child that day. Controlling for global levels of marital satisfaction, marital conflict, and parenting, a positive association was found between mothers’ and fathers’ daily ratings of marital quality and their ratings of parent-child relationship quality, supporting the spillover hypothesis. When considering time-lagged relations, support was found for the compensatory hypothesis for mothers: lower levels of marital quality were related to increases in mother-child relationship quality from one day to the next. Further, both maternal and paternal depressive symptoms moderated the link between marital quality and the other parent’s relationship quality with their child. Whereas maternal depressive symptoms strengthened spillover relations for fathers on the next day, paternal depression was related to less spillover for mothers on the same day. Alternative models did not find evidence for parent-child relationship quality as a predictor of changes in marital quality on the next day. The findings underscore the importance of the quality of the marital relationship for predicting the quality of other family relationships. PMID:24821519
Laser-tissue interaction in tattoo removal by q-switched lasers.
Barua, Shyamanta
2015-01-01
Q-switched (QS) lasers are widely considered the gold standard for tattoo removal, with excellent clinical results, impressive predictability, and a good safety profile. The generation of giant pulses by the method of Q-switching is responsible for the unique laser-tissue interaction that is seen in tattoo removal by QS lasers. The QS lasers work by impaction and dissolution of the tattoo pigments. Mechanical fragmentation of the tattoo pigments encased in intracellular lamellated organelles followed by their phagocytosis by macrophages is thought to be the major event in the clearance of pigments by QS lasers. A few novel techniques have been tried in recent times to hasten the clearance of tattoo pigments.
Ties That Bind: Academic Advisors as Agents of Student Relationship Management
Vianden, Jörg
2016-01-01
To affect college retention, academic advisors should act as agents of student relationship management by strengthening the connection between students and their institutions. Satisfaction and dissatisfaction with academic advising as perceived by 29 college students at 3 midwestern comprehensive institutions are described. Discussion is framed in…
DEFF Research Database (Denmark)
Zhang, Ling; Ulstrup, Jens; Zhang, Jingdong
2016-01-01
DNA quadruplexes (qs’s) are a class of “non-canonical” oligonucleotides (OGNs) composed of stacked guanine (G) quartets generally stabilized by monovalent cations. Metal porphyrins selectively bind to G-qs complexes to form DNAzyme, which can exhibit peroxidase and other catalytic activity simila...
The Organization of the Quorum Sensing luxI/R Family Genes in Burkholderia
Directory of Open Access Journals (Sweden)
Sándor Pongor
2013-07-01
Full Text Available Members of the Burkholderia genus of Proteobacteria are capable of living freely in the environment and can also colonize human, animal and plant hosts. Certain members are considered to be clinically important from both medical and veterinary perspectives and furthermore may be important modulators of the rhizosphere. Quorum sensing via N-acyl homoserine lactone signals (AHL QS is present in almost all Burkholderia species and is thought to play important roles in lifestyle changes such as colonization and niche invasion. Here we present a census of AHL QS genes retrieved from public databases and indicate that the local arrangement (topology of QS genes, their location within chromosomes and their gene neighborhoods show characteristic patterns that differ between the known Burkholderia clades. In sequence phylogenies, AHL QS genes seem to cluster according to the local gene topology rather than according to the species, which suggests that the basic topology types were present prior to the appearance of current Burkholderia species. The data are available at http://net.icgeb.org/burkholderia/.
Improved quorum sensing capacity by culturing Vibrio harveyi in microcapsules.
Gao, Meng; Song, Huiyi; Liu, Xiudong; Yu, Weiting; Ma, Xiaojun
2016-04-01
Microcapsule entrapped low density cells with culture (ELDCwc), different from free cell culture, conferred stronger stress resistance and improved cell viability of microorganisms. In this paper, the quorum sensing (QS) system of Vibrio harveyi was used to investigate changes when cells were cultured in microcapsules. Cells in ELDCwc group grew into cell aggregates, which facilitated cell-cell communication and led to increased bioluminescence intensity. Moreover, the luxS-AI-2 system, a well-studied QS signal pathway, was detected as both luxS gene and the AI-2 signaling molecule, and the results were analyzed with respect to QS capacity of unit cell. The V. harveyi of ELDCwc also showed higher relative gene expression and stronger quorum sensing capacity when compared with free cells. In conclusion, the confined microcapsule space can promote the cell aggregates formation, reduce cell-cell communication distance and increase local concentration of signal molecule, which are beneficial to bacterial QS. Copyright © 2015 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Privacy Challenges in the Quantified Self Movement – An EU Perspective
Directory of Open Access Journals (Sweden)
Leibenger Dominik
2016-10-01
Full Text Available The gathering of data about oneself (such as running speed, pulse, breathing rate, food consumption, etc. is rapidly becoming more popular, and has lead to the catch phrase “Quantified Self” (QS. While this trend creates opportunities both for individuals and for society, it also creates risks, due to the data’s personal and often sensitive nature. Countering these risks, while keeping the benefits of QS services, is a task both for the legal system and for the technical community. However, it should also take users’ expectations into account. We therefore analyze the legal situation of QS services based on European law and the privacy policies of some major service providers to clarify the practical consequences for users. We present the result of a study concerning the users’ views on privacy, revealing a conflict between the user’s expectations and the providers’ practices. To help resolve the conflict, we discuss how existing and future privacy-enhancing technologies can avoid the risks associated with QS services.
The Organization of the Quorum Sensing luxI/R Family Genes in Burkholderia
Choudhary, Kumari Sonal; Hudaiberdiev, Sanjarbek; Gelencsér, Zsolt; Coutinho, Bruna Gonçalves; Venturi, Vittorio; Pongor, Sándor
2013-01-01
Members of the Burkholderia genus of Proteobacteria are capable of living freely in the environment and can also colonize human, animal and plant hosts. Certain members are considered to be clinically important from both medical and veterinary perspectives and furthermore may be important modulators of the rhizosphere. Quorum sensing via N-acyl homoserine lactone signals (AHL QS) is present in almost all Burkholderia species and is thought to play important roles in lifestyle changes such as colonization and niche invasion. Here we present a census of AHL QS genes retrieved from public databases and indicate that the local arrangement (topology) of QS genes, their location within chromosomes and their gene neighborhoods show characteristic patterns that differ between the known Burkholderia clades. In sequence phylogenies, AHL QS genes seem to cluster according to the local gene topology rather than according to the species, which suggests that the basic topology types were present prior to the appearance of current Burkholderia species. The data are available at http://net.icgeb.org/burkholderia/. PMID:23820583
Directory of Open Access Journals (Sweden)
Mu-hsuan Huang
2011-06-01
Full Text Available This paper introduces three current major university ranking systems. The Performance Ranking of Scientific Papers for World Universities by Higher Education Evaluation and Accreditation Council of Taiwan (HEEACT Ranking emphasizes both the quality and quantity of research and current research performance. The Academic Ranking of World Universities by Shanghai Jiao Tung University (ARWU focuses on outstanding performance of universities with indicators such as Nobel Prize winners. The QS World University Ranking (2004-2009 by Times Higher Education (THE-QS emphasizes on peer review with high weighting in evaluation. This paper compares the 2009 ranking results from the three ranking systems. Differences exist in the top 20 universities in three ranking systems except the Harvard University, which scored top one in all of the three rankings. Comparisons also revealed that the THE-QS favored UK universities. Further, obvious differences can be observed between THE-QS and the other two rankings when ranking results of some European countries (Germany, UK, Netherlands, & Switzerland and Chinese speaking regions were compared.
Waldinger, Robert J; Vaillant, George E; Orav, E John
2007-06-01
The authors examined the quality of sibling relationships in childhood as a predictor of major depression in adulthood. Study subjects were 229 men selected for mental and physical health and followed from ages 20 through 50 and beyond as part of a study of adult psychosocial development. Data were obtained from interviews with participants and their parents at intake and from follow-up interviews and self-report questionnaires completed by participants at regular intervals. These data were used to rate the quality of relationships with siblings, the quality of parenting received in childhood, and family history of depression as well as the occurrence, by age 50, of major depression, alcoholism, and use of mood-altering drugs (tranquilizers, sleeping pills, and stimulants). Poorer relationships with siblings prior to age 20 and a family history of depression independently predicted both the occurrence of major depression and the frequency of use of mood-altering drugs by age 50, even after adjustment for the quality of childhood relationships with parents. Poor relationships with parents in childhood did not predict the occurrence of depression by age 50 when family history of depression and the quality of relationships with siblings were taken into account. Quality of sibling relationships and family history of depression did not predict later alcohol abuse or dependence. Poor sibling relationships in childhood may be an important and specific predictor of major depression in adulthood. Further study of links between childhood sibling relationships and adult depression is warranted.
Lifescience Database Archive (English)
Full Text Available vltlksmlikqvk*lptlkifslyqv mvwllvkvniqlqrwlkl*lkkvtmlnlvfiq*qvdyqvt*ifa*vkqrfhmtlfskwkk liqk*ki*i*qs*lvqmips...nlvfiq*qvdyqvt*ifa*vkqrfhmtlfskwkk liqk*ki*i*qs*lvqmipsivhqlkiqiqlslvcqllkfgkqnivsl*nvh*qmlvmpi fkiqyfinqilq
Tan, Chuan Hao; Koh, Kai Shyang; Xie, Chao; Tay, Martin; Zhou, Yan; Williams, Rohan; Ng, Wun Jern; Rice, Scott A; Kjelleberg, Staffan
2014-06-01
Quorum sensing (QS) signalling has been extensively studied in single species populations. However, the ecological role of QS in complex, multi-species communities, particularly in the context of community assembly, has neither been experimentally explored nor theoretically addressed. Here, we performed a long-term bioreactor ecology study to address the links between QS, organization and composition of complex microbial communities. The conversion of floccular biomass to highly structured granules was found to be non-random, but strongly and positively correlated with N-acyl-homoserine-lactone (AHL)-mediated QS. Specific AHLs were elevated up to 100-fold and were strongly associated with the initiation of granulation. Similarly, the levels of particular AHLs decreased markedly during the granular disintegration phase. Metadata analysis indicated that granulation was accompanied by changes in extracellular polymeric substance (EPS) production and AHL add-back studies also resulted in increased EPS synthesis. In contrast to the commonly reported nanomolar to micromolar signal concentrations in pure culture laboratory systems, QS signalling in the granulation ecosystem occurred at picomolar to nanomolar concentrations of AHLs. Given that low concentrations of AHLs quantified in this study were sufficient to activate AHL bioreporters in situ in complex granular communities, AHL mediated QS may be a common feature in many natural and engineered ecosystems, where it coordinates community behaviour.
Directory of Open Access Journals (Sweden)
Butenko Nataliia V.
2016-11-01
Full Text Available The aim of the article is to determine the transformation of sense of relationships between business entities in the national economy as well as basic ideas and principles of forming competitive advantages of effective relationships. The objective preconditions for the transition from the confrontation strategy to relationships as a basis of interaction of business entities in the structure of the national economy are analyzed. It is determined that the weakening of the antagonistic dominant of competitive relations and the growing importance of a constructive component of partnership has become a background of the desire of business entities to establish effective relationships. The attention is focused on the trends of the cooperation and integration approach to competitive behavior, which is manifested in such forms of competitive interactions as coordination, constructive interaction and competitive collaboration in order to achieve individual and common goals of competitive relationships of the entities. The competitive advantages based on establishing long-term and effective relationships are considered. The peculiarities in the formation of the system of relationships in the insurance market are justified, in particular the causes hindering the development of relationships in the sphere of security are determined, the main partners — entities in the system of relationships in the insurance market are identified, the levels of relationships management in the insurance market are determined. Among the advantages of the use of effective relationships in the field of insurance are the following: improving the company’s image, attracting new customers, additional sales of insurance services, limiting the access of competitors’ offers, more efficient use of the advertising budget, improving the efficiency of the development of new insurance products and services, increasing the profits and value of brands, improving relations with
Øverup, Camilla S; Brunson, Julie A; Acitelli, Linda K
2015-01-01
Past work has established a connection between self-esteem and self-presentation; however, research has not explored how self-esteem that is contingent on one's relationship may influence self-presentational tactics in that relationship. Across two studies, undergraduate students reported on the extent to which their self-esteem depended on their friendship and romantic relationship, as well as the extent to which they engaged in self-presentation behaviors in those relationships. The results suggest that relationship-specific contingent self-esteem predicts relationship-specific self-presentation; however, friendship-contingent self-esteem predicted self-presentation in both friendships and romantic relationships. These results suggest that individuals are keenly and differentially attuned to qualitatively different relationships, and when perceiving potential problems, they attempt to remedy those through their self-presentations. Furthermore, results indicate the possibility that self-esteem tied to a particular relationship may not be as important as self-esteem based more generally on one's relationships.
Directory of Open Access Journals (Sweden)
Chunyan Xu
2015-11-01
Full Text Available Algal biofuels are investigated as a promising alternative to petroleum fuel sources to satisfy transportation demand. Despite the high growth rate of algae, predation by rotifers, ciliates, golden algae, and other predators will cause an algae in open ponds to crash. In this study, Chlorella kessleri was used as a model alga and the freshwater rotifer, Brachionus calyciflorus, as a model predator. The goal of this study was to test the selective toxicity of the chemical, quinine sulfate (QS, on both the alga and the rotifer in order to fully inhibit the rotifer while minimizing its impact on algal growth. The QS LC50 for B. calyciflorus was 17 µM while C. kessleri growth was not inhibited at concentrations <25 µM. In co-culture, complete inhibition of rotifers was observed when the QS concentration was 7.7 µM, while algal growth was not affected. QS applications to produce 1 million gallons of biodiesel in one year are estimated to be $0.04/gallon or ~1% of Bioenergy Technologies Office’s (BETO projected cost of $5/gge (gallon gasoline equivalent. This provides algae farmers an important tool to manage grazing predators in algae mass cultures and avoid pond crashes.
Directory of Open Access Journals (Sweden)
Hui Liu
2008-06-01
Full Text Available Quorum sensing (QS in vitro controls production of plant cell wall degrading enzymes (PCWDEs and other virulence factors in the soft rotting enterobacterial plant pathogen Pectobacterium atrosepticum (Pba. Here, we demonstrate the genome-wide regulatory role of QS in vivo during the Pba-potato interaction, using a Pba-specific microarray. We show that 26% of the Pba genome exhibited differential transcription in a QS (expI- mutant, compared to the wild-type, suggesting that QS may make a greater contribution to pathogenesis than previously thought. We identify novel components of the QS regulon, including the Type I and II secretion systems, which are involved in the secretion of PCWDEs; a novel Type VI secretion system (T6SS and its predicted substrates Hcp and VgrG; more than 70 known or putative regulators, some of which have been demonstrated to control pathogenesis and, remarkably, the Type III secretion system and associated effector proteins, and coronafacoyl-amide conjugates, both of which play roles in the manipulation of plant defences. We show that the T6SS and a novel potential regulator, VirS, are required for full virulence in Pba, and propose a model placing QS at the apex of a regulatory hierarchy controlling the later stages of disease progression in Pba. Our findings indicate that QS is a master regulator of phytopathogenesis, controlling multiple other regulators that, in turn, co-ordinately regulate genes associated with manipulation of host defences in concert with the destructive arsenal of PCWDEs that manifest the soft rot disease phenotype.
Jiang, Tianyu; Zhu, Peng; Du, Lupei; Li, Minyong
2018-01-01
Quorum sensing (QS) is a cell-to-cell communication system that regulates gene expression as a result of the production and perception of signal molecules called autoinducers (AIs). AI-2 is a QS autoinducer produced by both Gram-negative and Gram-positive bacteria, in which it regulates intraspecies and interspecies communication. The identification of QS inhibitors is considered a promising strategy for the development of anti-virulence drugs with reduced selective pressure for resistance. Here we describe a high-throughput virtual screening approach to identify AI-2 quorum sensing inhibitors on the basis of Vibrio harveyi LuxPQ crystal structure. Seven potent inhibitors with IC 50 values in the micromolar range were selected with no effect or low effect on V. harveyi growth rate.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When determinations of relationship as wife... RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife... employee are made. (a) The claimant's relationship as the wife or husband of an employee is determined when...
Patel, Sapan J; Dao, Su; Darie, Costel C; Clarkson, Bayard D
2016-01-01
Quorum sensing (QS) is a generic term used to describe cell-cell communication and collective decision making by bacterial and social insects to regulate the expression of specific genes in controlling cell density and other properties of the populations in response to nutrient supply or changes in the environment. QS mechanisms also have a role in higher organisms in maintaining homeostasis, regulation of the immune system and collective behavior of cancer cell populations. In the present study, we used a p190BCR-ABL driven pre-B acute lymphoblastic leukemia (ALL3) cell line derived from the pleural fluid of a terminally ill patient with ALL to test the QS hypothesis in leukemia. ALL3 cells don’t grow at low density (LD) in liquid media but grow progressively faster at increasingly high cell densities (HD) in contrast to other established leukemic cell lines that grow well at very low starting cell densities. The ALL3 cells at LD are poised to grow but shortly die without additional stimulation. Supernates of ALL3 cells (HDSN) and some other primary cells grown at HD stimulate the growth of the LD ALL3 cells without which they won’t survive. To get further insight into the activation processes we performed microarray analysis of the LD ALL3 cells after stimulation with ALL3 HDSN at days 1, 3, and 6. This screen identified several candidate genes, and we linked them to signaling networks and their functions. We observed that genes involved in lipid, cholesterol, fatty acid metabolism, and B cell activation are most up- or down-regulated upon stimulation of the LD ALL3 cells using HDSN. We also discuss other pathways that are differentially expressed upon stimulation of the LD ALL3 cells. Our findings suggest that the Ph+ ALL population achieves dominance by functioning as a collective aberrant ecosystem subject to defective quorum-sensing regulatory mechanisms. PMID:27429840
Directory of Open Access Journals (Sweden)
Ioana Vlad
2016-02-01
Full Text Available Background: The implementation of maternal health guidelines remains unsatisfactory, even for simple, well established interventions. In settings where most births occur in health facilities, as is the case in Kerala, India, preventing maternal mortality is linked to quality of care improvements. Context: Evidence-informed quality standards (QS, including quality statements and measurable structure and process indicators, are one innovative way of tackling the guideline implementation gap. Having adopted a zero tolerance policy to maternal deaths, the Government of Kerala worked in partnership with the Kerala Federation of Obstetricians & Gynaecologists (KFOG and NICE International to select the clinical topic, develop and initiate implementation of the first clinical QS for reducing maternal mortality in the state. Description of practice: The NICE QS development framework was adapted to the Kerala context, with local ownership being a key principle. Locally generated evidence identified post-partum haemorrhage as the leading cause of maternal death, and as the key priority for the QS. A multidisciplinary group (including policy-makers, gynaecologists and obstetricians, nurses and administrators was established. Multi-stakeholder workshops convened by the group ensured that the statements, derived from global and local guidelines, and their corresponding indicators were relevant and acceptable to clinicians and policy-makers in Kerala. Furthermore, it helped identify practical methods for implementing the standards and monitoring outcomes. Lessons learned: An independent evaluation of the project highlighted the equal importance of a strong evidence-base and an inclusive development process. There is no one-size-fits-all process for QS development; a principle-based approach might be a better guide for countries to adapt global evidence to their local context.
Energy Technology Data Exchange (ETDEWEB)
Brunotte, F.; Laurens, M.H.; Itty, C.; Robert, J.; Cloez, J.L.; Marcon, F.; Pernot, C.
1986-12-01
To determine the value, of gated equilibrium angiography in secundum atrial septal defect (ASD) in children, the first pass pulmonic/systemic flow ratio (Qp/Qs) was compared with diastolic count ratio (DCR) and stroke count ratio (SCR) of the two ventricles. In 50 children we have found a correlation between Qp/Qs and DCR (r=0.71) and between Qp/Qs and SCR (r=0.66). For detection of significant atrial shunt (Qp/Qs>1.5) the sensitivity of DCR>2 was 0.81 and the specificity 0.75. For SCR>1.5 we sensitivity and specificity values of 0.87 and 0.71 respectively. Left and right ventricular ejection fractions were normal (0.67+-0.08 and 0.50+-0.07).
Non-Monotonic Spatial Reasoning with Answer Set Programming Modulo Theories
Wałęga, Przemysław Andrzej; Schultz, Carl; Bhatt, Mehul
2016-01-01
The systematic modelling of dynamic spatial systems is a key requirement in a wide range of application areas such as commonsense cognitive robotics, computer-aided architecture design, and dynamic geographic information systems. We present ASPMT(QS), a novel approach and fully-implemented prototype for non-monotonic spatial reasoning -a crucial requirement within dynamic spatial systems- based on Answer Set Programming Modulo Theories (ASPMT). ASPMT(QS) consists of a (qualitative) spatial re...
Directory of Open Access Journals (Sweden)
Jing Luo
Full Text Available The quorum sensing (QS circuit plays a role in the precise regulation of genes controlling virulence factors and biofilm formation in Pseudomonas aeruginosa. QS-controlled biofilm formation by Pseudomonas aeruginosa in clinical settings has remained controversial due to emerging drug resistance; therefore, screening diverse compounds for anti-biofilm or anti-QS activities is important. This study demonstrates the ability of sub-minimum inhibitory concentrations (sub-MICs of baicalin, an active natural compound extracted from the traditional Chinese medicinal Scutellaria baicalensis, to inhibit the formation of Pseudomonas aeruginosa biofilms and enhance the bactericidal effects of various conventional antibiotics in vitro. In addition, baicalin exerted dose-dependent inhibitory effects on virulence phenotypes (LasA protease, LasB elastase, pyocyanin, rhamnolipid, motilities and exotoxin A regulated by QS in Pseudomonas aeruginosa. Moreover, the expression levels of QS-regulatory genes, including lasI, lasR, rhlI, rhlR, pqsR and pqsA, were repressed after sub-MIC baicalin treatment, resulting in significant decreases in the QS signaling molecules 3-oxo-C12-HSL and C4-HSL, confirming the ability of baicalin-mediated QS inhibition to alter gene and protein expression. In vivo experiments indicated that baicalin treatment reduces Pseudomonas aeruginosa pathogenicity in Caenorhabditis elegans. Greater worm survival in the baicalin-treated group manifested as an increase in the LT50 from 24 to 96 h. In a mouse peritoneal implant infection model, baicalin treatment enhanced the clearance of Pseudomonas aeruginosa from the implants of mice infected with Pseudomonas aeruginosa compared with the control group. Moreover, the combination of baicalin and antibiotics significantly reduced the numbers of colony-forming units in the implants to a significantly greater degree than antibiotic treatment alone. Pathological and histological analyses revealed
Emotions and feelings as the body's comment to personal relationships:
DEFF Research Database (Denmark)
Willert, Søren
as eflections of phylogenetically evolved, evaluative and apperceptively based action systems helping organisms to structure and relate in adaptive fashion to their species-specific Umwelt. One special feature of humans' emotional life, setting our species apart from all other, is that emotions not only guide...... describing - as the title does - emotions and feelings as the body's (subjectively experienced) comments to personal relationships. A model of human self- or second order consciousness, consistent with the described theoretical framework, will be presented. Implications of the model for the understanding...
Lu, Feng-Ying; Wen, Si; Deng, Gang; Tang, Yung-Lung
2017-05-01
Childhood maltreatment is widely accepted as a risk factor for drug addiction from adolescence to adulthood. However, the influence of childhood maltreatment on drug treatment related variables, such as drug abstinence motivation and self-concept, as well as self-efficacy, remains unclear. This study aims at exploring whether self-concept mediates the relationship between childhood maltreatment and abstinence motivation, as well as self-efficacy, among drug addicts. This study involves 816 (550 males, 226 females, mean age=34.59, range=16-58 years) drug addicts from compulsory detoxification units. Participants completed questionnaires, including the childhood trauma questionnaire 28 - item short form (CTQ - SF), Tennessee self-concept scale (TSCS), general self-efficacy scale (GSES), and drug abstinence motivation questionnaire (DAMQ). The structural equation model (SEM) analysis, including total and specific forms of maltreatment scores, showed that childhood maltreatment was negatively associated with self-concept, self-efficacy, and abstinence motivation. Self-concept was positively associated with self-efficacy and abstinence motivation. Conversely, significant association between self-efficacy and abstinence motivation did not exist. An indirect analysis showed that self-concept mediated the relationship between childhood maltreatment and self-efficacy. Critically, self-concept arbitrated the relationship between childhood maltreatment and abstinence motivation. The indirect effect of self-concept between childhood maltreatment and abstinence motivation still existed when the total scores of maltreatment were replaced by the scores of specific forms of maltreatment. These results demonstrated that self-concept is a critical factor in understanding the relationship between childhood maltreatment and abstinence motivation, as well as self-efficacy, among drug addicts. Improving the sense of self-worth may be an effective intervention therapy among drug addicts
Sjöblom, Solveig; Harjunpää, Heidi; Brader, Günter; Palva, E Tapio
2008-07-01
Quorum sensing (QS), a population-density-sensing mechanism, controls the production of the main virulence determinants, the plant cell-wall-degrading enzymes (PCWDEs) of the soft-rot phytopathogen Erwinia carotovora subsp. carotovora. In this study, we used random transposon mutagenesis with a gusA reporter construct to identify two new QS-controlled genes encoding the regulator Hor and a plant ferredoxin-like protein, FerE. The QS control of the identified genes was executed by the QS regulators ExpR1 and ExpR2 and mediated by the global repressor RsmA. Hor was shown to contribute to bacterial virulence at least partly through its control of PCWDE production. Our results showed that FerE contributes to oxidative stress tolerance and in planta fitness of the bacteria and suggest that QS could be central to control of oxidative stress tolerance. The presence of the FerE protein appears to be rather unique in heterotrophic bacteria and suggests an acquisition of the corresponding gene from plant host by horizontal gene transfer.
A Riccati model for Denmark Strait overflow variability
Käse, R. H.
2006-10-01
A controlled volume box model of the western basins of the Nordic Seas for water denser than 1027.8 kg m-3 is constructed, where accumulation in volume ($\\frac{dV}{dt) is driven by net imbalances between prescribed net inflow from the northern, eastern and top boundaries (Qs) and hydraulically limited outflow through the Denmark Strait. The resulting Riccati equation is solved analytically for filling and flushing experiments with constant Qs and numerically for stochastic forcing Qs(t). For small perturbations to Qs with white noise spectrum, the overflow response is red noise with a time scale between 5 and 15 years depending on the mean interface height and area. For Qs proportional to the NAO index, the overflow is positively correlated with the NAO. A 140 years integration reveals variations in the overflow between 2.5 Sv in the 1970s and a maximum of 4 Sv in the 1990s. Hydraulic transport calculations from hydrographic data north of Iceland show good agreement with the model hindcast.
Bacterial tower of Babel --How cheating and lying diversify bacterial communication
Eldar, Avigdor
2012-02-01
In microbial ``quorum sensing'' (QS) communication systems, microbes produce and respond to a signaling molecule, enabling a cooperative response at high cell densities. Many species of bacteria show fast, intraspecific, evolutionary divergence of their QS pathway specificity---signaling molecules activate cognate receptors in the same strain but fail to activate, and sometimes inhibit, those of other strains. Despite many molecular studies, it has remained unclear how a signaling molecule and receptor can coevolve, what maintains diversity, and what drives the evolution of cross-inhibition. Here I use mathematical analysis to show that when QS controls the production of extracellular enzymes ---``public goods''---diversification can readily evolve. Coevolution is positively selected by cycles of alternating ``cheating'' receptor mutations and ``cheating immunity'' signaling mutations. The maintenance of diversity and the evolution of cross-inhibition between strains are facilitated by facultative cheating between the competing strains. My results suggest a role for complex social strategies in the long-term evolution of QS systems. More generally, my model of QS divergence suggests a form of kin recognition where different kin types coexist in unstructured populations.
Mössler, Karin; Gold, Christian; Aßmus, Jörg; Schumacher, Karin; Calvet, Claudine; Reimer, Silke; Iversen, Gun; Schmid, Wolfgang
2017-09-21
This study examined whether the therapeutic relationship in music therapy with children with Autism Spectrum Disorder predicts generalized changes in social skills. Participants (4-7 years, N = 48) were assessed at baseline, 5 and 12 months. The therapeutic relationship, as observed from session videos, and the generalized change in social skills, as judged by independent blinded assessors and parents, were evaluated using standardized tools (Assessment of the Quality of Relationship; ADOS; SRS). Linear mixed effect models showed significant interaction effects between the therapeutic relationship and several outcomes at 5 and 12 months. We found the music therapeutic relationship to be an important predictor of the development of social skills, as well as communication and language specifically.
A Metabolic Trade-Off Modulates Policing of Social Cheaters in Populations of Pseudomonas aeruginosa
Directory of Open Access Journals (Sweden)
Huicong Yan
2018-02-01
Full Text Available Pseudomonas aeruginosa uses quorum sensing (QS to regulate the production of public goods such as the secreted protease elastase. P. aeruginosa requires the LasI–LasR QS circuit to induce elastase and enable growth on casein as the sole carbon and energy source. The LasI–LasR system also induces a second QS circuit, the RhlI–RhlR system. During growth on casein, LasR-mutant social cheaters emerge, and this can lead to a population collapse. In a minimal medium containing ammonium sulfate as a nitrogen source, populations do not collapse, and cheaters and cooperators reach a stable equilibrium; however, without ammonium sulfate, cheaters overtake the cooperators and populations collapse. We show that ammonium sulfate enhances the activity of the RhlI–RhlR system in casein medium and this leads to increased production of cyanide, which serves to control levels of cheaters. This enhancement of cyanide production occurs because of a trade-off in the metabolism of glycine: exogenous ammonium ion inhibits the transformation of glycine to 5,10-methylenetetrahydrofolate through a reduction in the expression of the glycine cleavage genes gcvP1 and gcvP2, thereby increasing the availability of glycine as a substrate for RhlR-regulated hydrogen cyanide synthesis. Thus, environmental ammonia enhances cyanide production and stabilizes QS in populations of P. aeruginosa.
Correction of Pulmonary Oxygenizing Dysfunction in the Early Activation of Cardiosurgical Patients
Directory of Open Access Journals (Sweden)
I. A. Kozlov
2009-01-01
Full Text Available Objective: to justify a comprehensive approach to preventing and correcting pulmonary oxygenizing dysfunction requiring prolonged artificial ventilation in patients operated on under extracorporeal circulation for coronary heart disease. Subjects and methods. One hundred and twenty-three patients aged 55±0.6 years were examined. The study excluded patients with a complicated course of operations (perioperative myocardial infarction, acute cardiovascular insufficiency, hemorrhage, and long extracorporeal circulation. Stimulating spirometry was initiated 2 days before surgery. An alveolar opening maneuver was performed using a continuous dynamic thoracopulmonary compliance monitoring. The parameters of lung oxygenizing function and biomechanics were analyzed. Results. In 78% of the patients, preoperative inspiratory lung capacity was 5—30% lower than the age-related normal values. After extracorporeal circulation, pulmonary oxygenizing dysfunction was diagnosed in 40.9% of cases; at the same time PaO2/FiO2 was associated with an intrapulmonary shunt fraction (Qs/St (r=-0.53; p=0.002 and Qs/Qt was related to static thoracopulmonary compliance (Cst (r=-0.39; p=0.03. Preoperative stimulating spirometry provided a considerable increase in intraoperative PaO2/FiO2 values (p<0.05; improved Cst and decreased Qs/Qt. After extracorporeal circulation, the incidence of pulmonary oxygenizing dysfunction was decreased by more than twice (p<0.05. Patients with relative arterial hypoxemia showed a noticeable relationship to the magnitudes of a reduction in Cst and a rise in Qs/Qt (r=0.72; p=0.008, which served as the basis for applying the alveolar opening maneuver. This type of lung support corrected arterial hypoxemia in 67% of cases. Conclusion. In car-diosurgical patients with coronary heart disease, effective prophylaxis and correction of relative arterial hypoxemia caused by the interrelated impairments of pulmonary biomechanical properties and
Daphnia as a model organism in limnology and aquatic biology: introductory remarks
Czech Academy of Sciences Publication Activity Database
Seďa, Jaromír; Petrusek, A.
2011-01-01
Roč. 70, č. 2 (2011), s. 337-344 ISSN 1129-5767. [International Conference on Invertebrate Reproduction and Development in the Age of Genetic Modifications. Praha, 16.08.2010-20.08.2010] R&D Projects: GA AV ČR(CZ) 1QS600170504 Institutional research plan: CEZ:AV0Z60170517 Keywords : Daphnia * senescence * cyanobacteria * inducible defences * flood impact * egg banks * fish predation Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.207, year: 2011
Directory of Open Access Journals (Sweden)
Ashkan Emadi
Full Text Available BACKGROUND: Dimeric naphthoquinones (BiQ were originally synthesized as a new class of HIV integrase inhibitors but have shown integrase-independent cytotoxicity in acute lymphoblastic leukemia cell lines suggesting their use as potential anti-neoplastic agents. The mechanism of this cytotoxicity is unknown. In order to gain insight into the mode of action of binaphthoquinones we performed a systematic high-throughput screen in a yeast isogenic deletion mutant array for enhanced or suppressed growth in the presence of binaphthoquinones. METHODOLOGY/PRINCIPAL FINDINGS: Exposure of wild type yeast strains to various BiQs demonstrated inhibition of yeast growth with IC(50s in the microM range. Drug sensitivity and resistance screens were performed by exposing arrays of a haploid yeast deletion mutant library to BiQs at concentrations near their IC(50. Sensitivity screens identified yeast with deletions affecting mitochondrial function and cellular respiration as having increased sensitivity to BiQs. Corresponding to this, wild type yeast grown in the absence of a fermentable carbon source were particularly sensitive to BiQs, and treatment with BiQs was shown to disrupt the mitochondrial membrane potential and lead to the generation of reactive oxygen species (ROS. Furthermore, baseline ROS production in BiQ sensitive mutant strains was increased compared to wild type and could be further augmented by the presence of BiQ. Screens for resistance to BiQ action identified the mitochondrial external NAD(PH dehydrogenase, NDE1, as critical to BiQ toxicity and over-expression of this gene resulted in increased ROS production and increased sensitivity of wild type yeast to BiQ. CONCLUSIONS/SIGNIFICANCE: In yeast, binaphthoquinone cytotoxicity is likely mediated through NAD(PH:quonine oxidoreductases leading to ROS production and dysfunctional mitochondria. Further studies are required to validate this mechanism in mammalian cells.
Vasavi, Halkare Suryanarayana; Arun, Ananthapadmanabha Bhagwath; Rekha, Punchapady-Devasya
2014-05-01
Psidium guajava L., which has been used traditionally as a medicinal plant, was explored for anti-quorum sensing (QS) activity. The anti-QS activity of the flavonoid (FL) fraction of P. guajava leaves was determined using a biosensor bioassay with Chromobacterium violaceum CV026. Detailed investigation of the effects of the FL-fraction on QS-regulated violacein production in C. violaceum ATCC12472 and pyocyanin production, proteolytic, elastolytic activities, swarming motility and biofilm formation in Pseudomonas aeruginosa PAO1 was performed using standard methods. Possible mechanisms of QS-inhibition were studied by assessing violacein production in response to N-acyl homoserine lactone (AHL) synthesis in the presence of the FL-fraction in C. violaceum ATCC31532 and by evaluating the induction of violacein in the mutant C. violaceum CV026 by AHL extracted from the culture supernatants of C. violaceum 31532. Active compounds in the FL-fraction were identified by liquid chromatography-mass spectrometry (LC-MS). Inhibition of violacein production by the FL-fraction in a C. violaceum CV026 biosensor bioassay indicated possible anti-QS activity. The FL-fraction showed concentration-dependent decreases in violacein production in C. violaceum 12472 and inhibited pyocyanin production, proteolytic and elastolytic activities, swarming motility and biofilm formation in P. aeruginosa PAO1. Interestingly, the FL-fraction did not inhibit AHL synthesis; AHL extracted from cultures of C. violaceum 31532 grown in the presence of the FL-fraction induced violacein in the mutant C. violaceum CV026. LC-MS analysis revealed the presence of quercetin and quercetin-3-O-arabinoside in the FL-fraction. Both quercetin and quercetin-3-O-arabinoside inhibited violacein production in C. violaceum 12472, at 50 and 100 μg/mL, respectively. Results of this study provide scope for further research to exploit these active molecules as anti-QS agents. © 2014 The Societies and Wiley Publishing
Changing storm track diffusivity and the upper limit to poleward latent heat transport
Caballero, R.
2010-12-01
Poleward atmospheric energy transport plays a key role in the climate system by helping set the mean equator-pole temperature gradient. The mechanisms controlling the response of poleward heat flux to climate change are still poorly understood. Recent work shows that midlatitude poleward latent heat flux in atmospheric GCMs generally increases as the climate warms but reaches an upper limit at sufficiently high temperature and decreases with further warming. The reasons for this non-monotonic behavior have remained unclear. Simple arguments suggests that the latent heat flux Fl should scale as Fl ˜ vref qs, where vref is a typical meridional velocity in the baroclinic zone and qs is saturation humidity. While vref decreases with temperature, qs increases much more rapidly, so this scaling implies monotonically increasing moisture flux. We study this problem using a series of simulations employing NCAR’s CAM3 GCM coupled to a slab-ocean aquaplanet and spanning a wide range of atmospheric CO2 concentrations. We find that a modified scaling, Fl ˜ vref2 qs, describes the changes in moisture flux much more accurately. Using Lagrangian trajectory analysis, we explain the success of this scaling in terms of changes in the mixing length, which contracts proportionally to vref.
Directory of Open Access Journals (Sweden)
Silja eHeilmann
2015-07-01
Full Text Available Many bacteria secrete compounds, which act as public goods. Such compounds are often under quorum sensing (QS regulation, yet it is not understood exactly when bacteria may gain from having a public good under QS regulation.Here, we show that the optimal public good production rate per cell as a function of population size (the optimal production curve, OPC depend crucially on the cost and benefit functions of the public good and that the OPC will fall into one of two categories: Either it is continuous or it jumps from zero discontinuously at a critical population size.If, e.g., the public good has accelerating returns and linear cost, then the OPC is discontinuous and the best strategy thus to ramp up production sharply at a precise population size.By using the example of public goods with accelerating and diminishing returns (and linear cost we are able to determine how the two different categories of OPSs, can best be matched by production regulated through a QS signal feeding back on its own production. We find that the optimal QS parameters are different for the two categories and specifically that public goods, which provide accelerating returns, call for stronger positive signal feedback.
Bacterial biofilms and quorum sensing: fidelity in bioremediation technology.
Mangwani, Neelam; Kumari, Supriya; Das, Surajit
Increased contamination of the environment with toxic pollutants has paved the way for efficient strategies which can be implemented for environmental restoration. The major problem with conventional methods used for cleaning of pollutants is inefficiency and high economic costs. Bioremediation is a growing technology having advanced potential of cleaning pollutants. Biofilm formed by various micro-organisms potentially provide a suitable microenvironment for efficient bioremediation processes. High cell density and stress resistance properties of the biofilm environment provide opportunities for efficient metabolism of number of hydrophobic and toxic compounds. Bacterial biofilm formation is often regulated by quorum sensing (QS) which is a population density-based cell-cell communication process via signaling molecules. Numerous signaling molecules such as acyl homoserine lactones, peptides, autoinducer-2, diffusion signaling factors, and α-hydroxyketones have been studied in bacteria. Genetic alteration of QS machinery can be useful to modulate vital characters valuable for environmental applications such as biofilm formation, biosurfactant production, exopolysaccharide synthesis, horizontal gene transfer, catabolic gene expression, motility, and chemotaxis. These qualities are imperative for bacteria during degradation or detoxification of any pollutant. QS signals can be used for the fabrication of engineered biofilms with enhanced degradation kinetics. This review discusses the connection between QS and biofilm formation by bacteria in relation to bioremediation technology.
Coral-associated bacteria, quorum sensing disrupters, and the regulation of biofouling.
Golberg, Karina; Pavlov, Valentina; Marks, Robert S; Kushmaro, Ariel
2013-01-01
Marine biofouling, the settlement of microorganisms and macroorganisms on structures submerged in seawater, although economically detrimental, is a successful strategy for survival in hostile environments, where coordinated bacterial communities establish biofilms via the regulation of quorum sensing (QS) communication systems. The inhibition of QS activity among bacteria isolated from different coral species was investigated to gain further insight into its potency in the attenuation, or even the prevention, of undesirable biofouling on marine organisms. It is hypothesized that coral mucus/microorganism interactions are competitive, suggesting that the dominant communities secrete QS disruptive compounds. One hundred and twenty bacterial isolates were collected from healthy coral species and screened for their ability to inhibit QS using three bioreporter strains. Approximately 12, 11, and 24% of the isolates exhibited anti-QS activity against Escherichia coli pSB1075, Chromobacterium violaceum CV026, and Agrobacterium tumefaciens KYC55 indicator strains, respectively. Isolates with positive activity against the bioluminescent monitor strains were scanned via a cytotoxic/genotoxic, E. coli TV1061 and DPD2794 antimicrobial panel. Isolates detected by C. violaceum CV026 and A. tumefaciens KYC55 reporter strains were tested for their ability to inhibit the growth of these reporter strains, which were found to be unaffected. Tests of the Favia sp. coral isolate Fav 2-50-7 (>98% similarity to Vibrio harveyi) for its ability to attenuate the formation of biofilm showed extensive inhibitory activity against biofilms of Pseudomonas aeruginosa and Acinetobacter baumannii. To ascertain the stability and general structure of the active compound, cell-free culture supernatants exposed to an increasing temperature gradient or to digestion by proteinase K, were shown to maintain potent QS attenuation and the ability to inhibit the growth of biofilms. Mass spectrometry confirmed
International Nuclear Information System (INIS)
Wang Jisuo; Sun Changyong; He Jinyu
1996-01-01
The eigenstates of the higher power of the annihilation operator a qs k (k≥3) of the two-parameter deformed harmonic oscillator are constructed. Their completeness is demonstrated in terms of the qs-integration
Directory of Open Access Journals (Sweden)
Share Yuan Goh
2014-05-01
Full Text Available Bacteria realize the ability to communicate by production of quorum sensing (QS molecules called autoinducers, which regulate the physiological activities in their ecological niches. The oral cavity could be a potential area for the presence of QS bacteria. In this study, we report the isolation of a QS bacterial isolate C10B from dentine caries. Preliminary screening using Chromobacterium violaceum CV026 biosensor showed that isolate C10B was able to produce N-acylhomoserine lactones (AHLs. This bacterium was further identified as a member of Burkholderia, an opportunistic pathogen. The isolated Burkholderia sp. was confirmed to produce N-hexanoyl-L-homoserine lactone (C6-HSL, N-octanoyl-L-homoserine lactone (C8-HSL, N-decanoyl-L-homoserine lactone (C10-HSL and N-dodecanoyl-L-homoserine lactone (C12-HSL.
Moessbauer Spectroscopy of Martian and Sverrefjell Carbonates
Agresti, David G.; Morris, Richard V.
2011-01-01
Mars, in its putative "warmer, wetter: early history, could have had a CO2 atmosphere much denser than its current value of Chocolate Pots in Yellowstone National Park (YNP) are shown; they are the same within error. For Comanche carbonate summed over 210-270 K, (CS, QS) = (1.23, 1.95) mm/s. The value of QS for Sverrefjell carbonate at 295 K, (CS, QS) = (1.25, 1.87) mm/s, is also plotted, and the plot shows that the QS for the Sverrefjell carbonate agrees within error with the Comanche data extrapolated to 295 K. This agreement is additional evidence that the Sverrefjell carbonates are Mossbauer analogues for the Comanche carbonates, and that both carbonates might have precipitated from solutions that became carbonate rich by passing through buried carbonate deposits.
Datta, Siraj; Jana, Debanjan; Maity, Tilak Raj; Samanta, Aveek; Banerjee, Rajarshi
2016-06-01
Quorum sensing (QS) plays an important role in virulence of Pseudomonas aeruginosa, blocking of QS ability are viewed as viable antimicrobial chemotherapy and which may prove to be a safe anti-virulent drug. Bioactive components from Piper betle have been reported to possess antimicrobial ability. This study envisages on the anti-QS properties of ethanolic extract of P. betle leaf (PbLE) using P. aeruginosa PAO1 as a model organism. A marked reduction in swarming, swimming, and twitching ability of the bacteria is demonstrated in presence of PbLE. The biofilm and pyocyanin production also shows a marked reduction in presence of PbLE, though it does not affect the bacterial growth. Thus, the studies hint on the possible effect of the bioactive components of PbLE on reducing the virulent ability of the bacteria; identification of bioactive compounds should be investigated further.
Putting Laughter in Context: Shared Laughter as Behavioral Indicator of Relationship Well-Being
Kurtz, Laura E.; Algoe, Sara B.
2015-01-01
Laughter is a pervasive human behavior that most frequently happens in a social context. However, data linking the behavior of laughter with psychological or social outcomes is exceptionally rare. Here, we draw attention to shared laughter as a useful objective marker of relationship well-being. Spontaneously-generated laughs of 71 heterosexual romantic couples were coded from a videorecorded conversation about how the couple first met. Multilevel models revealed that, while controlling for all other laughter present, the proportion of the conversation spent laughing simultaneously with the romantic partner was uniquely positively associated with global evaluations of relationship quality, closeness, and social support. Results are discussed with respect to methodological considerations and theoretical implications for relationships and behavioral research more broadly. PMID:26957946
Vanarase, Mithila; Gautam, Ram Krishan; Arora, Pooja; Bajaj, Sonali; Meena, Neha; Khurana, Ananta
2017-10-01
Q-switched lasers are conventionally used for the treatment of black tattoo. However, they require multiple sittings, and the response may be slow due to competing epidermal pigment in dark skin. To compare the efficacy of Q-switched Nd:YAG laser alone with its combination with ultrapulse CO 2 for the removal of black tattoo. Sixty patients with black tattoo were randomized into two groups viz., group A and group B. Group A was treated with QS Nd:YAG laser (1064 nm) alone, and group B received combination of ablative ultrapulse CO 2 followed by fixed-dose QS Nd:YAG laser (1064 nm), at 6-week interval for a maximum of 6 sittings. After each sitting, 3 independent physicians noted percentage of improvement that was evaluated using visual analogue scale (VAS) and grading system for tattoo ink lightening (TIL). Combination laser (group B) showed statistically significant improvement in mean VAS score in the last 2 noted visits as compared to 1st session (p tattoos, combination of ultrapulse CO 2 laser and QS Nd:YAG laser is superior to QS Nd:YAG laser alone.
50 CFR Table 7 to Part 680 - Initial Issuance of Crab QS by Crab QS Fishery
2010-10-01
... June 10, 2002 in the Eastern Aleutian Island golden (brown) king crab, Western Aleutian Island golden... through February 8, 2002. 4 years 3. Eastern Aleutian Islands golden king crab (EAG) 5 years of the 5-year... through September 24, 2000. (3) August 15, 2001 through September 10, 2001. 5 years 4. Eastern Bering Sea...
Relationships as determinants of substance use amongst street ...
African Journals Online (AJOL)
stress, peer relationships and frequency of family meals.7,8,9,10 Amongst ... students with the fewest peer interaction problems.12 Furthermore, the ..... substance use among street children in a local government area of Nigeria: Drug and.
Directory of Open Access Journals (Sweden)
Walter Giordano
2012-03-01
Full Text Available Bacteria of the genus Bradyrhizobium are able to establish a symbiotic relationship with peanut (Arachis hypogaea root cells and to fix atmospheric nitrogen by converting it to nitrogenous compounds. Quorum sensing (QS is a cell-cell communication mechanism employed by a variety of bacterial species to coordinate behavior at a community level through regulation of gene expression. The QS process depends on bacterial production of various signaling molecules, among which the N-acylhomoserine lactones (AHLs are most commonly used by Gram-negative bacteria. Some previous reports have shown the production of QS signaling molecules by various rhizobia, but little is known regarding mechanisms of communication among peanut-nodulating strains. The aims of this study were to identify and characterize QS signals produced by peanut-nodulating bradyrhizobial strains and to evaluate their effects on processes related to cell interaction. Detection of AHLs in 53 rhizobial strains was performed using the biosensor strains Agrobacterium tumefaciens NTL4 (pZLR4 and Chromobacterium violaceum CV026 for AHLs with long and short acyl chains, respectively. None of the strains screened were found to produce AHLs with short acyl chains, but 14 strains produced AHLs with long acyl chains. These 14 AHL-producing strains were further studied by quantification of β-galactosidase activity levels (AHL-like inducer activity in NTL4 (pZLR4. Strains displaying moderate to high levels of AHL-like inducer activity were subjected to chemical identification of signaling molecules by high-performance liquid chromatography coupled to mass spectrometry (LC-MS/MS. For each AHL-producing strain, we found at least four different AHLs, corresponding to N-hexanoyl-DL-homoserine lactone (C6, N-(3-oxodecanoyl-L-homoserine lactone (3OC10, N-(3-oxododecanoyl-L-homoserine lactone (3OC12, and N-(3-oxotetradecanoyl-L-homoserine lactone (3OC14. Biological roles of 3OC10, 3OC12, and 3OC14 AHLs
Dainton, Marianne
2013-01-01
Previous research indicates that the primary reason college students use Facebook is for relationship maintenance. The present study sought to determine the relationship between Facebook maintenance and general maintenance efforts in college student romantic relationships, as well as the impacts of such behaviors on the relationship. Survey data…
International Nuclear Information System (INIS)
Huo, Zhipeng; Tao, Li; Wang, Lu; Zhu, Jun; Chen, Shuanghong; Zhang, Changneng; Dai, Songyuan; Zhang, Bing
2015-01-01
Highlights: •A series of novel IGEs based on 12-hydroxystearicacid as LMOG were prepared. •The QS-DSSCs exhibit excellent stability during the accelerated aging tests. •The influence of Im + alkyl chain length on the electron kinetic process is investigated. -- Abstract: A series of stable quasi-solid-state dye-sensitized solar cells (QS-DSSCs) are prepared by the 12-hydroxystearicacid as low molecular mass organogelator (LMOG) to gelate the ionic liquid with different alkyl chain lengths (3, 4, and 7). The influence of alkyl chain length of imidazolium cations (Im + ) on the kinetic processes of electron transport and recombination are investigated by Electrochemical impedance spectroscopy (EIS) and intensity-modulated photocurrent spectroscopy/intensity-modulated photovoltage spectroscopy (IMPS/IMVS). It is found that the ionic gel electrolytes (IGEs) with different alkyl chain lengths of Im + can influence the competitive adsorption effects of imidazolium cations (Im + ) and Li + , and further affect the charge diffusion, the electron recombination/transport processes, the shift of TiO 2 conduction band edge and surface states distribution. The IGE with longer alkyl chain length of Im + can prolong the electron recombination lifetime, promote the incidental photon-to-electron conversion efficiency (IPCE) and the short circuit photocurrent density (J sc ). An excellent QS-DSSC based on the IGE with the longer alkyl chain of Im + gives the highest photoelectric conversion efficiency. Moreover, all the QS-DSSCs based on IGEs exhibit excellent durability without losing their photovoltaic performances during the accelerated thermal and light–soaking test. These results are very important to the researches on the electrochemical mechanism and application of QS-DSSCs based on IGEs
Quorum sensing: a non-conventional target for antibiotic discovery.
Naik, Varsha; Mahajan, Girish
2013-10-01
Quorum sensing (QS) is known to regulate different functions viz. pathogenesis, biofilm formation, and host colonization, along with other functions by regulating bacterial virulence determinants. Therefore, QS is deemed to be an interesting target to modulate pathogenesis. Also, there have been global reports of continuous emergence of antibiotic-resistant microbes; hence, an alternative treatment that compliments antibiotic activity is highly desirable. One such approach is to look for QS inhibitors, which can quench the virulence phenotypes exerted by pathogenic bacteria and compliment antibiotic treatment. In the present study, Pseudomonas aeruginosa strain was used as the model organism which produces three pigments viz. pyocyanin, pyoverdin and pyorubin. Pyocyanin synthesis is reported to be QS dependent and is one of the virulence factors of P. aeruginosa. Hence, we envisage inhibition of pyocyanin pigment would indicate QS inhibition (QSI). Auto-inducers like N-(3-oxododecanoyl)-L-homoserine lactone (OdDHL/3-oxo-C12-HSL) and N-butyryl-L- homoserine lactone (BHL/C4-HSL) were used to enhance the pyocyanin pigment production by the model strain at different doses and time points. BHL, at 25 microM was found to be a better inducer of pyocyanin. Tannic acid (TA) was tested to suppress this pigment synthesis and it was found to be effective when assessed at different time points. About 5.12 mg/mL TA was found to be the optimum concentration at which pyocyanin was inhibited by 77.3%. Thus, we confirm that TA can be used as a QSI, either in its purest form or in the crude form found in various plant species, and could be considered for development to compliment antibiotic therapy.
Humans' Relationship to Flowers as an Example of the Multiple Components of Embodied Aesthetics.
Huss, Ephrat; Bar Yosef, Kfir; Zaccai, Michele
2018-03-01
This paper phenomenologically and qualitatively explores the relationship between humans and flowers as a relationship that throws light on the synergetic dynamics of embodied aesthetics. Its methods include qualitative description and thematic analyses of preferred flower types, as well as concept maps of the general term 'flower' by 120 students in Israel. The results revealed the interactive perceptual-compositional elements, as well as embodied, relational, and socially embedded elements of the aesthetic pleasure associated with flowers. Implications of this case study are generalized to understand the multiple and interactive components of embodied aesthetic experiences as a deep source of pleasure through interactive stimulation by and connection to the natural world.
2010-10-18
... certain pieces of information found in the 1996 study and recommends that FDA make this document part of... made aware of on-going issues relating to the CGMP/QS regulations. FDA's Medical Device GMP/QS experts...
Directory of Open Access Journals (Sweden)
Hong-Man Hou
2017-04-01
Full Text Available This study aimed to identify N-acylhomoserine lactone (AHL produced by Hafnia alvei H4, which was isolated from spoiled instant sea cucumber, and to investigate the effect of AHLs on biofilm formation. Two biosensor strains, Chromobacterium violaceum CV026 and Agrobacterium tumefaciens KYC55, were used to detect the quorum sensing (QS activity of H. alvei H4 and to confirm the existence of AHL-mediated QS system. Thin layer chromatography (TLC and high resolution triple quadrupole liquid chromatography/mass spectrometry (LC/MS analysis of the AHLs extracted from the culture supernatant of H. alvei H4 revealed the existence of at least three AHLs: N-hexanoyl-l-homoserine lactone (C6-HSL, N-(3-oxo-octanoyl-l-homoserine lactone (3-oxo-C8-HSL, and N-butyryl-l-homoserine lactone (C4-HSL. This is the first report of the production of C4-HSL by H. alvei. In order to determine the relationship between the production of AHL by H. alvei H4 and bacterial growth, the β-galactosidase assay was employed to monitor AHL activity during a 48-h growth phase. AHLs production reached a maximum level of 134.6 Miller unites at late log phase (after 18 h and then decreased to a stable level of about 100 Miller unites. AHL production and bacterial growth displayed a similar trend, suggesting that growth of H. alvei H4 might be regulated by QS. The effect of AHLs on biofilm formation of H. alvei H4 was investigated by adding exogenous AHLs (C4-HSL, C6-HSL and 3-oxo-C8-HSL to H. alvei H4 culture. Biofilm formation was significantly promoted (p < 0.05 by 5 and 10 µM C6-HSL, inhibited (p < 0.05 by C4-HSL (5 and 10 µM and 5 µM 3-oxo-C8-HSL, suggesting that QS may have a regulatory role in the biofilm formation of H. alvei H4.
Directory of Open Access Journals (Sweden)
Sajal Sarabhai
Full Text Available BACKGROUND: Burgeoning antibiotic resistance in Pseudomonas aeruginosa has necessitated the development of anti pathogenic agents that can quench acylhomoserine lactone (AHL mediated QS with least risk of resistance. This study explores the anti quorum sensing potential of T. chebula Retz. and identification of probable compounds(s showing anti QS activity and the mechanism of attenuation of P. aeruginosa PAO1 virulence factors. METHODS AND RESULTS: Methanol extract of T. chebula Retz. fruit showed anti QS activity using Agrobacterium tumefaciens A136. Bioactive fraction (F7, obtained by fractionation of methanol extract using Sephadex LH20, showed significant reduction (p<0.001 in QS regulated production of extracellular virulence factors in P. aeruginosa PAO1. Biofilm formation and alginate were significantly (p<0.05 reduced with enhanced (20% susceptibility to tobramycin. Real Time PCR of F7 treated P. aeruginosa showed down regulation of autoinducer synthase (lasI and rhlI and their cognate receptor (lasR and rhlR genes by 89, 90, 90 and 93%, respectively. Electrospray Ionization Mass Spectrometry also showed 90 and 64% reduction in the production of 3-oxo-C(12HSL and C(4HSL after treatment. Decrease in AHLs as one of the mechanisms of quorum quenching by F7 was supported by the reversal of inhibited swarming motility in F7-treated P. aeruginosa PAO1 on addition of C(4HSL. F7 also showed antagonistic activity against 3-oxo-C(12HSL-dependent QS in E. coli bioreporter. C. elegans fed on F7-treated P. aeruginosa showed enhanced survival with LT50 increasing from 24 to 72 h. LC-ESI-MS of F7 revealed the presence of ellagic acid derivatives responsible for anti QS activity in T. chebula extract. CONCLUSIONS: This is the first report on anti QS activity of T. chebula fruit linked to EADs which down regulate the expression of lasIR and rhlIR genes with concomitant decrease in AHLs in P. aeruginosa PAO1 causing attenuation of its virulence factors
Rosenthal, Lisa; Starks, Tyrel J
2015-12-01
Interracial and same-sex romantic relationships are more common and socially accepted in the United States than ever before; yet, stigmatization of these relationships persists, with consequences for relationship dynamics. We conducted an online survey study with adults living in the United States in interracial and same-sex relationships to examine associations of relationship stigma from family, friends, and public with several relationship outcomes (i.e., investment, satisfaction, intimate partner aggression victimization and perpetration, commitment, intimacy, trust, passion, love, sexual communication, and sexual satisfaction), as well as the potential buffering roles of egalitarianism and dyadic coping. Regression analyses with 480 participants support that above and beyond individually experienced discrimination and other well-known predictors of relationship outcomes, relationship stigma from friends in particular was associated with lower relationship commitment, trust, love, and sexual communication, as well as greater odds of intimate partner aggression victimization. Egalitarianism and dyadic coping moderated some of the associations of relationship stigma from family, friends, and public with relationship outcomes, supporting their potential roles as buffers. These findings suggest many avenues for future research and implications for clinicians working with interracial and same-sex couples, individuals in those couples, and their families. Given increasing prevalence of interracial and same-sex relationships and marriages, more work should continue to explore these couples' experiences and how best to support them. (c) 2015 APA, all rights reserved).
Post-secretional activation of Protease IV by quorum sensing in Pseudomonas aeruginosa
Oh, Jungmin; Li, Xi-Hui; Kim, Soo-Kyong; Lee, Joon-Hee
2017-01-01
Protease IV (PIV), a key virulence factor of Pseudomonas aeruginosa is a secreted lysyl-endopeptidase whose expression is induced by quorum sensing (QS). We found that PIV expressed in QS mutant has severe reduction of activity in culture supernatant (CS), even though it is overexpressed to high level. PIV purified from the QS mutant (M-PIV) had much lower activity than the PIV purified from wild type (P-PIV). We found that the propeptide cleaved from prepro-PIV was co-purified with M-PIV, bu...
Srijan, Apichai; Margulieux, Katie R; Ruekit, Sirigade; Snesrud, Erik; Maybank, Rosslyn; Serichantalergs, Oralak; Kormanee, Rosarin; Sukhchat, Prawet; Sriyabhaya, Jossin; Hinkle, Mary; Crawford, John M; McGann, Patrick; Swierczewski, Brett E
2018-05-01
Multidrug-resistant Klebsiella pneumoniae strains are one of the most prevalent causes of nosocomial infections and pose an increasingly dangerous public health threat. The lack of remaining treatment options has resulted in the utilization of older drug classes, including colistin. As a drug of last resort, the discovery of plasmid-mediated colistin resistance by mcr-1 denotes the potential development of pandrug-resistant bacterial pathogens. To address the emergence of the mcr-1 gene, 118 gram-negative Enterobacteriaceae isolated from clinical samples collected at Queen Sirikit Naval Hospital in Chonburi, Thailand were screened for colistin resistance using automated antimicrobial susceptibility testing and conventional PCR screening. Two K. pneumoniae strains, QS17-0029 and QS17-0161, were positive for mcr-1, and both isolates were sequenced to closure using short- and long-read whole-genome sequencing. QS17-0029 carried 16 antibiotic resistance genes in addition to mcr-1, including 2 carbapenemases, bla NDM-1 and bla OXA-232 . QS17-0161 carried 13 antibiotic resistance genes in addition to mcr-1, including the extended-spectrum β-lactamase bla CTX-M-55 . Both isolates carried multiple plasmids, but mcr-1 was located alone on highly similar 33.9 Kb IncX4 plasmids in both isolates. The IncX4 plasmid shared considerable homology to other mcr-1-containing IncX4 plasmids. This is the first report of a clinical K. pneumoniae strain from Thailand carrying mcr-1 as well as the first strain to simultaneously carry mcr-1 and multiple carbapenemase genes (QS17-0029). The identification and characterization of these isolates serves to highlight the urgent need for continued surveillance and intervention in Southeast Asia, where extensively drug-resistant pathogens are being increasingly identified in hospital-associated infections.
Bas, Esra
2014-07-01
In this paper, an integrated methodology for Quality Function Deployment (QFD) and a 0-1 knapsack model is proposed for occupational safety and health as a systems thinking approach. The House of Quality (HoQ) in QFD methodology is a systematic tool to consider the inter-relationships between two factors. In this paper, three HoQs are used to consider the interrelationships between tasks and hazards, hazards and events, and events and preventive/protective measures. The final priority weights of events are defined by considering their project-specific preliminary weights, probability of occurrence, and effects on the victim and the company. The priority weights of the preventive/protective measures obtained in the last HoQ are fed into a 0-1 knapsack model for the investment decision. Then, the selected preventive/protective measures can be adapted to the task design. The proposed step-by-step methodology can be applied to any stage of a project to design the workplace for occupational safety and health, and continuous improvement for safety is endorsed by the closed loop characteristic of the integrated methodology. Copyright © 2013 Elsevier Ltd. All rights reserved.
Kamran, Haroon; Salciccioli, Louis; Pushilin, Sergei; Kumar, Paraag; Carter, John; Kuo, John; Novotney, Carol; Lazar, Jason M
2011-01-01
Nonhuman primates are used frequently in cardiovascular research. Cardiac time intervals derived by phonocardiography have long been used to assess left ventricular function. Electronic stethoscopes are simple low-cost systems that display heart sound signals. We assessed the use of an electronic stethoscope to measure cardiac time intervals in 48 healthy bonnet macaques (age, 8 ± 5 y) based on recorded heart sounds. Technically adequate recordings were obtained from all animals and required 1.5 ± 1.3 min. The following cardiac time intervals were determined by simultaneously recording acoustic and single-lead electrocardiographic data: electromechanical activation time (QS1), electromechanical systole (QS2), the time interval between the first and second heart sounds (S1S2), and the time interval between the second and first sounds (S2S1). QS2 was correlated with heart rate, mean arterial pressure, diastolic blood pressure, and left ventricular ejection time determined by using echocardiography. S1S2 correlated with heart rate, mean arterial pressure, diastolic blood pressure, left ventricular ejection time, and age. S2S1 correlated with heart rate, mean arterial pressure, diastolic blood pressure, systolic blood pressure, and left ventricular ejection time. QS1 did not correlate with any anthropometric or echocardiographic parameter. The relation S1S2/S2S1 correlated with systolic blood pressure. On multivariate analyses, heart rate was the only independent predictor of QS2, S1S2, and S2S1. In conclusion, determination of cardiac time intervals is feasible and reproducible by using an electrical stethoscope in nonhuman primates. Heart rate is a major determinant of QS2, S1S2, and S2S1 but not QS1; regression equations for reference values for cardiac time intervals in bonnet macaques are provided. PMID:21439218
Yamasaki, Yuzo; Kawanami, Satoshi; Kamitani, Takeshi; Sagiyama, Koji; Sakamoto, Ichiro; Hiasa, Ken-Ichi; Yabuuchi, Hidetake; Nagao, Michinobu; Honda, Hiroshi
2018-01-16
To investigate the effect of breath-holding on left-to-right shunts in patients with a secundum atrial septal defect (ASD). Thirty-five consecutive patients with secundum ASDs underwent right heart catheterization and invasive oximetry. Phase-contrast magnetic resonance imaging (MRI) was performed for the main pulmonary artery and ascending aorta. All measurements were obtained during free breathing (FB) (quiet breathing; no breath-hold), expiratory breath-hold (EBH), and inspiratory breath-hold (IBH). Pulmonary circulation flow (Qp) and systemic circulation flow (Qs) were calculated by multiplying the heart rate by the stroke volume. Measurements during FB, EBH, and IBH were compared, and the differences compared to invasive oximetry were evaluated. There were significant differences among the measurements during FB, EBH, and IBH for Qp (FB, 7.70 ± 2.68; EBH, 7.18 ± 2.34; IBH, 6.88 ± 2.51 l/min); however, no significant difference was found for Qs (FB, 3.44 ± 0.74; EBH, 3.40 ± 0.83; IBH, 3.40 ± 0.86 l/min). There were significant differences among the measurements during FB, EBH, and IBH for Qp/Qs (FB, 2.38 ± 1.12; EBH, 2.24 ± 0.95; IBH, 2.14 ± 0.97). Qp/Qs during FB and EBH correlated better with Qp/Qs measured by invasive oximetry than did IBH. The limit of agreement was smaller for EBH than for FB and IBH. In patients with secundum ASDs, Qp/Qs significantly decreased with breath-holding. The accuracy of the Qp/Qs measurement by MRI compared with invasive oximetry during EBH was higher than during FB and IBH.
Hierarchical Bayesian calibration of tidal orbit decay rates among hot Jupiters
Collier Cameron, Andrew; Jardine, Moira
2018-05-01
Transiting hot Jupiters occupy a wedge-shaped region in the mass ratio-orbital separation diagram. Its upper boundary is eroded by tidal spiral-in of massive, close-in planets and is sensitive to the stellar tidal dissipation parameter Q_s^'. We develop a simple generative model of the orbital separation distribution of the known population of transiting hot Jupiters, subject to tidal orbital decay, XUV-driven evaporation and observational selection bias. From the joint likelihood of the observed orbital separations of hot Jupiters discovered in ground-based wide-field transit surveys, measured with respect to the hyperparameters of the underlying population model, we recover narrow posterior probability distributions for Q_s^' in two different tidal forcing frequency regimes. We validate the method using mock samples of transiting planets with known tidal parameters. We find that Q_s^' and its temperature dependence are retrieved reliably over five orders of magnitude in Q_s^'. A large sample of hot Jupiters from small-aperture ground-based surveys yields log _{10} Q_s^' }=(8.26± 0.14) for 223 systems in the equilibrium-tide regime. We detect no significant dependence of Q_s^' on stellar effective temperature. A further 19 systems in the dynamical-tide regime yield log _{10} Q_s^' }=7.3± 0.4, indicating stronger coupling. Detection probabilities for transiting planets at a given orbital separation scale inversely with the increase in their tidal migration rates since birth. The resulting bias towards younger systems explains why the surface gravities of hot Jupiters correlate with their host stars' chromospheric emission fluxes. We predict departures from a linear transit-timing ephemeris of less than 4 s for WASP-18 over a 20-yr baseline.
Competition Experiments as a Means of Evaluating Linear Free Energy Relationships
Mullins, Richard J.; Vedernikov, Andrei; Viswanathan, Rajesh
2004-01-01
The use of competition experiments as a means of evaluating linear free energy relationship in the undergraduate teaching laboratory is reported. The use of competition experiments proved to be a reliable method for the construction of Hammett plots with good correlation providing great flexibility with regard to the compounds and reactions that…
Directory of Open Access Journals (Sweden)
Simon Le Bloa
Full Text Available Rimicaris exoculata is a caridean shrimp that dominates the fauna at several hydrothermal vent sites of the Mid-Atlantic Ridge. It has two distinct and stable microbial communities. One of these epibiontic bacterial communities is located in the shrimp gut and has a distribution and role that are poorly understood. The second colonizes its enlarged gill chamber and is involved in host nutrition. It is eliminated after each molt, and has colonization processes reminiscent of those of a biofilm. The presence and expression of genes usually involved in quorum sensing (QS were then studied. At four sites, Rainbow, TAG, Snake Pit and Logatchev, two lux genes were identified in the R. exoculata epibiontic community at different shrimp molt stages and life stages. RT-PCR experiments highlighted lux gene expression activity at TAG, Snake Pit and Rainbow vent sites. Their potential QS activity and their possible roles in epibiont colonization processes are discussed. Moreover, phylogenetic analysis has shown the presence of three clades for luxS (Epsilonproteobacteria and four clades for luxR (Gammaproteobacteria genes, each clade being restricted to a single site. These genes are more divergent than the 16S rRNA one. They could therefore be used as biogeographical genetic markers.
Flavonoids from Piper delineatum modulate quorum-sensing-regulated phenotypes in Vibrio harveyi.
Martín-Rodríguez, Alberto J; Ticona, Juan C; Jiménez, Ignacio A; Flores, Ninoska; Fernández, José J; Bazzocchi, Isabel L
2015-09-01
Quorum sensing (QS), or bacterial cell-to-cell communication, is a key process for bacterial colonization of substrata through biofilm formation, infections, and production of virulence factors. In an ongoing investigation of bioactive secondary metabolites from Piper species, four new flavonoids (1-4), along with five known ones (5-9) were isolated from the leaves of Piper delineatum. Their stereostructures were established by spectroscopic and spectrometric methods, including 1D and 2D NMR experiments, and comparison with data reported in the literature. The compounds were screened for their ability to interfere with QS signaling in the bacterial model Vibrio harveyi. Four compounds from this series (2, 3, 6, and 7) exhibited remarkable activity in the micromolar range, being compounds 3 and 7 particularly attractive since they did not affect bacterial growth. The results suggest that these flavonoids disrupt QS-mediated bioluminescence by interaction with elements downstream LuxO in the QS circuit of V. harveyi, and also, they exhibited a strong dose-dependent inhibition of biofilm formation. The present findings shed light on the QS inhibition mechanisms of flavonoids, underlining their potential applications. Copyright © 2015 Elsevier Ltd. All rights reserved.
Okusa, Philippe N; Rasamiravaka, Tsiry; Vandeputte, Olivier; Stévigny, Caroline; Jaziri, Mondher El; Duez, Pierre
2014-01-01
The fight against infectious diseases and antimicrobial resistances needs the exploration of new active compounds with new proprieties like disrupting quorum sensing (QS) mechanisms, which is a cell-to-cell communication that regulates bacterial virulence factors. In this work, leaves and root barks extracts of a Congolese medicinal plant, Cordia gilletii, were investigated for their effect on the production of Pseudomonas aeruginosa major virulence factors regulated by QS. The effect of C. gilletii extracts on virulence factors of P. aeruginosa PAO1 was studied by the evaluation of the production of pyocyanine, elastase and biofilm; and by the measurement of the expression of QS-related genes. The dichloromethane extract from root barks was found to quench the production of pyocyanin, a QS-dependent virulence factor in P. aeruginosa PAO1. Moreover, this extract specifically inhibits the expression of several QS-regulated genes (i.e. lasB, rhlA, lasI, lasR, rhlI, and rhlR) and reduces biofilm formation by PAO1. This study contributes to explain the efficacy of C. gilletii in the traditional treatment of infectious diseases caused by P. aeruginosa.
Okusa, Philippe N.; Rasamiravaka, Tsiry; Vandeputte, Olivier; Stévigny, Caroline; Jaziri, Mondher El; Duez, Pierre
2014-01-01
Aim: The fight against infectious diseases and antimicrobial resistances needs the exploration of new active compounds with new proprieties like disrupting quorum sensing (QS) mechanisms, which is a cell-to-cell communication that regulates bacterial virulence factors. In this work, leaves and root barks extracts of a Congolese medicinal plant, Cordia gilletii, were investigated for their effect on the production of Pseudomonas aeruginosa major virulence factors regulated by QS. Materials and Methods: The effect of C. gilletii extracts on virulence factors of P. aeruginosa PAO1 was studied by the evaluation of the production of pyocyanine, elastase and biofilm; and by the measurement of the expression of QS-related genes. Results: The dichloromethane extract from root barks was found to quench the production of pyocyanin, a QS-dependent virulence factor in P. aeruginosa PAO1. Moreover, this extract specifically inhibits the expression of several QS-regulated genes (i.e. lasB, rhlA, lasI, lasR, rhlI, and rhlR) and reduces biofilm formation by PAO1. Conclusion: This study contributes to explain the efficacy of C. gilletii in the traditional treatment of infectious diseases caused by P. aeruginosa. PMID:26401363
Mijakoski, Dragan; Karadzinska-Bislimovska, Jovanka; Basarovska, Vera; Minov, Jordan; Stoleski, Sasho; Angeleska, Nada; Atanasovska, Aneta
2015-03-15
Few studies have examined teamwork as mediator and moderator of work demands-burnout and job engagement-job satisfaction relationships in healthcare workers (HCWs) in South-East Europe. To assess mediation and moderation effect of teamwork on the relationship between independent (work demands or job engagement) and dependent (burnout or job satisfaction) variables. Work demands, burnout, job engagement, and job satisfaction were measured with Hospital Experience Scale, Maslach Burnout Inventory, Utrecht Work Engagement Scale, and Job Satisfaction Survey, respectively. Hospital Survey on Patient Safety Culture was used for assessment of teamwork. In order to examine role of teamwork as a mediating variable we fit series of regression models for burnout and job satisfaction. We also fit regression models predicting outcome (burnout or job satisfaction) from predictor (work demands or job engagement) and moderator (teamwork) variable. Teamwork was partial mediator of work demands-burnout relationship and full mediator of job engagement-job satisfaction relationship. We found that only job engagement-job satisfaction relationship was moderated by teamwork. Occupational health services should target detection of burnout in HCWs and implementation of organizational interventions in hospitals, taking into account findings that teamwork predicted reduced burnout and higher job satisfaction.
Directory of Open Access Journals (Sweden)
A. C Innocenti
2010-09-01
Full Text Available Los mastocitos (M han sido implicados en el crecimiento y diseminación tumoral. Se estudiaron los M en quince casos de cada una de las siguientes patologías: carcinoma basocelular (CBC, carcinoma espinocelular (CEC, melanoma (MM, queratoacantoma (QA y queratosis seborreica (QS con tinción de azul de toluidina. Encontramos que los CBC tenían la mayor cantidad de M seguidos en orden por QS, MM, CEC y QA. Se halló una diferencia extremadamente significativa comparando la cantidad de M en CBC con CEC, MM, QA y QS; QS con CEC, MM y QA. La mayor superficie celular de M la tuvo el CEC seguido de QA, MM, CBC y QS. El cotejo de la superficie de los M fue extremadamente significativa entre CBC con CEC, MM, QA; QS con MM, QA; CEC con MM. El CEC también presentó los M con mayor diámetro seguido por QA, MM, QS y CBC. Diferencia extremadamente significativa, de los diámetros de los M, se descubrió entre CBC con CEC, MM, QA; QS con CEC, MM, QA. Los M estaban aumentados en todas las patologías estudiadas comparados con piel normal. La superficie y diámetro mayor de los M en todas las enfermedades respecto de la piel normal fue extremadamente diferente. La superficie y el diámetro de los M fueron inversamente proporcionales a la cantidad de dichas células. No existe correlación entre malignidad y mayor número de mastocitos.Mast cells (MC have been implicated in tumor growth and spread. We analyzed MC in fifteen cases of each basal cell carcinoma (BCC, squamous cell carcinoma (SCC, malignant melanoma (MM, keratoacanthoma (KA and seborrheic keratosis (SK stained with toluidine blue. We found that BCC had the largest quantity of MC followed by SK, MM, SCC and KA. An extremely significant difference was found comparing MC quantity in BCC vs SCC, MM, KA and SK; SK vs SCC, MM and KA. SCC had the biggest MC area pursued by KA, MM, BCC and SK. The comparisons of MC areas were extremely significant in BCC vs SCC, MM, KA; SK vs MM, KA; SCC vs MM. SCC, also
Duckweed (Lemna minor) as a Model Plant System for the Study of Human Microbial Pathogenesis
Zhang, Yong; Hu, Yangbo; Yang, Baoyu; Ma, Fang; Lu, Pei; Li, Lamei; Wan, Chengsong; Rayner, Simon; Chen, Shiyun
2010-01-01
Background Plant infection models provide certain advantages over animal models in the study of pathogenesis. However, current plant models face some limitations, e.g., plant and pathogen cannot co-culture in a contained environment. Development of such a plant model is needed to better illustrate host-pathogen interactions. Methodology/Principal Findings We describe a novel model plant system for the study of human pathogenic bacterial infection on a large scale. This system was initiated by co-cultivation of axenic duckweed (Lemna minor) plants with pathogenic bacteria in 24-well polystyrene cell culture plate. Pathogenesis of bacteria to duckweed was demonstrated with Pseudomonas aeruginosa and Staphylococcus aureus as two model pathogens. P. aeruginosa PAO1 caused severe detriment to duckweed as judged from inhibition to frond multiplication and chlorophyll formation. Using a GFP-marked PAO1 strain, we demonstrated that bacteria colonized on both fronds and roots and formed biofilms. Virulence of PAO1 to duckweed was attenuated in its quorum sensing (QS) mutants and in recombinant strains overexpressing the QS quenching enzymes. RN4220, a virulent strain of S. aureus, caused severe toxicity to duckweed while an avirulent strain showed little effect. Using this system for antimicrobial chemical selection, green tea polyphenols exhibited inhibitory activity against S. aureus virulence. This system was further confirmed to be effective as a pathogenesis model using a number of pathogenic bacterial species. Conclusions/Significance Our results demonstrate that duckweed can be used as a fast, inexpensive and reproducible model plant system for the study of host-pathogen interactions, could serve as an alternative choice for the study of some virulence factors, and could also potentially be used in large-scale screening for the discovery of antimicrobial chemicals. PMID:21049039
Duckweed (Lemna minor as a model plant system for the study of human microbial pathogenesis.
Directory of Open Access Journals (Sweden)
Yong Zhang
Full Text Available BACKGROUND: Plant infection models provide certain advantages over animal models in the study of pathogenesis. However, current plant models face some limitations, e.g., plant and pathogen cannot co-culture in a contained environment. Development of such a plant model is needed to better illustrate host-pathogen interactions. METHODOLOGY/PRINCIPAL FINDINGS: We describe a novel model plant system for the study of human pathogenic bacterial infection on a large scale. This system was initiated by co-cultivation of axenic duckweed (Lemna minor plants with pathogenic bacteria in 24-well polystyrene cell culture plate. Pathogenesis of bacteria to duckweed was demonstrated with Pseudomonas aeruginosa and Staphylococcus aureus as two model pathogens. P. aeruginosa PAO1 caused severe detriment to duckweed as judged from inhibition to frond multiplication and chlorophyll formation. Using a GFP-marked PAO1 strain, we demonstrated that bacteria colonized on both fronds and roots and formed biofilms. Virulence of PAO1 to duckweed was attenuated in its quorum sensing (QS mutants and in recombinant strains overexpressing the QS quenching enzymes. RN4220, a virulent strain of S. aureus, caused severe toxicity to duckweed while an avirulent strain showed little effect. Using this system for antimicrobial chemical selection, green tea polyphenols exhibited inhibitory activity against S. aureus virulence. This system was further confirmed to be effective as a pathogenesis model using a number of pathogenic bacterial species. CONCLUSIONS/SIGNIFICANCE: Our results demonstrate that duckweed can be used as a fast, inexpensive and reproducible model plant system for the study of host-pathogen interactions, could serve as an alternative choice for the study of some virulence factors, and could also potentially be used in large-scale screening for the discovery of antimicrobial chemicals.
Buelna, Christina; Ulloa, Emilio C.; Ulibarri, Monica D.
2009-01-01
This study examined relationship power as a possible mediator of the relationship between dating violence and sexually transmitted infections (STIs). The proposed mediation model was based on the theory of gender and power as well as previous research on intimate partner violence and STI risk. Survey results from a sample of 290 single,…
Quorum system and random based asynchronous rendezvous protocol for cognitive radio ad hoc networks
Directory of Open Access Journals (Sweden)
Sylwia Romaszko
2013-12-01
Full Text Available This paper proposes a rendezvous protocol for cognitive radio ad hoc networks, RAC2E-gQS, which utilizes (1 the asynchronous and randomness properties of the RAC2E protocol, and (2 channel mapping protocol, based on a grid Quorum System (gQS, and taking into account channel heterogeneity and asymmetric channel views. We show that the combination of the RAC2E protocol with the grid-quorum based channel mapping can yield a powerful RAC2E-gQS rendezvous protocol for asynchronous operation in a distributed environment assuring a rapid rendezvous between the cognitive radio nodes having available both symmetric and asymmetric channel views. We also propose an enhancement of the protocol, which uses a torus QS for a slot allocation, dealing with the worst case scenario, a large number of channels with opposite ranking lists.
DEFF Research Database (Denmark)
Rasmussen, Bastian Barker; Nielsen, Kristian Fog; Machado, Henrique
2014-01-01
Bacterial quorum sensing (QS) and the corresponding signals, acyl homoserine lactones (AHLs), were first described for a luminescent Vibrio species. Since then, detailed knowledge has been gained on the functional level of QS; however, the abundance of AHLs in the family of Vibrionaceae in the en......Bacterial quorum sensing (QS) and the corresponding signals, acyl homoserine lactones (AHLs), were first described for a luminescent Vibrio species. Since then, detailed knowledge has been gained on the functional level of QS; however, the abundance of AHLs in the family of Vibrionaceae...... violaceum reporter strains. Ethyl acetate extracts of the cultures were analysed by ultra-high performance liquid chromatography-high resolution mass spectrometry (MS) with automated tandem MS confirmation for AHLs. N-(3-hydroxy-hexanoyl) (OH-C6) and N-(3-hydroxy-decanoyl) (OH-C10) homoserine lactones were...
Moessbauer Spectroscopy Studies of Some Intermetallics in the Zr-Nb-Fe System
International Nuclear Information System (INIS)
Ramos, C.; Saragovi, C.; Granovsky, M.; Arias, D.
2002-01-01
Samples with the following compositions: Zr 62 Nb 14 Fe 24 , Zr 65 Nb 10 Fe 25 and Zr 52 Nb 10 Fe 38 were studied by Moessbauer spectroscopy. All of them showed a ternary cubic Ti 2 Ni-type phase (QS: 0.30±0.02, IS: -0.14±0.01) and traces of Zr 2 Fe phase (QS: 0.86±0.03, IS: -0.29±0.01). Zrβ phase (QS: 0.22±0.01, IS: -0.11±0.01) was also detected except in the case of the richer Fe sample. In addition to these expected phases, a hexagonal MgZn 2 -type phase was determined. The assigned parameters for this phase are: QS: 0.38±0.04, IS: -0.28±0.02. These results suggest a revision of the diagram.
Peng Lee Wah; Seng Ng See; Choon Toh Tien; Sim Lim Cheng; Khian Yong Ching; Chen Goh Kai
2016-01-01
Recent developments in quantity surveying (QS) emphasised the importance of identifying cost significant elements (CSE). The knowledge on CSE of high-rise condominium projects (HRCP) is essential as high-rise residential multi-unit projects are the next option in building construction due to limited land areas in urban areas. This study aims to determine the levels of awareness among QS undergraduates of a private university in Malaysia on CSE of HRCP in Malaysia. The respondents’ knowledge o...
Directory of Open Access Journals (Sweden)
Melissa Starkey
2014-08-01
Full Text Available Etiological agents of acute, persistent, or relapsing clinical infections are often refractory to antibiotics due to multidrug resistance and/or antibiotic tolerance. Pseudomonas aeruginosa is an opportunistic Gram-negative bacterial pathogen that causes recalcitrant and severe acute chronic and persistent human infections. Here, we target the MvfR-regulated P. aeruginosa quorum sensing (QS virulence pathway to isolate robust molecules that specifically inhibit infection without affecting bacterial growth or viability to mitigate selective resistance. Using a whole-cell high-throughput screen (HTS and structure-activity relationship (SAR analysis, we identify compounds that block the synthesis of both pro-persistence and pro-acute MvfR-dependent signaling molecules. These compounds, which share a benzamide-benzimidazole backbone and are unrelated to previous MvfR-regulon inhibitors, bind the global virulence QS transcriptional regulator, MvfR (PqsR; inhibit the MvfR regulon in multi-drug resistant isolates; are active against P. aeruginosa acute and persistent murine infections; and do not perturb bacterial growth. In addition, they are the first compounds identified to reduce the formation of antibiotic-tolerant persister cells. As such, these molecules provide for the development of next-generation clinical therapeutics to more effectively treat refractory and deleterious bacterial-human infections.
Leonhardt, Nathan D; Willoughby, Brian J; Young-Petersen, Bonnie
2018-01-01
Recent research on pornography suggests that perception of addiction predicts negative outcomes above and beyond pornography use. Research has also suggested that religious individuals are more likely to perceive themselves to be addicted to pornography, regardless of how often they are actually using pornography. Using a sample of 686 unmarried adults, this study reconciles and expands on previous research by testing perceived addiction to pornography as a mediator between religiosity and relationship anxiety surrounding pornography. Results revealed that pornography use and religiosity were weakly associated with higher relationship anxiety surrounding pornography use, whereas perception of pornography addiction was highly associated with relationship anxiety surrounding pornography use. However, when perception of pornography addiction was inserted as a mediator in a structural equation model, pornography use had a small indirect effect on relationship anxiety surrounding pornography use, and perception of pornography addiction partially mediated the association between religiosity and relationship anxiety surrounding pornography use. By understanding how pornography use, religiosity, and perceived pornography addiction connect to relationship anxiety surrounding pornography use in the early relationship formation stages, we hope to improve the chances of couples successfully addressing the subject of pornography and mitigate difficulties in romantic relationships.
Interference of Pseudomonas aeruginosa signalling and biofilm formation for infection control
DEFF Research Database (Denmark)
Bjarnsholt, Thomas; Tolker-Nielsen, Tim; Høiby, Niels
2010-01-01
Pseudomonas aeruginosa is the best described bacterium with regards to quorum sensing (QS), in vitro biofilm formation and the development of antibiotic tolerance. Biofilms composed of P. aeruginosa are thought to be the underlying cause of many chronic infections, including those in wounds...... and in the lungs of patients with cystic fibrosis. In this review, we provide an overview of the molecular mechanisms involved in QS, QS-enabled virulence, biofilm formation and biofilm-enabled antibiotic tolerance. We now have substantial knowledge of the multicellular behaviour of P. aeruginosa in vitro. A major...
Institute of Scientific and Technical Information of China (English)
无
2009-01-01
Two new inorganic-organic hybrid polymers, Mn(QS)(H2O) (1) and Co(QS)(H2O)2 (2) (H2QS=8-hydroxyl-quinoline-5-sulfonic acid), based on 8-hydroxylquinoline-5-sulfonate ligand, have been synthesized under solvothermal conditions and their structures were solved by single-crystal X-ray diffraction analysis. Compound 1 is a three-dimensional open framework with rutile topology structure, and compound 2 is a three-dimensional supramolecular structure. These compounds were characterized by powder XRD, infrared spectroscopy, thermogravimetric analysis, fluorescence properties and magnetism properties.
Lomos, C.; Hofman, R.H.; Bosker, R.J.
Secondary school teaching is organized in departments and effective departments functioning as collaborative teams have been associated with effective schools. Therefore, this study investigates the relationship of mathematics departments perceived as professional communities and student achievement
Sentse, Miranda; Laird, Robert D.
2010-01-01
This study focused on support and conflict in parent-child relationships and dyadic friendships as predictors of behavior problems in early adolescence (n=182; M age=12.9 years, 51% female, 45% African American, 74% two-parent homes). Support and conflict in one relationship context were
Joshi, Chinmayi; Kothari, Vijay; Patel, Pooja
2016-01-01
Pigment production is regulated by quorum-sensing (QS) in certain bacteria which are being widely used as model organisms in different QS labs. This paper emphasizes importance of selecting an appropriate wavelength for quantification of bacterial growth and pigmentation. While screening different natural/synthetic preparations for their possible QSmodulating potential, it becomes very much necessary to establish that the observed effect is truly QS-associated, and not falsely inflated owing to inaccurate quantification of bacterial cell density/ pigment intensity. Pigments were extracted in suitable organic solvents, whereas quantification of bacterial growth and extracted pigments was done photometrically. Findings reported in this paper, suggest that while quantifying cell density in a pigmented bacterial suspension, such a wavelength (e.g. 764 nm) should be selected at which pigment interference is either absent or minimum. Additionally, importance of appropriate dilution of the bacterial cell suspensions, prior to photometric measurement has been highlighted. This work indicates that while working with pigmented bacteria, it is important to pay attention to the absorption spectrum of the pigment(s) involved, and also to dilute the dense bacterial suspensions appropriately prior to measuring optical density, so as to avoid any major deviation of OD from the proportionality to the cell density. Besides presenting the experimental data in this paper, patents regarding measurement of cell growth, as well as those indicating the potential of commercialization of various aspects of QS research have been mentioned.
DEFF Research Database (Denmark)
Arevalo-Ferro, C.; Hentzer, Morten; Reil, G.
2003-01-01
The Gram-negative bacterium Pseudomonas aeruginosa is an opportunistic human pathogen which is responsible for severe nosocomial infections in immunocompromised patients and is the major pathogen in cystic fibrosis. The bacterium utilizes two interrelated quorum-sensing (QS) systems, which rely......-controlled protein spots of the surface fraction, confirming the high specificity of the compound. Importantly, 20 novel QS-regulated proteins were identified, many of which are involved in iron utilization, suggesting a link between quorum sensing and the iron regulatory system. Two of these proteins, PhuR and Has......Ap, are components of the two distinct haem-uptake systems present in P. aeruginosa. In agreement with the finding that both proteins are positively regulated by the QS cascade, we show that the lasI rhlI double mutant grows poorly with haemoglobin as the only iron source when compared with the wild type...
Directory of Open Access Journals (Sweden)
Pierre Mostert
2010-12-01
Full Text Available Organisations are increasingly focusing on building long-term relationships with customers, thereby increasing their probability for success by offering customers higher levels of satisfaction, increasing customer loyalty, and ultimately retaining customers. Airlines in particular can benefit from retaining customers as the airline industry is characterised by fierce competition and many airlines are finding it difficult to survive against the backdrop of enormous challenges in the past decade, including the significant decline in demand for air travel together with rising costs and the worldwide economic downturn. This study investigates the effect which a strategy by airlines of building relationships with customers has on customer satisfaction, loyalty, and ultimately customer retention. The effect of service failures on customers' relationships with airlines are also considered as a negative experience could results in customers defecting to competitors. A questionnaire, comprising six sections, was specifically compiled to determine customer retention in the South African domestic passenger airline industry. Data were collected by trained fieldworkers from OR Tambo International Airport by means of a non-probability convenience sampling method from 324 passengers flying with the various domestic airlines. Findings indicate that most respondents were satisfied with the airlines' overall service; respondents who formed relationships with domestic airlines were more loyal toward the airlines; and the relationships of respondents who were satisfied with airlines' service recovery efforts were either strengthened or unchanged. The findings from this study support findings from international studies by providing a unique South African perspective on the effect of a strategy of building relationships with customers on their satisfaction, loyalty and ultimately retention. It can therefore be recommended that the organisations competing in the South
Energy Technology Data Exchange (ETDEWEB)
Pellegrini, M.C.; Zalazar, L.; Fuselli, S.L.; Ponce, A.G.
2017-07-01
American foulbrood (AFB) is a disease affecting the larva of Apis mellifera. The etiological agent is Paenibacillus larvae, which releases metalloproteases involved in the degradation of larval tissues. Through quorum sensing (QS) mechanism, bacteria are able to activate specific genes such as virulence factors. The exoproteases regulation of P. larvae could be associated with QS. A promising mechanism of AFB control is to block QS mechanism with essential oils (EO). The aim of this study was to investigate the potential presence of QS signals in the regulation of P. larvae proteases and the effect of seven EOs on the exoproteases activity of P. larvae. From growth curves and evaluation of the presence of proteases by milk agar plates assay, it was observed protease activity during the late exponential phase of growth. Early production of protease activity (15 hours earlier than control) was observed when a low density culture was incubated with late exponential spent medium (SM) suggesting the presence of factor(s) inducing this activity. SM was obtained by the ultrafiltration of P. larvae cultures on late growth phase and was free of proteases. Proteolytic activity was quantified on P. larvae cultures in presence of sublethal concentration of EO by azocasein method. The EOs, except S. chilensis EO, reduced significantly protease activity (more than 50%). We report for the first time evidence on the possible role of QS on P. larvae and the antiproteolytic activity of EOs (except for S. chilensis) on exoproteases, an interesting therapeutic strategy to control AFB.
Prospective bacterial quorum sensing inhibitors from Indian medicinal plant extracts.
Tiwary, B K; Ghosh, R; Moktan, S; Ranjan, V K; Dey, P; Choudhury, D; Dutta, S; Deb, D; Das, A P; Chakraborty, R
2017-07-01
As virulence of many pathogenic bacteria is regulated by the phenomenon of quorum sensing (QS), the present study aimed to find the QS-inhibiting (QS-I) property (if any) in 61 Indian medicinal plants. The presence of QS-I compound in the leaf extract was evaluated by its ability to inhibit production of pigment in Chromobacterium violaceum MTCC 2656 (violacein) and Pseudomonas aeruginosa MTCC 2297 (pyocyanin) or swarming of P. aeruginosa MTCC 2297. Extracts of three plants, Astilbe rivularis, Fragaria nubicola and Osbeckia nepalensis, have shown a dose-dependent inhibition of violacein production with no negative effect on bacterial growth. Inhibition of pyocyanin pigment production and swarming motility in P. aeruginosa MTCC 2297 was also shown. Based on the results obtained by gas chromatography-mass spectroscopy (GC-MS) and thin-layer chromatography-direct bioautography (TLC-DB), it was concluded that triterpenes and flavonoid compounds found in the three plant extracts could have QS-I activity. A novel alternative prospect to prevent bacterial infections without inhibiting the growth is to apply chemicals that inhibit quorum sensing mechanism of the pathogens. Antiquorum property of 61 medicinal plants was evaluated by the ability of their leaf extract(s) to inhibit production of pigment (violacein in Chromobacterium violaceum MTCC 2656, pyocyanin in Pseudomonas aeruginosa MTCC 2297) or swarming in P. aeruginosa MTCC 2297. The most prospective plants (for the development of quorum sensing inhibitor), showing inhibition of violacein production without affecting bacterial growth, were Astilbe rivularis, Fragaria nubicola and Osbeckia nepalensis. © 2017 The Society for Applied Microbiology.
Penverne, Yann; Leclere, Brice; Labady, Julien; Berthier, Frederic; Jenvrin, Joel; Javaudin, Francois; Batard, Eric; Montassier, Emmanuel
2017-05-17
Emergency Medical Communication Centre (EMCC) represents a pivotal link in the chain of survival for those requiring rapid response for out-of-hospital medical emergencies. Assessing and grading the performance of EMCCs are warranted as it can affect the health and safety of the served population. The aim of our work was to describe the activity on an EMCC and to explore the associations between different key performance indicators. We carried out our prospective observational study in the EMCC of Nantes, France, from 6 June 2011 to 6 June 2015. The EMCC performance was assessed with the following key performance indicators: answered calls, Quality of Service 20 s (QS20), occupation rate and average call duration. A total of 35 073 h of dispatch activity were analysed. 1 488 998 emergency calls were answered. The emergency call incidence varied slightly from 274 to 284 calls/1000 citizens/year between 2011 and 2015. The median occupation rate was 35% (25-44). QS20 was correlated negatively with the occupation rate (Spearman's ρ: -0.78). The structural equation model confirmed that the occupation rate was highly correlated with the QS20 (standardized coefficient: -0.89). For an occupation rate of 26%, the target value estimated by our polynomial model, the probability of achieving a QS20 superior or equal to 95% varied between 56 and 84%. The occupation rate appeared to be the most important factor contributing towards the QS20. Our data will be useful to develop best practices and guidelines in the field of emergency medicine communication centres.
International Nuclear Information System (INIS)
Pellegrini, M.C.; Zalazar, L.; Fuselli, S.L.; Ponce, A.G.
2017-01-01
American foulbrood (AFB) is a disease affecting the larva of Apis mellifera. The etiological agent is Paenibacillus larvae, which releases metalloproteases involved in the degradation of larval tissues. Through quorum sensing (QS) mechanism, bacteria are able to activate specific genes such as virulence factors. The exoproteases regulation of P. larvae could be associated with QS. A promising mechanism of AFB control is to block QS mechanism with essential oils (EO). The aim of this study was to investigate the potential presence of QS signals in the regulation of P. larvae proteases and the effect of seven EOs on the exoproteases activity of P. larvae. From growth curves and evaluation of the presence of proteases by milk agar plates assay, it was observed protease activity during the late exponential phase of growth. Early production of protease activity (15 hours earlier than control) was observed when a low density culture was incubated with late exponential spent medium (SM) suggesting the presence of factor(s) inducing this activity. SM was obtained by the ultrafiltration of P. larvae cultures on late growth phase and was free of proteases. Proteolytic activity was quantified on P. larvae cultures in presence of sublethal concentration of EO by azocasein method. The EOs, except S. chilensis EO, reduced significantly protease activity (more than 50%). We report for the first time evidence on the possible role of QS on P. larvae and the antiproteolytic activity of EOs (except for S. chilensis) on exoproteases, an interesting therapeutic strategy to control AFB.
Koutsoudis, Maria D; Tsaltas, Dimitrios; Minogue, Timothy D; von Bodman, Susanne B
2006-04-11
The phytopathogenic bacterium Pantoea stewartii subsp. stewartii synthesizes stewartan exo/capsular polysaccharide (EPS) in a cell density-dependent manner governed by the EsaI/EsaR quorum-sensing (QS) system. This study analyzes biofilm development and host colonization of the WT and QS regulatory mutant strains of P. stewartii. First, we show that the cell density-dependent synthesis of stewartan EPS, governed by the EsaI/EsaR QS system, is required for proper bacterial adhesion and development of spatially defined, 3D biofilms. Second, a nonvirulent mutant lacking the esaI gene adheres strongly to surfaces and develops densely packed, less structurally defined biofilms in vitro. This strain appears to be arrested in a low cell density developmental mode. Exposure of this strain to exogenous N-acyl-homoserine lactone counteracts this adhesion phenotype. Third, QS mutants lacking the EsaR repressor attach poorly to surfaces and form amorphous biofilms heavily enmeshed in excess EPS. Fourth, the WT strain disseminates efficiently within the xylem, primarily in a basipetal direction. In contrast, the two QS mutant strains remain largely localized at the site of infection. Fifth, and most significantly, epifluorescence microscopic imaging of infected leaf tissue and excised xylem vessels reveals that the bacteria colonize the xylem with unexpected specificity, particularly toward the annular rings and spiral secondary wall thickenings of protoxylem, as opposed to indiscriminate growth to fill the xylem lumen. These observations are significant to bacterial plant pathogenesis in general and may reveal targets for disease control.
Directory of Open Access Journals (Sweden)
María C. Pellegrini
2018-02-01
Full Text Available American foulbrood (AFB is a disease affecting the larva of Apis mellifera. The etiological agent is Paenibacillus larvae, which releases metalloproteases involved in the degradation of larval tissues. Through quorum sensing (QS mechanism, bacteria are able to activate specific genes such as virulence factors. The exoproteases regulation of P. larvae could be associated with QS. A promising mechanism of AFB control is to block QS mechanism with essential oils (EO. The aim of this study was to investigate the potential presence of QS signals in the regulation of P. larvae proteases and the effect of seven EOs on the exoproteases activity of P. larvae. From growth curves and evaluation of the presence of proteases by milk agar plates assay, it was observed protease activity during the late exponential phase of growth. Early production of protease activity (15 hours earlier than control was observed when a low density culture was incubated with late exponential spent medium (SM suggesting the presence of factor(s inducing this activity. SM was obtained by the ultrafiltration of P. larvae cultures on late growth phase and was free of proteases. Proteolytic activity was quantified on P. larvae cultures in presence of sublethal concentration of EO by azocasein method. The EOs, except S. chilensis EO, reduced significantly protease activity (more than 50%. We report for the first time evidence on the possible role of QS on P. larvae and the antiproteolytic activity of EOs (except for S. chilensis on exoproteases, an interesting therapeutic strategy to control AFB.
Directory of Open Access Journals (Sweden)
Chhabra Siri
2011-03-01
Full Text Available Abstract Background Cell-to-cell communication (quorum sensing (QS co-ordinates bacterial behaviour at a population level. Consequently the behaviour of a natural multi-species community is likely to depend at least in part on co-existing QS and quorum quenching (QQ activities. Here we sought to discover novel N-acylhomoserine lactone (AHL-dependent QS and QQ strains by investigating a bacterial community associated with the rhizosphere of ginger (Zingiber officinale growing in the Malaysian rainforest. Results By using a basal growth medium containing N-(3-oxohexanoylhomoserine lactone (3-oxo-C6-HSL as the sole source of carbon and nitrogen, the ginger rhizosphere associated bacteria were enriched for strains with AHL-degrading capabilities. Three isolates belonging to the genera Acinetobacter (GG2, Burkholderia (GG4 and Klebsiella (Se14 were identified and selected for further study. Strains GG2 and Se14 exhibited the broadest spectrum of AHL-degrading activities via lactonolysis while GG4 reduced 3-oxo-AHLs to the corresponding 3-hydroxy compounds. In GG2 and GG4, QQ was found to co-exist with AHL-dependent QS and GG2 was shown to inactivate both self-generated and exogenously supplied AHLs. GG2, GG4 and Se14 were each able to attenuate virulence factor production in both human and plant pathogens. Conclusions Collectively our data show that ginger rhizosphere bacteria which make and degrade a wide range of AHLs are likely to play a collective role in determining the QS-dependent phenotype of a polymicrobial community.
Odekerken-Schröder, G.J.; Bloemer, J.M.M.
2002-01-01
The objective of this study is to empirically determine the role of constraints and dedication as drivers of relationship commitment as most of the existing work is of a conceptual nature only. We assess how and to which extent these two drivers fit into the established relationships between overall
Directory of Open Access Journals (Sweden)
Alberto Jorge da Rocha Silva
2005-03-01
Full Text Available O trabalho visa determinar as relações entre comunidades e vegetação na Zona da Mata de Pernambuco. A comunidade da Usina São José (Igarassu - Ig é formada por vilas rurais, vizinhas da Reserva Ecológica da Mata da Usina São José. Jaguarana (Paulista-Pa é uma comunidade urbana, próxima à Reserva Ecológica da Mata de Jaguarana. Levantou-se as plantas úteis para estas comunidades por meio de 38 entrevistas não-estruturadas, enquadrando-as nas categorias de uso alimentação, comércio, construção, mágico, medicinal, tecnológico e outros. Foram registradas 334 espécies, nativas e cultivadas. Comparou-se as comunidades, através do Quociente de Similaridade de Sørensen (Qs, obtendo-se maiores índices para plantas alimentícias (QsIgPa= 0,71, predominantemente cultivadas, e medicinais (QsIgPa= 0,56, 45,1% delas nativas, predominantemente herbáceas. A vegetação nativa constitui uma fonte importante de recursos medicinais mas é subutilizada como fonte de alimento e tem pouca relevância na visão cosmológica das comunidades. Os vegetais não têm relevância na atividade de comércio, servindo como complemento de renda para as famílias (QsIgPa= 0,30. Na categoria construção enquadram-se, majoritariamente, espécies nativas (87,8% e arbóreas (92,7%. Em tecnologia têm maior representatividade espécies nativas (85,7% e arbóreo/arbustivas (84,1%. As comunidades utilizam diferentes fontes vegetais para as categorias construção, mágica, tecnologia e outros, decorrentes tanto das principais atividades que nelas exercem seus moradores, como dos recursos naturais à sua disposição.The objective of this work is to determine the social behaviour concerning the consumption of vegetal species by local communities. The involved localities are: the Usina São José (Igarassu - Ig, which involves rural communities in the surroundings of the Ecological Reserve of the Usina São José and the Jaguarana (Paulista - PE, an urban
Zhi, Xiangyun; Abdullah, Iman Tajer; Gazioglu, Ozcan; Manzoor, Irfan; Shafeeq, Sulman; Kuipers, Oscar P; Hiller, N Luisa; Andrew, Peter W; Yesilkaya, Hasan
2018-01-01
Microbes communicate with each other by using quorum sensing (QS) systems and modulate their collective 'behavior' for in-host colonization and virulence, biofilm formation, and environmental adaptation. The recent increase in genome data availability reveals the presence of several putative QS
DEFF Research Database (Denmark)
Claussen, Anetta; Abdali, Salim; Berg, Rolf W.
2013-01-01
suitable tool for in situ measurements of low Acyl-Homoserine Lactone (AHL) concentrations in biofilms containing QS bacteria. Signal molecules communicate information about their environment and coordinate certain physiological activities in QS systems that exist in many bacteria. SERS enables detection...
New frontiers of quantified self 2
DEFF Research Database (Denmark)
Rapp, Amon; Cena, Federica; Kay, Judy
2016-01-01
While the Quantified Self (QS) community is described in terms of "self-knowledge through numbers" people are increasingly demanding value and meaning. In this workshop we aim at refocusing the QS debate on the value of data for providing new services....
Impact of quorum sensing on the quality of fermented foods
DEFF Research Database (Denmark)
Johansen, Pernille; Jespersen, Lene
2017-01-01
The quality of fermented food highly dependents on the microorganisms involved, their metabolic activities and interactions. Recently, focus has been on quorum sensing (QS) being a cell density-dependent mechanism allowing adaptive responses. Specific QS molecules in prokaryotes and eukaryotes...
Wong, Sin Man; Leung, Angel Nga-Man; McBride-Chang, Catherine
2010-01-01
This study examined the perceived parental styles of maternal warmth and control, as well as adolescent filial piety, in relation to parent-child relationship quality, in 308 Hong Kong Chinese adolescents. The three mother-child relationship qualities measured were perceived maternal support, conflicts, and relationship depth. Adolescents'…
Minieri, Alexandra M; Staton-Tindall, Michele; Leukefeld, Carl; Clarke, Jennifer G; Surratt, Hilary L; Frisman, Linda K
2014-03-01
The purpose of this study was to examine perceived relationship power as a mediator of the relationship between intimate partner violence (IPV) and mental health issues among incarcerated women with a history of substance use. Cross-sectional data from 304 women as part of the Criminal Justice Drug Abuse Treatment Studies (CJ-DATS) were used to evaluate this hypothesis. Regression analyses examined the mediation relationship of perceived relationship power in the association between a history of IPV and mental health issues. Results supported the hypothesis, suggesting that perceived relationship power helps to explain the association between IPV and mental health issues. Implications of the findings for the provision of services to address the needs of these women are discussed, including assessment of perceived relationship power and focusing counseling interventions on women's experiences with power in intimate relationships.
Czech Academy of Sciences Publication Activity Database
Valach, F.; Revallo, M.; Bochníček, Josef; Hejda, Pavel
2009-01-01
Roč. 7, April (2009), S04004/1-S04004/7 ISSN 1542-7390 R&D Projects: GA AV ČR(CZ) IAA300120608; GA AV ČR 1QS300120506 Institutional research plan: CEZ:AV0Z30120515 Keywords : neural networks * coronal mass ejections * energetic particles * flares * radio emissions * magnetic storms Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.845, year: 2009
Milatz, Anne; Lüftenegger, Marko; Schober, Barbara
2015-01-01
Teachers’ relationship quality with students has been argued to be an important source of teacher wellbeing. Thus, the current study aimed to investigate to what extent teachers’ relationship closeness toward students, combined with attachment security is a resource protecting against teacher burnout. Eighty-three elementary school teachers reported on their most and least attached student’s relationship closeness, their attachment security and levels of burnout, as measured by emotional exhaustion, depersonalization and personal accomplishment. Response surface analysis (RSA), enabling researchers to investigate the effect of congruence/incongruence of two predictors on an outcome, revealed that teachers’ depersonalization and emotional exhaustion were lowest when they developed homogenous close relationships toward the students within their classroom and when teachers in general made congruent relationship experiences. No RSA model could be specified for personal accomplishment, even though a correlational analysis revealed that increasing closeness with students fostered teachers’ personal accomplishment. Teachers’ secure attachment experiences were not directly related to burnout, but enhanced their capability to establish close relationships toward their students. Findings suggest that teachers’ relationships toward students are a resource for the teacher’s wellbeing, which highlights once again the importance of student–teacher relationships in education. PMID:26779045
Violent behavior of men in their intimate relationships, as they experience it.
Flinck, Aune; Paavilainen, Eija
2008-09-01
Violence against women has been extensively studied in various disciplines, whereas less attention has been paid to the experiences of men. Even the violent behavior of men in their intimate relationships has been mostly studied as experienced by women. This study follows Husserlian descriptive phenomenology. Twenty open-ended interviews were conducted with 10 Finnish men with a history of intimate partner violence (IPV). The data were analyzed by the method developed by Colaizzi. Findings suggested that men considered communication and dynamics of the relationship important. Fundamentally, these abusive men had a need to be respected as men, and they sought to experience human dignity. It is necessary to readjust the framework on interpersonal violence, listen to the voice of men, and develop prevention, early identification, and supportive intervention strategies for men, couples, and families. Research on IPV should be expanded to include the experiences of both genders.
Shin, HaeJin; Lee, Dong Hun; Yu, Kumlan; Ham, KyongAe
2016-01-01
The purpose of the current study was to investigate a two-stage model in which parent-related stress and hopelessness each served as mediators of the relationship between perceived parental bonding and South Korean adolescent peer victimization. This study also examined whether the mediating relationships differed by the gender of parents and…
Information Technology and the QS Practice
Directory of Open Access Journals (Sweden)
Peter Smith
2011-08-01
Full Text Available The paper examines how Quantity Surveying practices can improve their business performance, market share and profit levels by embracing and evolving with the latest technological developments in electronic business practices and data/information analysis and exchange in the construction industry. Firms in the new millenium will need towork smarterto gain competitive advantage and electronic commerce provides probably the greatest scope for this to be achieved. More importantly, current project procurement trends strongly indicate that firms not able to communicating electronically at all levels with project participants will find it increasingly difficult to secure work. The results of three nationwide surveys of the Australian Quantity Surveying profession spanning from 1995 to 1999 are used to identify current business practices and technology utilisation by Quantity Surveying firms and to analyse whether firms are positioning themselves to meet future industryrequirements. The paper concludes with a range of Information Technology strategies aimed at improving business opportunities and performance for Quantity Surveying firms.
Subramoni, Sujatha; Florez Salcedo, Diana Vanessa; Suarez-Moreno, Zulma R.
2015-01-01
LuxR solo transcriptional regulators contain both an autoinducer binding domain (ABD; N-terminal) and a DNA binding Helix-Turn-Helix domain (HTH; C-terminal), but are not associated with a cognate N-acyl homoserine lactone (AHL) synthase coding gene in the same genome. Although a few LuxR solos have been characterized, their distributions as well as their role in bacterial signal perception and other processes are poorly understood. In this study we have carried out a systematic survey of distribution of all ABD containing LuxR transcriptional regulators (QS domain LuxRs) available in the InterPro database (IPR005143), and identified those lacking a cognate AHL synthase. These LuxR solos were then analyzed regarding their taxonomical distribution, predicted functions of neighboring genes and the presence of complete AHL-QS systems in the genomes that carry them. Our analyses reveal the presence of one or multiple predicted LuxR solos in many proteobacterial genomes carrying QS domain LuxRs, some of them harboring genes for one or more AHL-QS circuits. The presence of LuxR solos in bacteria occupying diverse environments suggests potential ecological functions for these proteins beyond AHL and interkingdom signaling. Based on gene context and the conservation levels of invariant amino acids of ABD, we have classified LuxR solos into functionally meaningful groups or putative orthologs. Surprisingly, putative LuxR solos were also found in a few non-proteobacterial genomes which are not known to carry AHL-QS systems. Multiple predicted LuxR solos in the same genome appeared to have different levels of conservation of invariant amino acid residues of ABD questioning their binding to AHLs. In summary, this study provides a detailed overview of distribution of LuxR solos and their probable roles in bacteria with genome sequence information. PMID:25759807
Subramoni, Sujatha; Florez Salcedo, Diana Vanessa; Suarez-Moreno, Zulma R
2015-01-01
LuxR solo transcriptional regulators contain both an autoinducer binding domain (ABD; N-terminal) and a DNA binding Helix-Turn-Helix domain (HTH; C-terminal), but are not associated with a cognate N-acyl homoserine lactone (AHL) synthase coding gene in the same genome. Although a few LuxR solos have been characterized, their distributions as well as their role in bacterial signal perception and other processes are poorly understood. In this study we have carried out a systematic survey of distribution of all ABD containing LuxR transcriptional regulators (QS domain LuxRs) available in the InterPro database (IPR005143), and identified those lacking a cognate AHL synthase. These LuxR solos were then analyzed regarding their taxonomical distribution, predicted functions of neighboring genes and the presence of complete AHL-QS systems in the genomes that carry them. Our analyses reveal the presence of one or multiple predicted LuxR solos in many proteobacterial genomes carrying QS domain LuxRs, some of them harboring genes for one or more AHL-QS circuits. The presence of LuxR solos in bacteria occupying diverse environments suggests potential ecological functions for these proteins beyond AHL and interkingdom signaling. Based on gene context and the conservation levels of invariant amino acids of ABD, we have classified LuxR solos into functionally meaningful groups or putative orthologs. Surprisingly, putative LuxR solos were also found in a few non-proteobacterial genomes which are not known to carry AHL-QS systems. Multiple predicted LuxR solos in the same genome appeared to have different levels of conservation of invariant amino acid residues of ABD questioning their binding to AHLs. In summary, this study provides a detailed overview of distribution of LuxR solos and their probable roles in bacteria with genome sequence information.
Directory of Open Access Journals (Sweden)
Sujatha eSubramoni
2015-02-01
Full Text Available LuxR solo transcriptional regulators contain both an autoinducer binding domain (ABD; N-terminal and a DNA binding Helix-Turn-Helix domain (HTH; C-terminal, but are not associated with a cognate N-acyl homoserine lactone (AHL synthase coding gene in the same genome. Although a few LuxR solos have been characterized, their distributions as well as their role in bacterial signal perception and other processes are poorly understood. In this study we have carried out a systematic survey of distribution of all ABD containing LuxR transcriptional regulators (QS domain LuxRs available in the InterPro database (IPR005143, and identified those lacking a cognate AHL synthase. These LuxR solos were then analyzed regarding their taxonomical distribution, predicted functions of neighboring genes and the presence of complete AHL-QS systems in the genomes that carry them. Our analyses reveal the presence of one or multiple predicted LuxR solos in many proteobacterial genomes carrying QS domain LuxRs, some of them harboring genes for one or more AHL-QS circuits. The presence of LuxR solos in bacteria occupying diverse environments suggests potential ecological functions for these proteins beyond AHL and interkingdom signaling. Based on gene context and the conservation levels of invariant amino acids of ABD, we have classified LuxR solos into functionally meaningful groups or putative orthologs. Surprisingly, putative LuxR solos were also found in a few non-proteobacterial genomes which are not known to carry AHL-QS systems. Multiple predicted LuxR solos in the same genome appeared to have different levels of conservation of invariant amino acid residues of ABD questioning their binding to AHLs. In summary, this study provides a detailed overview of distribution of LuxR solos and their probable roles in bacteria with genome sequence information.
Relationships between food producers and retail chains seen as shared meanings
DEFF Research Database (Denmark)
Skytte, Hans
This paper presents a new theory on relationships between producers and retail chains. This theory is a result of a project which investigated the cooperation between Danish abattoirs and food processors, and retail chains in four countries. The new theory's main point is that relationships betwe...
Thomas, Elizabeth C; Muralidharan, Anjana; Medoff, Deborah; Drapalski, Amy L
2016-12-01
The purposes of this research were to assess relationships between social support and objective and subjective recovery in a sample of adults with serious mental illness and to examine self-efficacy as a potential mediator of these relationships. In this cross-sectional study, a sample of 250 individuals completed measures tapping social support network size, satisfaction with social support, perceived support from the mental health system, self-efficacy, objective recovery (i.e., psychiatric symptoms, social functioning), and subjective recovery. Pearson product-moment correlations and multiple linear regression analyses examined relationships among social support, self-efficacy, and recovery. A bootstrapping procedure was used to estimate the magnitude and significance of indirect effects in mediation analyses. All social support domains (i.e., social support network size, satisfaction with support, perceived support from the mental health system) were significantly related to at least 1 objective recovery outcome and to subjective recovery. Self-efficacy was a mediator of all relationships between social support and objective and subjective recovery. The present study aids in better understanding the relationship between social support and recovery in individuals with serious mental illness and paves the way for future research. Particularly relevant to mental health service providers, it highlights the importance of establishing and maintaining an effective therapeutic relationship as well as assisting consumers with developing supportive relationships with others. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
The relationship between glass ceiling and power distance as a cultural variable by a new method
Directory of Open Access Journals (Sweden)
Naide Jahangirov
2015-12-01
Full Text Available Glass ceiling symbolizes a variety of barriers and obstacles that arise from gender inequality at business life. With this mind, culture influences gender dynamics. The purpose of this research was to examine the relationship between the glass ceiling and the power distance as a cultural variable within organizations. Gender variable is taken as a moderator variable in relationship between the concepts. In addition to conventional correlation analysis, we employed a new method to investigate this relationship in detail. The survey data were obtained from 109 people working at a research center which operated as a part of the non-profit private university in Ankara, Turkey. The relationship between the variables was revealed by a new method which was developed as an addition to the correlation in survey. The analysis revealed that the female staff perceived the glass ceiling and the power distance more intensely than the male staff. In addition, the medium level relation was determined between the power distance and the glass ceiling perception among female staff.
Lowery, Colin A; Matamouros, Susana; Niessen, Sherry; Zhu, Jie; Scolnick, Jonathan; Lively, Jenny M; Cravatt, Benjamin F; Miller, Samuel I; Kaufmann, Gunnar F; Janda, Kim D
2013-07-25
Small molecule probes have been used extensively to explore biologic systems and elucidate cellular signaling pathways. In this study, we use an inhibitor of bacterial communication to monitor changes in the proteome of Salmonella enterica serovar Typhimurium with the aim of discovering unrecognized processes regulated by AI-2-based quorum-sensing (QS), a mechanism of bacterial intercellular communication that allows for the coordination of gene expression in a cell density-dependent manner. In S. typhimurium, this system regulates the uptake and catabolism of intercellular signals and has been implicated in pathogenesis, including the invasion of host epithelial cells. We demonstrate that our QS antagonist is capable of selectively inhibiting the expression of known QS-regulated proteins in S. typhimurium, thus attesting that QS inhibitors may be used to confirm proposed and elucidate previously unidentified QS pathways without relying on genetic manipulation. Copyright © 2013 Elsevier Ltd. All rights reserved.
Saeed, O.; Duru, L.; Yulin, D.
2018-05-01
A proposed microfluidic design has been fabricated and simulated using COMSOL Multiphysics software, based on two physical models included in this design. The device’s ability to create a narrow stream of the core sample by controlling the sheath flow rates Qs1 and Qs2 in both peripheral channels was investigated. The main target of this paper is to study the possibility of combing the hydrodynamic and magnetic techniques, in order to achieve a high rate of cancer cells separation from a cell mixture and/or buffer sample. The study has been conducted in two stages, firstly, the effects of the sheath flow rates (Qs1 and Qs2) on the sample stream focusing were studied, to find the proposed device effectiveness optimal conditions and its capability in cell focusing, and then the magnetic mechanism has been utilized to finalize the pre-labelled cells separation process.
Moessbauer Spectroscopy Studies of Some Intermetallics in the Zr-Nb-Fe System
Energy Technology Data Exchange (ETDEWEB)
Ramos, C. [CNEA-UNSAM, Comision Nacional de Energia Atomica, Instituto de Tecnologia J. Sabato (Argentina); Saragovi, C. [Comision Nacional de Energia Atomica, Departamento de Fisica (Argentina); Granovsky, M.; Arias, D. [Comision Nacional de Energia Atomica, Departamento de Materiales (Argentina)
2002-03-15
Samples with the following compositions: Zr{sub 62}Nb{sub 14}Fe{sub 24}, Zr{sub 65}Nb{sub 10}Fe{sub 25} and Zr{sub 52}Nb{sub 10}Fe{sub 38} were studied by Moessbauer spectroscopy. All of them showed a ternary cubic Ti{sub 2}Ni-type phase (QS: 0.30{+-}0.02, IS: -0.14{+-}0.01) and traces of Zr{sub 2}Fe phase (QS: 0.86{+-}0.03, IS: -0.29{+-}0.01). Zr{beta} phase (QS: 0.22{+-}0.01, IS: -0.11{+-}0.01) was also detected except in the case of the richer Fe sample. In addition to these expected phases, a hexagonal MgZn{sub 2}-type phase was determined. The assigned parameters for this phase are: QS: 0.38{+-}0.04, IS: -0.28{+-}0.02. These results suggest a revision of the diagram.
Negash, Sesen; Cravens, Jaclyn D; Brown, Preston C; Fincham, Frank D
This study evaluated the impact of a relationship education program, delivered as part of a college course, among students (N = 152) who reported experiencing psychological aggression in their exclusive dating relationship. Preliminary results showed that compared to those in the control group, participants receiving relationship education were significantly more likely to end their romantic relationship, even after controlling for relationship satisfaction. Furthermore, when relationship termination occurred, those in the intervention group were significantly more likely to attribute the breakup to their participation in the class as compared to those in the control group. The tentative findings are an important preliminary step in assessing the benefits of relationship education in reducing the risk of psychological aggression among college students.
Relationships as determinants of substance use amongst street ...
African Journals Online (AJOL)
Background: Unrestrained exposure to street life often makes the street child vulnerable to psychoactive substances. In other settings, the social relationships of the substance user with those around him or her and family norms of parenting have been docu-mented to modulate use. However, there is a dearth of literature on ...
Yang, Nana; Ding, Shuting; Chen, Feifei; Zhang, Xue; Xia, Yongjie; Di, Hongxia; Cao, Qiao; Deng, Xin; Wu, Min; Wong, Catherine C L; Tian, Xiao-Xu; Yang, Cai-Guang; Zhao, Jing; Lan, Lefu
2015-05-01
Rhamnolipid acts as a virulence factor during Pseudomonas aeruginosa infection. Here, we show that deletion of the catabolite repression control (crc) gene in P. aeruginosa leads to a rhamnolipid-negative phenotype. This effect is mediated by the down-regulation of rhl quorum sensing (QS). We discover that a disruption of the gene encoding the Lon protease entirely offsets the effect of crc deletion on the production of both rhamnolipid and rhl QS signal C4-HSL. Crc is unable to bind lon mRNA in vitro in the absence of the RNA chaperon Hfq, while Crc contributes to Hfq-mediated repression of the lon gene expression at a posttranscriptional level. Deletion of crc, which results in up-regulation of lon, significantly reduces the in vivo stability and abundance of the RhlI protein that synthesizes C4-HSL, causing the attenuation of rhl QS. Lon is also capable of degrading the RhlI protein in vitro. In addition, constitutive expression of rhlI suppresses the defects of the crc deletion mutant in rhamnolipid, C4-HSL and virulence on lettuce leaves. This study therefore uncovers a novel posttranscriptional regulatory cascade, Crc-Hfq/Lon/RhlI, for the regulation of rhamnolipid production and rhl QS in P. aeruginosa. © 2015 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Liz A. Kawabata-Yoshihara
2009-12-01
Full Text Available FUNDAMENTO: A determinação da prevalência de alterações eletrocardiográficas nas faixas etárias mais velhas da população brasileira representa importante informação com finalidade clínica e epidemiológica. OBJETIVO: Verificar as taxas de prevalência de fibrilação atrial, ondas alargadas Q/QS (código de Minnesota 1.1-1.2 e bloqueio de ramo esquerdo. MÉTODOS: Em estudo de base populacional, 1.524 participantes (921 mulheres e 603 homens com idade acima de 65 anos moradores de São Paulo, Brasil foram submetidos a exame eletrocardiográfico em repouso, a medidas antropométricas e de pressão arterial, além de coleta de sangue em jejum para dosagem de glicose, colesterol total e frações. RESULTADOS: Prevalência ajustada por idade para ondas alargadas Q/QS foi 12,1% (homens, 17,2%; mulheres, 9,6%, para fibrilação atrial foi de 2,4% (homens 3,9%; mulheres, 2,0%, e, para bloqueio de ramo esquerdo foi de 3,1% (homens, 3,1%; mulheres, 3,8%. Para fibrilação atrial (ambos os sexos, ondas alargadas Q/QS (homens e bloqueio de ramo esquerdo (mulheres houve aumento de frequência de acordo com a faixa etária. Após ajustes para idade, sexo, diabetes e dislipidemia, a razão de chances entre as frequências de ondas alargadas Q/QS e hipertensão arterial foi 2,4 (intervalo de confiança 95% [IC 95%CI] 1,4 -3,9 sendo de 5,1 (IC 95% 1,8 -14,4 para mulheres e 1,7 (95%CI, 0,95-3,1] para homens. CONCLUSÃO: A comparação desses dados com outros estudos revelou prevalência elevada de alargamento de ondas Q/QS nessa população com associação direta com a prevalência de hipertensão arterial.FUNDAMENTO: la determinación de la prevalencia de alteraciones electrocardiográficas en las franjas etarias más viejas en la población brasileña representa importante información con finalidad clínica y epidemiológica. OBJETIVO: Verificar las tasas de prevalencia de fibrilación auricular, ondas alargadas Q/QS (código de Minnesota 1
Directory of Open Access Journals (Sweden)
Atefeh Arab
2013-07-01
Full Text Available We present a social work study on relationship between parenting styles and career aspirations as well as psychological well-being among third year high school female students in city of Khomeinishahr, Iran during the year of 2012. The study selects a sample of 300 students from 1260 female students who were enrolled in third year high school education, randomly. The study uses the Baumrind’s questionnaire on parenting style, which consists of 30 questions which equally measure three parenting styles including authoritarian, indulgent and authoritative in Likert scale. The survey also uses Gottfredson’s questionnaire to examine occupational aspirations. The study examines whether there is any relationship between parenting style from one side and three personal characteristics including gender, career aspiration and wishes type on the other side. Using Chi-Square technique, the survey examines three hypotheses and the results confirm all three hypotheses of the survey.
Running With the Pack: Teen Peer-Relationship Qualities as Predictors of Adult Physical Health.
Allen, Joseph P; Uchino, Bert N; Hafen, Christopher A
2015-10-01
This study assessed qualities of adolescent peer relationships as long-term predictors of physical health quality in adulthood. In an intensive multimethod, multireporter study of a community sample of 171 individuals assessed repeatedly from the ages of 13 to 27 years, physical health quality in adulthood was robustly predicted by independent reports of early-adolescent close-friendship quality and by a pattern of acquiescence to social norms in adolescent peer relationships. Predictions remained after accounting for numerous potential confounds, including prior health problems, concurrent body mass index, anxious and depressive symptoms, personality characteristics, adolescent-era financial adversity, and adolescent-era physical attractiveness. These findings have important implications for understanding the unique intensity of peer relationships in adolescence. © The Author(s) 2015.
Memory as social glue: Close interpersonal relationships in amnesic patients
Directory of Open Access Journals (Sweden)
Patrick S.R. Davidson
2012-12-01
Full Text Available Memory may be crucial for establishing and/or maintaining social bonds. Using the National Social life, Health, and Aging Project questionnaire, we examined close interpersonal relationships in three amnesic people: K.C. and D.A. (who are adult-onset cases and H.C. (who has developmental amnesia. All three patients were less involved than demographically-matched controls with neighbors and religious and community groups. A higher-than-normal percentage of the adult-onset (K.C. and D.A. cases’ close relationships were with family members, and they had made few new close friends in the decades since the onset of their amnesia. On the other hand, the patient with developmental amnesia (H.C. had forged a couple of close relationships, including one with her fiancé. Social networks appear to be winnowed, but not obliterated, by amnesia. The obvious explanation for the patients’ reduced social functioning stems from their memory impairment, but we discuss other potentially important factors for future study.
Taxonomic relationships among Phenacomys voles as inferred by cytochrome b
Bellinger, M.R.; Haig, S.M.; Forsman, E.D.; Mullins, T.D.
2005-01-01
Taxonomic relationships among red tree voles (Phenacomys longicaudus longicaudus, P. l. silvicola), the Sonoma tree vole (P. pomo), the white-footed vole (P. albipes), and the heather vole (P. intermedius) were examined using 664 base pairs of the mitochondrial cytochrome b gene. Results indicate specific differences among red tree voles, Sonoma tree voles, white-footed voles, and heather voles, but no clear difference between the 2 Oregon subspecies of red tree voles (P. l. longicaudus and P. l. silvicola). Our data further indicated a close relationship between tree voles and albipes, validating inclusion of albipes in the subgenus Arborimus. These 3 congeners shared a closer relationship to P. intermedius than to other arvicolids. A moderate association between porno and albipes was indicated by maximum parsimony and neighbor-joining phylogenetic analyses. Molecular clock estimates suggest a Pleistocene radiation of the Arborimus clade, which is concordant with pulses of diversification observed in other murid rodents. The generic rank of Arborimus is subject to interpretation of data.
Psychosocial Predictors of Relationship Conflict Styles as Mediated by Emotional Intelligence
Directory of Open Access Journals (Sweden)
Nicole M. Monteiro
2015-05-01
Full Text Available This study investigated the influence of age, gender, and emotional intelligence (EI on conflict management styles among dating age adults in Botswana. A mixed survey and quasi-experimental design was used to assess the relationship between age and gender and the mediating influence of EI on participants’ preferred conflict management strategies (avoidance, competition, compromise, accommodation, and collaboration in response to violent and nonviolent relationship conflict. One hundred fifty-two participants were surveyed before (with the Wong and Law Emotional Intelligence Scale and after (with the Conflict Style Questionnaire watching video clips of nonviolent and violent relationship conflict. Correlations, t tests, and regression analyses were conducted. Findings revealed that women were more likely than men to report use of collaboration conflict strategies in response to the nonviolent video, and men were more likely than women to report accommodation strategies in response to the violent video. In the regression analysis, gender was a significant predictor of accommodation conflict style in response to the violent video, and EI had a significant independent and partial mediating relationship with compromise in response to the violent situation and collaboration in response to both violent and nonviolent conflict situations. Findings highlight the important role of EI in the use of higher-level relationship conflict strategies. Implications in the way of communication and conflict management for dating age adults and couples are discussed.
Culture and Social Relationship as Factors of Affecting Communicative Non-Verbal Behaviors
DEFF Research Database (Denmark)
Lipi, Afia Akhter; Nakano, Yukiko; Rehm, Matthias
2010-01-01
The goal of this paper is to link a bridge between social relationship and cultural variation to predict conversants' non-verbal behaviors. This idea serves as a basis of establishing a parameter based socio-cultural model, which determines non-verbal expressive parameters that specify the shapes...
Directory of Open Access Journals (Sweden)
Hasbullah Shafie
2014-11-01
QS graduates’ soft skills’ performance and their expectations were identified, and discussed. This paper also presents the recommendations made by the employers towards Higher Education Institutions (HEIs in Malaysia producing QS graduates in order to improve and prepare the graduates for their work place.
Bacterial quorum sensing and nitrogen cycling in rhizosphere soil
Energy Technology Data Exchange (ETDEWEB)
DeAngelis, K.M.; Lindow, S.E.; Firestone, M.K.
2008-10-01
Plant photosynthate fuels carbon-limited microbial growth and activity, resulting in increased rhizosphere nitrogen (N)-mineralization. Most soil organic N is macromolecular (chitin, protein, nucleotides); enzymatic depolymerization is likely rate-limiting for plant N accumulation. Analyzing Avena (wild oat) planted in microcosms containing sieved field soil, we observed increased rhizosphere chitinase and protease specific activities, bacterial cell densities, and dissolved organic nitrogen (DON) compared to bulk soil. Low-molecular weight DON (<3000 Da) was undetectable in bulk soil but comprised 15% of rhizosphere DON. Extracellular enzyme production in many bacteria requires quorum sensing (QS), cell-density dependent group behavior. Because proteobacteria are considered major rhizosphere colonizers, we assayed the proteobacterial QS signals acyl-homoserine lactones (AHLs), which were significantly increased in the rhizosphere. To investigate the linkage between soil signaling and N cycling, we characterized 533 bacterial isolates from Avena rhizosphere: 24% had chitinase or protease activity and AHL production; disruption of QS in 7 of 8 eight isolates disrupted enzyme activity. Many {alpha}-Proteobacteria were newly found with QS-controlled extracellular enzyme activity. Enhanced specific activities of N-cycling enzymes accompanied by bacterial density-dependent behaviors in rhizosphere soil gives rise to the hypothesis that QS could be a control point in the complex process of rhizosphere N-mineralization.
Directory of Open Access Journals (Sweden)
Prateeksha
2017-03-01
Full Text Available Honey is an excellent source of polyphenolic compounds that are effective in attenuating quorum sensing (QS, a chemical process of cell-to-cell communication system used by the opportunistic pathogen Pseudomonas aeruginosa to regulate virulence and biofilm formation. However, lower water solubility and inadequate bioavailability remains major concerns of these therapeutic polyphenols. Its therapeutic index can be improved by using nano-carrier systems to target QS signaling potently. In the present study, we fabricated a unique drug delivery system comprising selenium nanoparticles (SeNPs; non-viral vectors and polyphenols of honey (HP for enhancement of anti-QS activity of HP against P. aeruginosa PAO1. The developed selenium nano-scaffold showed superior anti-QS activity, anti-biofilm efficacy, and anti-virulence potential in both in-vitro and in-vivo over its individual components, SeNPs and HP. LasR is inhibited by selenium nano-scaffold in-vitro. Using computational molecular docking studies, we have also demonstrated that the anti-virulence activity of selenium nano-scaffold is reliant on molecular binding that occurs between HP and the QS receptor LasR through hydrogen bonding and hydrophobic interactions. Our preliminary investigations with selenium-based nano-carriers hold significant promise to improve anti-virulence effectiveness of phytochemicals by enhancing effective intracellular delivery.
Directory of Open Access Journals (Sweden)
Anara A Kamaeva
Full Text Available Chromobacterium violaceum abounds in soil and water ecosystems in tropical and subtropical regions and occasionally causes severe and often fatal human and animal infections. The quorum sensing (QS system and biofilm formation are essential for C. violaceum's adaptability and pathogenicity, however, their interrelation is still unknown. C. violaceum's cell and biofilm morphology were examined by atomic force microscopy (AFM in comparison with growth rates, QS-dependent violacein biosynthesis and biofilm biomass quantification. To evaluate QS regulation of these processes, the wild-type strain C. violaceum ATCC 31532 and its mini-Tn5 mutant C. violaceum NCTC 13274, cultivated with and without the QS autoinducer N-hexanoyl-L-homoserine lactone (C6-HSL, were used. We report for the first time the unusual morphological differentiation of C. violaceum cells, associated with biofilm development and directed by the QS autoinducer. AFM revealed numerous invaginations of the external cytoplasmic membrane of wild-type cells, which were repressed in the mutant strain and restored by exogenous C6-HSL. With increasing bacterial growth, polymer matrix extrusions formed in place of invaginations, whereas mutant cells were covered with a diffusely distributed extracellular substance. Thus, quorum sensing in C. violaceum involves a morphological differentiation that organises biofilm formation and leads to a highly differentiated matrix structure.
Kamaeva, Anara A; Vasilchenko, Alexey S; Deryabin, Dmitry G
2014-01-01
Chromobacterium violaceum abounds in soil and water ecosystems in tropical and subtropical regions and occasionally causes severe and often fatal human and animal infections. The quorum sensing (QS) system and biofilm formation are essential for C. violaceum's adaptability and pathogenicity, however, their interrelation is still unknown. C. violaceum's cell and biofilm morphology were examined by atomic force microscopy (AFM) in comparison with growth rates, QS-dependent violacein biosynthesis and biofilm biomass quantification. To evaluate QS regulation of these processes, the wild-type strain C. violaceum ATCC 31532 and its mini-Tn5 mutant C. violaceum NCTC 13274, cultivated with and without the QS autoinducer N-hexanoyl-L-homoserine lactone (C6-HSL), were used. We report for the first time the unusual morphological differentiation of C. violaceum cells, associated with biofilm development and directed by the QS autoinducer. AFM revealed numerous invaginations of the external cytoplasmic membrane of wild-type cells, which were repressed in the mutant strain and restored by exogenous C6-HSL. With increasing bacterial growth, polymer matrix extrusions formed in place of invaginations, whereas mutant cells were covered with a diffusely distributed extracellular substance. Thus, quorum sensing in C. violaceum involves a morphological differentiation that organises biofilm formation and leads to a highly differentiated matrix structure.
The relationship between affect and constructivism as viewed by middle school science teachers
Black, Denise L.
The purpose of this research was to examine middle school science teachers' perceptions of their students' affective behaviors at each level of the affective domain (receiving, responding, valuing, organization, characterization of value system), perceptions of the usefulness of constructivism as a curricular theory, and constructivist teaching strategies. This study investigated the relationship between affect and constructivism to determine if constructivist strategies can predict levels of affective behavior. Affect is a broad generalization that includes elements (i.e., interests, attitudes, values, emotions, and feelings). The importance of this research relates to enhancing learning, increasing achievement, participatory democracy, and facilitating understanding of science, as well as promoting the development of higher order thinking skills. A nonexperimental, descriptive research design was used to determine the relationship between affect and constructivism. A total of 111 middle school teachers participated in this study. Three instruments were used in this study: Taxonomy of Affective Behavior (TAB), Survey of Science Instruction (SSI), and a short demographic survey. Statistical significance obtained from one-sample t-tests provided evidence that teachers were aware that the affective domain was a viable construct. Statistical evidence of one-sample t-tests provided evidence that teachers perceived constructivism was useful to teach science to middle school students. Pearson product moment correlations results indicated statistically significant relationships between perceptions of constructivism and associated constructivist teaching strategies. Stepwise multiple linear regression analysis revealed a relationship between affect and constructivism. Teacher responses indicated they felt constrained from implementing constructivism due to an emphasis on testing. Colleges of education, curriculum specialists, science teachers, and school districts may
Sibling relationships as a resource for coping with traumatic events.
Perricone, Giovanna; Fontana, Valentina; Burgio, Sofia; Polizzi, Concetta
2014-01-01
The study investigated the correlation between the perception of sibling relationship to cope an adverse occurrence - the partial collapse of a primary school - and the indicators related to the traumatic impact set off by the event, by soliciting the child's reminiscence of the catastrophic experience. One hundred trauma-exposed children were recruited from a Sicilian primary school and were administered the following research instruments: the Trauma Symptom Checklist for Children (TSCC-A), to investigate the traumatized response that can be triggered in the children involved; the Brother as a Resource Questionnaire (BRQ), to delve into the perception of sibling relationship as a resource. The outcomes showed statistically significant negative correlations between the Anxiety scale of the TSCC-A and the Scaffolding factors (r = -.260, p Depression scale and the Scaffolding factors (r = -.147, p < .05), Emotional sharing (r = -.168, p < .05) and Decision making process (r = -.281, p < .05). The Anger scale correlated negatively with the Emotional sharing (r = -187, p < .05), the Decision making process (r = -.182, p < .05) and the Scaffolding factors (r = -.279, p < .05); the Post-traumatic Stress correlated negatively with the Scaffolding factors (r = -.203, p < .05) and the Decision making process (r = -.238, p < .05). Lastly, the Dissociation correlated negatively with the Decision making process (r = -.270, p < .05).
Engelbach, Ute; Dannecker, Martin; Kaufhold, Johannes; Lenz, Cynthia; Grabhorn, Ralph
2008-06-01
This qualitative study examines the relationship between doctors and HIV-infected patients with regard to problems of adherence. Objective hermeneutics was used to analyze the scene of a doctor-patient conversation produced through psychodrama. Specific traits shared by the patients in question were a confused regulation of closeness and distance as well as a non-maintenance of the traditional asymmetry within the doctor-patient relation. The patients faced the doctors on a level of diffuse social relations and showed the tendency to involve the doctor into their community. The conclusion for a model explaining patients' adherence may be: it exist an individual level of the need for being accepted by the doctor as somebody particular. If this level is reached, i. e. individual claims are met and personal desires are satisfied, the patient will follow the physician's advice. Authors discuss whether the model is compatible with the conflict of self-esteem.
The bacterium Pseudomonas syringae is a plant-pathogen, which through quorum sensing (QS), controls virulence. In this paper, by means of mathematical modeling, we investigate QS of this bacterium when living on leaf surfaces. We extend an existing stochastic model for the formation of Pseudomonas s...
DEFF Research Database (Denmark)
Kristiansen, S.; Bjarnsholt, Thomas; Adeltoft, D.
2008-01-01
Pseudomonas aeruginosa uses acyl-homoserine lactones to coordinate gene transcription in a process called quorum sensing (QS). The QS molecules C-4-HSL and C-12-oxo-HSL are synthesized from the universal precursor S-adenosyl methionine, which is also a precursor of polyamines in human cells...
Perspektif al-Qur’an tentang Dakwah Pendekatan Tematik dan Analisis Semantik
Directory of Open Access Journals (Sweden)
Hamidah Hamidah
2016-03-01
Full Text Available Dakwah pada hakikatnya adalah usaha orang beriman untuk mewujudkan Islam dalam semua segi kehidupan pada tataran individu, keluarga, masyarakat, umat dan bangsa. Sebagai aktualisasi iman, dakwah merupakan keharusan dan menjadi tugas suci bagi setiap muslim setingkat dengan kapasitas dan kapabilitas yang dimiliki. Dakwah merupakan salah satu bentuk komitmen muslim terhadap agamanya. Setiap muslim dan muslimat wajib mendakwahkan Islam, sesuai dengan kemampuan dan kesanggupan masing-masing, sesuai dengan profesi dan dedikasinya kepada orang lain, baik orang Islam maupun orang-orang yang tidak atau belum beragama Islam. Istilah dakwah digunakan dalam Al Qur’an baik dalam bentuk fi’il maupun dalam bentuk mashdar berjumlah lebih dari seratus kali. Dalam Al Qur’an, dakwah dalam arti mengajak ditemukan sebanyak 46 kali, 39 kali dalam arti mengajak kepada Islam dan kebaikan, 7 kali kepada neraka dan kejahatan.Beberapa dari ayat tersebut:Mengajak manusia kepada kebaikan dan mencegah kemungkaran ( QS. Ali Imran: 104; Mengajak manusia kepada jalan Allah (QS an-Nahl:125; Mengajak manusia kepada agama Islam (QS as-Shaf: 7; Mengajak manusia kepada jalan yang lurus (QS al-Mukminun:73; Memutuskan perkara dalam kehidupan umat manusia, kittabullah dan sunnaturrasul (QS an-Nur:48 dan 51, serta QS Ali Imran:23; Mengajak ke surga (QS al-Baqarah:122. This article discusses the meaning of propaganda used by the thematic approach and semantic analysis based on the perspective of the Qur'an. Quran is the basis for the study of the meaning of da'wah studied. The results showed, Da'wah is an attempt to realize the believer of Islam in all aspects of life at the level of individuals, families, communities, people and nation. As the actualization of faith, preaching the necessity and become a sacred duty for every Muslim a level with the capacity and capabilities. Da’wah is one of the commitments of the Muslim religion. Every Muslim and muslimat obliged to preach
Computational dosimetry for grounded and ungrounded human models due to contact current
International Nuclear Information System (INIS)
Chan, Kwok Hung; Hattori, Junya; Laakso, Ilkka; Hirata, Akimasa; Taki, Masao
2013-01-01
This study presents the computational dosimetry of contact currents for grounded and ungrounded human models. The uncertainty of the quasi-static (QS) approximation of the in situ electric field induced in a grounded/ungrounded human body due to the contact current is first estimated. Different scenarios of cylindrical and anatomical human body models are considered, and the results are compared with the full-wave analysis. In the QS analysis, the induced field in the grounded cylindrical model is calculated by the QS finite-difference time-domain (QS-FDTD) method, and compared with the analytical solution. Because no analytical solution is available for the grounded/ungrounded anatomical human body model, the results of the QS-FDTD method are then compared with those of the conventional FDTD method. The upper frequency limit for the QS approximation in the contact current dosimetry is found to be 3 MHz, with a relative local error of less than 10%. The error increases above this frequency, which can be attributed to the neglect of the displacement current. The QS or conventional FDTD method is used for the dosimetry of induced electric field and/or specific absorption rate (SAR) for a contact current injected into the index finger of a human body model in the frequency range from 10 Hz to 100 MHz. The in situ electric fields or SAR are compared with the basic restrictions in the international guidelines/standards. The maximum electric field or the 99th percentile value of the electric fields appear not only in the fat and muscle tissues of the finger, but also around the wrist, forearm, and the upper arm. Some discrepancies are observed between the basic restrictions for the electric field and SAR and the reference levels for the contact current, especially in the extremities. These discrepancies are shown by an equation that relates the current density, tissue conductivity, and induced electric field in the finger with a cross-sectional area of 1 cm 2 . (paper)
Anime Landscapes as a Tool for Analyzing the Human–Environment Relationship: Hayao Miyazaki Films
Directory of Open Access Journals (Sweden)
Sema Mumcu
2018-04-01
Full Text Available Common dualistic thinking in environmental design education adopts humans and the environment as separate entities, with the environment as raw material stock. This approach affects the intellectual development of landscape architects and limits their ability to create meaningful landscapes. Therefore, it is necessary to explore and highlight new ideas about the more integrated human–environment relationship. Through the films of Hayao Miyazaki, many audiences around the world have encountered a different worldview. By contrast with Western thinking, which adopts human superiority to nature, the worldview that Miyazaki reflects in his films depicts human as an inseparable part of nature. Being inspired by different communities and their relationship to nature in Miyazaki’s films, we propose using anime as a means of analyzing the human–environment relationship. We classified landscapes based on power relations between humans and nature. We explored how communities shape their physical environment based on how they socially construct nature and the resulting landscapes. Thus, through apocalyptic landscapes, the bitter results of exploiting nature were depicted. Wilderness landscapes reflect the bias humanity has about nature as wild and hostile. Responsible landscapes were introduced asway of understanding the unbreakable bond between humans and the environment. Through these animated landscape types, the ways landscape architecture should approach nature in professional practices was discussed, and the importance of creating responsible landscapes was emphasized.
Doyle, Carol M; Rees, Amy M; Titus, Tana L
2015-01-01
The current study sought to add to the literature that has demonstrated a link between sexism and sexual prejudice. The study evaluated whether a community sample with an age range of 19-64 (n = 122), including 32% sexual minority participants, believe that dating, sex, and marriage with same-sex partners are perceived to be gender role violations. Results varied by participant sexual/gender identity (LGBTQ or heterosexual) and political ideology. Liberal LGBTQ persons do not see same-sex relationships as gender role violations; LGBTQ non-liberals and heterosexual liberals rated same-sex relationships as mild violations; and non-liberal heterosexuals perceive same-sex relationships as "moderate" violations. Our results suggest both positive movement in attitudes toward same-sex relationships, including same-sex marriage, and broader recognition that gender identity, gender role expression, and sexual orientation are separate and distinct components of one's overall sexual identity.
V773 Cas, QS Aql, and BR Ind: eclipsing binaries as parts of multiple systems
Czech Academy of Sciences Publication Activity Database
Zasche, P.; Juryšek, Jakub; Nemravová, J.; Uhlář, R.; Svoboda, P.; Wolf, M.; Hoňková, K.; Mašek, Martin; Prouza, Michael; Čechura, Jan; Korčáková, D.; Šlechta, Miroslav
2017-01-01
Roč. 153, č. 1 (2017), 1-7, č. článku 36. ISSN 0004-6256 R&D Projects: GA MŠk LM2015038; GA MŠk LG15014; GA ČR(CZ) GA14-17501S; GA MŠk LG14013 Institutional support: RVO:68378271 ; RVO:67985815 Keywords : binaries * eclipsing stars * spectroscopy Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 2.609, year: 2016
Maintaining close relationships: gratitude as a motivator and a detector of maintenance behavior.
Kubacka, Kaska E; Finkenauer, Catrin; Rusbult, Caryl E; Keijsers, Loes
2011-10-01
This research examined the dual function of gratitude for relationship maintenance in close relationships. In a longitudinal study among married couples, the authors tested the dyadic effects of gratitude over three time points for approximately 4 years following marriage. They found that feelings of gratitude toward a partner stem from the partner's relationship maintenance behaviors, partly because such behaviors create the perception of responsiveness to one's needs. In turn, gratitude motivates partners to engage in relationship maintenance. Hence, the present model emphasizes that gratitude between close partners (a) originates from partners' relationship maintenance behaviors and the perception of a partner's responsiveness and (b) promotes a partner's reciprocal maintenance behaviors. Thus, the authors' findings add credence to their model, in that gratitude contributes to a reciprocal process of relationship maintenance, whereby each partner's maintenance behaviors, perceptions of responsiveness, and feelings of gratitude feed back on and influence the other's behaviors, perceptions, and feelings.
Ajoene, a Sulfur-Rich Molecule from Garlic, Inhibits Genes Controlled by Quorum Sensing
DEFF Research Database (Denmark)
Jakobsen, Tim Holm; van Gennip, Maria; Phipps, Richard Kerry
2012-01-01
the expression of specific genes involved in pathogenicity, is a possible drug target. Previous in vitro and in vivo studies revealed a significant inhibition of P. aeruginosa QS by crude garlic extract. By bioassay-guided fractionation of garlic extracts, we determined the primary QS inhibitor present in garlic...
Optimal Control of Solar Heating System
Huang, Bin-Juine; Ton, Wei-Zhe; Wu, Chen-Chun; Ko, Hua-Wei; Chang, Hsien-Shun; Yen, Rue-Her
2017-01-01
was used in the feedback design of MPPT. The field test results show that the pumping power is 89 W at Qs = 13.7 kW and IT = 892 W/m2. A very high electrical COP of the solar heating system (Qs/Wp = 153.8) is obtained.
Soheili, Vahid; Bazzaz, Bibi Sedigheh Fazly; Abdollahpour, Nooshin; Hadizadeh, Farzin
2015-12-01
Pseudomonas aeruginosa is an opportunistic human pathogen and a common Gram-negative bacterium in hospital-acquired infections. It causes death in many burn victims, cystic-fibrosis and neutropenic-cancer patients. It is known that P. aeruginosa biofilm maturation and production of cell-associated and extracellular virulence factors such as pyocyanin, elastase and rhamnolipids are under the control of a quorum-sensing (QS) system. Among several proteins involved in the Pseudomonas QS mechanism, LasR and PqsE play an important role in its cascade signaling system. They can cause increases in QS factors, biofilm maturation, and the production of virulence factors. Therefore, inhibition of these proteins can reduce the pathogenicity of P. aeruginosa. According to the structure of corresponding auto-inducers bound to these proteins, in silico calculations were performed with some non-steroidal anti-inflammatory drugs (NSAIDs) to estimate possible interactions and find the co-inhibitors of LasR and PqsE. The results showed that oxicams (Piroxicam and Meloxicam) can interact well with active sites of both proteins with the Ki of 119.43 nM and 4.0 μM for Meloxicam and 201.39 nM and 4.88 μM against LasR and PqsE, respectively. These findings suggested that Piroxicam and Meloxicam can be used as potential inhibitors for control of the P. aeruginosa QS signaling system and biofilm formation, and may be used in the design of multiple inhibitors. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
P. Sankar Ganesh
2018-01-01
Full Text Available Pseudomonas aeruginosa use small signaling molecules such as acyl homoserine lactones (AHLs, which play an important role in release virulence factors and toxin for further establishment of host infection. Thus, involving with the QS system would provide alternative ways of preventing the pathogenicity. In the present study, totally six medicinal plants (Terminalia bellerica, Celastrus paniculatus, Kingiodendron pinnatum, Schleichera oleosa, Melastoma malabathricum, Garcinia gummi-gutta were screened for anti-QS activity using biomonitor strain of Chromobacterium violaceum CV12472. The primary screening of antimicrobial activity of all the plant extracts have inhibited the growth of tested bacterial species. Of these at the sub-minimum inhibitory concentration the methanol extract of T. bellerica (0.0625–0.5 mg/ml has significantly inhibited violacein production (20.07–66.22% in C. violaceum (CV12472. Consequently, the extract of T. bellerica has reduced the production of pyocyanin, exopolysaccharide and biofilm formation in P. aeruginosa strains. Fluorescence and scanning electron microscopy analysis confirmed the reduction of biofilm formation in P. aeruginosa strains when treated with T. bellerica. GC–MS analysis showed the active compounds inhibited the production of virulence factors of P. aeruginosa. The results suggest the possible use of this T. bellerica as an anti-QS and anti-biofilm agent to control Pseudomonas infection. Interference of QS provides an important means for the inhibition of bacterial virulence and thus aids in treatment strategies.
Lam, Yat-Yin; Fang, Fang; Yip, Gabriel Wai-Kwok; Li, Zhi-An; Yang, Ya; Yu, Cheuk-Man
2012-09-20
The relation between pulmonary venous flow (PVF) pattern and degree of left-to-right interatrial shunting (IAS) in patients with secundum atrial septal defect (ASD) is unknown. Fifty consecutive ASD patients (14 males, 36 ± 17 years) received transthoracic echocardiography (TTE) before and 1 day after transcatheter closure and their results were compared to 40 controls. The ratio of pulmonary-to-systemic flows (Qp/Qs) was assessed by TTE and invasive oximetry. Pre-closure PV systolic (PVs), diastolic (PVd) velocities and velocity-time integral (PV-VTI) increased, time from onset of ECG Q-wave to the peak PV diastolic wave (Q-PVd) shortened and atrial reversal (PVar) velocity significantly decreased as compared to normals. These findings normalized after closure. Patients with large IAS (defined as invasive Qp/Qs ≥ 2) had higher PVs, PVd and PV-VTI, shorter Q-PVd but lower PVar (all pIAS. Invasive Qp/Qs ratios correlated with PVs, PVd, PV-VTI, Q-PVd and TTE-derived Qp/Qs ratios, ASD sizes and RV end-diastolic dimensions (all pIAS after multivariate analysis. The corresponding sensitivity, specificity and AUC were 89%, 82% and 0.90 respectively for a PV-VTI of 30 cm (pIAS have distinguishable PVF features. Doppler evaluation of PV-VTI is a novel additional tool for assessing the magnitude of shunting in these patients non-invasively. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Social relationships among adolescents as described in an electronic diary: a mixed methods study.
Anttila, Katriina I; Anttila, Minna J; Kurki, Marjo H; Välimäki, Maritta A
2017-01-01
Social relationships among adolescents with mental disorders are demanding. Adolescents with depressive symptoms may have few relationships and have difficulties sharing their problems. Internet may offer reliable and easy to use tool to collect real-time information from adolescents. The aim of this study is to explore how adolescents describe their social relationships with an electronic diary. Mixed methods were used to obtain a broad picture of adolescents' social relationships with the data gathered from network maps and reflective texts written in an electronic diary. Adolescents who visited an outpatient clinic and used an intervention (N=70) designed for adolescents with signs of depression were invited to use the electronic diary; 29 did so. The quantitative data gathered in the electronic diary were summarized with descriptive statistics, and the qualitative data were categorized using a thematic analysis with an inductive approach. We found that social relationships among adolescents with signs of depression can vary greatly in regards to the number of existing relationships (from lacking to 21) and the quality of the relationships (from trustful to difficult). However, the relationships may change, and the adolescents are also willing to build up their social relationships. Professionals need to be aware of the diversity of adolescents' social relationships and their need for personalized support.
Estévez, Ana; Ozerinjauregi, Nagore; Herrero-Fernández, David
2016-01-01
Child sexual abuse is one of the most serious forms of abuse due to the psychological consequences that persist even into adulthood. Expressions of anger among child sexual abuse survivors remain common even years after the event. While child sexual abuse has been extensively studied, the expression of displaced aggression has been studied less. Some factors, such as the maladaptive early schemas, might account for this deficiency. The objective of this study was to analyze the relationships between child sexual abuse, displaced aggression, and these schemas according to gender and determine if these early schemas mediate the relationship between child sexual abuse and displaced aggression. A total of 168 Spanish subjects who were victims of child sexual abuse completed measures of childhood trauma, displaced aggression, and early maladaptive schemas. The results depict the relationship between child sexual abuse, displaced aggression, and early maladaptive schemas. Women scored higher than men in child sexual abuse, emotional abuse, disconnection or rejection and impaired autonomy. Mediational analysis found a significant mediation effect of disconnection or rejection on the relationship between child sexual abuse and displaced aggression; however, impaired autonomy did not mediate significantly.
Directory of Open Access Journals (Sweden)
Reza Esmaeilpour
2012-10-01
Full Text Available Customer relationship management is considered as a strategic necessity in all organizations. Today, companies and organizations have to consider the preservation of environment in their activities in order to gain customers’ satisfaction, perform social responsibilities, and protect consumers’ rights. Regarding these green marketing mixtures, the present research aims at studying the role of customer relationship management as a competitive advantage in green marketing on health and cosmetic products. Here, four marketing mixtures (product, promotion, place, and price were defined as the research variables. Out of the total subjects that included all shops selling these products in the city of Rasht, a sample population of 131 shopkeepers was chosen to indicate the degree of their attention to selling green products and the degree of customers’ attention to buying green products. The present research is an analytic-descriptive one. A researcher- made questionnaire standardized through Cronbach’s alpha was used to collect data. Then, the data collected were analyzed by SPSS 15, t-test of tow independent samples, and variance analysis. It was finally indicated that there was meaningful relationship between customer relationship management and the mixture elements of green marketing.
Gelso, Charles J; Palma, Beatriz; Bhatia, Avantika
2013-11-01
Recent decades have witnessed an extraordinary amount of conceptual and empirical work on attachment theory in psychology and psychotherapy. Attachment theory is discussed in the present article as a way of understanding and fostering therapeutic work with 2 other key relationship constructs that have been theorized to be elements of all psychotherapies: client transference and the real relationship existing between the therapist and patient. Fundamental features of attachment, transference, and the real relationship are summarized. Particular emphasis is given to the role of the therapist as a secure base and a safe haven within the real relationship, and to the patient's internal working model as it relates to transference. A case of long-term psychodynamic psychotherapy conducted by the first author is presented to illuminate the 3 main constructs. The case demonstrates both the usefulness of attachment theory and the fact that any single theory cannot explain all of the complex features of a given treatment. © 2013 Wiley Periodicals, Inc.
Mijakoski, Dragan; Karadzinska-Bislimovska, Jovanka; Basarovska, Vera; Minov, Jordan; Stoleski, Sasho; Angeleska, Nada; Atanasovska, Aneta
2015-01-01
BACKGROUND: Few studies have examined teamwork as mediator and moderator of work demands-burnout and job engagement-job satisfaction relationships in healthcare workers (HCWs) in South-East Europe. AIM: To assess mediation and moderation effect of teamwork on the relationship between independent (work demands or job engagement) and dependent (burnout or job satisfaction) variables. METHODS: Work demands, burnout, job engagement, and job satisfaction were measured with Hospital Experienc...
Exercise dependence as a mediator of the exercise and eating disorders relationship: a pilot study.
Cook, Brian; Hausenblas, Heather; Crosby, Ross D; Cao, Li; Wonderlich, Stephen A
2015-01-01
Excessive exercise is a common feature of eating disorders (ED) and is associated with earlier ED onset, more ED symptoms, and higher persistence of ED behavior. Research indicates that exercise amount alone is not associated with ED. The purpose of this study was to investigate pathological attitudes and behaviors related to exercise (e.g., exercise dependence) as a mediator of the exercise and ED relationship. Participants were 43 women with an ED who completed measures of ED symptoms, exercise behavior, and exercise dependence. Analyses were conducted using the indirect bootstrapping method for examining mediation. Exercise dependence mediated the relationship between exercise and ED. This mediation model accounted for 14.34% of the variance in the relationship. Our results extend the literature by offering preliminary evidence of a psychological variable that may be a candidate for future interventions on the exercise and ED relationship. Implications and suggestions for future research are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.
Role and regulation of the orphan AphA protein of quorum sensing in pathogenic Vibrios.
Lu, Renfei; Osei-Adjei, George; Huang, Xinxiang; Zhang, Yiquan
2018-03-01
Quorum sensing (QS), a cell-to-cell communication process, is widely distributed in the bacterial kingdom. Bacteria use QS to control gene expression in response to cell density by detecting the signal molecules called autoinducers. AphA protein is the master QS regulator of vibrios operating at low cell density. It regulates the expression of a variety of genes, especially those encoding virulence factors, flagella/motility and biofilm formation. The role and regulation of AphA in vibrios, especially in human pathogenic vibrios, are summarized in this review. Clarification of the roles of AphA will help us to understand the pathogenesis of vibrios.
Pseudomonas aeruginosa forms Biofilms in Acute InfectionIndependent of Cell-to-Cell Signaling
Energy Technology Data Exchange (ETDEWEB)
Schaber, J. Andy; Triffo, W.J.; Suh, Sang J.; Oliver, Jeffrey W.; Hastert, Mary C.; Griswold, John A.; Auer, Manfred; Hamood, Abdul N.; Rumbaugh, Kendra P.
2006-09-20
Biofilms are bacterial communities residing within a polysaccharide matrix that are associated with persistence and antibiotic resistance in chronic infections. We show that the opportunistic pathogen Pseudomonas aeruginosa forms biofilms within 8 hours of infection in thermally-injured mice, demonstrating that biofilms contribute to bacterial colonization in acute infections. P. aeruginosa biofilms were visualized within burned tissue surrounding blood vessels and adipose cells. Although quorum sensing (QS), a bacterial signaling mechanism, coordinates differentiation of biofilms in vitro, wild type and QS-deficient P. aeruginosa formed similar biofilms in vivo. Our findings demonstrate that P. aeruginosa forms biofilms on specific host tissues independent of QS.
The relationship between glass ceiling and power distance as a cultural variable by a new method
Naide Jahangirov; Guler Saglam Ari; Seymur Jahangirov; Nuray Guneri Tosunoglu
2015-01-01
Glass ceiling symbolizes a variety of barriers and obstacles that arise from gender inequality at business life. With this mind, culture influences gender dynamics. The purpose of this research was to examine the relationship between the glass ceiling and the power distance as a cultural variable within organizations. Gender variable is taken as a moderator variable in relationship between the concepts. In addition to conventional correlation analysis, we employed a new method to investigate ...
Peptide pheromone signaling in Streptococcus and Enterococcus
Cook, Laura C.; Federle, Michael J.
2014-01-01
Intercellular chemical signaling in bacteria, commonly referred to as quorum sensing (QS), relies on the production and detection of compounds known as pheromones to elicit coordinated responses among members of a community. Pheromones produced by Gram-positive bacteria are comprised of small peptides. Based on both peptide structure and sensory system architectures, Gram-positive bacterial signaling pathways may be classified into one of four groups with a defining hallmark: cyclical peptides of the Agr type, peptides that contain Gly-Gly processing motifs, sensory systems of the RNPP family, or the recently characterized Rgg-like regulatory family. The recent discovery that Rgg family members respond to peptide pheromones increases substantially the number of species in which QS is likely a key regulatory component. These pathways control a variety of fundamental behaviors including conjugation, natural competence for transformation, biofilm development, and virulence factor regulation. Overlapping QS pathways found in multiple species and pathways that utilize conserved peptide pheromones provide opportunities for interspecies communication. Here we review pheromone signaling identified in the genera Enterococcus and Streptococcus, providing examples of all four types of pathways. PMID:24118108
Quorum sensing activity of Citrobacter amalonaticus L8A, a bacterium isolated from dental plaque.
Goh, Share-Yuan; Khan, Saad Ahmed; Tee, Kok Keng; Abu Kasim, Noor Hayaty; Yin, Wai-Fong; Chan, Kok-Gan
2016-02-10
Cell-cell communication is also known as quorum sensing (QS) that happens in the bacterial cells with the aim to regulate their genes expression in response to increased cell density. In this study, a bacterium (L8A) isolated from dental plaque biofilm was identified as Citrobacter amalonaticus by matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry (MS). Its N-acylhomoserine-lactone (AHL) production was screened by using two types of AHL biosensors namely Chromobacterium violaceum CV026 and Escherichia coli [pSB401]. Citrobacter amalonaticus strain L8A was identified and confirmed producing numerous types of AHL namely N-butyryl-L-homoserine lactone (C4-HSL), N-hexanoyl-L-homoserine lactone (C6-HSL), N-octanoyl-L-homoserine lactone (C8-HSL) and N-hexadecanoyl-L-homoserine lactone (C16-HSL). We performed the whole genome sequence analysis of this oral isolate where its genome sequence reveals the presence of QS signal synthase gene and our work will pave the ways to study the function of the related QS genes in this bacterium.
Particle Correlations in Saturated QCD Matter
Baier, R; Nardi, M; Wiedemann, Urs Achim; Baier, Rudolf; Kovner, Alex; Nardi, Marzia; Wiedemann, Urs Achim
2005-01-01
We study quantitatively angular correlations in the two-particle spectrum produced by an energetic probe scattering off a dense hadronic target with sizeable saturation momentum. To this end, two parton inclusive cross sections for arbitrary projectiles with small color charge density are derived in the eikonal formalism. Our results are the following: For large momenta of the observed particles, the perturbative limit with characteristic back-to-back correlation is recovered. As the trigger momenta get closer to the saturation scale Q_s, the angular distribution broadens. When the momenta are significantly smaller than Q_s, the azimuthal distribution is broad but still peaked back-to-back. However, in a narrow momentum range (0.5 - 1.5) Q_s, we observe that the azimuthal correlation splits into a double peak with maxima displaced away from 180 degree. We argue that it is the soft multiple scattering physics that is responsible for the appearance of this shift in the angle of maximal correlation. We also poin...
ω-Hydroxyemodin Limits Staphylococcus aureus Quorum Sensing-Mediated Pathogenesis and Inflammation
Daly, Seth M.; Elmore, Bradley O.; Kavanaugh, Jeffrey S.; Triplett, Kathleen D.; Figueroa, Mario; Raja, Huzefa A.; El-Elimat, Tamam; Crosby, Heidi A.; Femling, Jon K.; Cech, Nadja B.; Horswill, Alexander R.; Oberlies, Nicholas H.
2015-01-01
Antibiotic-resistant pathogens are a global health threat. Small molecules that inhibit bacterial virulence have been suggested as alternatives or adjuncts to conventional antibiotics, as they may limit pathogenesis and increase bacterial susceptibility to host killing. Staphylococcus aureus is a major cause of invasive skin and soft tissue infections (SSTIs) in both the hospital and community settings, and it is also becoming increasingly antibiotic resistant. Quorum sensing (QS) mediated by the accessory gene regulator (agr) controls virulence factor production essential for causing SSTIs. We recently identified ω-hydroxyemodin (OHM), a polyhydroxyanthraquinone isolated from solid-phase cultures of Penicillium restrictum, as a suppressor of QS and a compound sought for the further characterization of the mechanism of action. At concentrations that are nontoxic to eukaryotic cells and subinhibitory to bacterial growth, OHM prevented agr signaling by all four S. aureus agr alleles. OHM inhibited QS by direct binding to AgrA, the response regulator encoded by the agr operon, preventing the interaction of AgrA with the agr P2 promoter. Importantly, OHM was efficacious in a mouse model of S. aureus SSTI. Decreased dermonecrosis with OHM treatment was associated with enhanced bacterial clearance and reductions in inflammatory cytokine transcription and expression at the site of infection. Furthermore, OHM treatment enhanced the immune cell killing of S. aureus in vitro in an agr-dependent manner. These data suggest that bacterial disarmament through the suppression of S. aureus QS may bolster the host innate immune response and limit inflammation. PMID:25645827
Longobardi, Claudio; Prino, Laura E; Marengo, Davide; Settanni, Michele
2016-01-01
A robust body of research has identified school transitions during adolescence, and in particular the transition from middle to high school, as one of the riskiest phases for school failure, being characterized by significant social, emotional and behavioral changes. This transition is critical even with respect to academic achievement: in Italy, the highest frequency of school dropout can be observed in the 9th and 10th grades, partly as a consequence of poor adjustment to the new school context. The impact of students' relationships with their teachers may be particularly relevant during critical developmental periods. Indeed, student-teacher relationships have been widely recognized as protective factors in school adjustment and, in case of negative relationships, also as a factor that increases the risk of maladjustment. Positive and affective student-teacher relationships may play an important role in students' adaptation to the school environment, favoring both academic achievement and adaptive behaviors. The aim of this study was to investigate the effects of the quality of teacher-student relationships, as perceived by pupils, on academic achievement, and problem and prosocial behaviors during the relevant school transition. The sample consisted of 122 students (55% female). We employed a self-report questionnaire to collect information on: demographic characteristics, quality of the relationship with teachers, problem and prosocial behaviors, and academic achievement. Students filled in the questionnaires twice: once during the 8th grade and 1 year later, during their first year of high school (9th grade). Regression analyses indicated that both average and varying levels of closeness with teachers significantly predicted changes in academic achievement: A perceived increase in closeness in 9th grade, as well as a higher mean closeness level, was associated with an increase in academic achievement. In turn, an increase in the level of perceived conflict
Athlete and Coach Relationship as a Factor of the Success in Sports Activities
Directory of Open Access Journals (Sweden)
Svetlova A.A.,
2014-11-01
Full Text Available We present the results of a theoretical analysis of the psychological bases of success of athletes. We provide an overview of studies of the factors influencing the success of the activities in the sport. Sports activities are considered as a joint activity of athlete and coach, the success of which is affected by the personal qualities and characteristics of the relationship of its members. We summarize the main approaches to the study of personality and social psychological aspects of successful athletes and coaches. As the main factors in the success of sports activities, we considered individual psychological characteristics of athletes (motives, attitudes, modes of behavior and response, and socio-psychological characteristics of the interaction of coach and athlete (leadership style, the nature of interpersonal relationships and role expectations. We emphasize the importance of mutual role expectations of athlete and coach to achieve high results of sports activity.
Emotion Regulation and Depressive Symptoms: Close Relationships as Social Context and Influence
Marroquín, Brett; Nolen-Hoeksema, Susan
2015-01-01
Depression is associated with social dysfunction and maladaptive social environments, but mechanisms through which social relationships affect depressive psychopathology are unclear. We hypothesized that emotion regulation (ER) is such a mechanism, with outcomes of individuals’ ER efforts sensitive to the social context, and individuals’ ER strategy repertoire and use sensitive to social influence. In Study 1, a longitudinal study of community adults (N = 1,319), associations of individuals’ ER strategies with depressive symptoms depended on social connectedness and romantic relationship status (social context hypothesis). Moreover, associations of social connectedness and relationship status with symptoms were accounted for by maladaptive ER concurrently and, for social connectedness, prospectively over 1 year (social influence hypothesis). Study 2a, using a national sample (N = 772), replicated and extended these findings with a broader array of ER strategies, and ruled out alternative explanations regarding social skills and psychological wellbeing. Among participants in romantic relationships (Study 2b; N = 558), intimacy and trust buffered associations of maladaptive ER strategies with symptoms (context), and maladaptive and adaptive ER mediated links between relationship variables and symptoms (influence). Findings suggest that close relationships—and variation in underlying relational processes within relationships— influence the ER strategies people use, and also affect whether individuals’ own ER repertoires contribute to depression when deployed. Results elucidate core social mechanisms of ER in terms of both basic processes and depressive psychopathology, suggest ER is a channel through which social factors affect internal functioning and mental health, and inform relationship pathways for clinical intervention. PMID:26479366
Machiavellianism, Relationship Satisfaction, and Romantic Relationship Quality
Directory of Open Access Journals (Sweden)
Gayle Brewer
2017-08-01
Full Text Available Machiavellianism is characterised by a manipulative interpersonal style, willingness to exploit others, and a preference for emotionally detached relationships. The present studies investigate the extent to which Machiavellianism influences relationship satisfaction and romantic relationship quality. In Study 1, 194 heterosexual partnered women completed Machiavellianism and Relationship Satisfaction measures. Women with higher levels of Machiavellianism reported lower levels of relationship satisfaction. In Study 2, 132 heterosexual partnered women completed Machiavellianism, Trust, Commitment, Control, and Emotional Abuse scales. Women with higher levels of Machiavellianism perceived their partners to be less dependable, reported less faith in their partners, and were less willing to persist with the relationship than those with low levels of Machiavellianism. With regards to negative behavior, Machiavellianism predicted each form of control and emotional abuse investigated, such that those with high levels of Machiavellianism were more likely to engage in controlling behavior and emotional abuse. Findings have important implications for the prediction of romantic relationship quality and in particular for negative behavior such as control and abuse.
Lin, Ruilin; Xie, Jingchen; Jeng, Yoau-Chau; Wang, Zheng-Hong
2011-01-01
The purpose of this study is to explore the relationships between "job involvement" and "school administrative effectiveness" as perceived by junior high school administration teachers. The findings are as follows. (1) The current status of "job involvement" and "school administrative effectiveness" as…
Gaby Odekerken-Schröder; Bloemer Josée
2002-01-01
The objective of this study is to empirically determine the role of constraints and dedication as drivers of relationship commitment as most of the existing work is of a conceptual nature only. We assess how and to which extent these two drivers fit into the established relationships between overall service quality, satisfaction, trust and commitment. Using LISREL, we estimate the conceptual model based on a sample of customers of health-care centers. The results indicate that both constraint...
Directory of Open Access Journals (Sweden)
Daniele Parziani
2011-01-01
Full Text Available In this article the author attempts a first description of his ongoing research on the pedagogy and educational philosophy which can be applied in working with the youth orchestra, based on Christopher Small's theory of musicking; the youth orchestra is seen here as a learning community, and the author attempts to redefine the relationships which are embodied and shaped within it, wishing to stir up the stagnant social relationships of the classical orchestra community. The article is particularly concerned with the power relationship between the teacher-conductor and the students, while raising questions of musical identity, hierarchy and empathy from a Smallian perspective applied to the conducting of the youth orchestra, within a concept of educational conducting.
DEFF Research Database (Denmark)
Rapp, Amon; Cena, Federica; Kay, Judy
2015-01-01
In spite of the fast growth in the market of devices and applications that allow people to collect personal information, Quantified Self (QS) tools still present a variety of issues when they are used in everyday lives of common people. In this workshop we aim at exploring new ways for designing QS...
Directory of Open Access Journals (Sweden)
Van Calenbergh Serge
2008-09-01
Full Text Available Abstract Background To date, only few compounds targeting the AI-2 based quorum sensing (QS system are known. In the present study, we screened cinnamaldehyde and substituted cinnamaldehydes for their ability to interfere with AI-2 based QS. The mechanism of QS inhibition was elucidated by measuring the effect on bioluminescence in several Vibrio harveyi mutants. We also studied in vitro the ability of these compounds to interfere with biofilm formation, stress response and virulence of Vibrio spp. The compounds were also evaluated in an in vivo assay measuring the reduction of Vibrio harveyi virulence towards Artemia shrimp. Results Our results indicate that cinnamaldehyde and several substituted derivatives interfere with AI-2 based QS without inhibiting bacterial growth. The active compounds neither interfered with the bioluminescence system as such, nor with the production of AI-2. Study of the effect in various mutants suggested that the target protein is LuxR. Mobility shift assays revealed a decreased DNA-binding ability of LuxR. The compounds were further shown to (i inhibit biofilm formation in several Vibrio spp., (ii result in a reduced ability to survive starvation and antibiotic treatment, (iii reduce pigment and protease production in Vibrio anguillarum and (iv protect gnotobiotic Artemia shrimp against virulent Vibrio harveyi BB120. Conclusion Cinnamaldehyde and cinnamaldehyde derivatives interfere with AI-2 based QS in various Vibrio spp. by decreasing the DNA-binding ability of LuxR. The use of these compounds resulted in several marked phenotypic changes, including reduced virulence and increased susceptibility to stress. Since inhibitors of AI-2 based quorum sensing are rare, and considering the role of AI-2 in several processes these compounds may be useful leads towards antipathogenic drugs.
Brackman, Gilles; Defoirdt, Tom; Miyamoto, Carol; Bossier, Peter; Van Calenbergh, Serge; Nelis, Hans; Coenye, Tom
2008-01-01
Background To date, only few compounds targeting the AI-2 based quorum sensing (QS) system are known. In the present study, we screened cinnamaldehyde and substituted cinnamaldehydes for their ability to interfere with AI-2 based QS. The mechanism of QS inhibition was elucidated by measuring the effect on bioluminescence in several Vibrio harveyi mutants. We also studied in vitro the ability of these compounds to interfere with biofilm formation, stress response and virulence of Vibrio spp. The compounds were also evaluated in an in vivo assay measuring the reduction of Vibrio harveyi virulence towards Artemia shrimp. Results Our results indicate that cinnamaldehyde and several substituted derivatives interfere with AI-2 based QS without inhibiting bacterial growth. The active compounds neither interfered with the bioluminescence system as such, nor with the production of AI-2. Study of the effect in various mutants suggested that the target protein is LuxR. Mobility shift assays revealed a decreased DNA-binding ability of LuxR. The compounds were further shown to (i) inhibit biofilm formation in several Vibrio spp., (ii) result in a reduced ability to survive starvation and antibiotic treatment, (iii) reduce pigment and protease production in Vibrio anguillarum and (iv) protect gnotobiotic Artemia shrimp against virulent Vibrio harveyi BB120. Conclusion Cinnamaldehyde and cinnamaldehyde derivatives interfere with AI-2 based QS in various Vibrio spp. by decreasing the DNA-binding ability of LuxR. The use of these compounds resulted in several marked phenotypic changes, including reduced virulence and increased susceptibility to stress. Since inhibitors of AI-2 based quorum sensing are rare, and considering the role of AI-2 in several processes these compounds may be useful leads towards antipathogenic drugs. PMID:18793453
Legarra, Andres; Christensen, Ole F; Vitezica, Zulma G; Aguilar, Ignacio; Misztal, Ignacy
2015-06-01
Recent use of genomic (marker-based) relationships shows that relationships exist within and across base population (breeds or lines). However, current treatment of pedigree relationships is unable to consider relationships within or across base populations, although such relationships must exist due to finite size of the ancestral population and connections between populations. This complicates the conciliation of both approaches and, in particular, combining pedigree with genomic relationships. We present a coherent theoretical framework to consider base population in pedigree relationships. We suggest a conceptual framework that considers each ancestral population as a finite-sized pool of gametes. This generates across-individual relationships and contrasts with the classical view which each population is considered as an infinite, unrelated pool. Several ancestral populations may be connected and therefore related. Each ancestral population can be represented as a "metafounder," a pseudo-individual included as founder of the pedigree and similar to an "unknown parent group." Metafounders have self- and across relationships according to a set of parameters, which measure ancestral relationships, i.e., homozygozities within populations and relationships across populations. These parameters can be estimated from existing pedigree and marker genotypes using maximum likelihood or a method based on summary statistics, for arbitrarily complex pedigrees. Equivalences of genetic variance and variance components between the classical and this new parameterization are shown. Segregation variance on crosses of populations is modeled. Efficient algorithms for computation of relationship matrices, their inverses, and inbreeding coefficients are presented. Use of metafounders leads to compatibility of genomic and pedigree relationship matrices and to simple computing algorithms. Examples and code are given. Copyright © 2015 by the Genetics Society of America.
Atefeh Arab; Najmeh Sedrpoushan; Afsaneh Javadzade
2013-01-01
We present a social work study on relationship between parenting styles and career aspirations as well as psychological well-being among third year high school female students in city of Khomeinishahr, Iran during the year of 2012. The study selects a sample of 300 students from 1260 female students who were enrolled in third year high school education, randomly. The study uses the Baumrind’s questionnaire on parenting style, which consists of 30 questions which equally measure three parentin...
Rezzonico, Fabio; Duffy, Brion
2008-09-20
Great excitement accompanied discoveries over the last decade in several Gram-negative and Gram-positive bacteria of the LuxS protein, which catalyzes production of the AI-2 autoinducer molecule for a second quorum sensing system (QS-2). Since the luxS gene was found to be widespread among the most diverse bacterial taxa, it was hypothesized that AI-2 may constitute the basis of a universal microbial language, a kind of bacterial Esperanto. Many of the studies published in this field have drawn a direct correlation between the occurrence of the luxS gene in a given organism and the presence and functionality of a QS-2 therein. However, rarely hathe existence of potential AI-2 receptors been examined. This is important, since it is now well recognized that LuxS also holds a central role as a metabolic enzyme in the activated methyl cycle which is responsible for the generation of S-adenosyl-L-methionine, the major methyl donor in the cell. In order to assess whether the role of LuxS in these bacteria is indeed related to AI-2 mediated quorum sensing we analyzed genomic databases searching for established AI-2 receptors (i.e., LuxPQ-receptor of Vibrio harveyi and Lsr ABC-transporter of Salmonella typhimurium) and other presumed QS-related proteins and compared the outcome with published results about the role of QS-2 in these organisms. An unequivocal AI-2 related behavior was restricted primarily to organisms bearing known AI-2 receptor genes, while phenotypes of luxS mutant bacteria lacking these genes could often be explained simply by assuming deficiencies in sulfur metabolism. Genomic analysis shows that while LuxPQ is restricted to Vibrionales, the Lsr-receptor complex is mainly present in pathogenic bacteria associated with endotherms. This suggests that QS-2 may play an important role in interactions with animal hosts. In most other species, however, the role of LuxS appears to be limited to metabolism, although in a few cases the presence of yet unknown
Directory of Open Access Journals (Sweden)
Duffy Brion
2008-09-01
Full Text Available Abstract Background Great excitement accompanied discoveries over the last decade in several Gram-negative and Gram-positive bacteria of the LuxS protein, which catalyzes production of the AI-2 autoinducer molecule for a second quorum sensing system (QS-2. Since the luxS gene was found to be widespread among the most diverse bacterial taxa, it was hypothesized that AI-2 may constitute the basis of a universal microbial language, a kind of bacterial Esperanto. Many of the studies published in this field have drawn a direct correlation between the occurrence of the luxS gene in a given organism and the presence and functionality of a QS-2 therein. However, rarely hathe existence of potential AI-2 receptors been examined. This is important, since it is now well recognized that LuxS also holds a central role as a metabolic enzyme in the activated methyl cycle which is responsible for the generation of S-adenosyl-L-methionine, the major methyl donor in the cell. Results In order to assess whether the role of LuxS in these bacteria is indeed related to AI-2 mediated quorum sensing we analyzed genomic databases searching for established AI-2 receptors (i.e., LuxPQ-receptor of Vibrio harveyi and Lsr ABC-transporter of Salmonella typhimurium and other presumed QS-related proteins and compared the outcome with published results about the role of QS-2 in these organisms. An unequivocal AI-2 related behavior was restricted primarily to organisms bearing known AI-2 receptor genes, while phenotypes of luxS mutant bacteria lacking these genes could often be explained simply by assuming deficiencies in sulfur metabolism. Conclusion Genomic analysis shows that while LuxPQ is restricted to Vibrionales, the Lsr-receptor complex is mainly present in pathogenic bacteria associated with endotherms. This suggests that QS-2 may play an important role in interactions with animal hosts. In most other species, however, the role of LuxS appears to be limited to metabolism
Drivers' social-work relationships as antecedents of unsafe driving: A social network perspective.
Arizon Peretz, Renana; Luria, Gil
2017-09-01
In order to reduce road accidents rates, studies around the globe have attempted to shed light on the antecedents for unsafe road behaviors. The aim of the current research is to contribute to this literature by offering a new organizational antecedent of driver's unsafe behavior: The driver's relationships with his or her peers, as reflected in three types of social networks: negative relationships network, friendship networks and advice networks (safety consulting). We hypothesized that a driver's position in negative relationship networks, friendship networks, and advice networks will predict unsafe driving. Additionally, we hypothesized the existence of mutual influences among the driver's positions in these various networks, and suggested that the driver's positions interact to predict unsafe driving behaviors. The research included 83 professional drivers from four different organizations. Driving behavior data were gathered via the IVDR (In-Vehicle Data Recorder) system, installed in every truck to measure and record the driver's behavior. The findings indicated that the drivers' position in the team networks predicts safe driving behavior: Centrality in negative relationship networks is positively related to unsafe driving, and centrality in friendship networks is negatively related to unsafe driving, while centrality in advice networks is not related to unsafe driving. Furthermore, we found an interaction effect between negative network centrality and centrality in friendship networks. The relation between negative networks and unsafe behavior is weaker when high levels of friendship network centrality exist. The implications will be presented in the Discussion section. Copyright © 2017 Elsevier Ltd. All rights reserved.
Medical technology as a key driver of rising health expenditure: disentangling the relationship
Sorenson, Corinna; Drummond, Michael; Bhuiyan Khan, Beena
2013-01-01
Health care spending has risen steadily in most countries, becoming a concern for decision-makers worldwide. Commentators often point to new medical technology as the key driver for burgeoning expenditures. This paper critically appraises this conjecture, based on an analysis of the existing literature, with the aim of offering a more detailed and considered analysis of this relationship. Several databases were searched to identify relevant literature. Various categories of studies (eg, multivariate and cost-effectiveness analyses) were included to cover different perspectives, methodological approaches, and issues regarding the link between medical technology and costs. Selected articles were reviewed and relevant information was extracted into a standardized template and analyzed for key cross-cutting themes, ie, impact of technology on costs, factors influencing this relationship, and methodological challenges in measuring such linkages. A total of 86 studies were reviewed. The analysis suggests that the relationship between medical technology and spending is complex and often conflicting. Findings were frequently contingent on varying factors, such as the availability of other interventions, patient population, and the methodological approach employed. Moreover, the impact of technology on costs differed across technologies, in that some (eg, cancer drugs, invasive medical devices) had significant financial implications, while others were cost-neutral or cost-saving. In light of these issues, we argue that decision-makers and other commentators should extend their focus beyond costs solely to include consideration of whether medical technology results in better value in health care and broader socioeconomic benefits. PMID:23807855
Mishra, Aura A; Christ, Sharon L; Schwab-Reese, Laura M; Nair, Nayantara
2018-07-01
In the present study, witnessing in-home violence and peer relationship quality are evaluated as to their relative impact on Post Traumatic Stress (PTS) symptoms among children aged 8 to 17 investigated by child protective services (CPS) for maltreatment exposure. The sample included 2151 children from the National Survey of Child and Adolescent Well-Being II (NSCAW II). Linear growth models were estimated to assess associations between changes in PTS symptoms, witnessing in-home violence, and peer relationship quality over time. Greater frequency of witnessing in-home violence at baseline (i.e. wave 1) was associated with higher baseline PTS symptoms (β = 0.44). Increases in witnessing in-home violence frequency over time (average annual change across three years) had a strong association with increases in PTS symptoms over time (β = 0.88). Baseline peer relationship quality was associated with fewer PTS symptoms at baseline (β = -0.45). Increases in peer relationship quality over time were strongly associated with declines in PTS symptoms over time (β = -0.68). Peer relationship quality at baseline did not moderate baseline or over time associations between witnessing in-home violence and PTS symptoms. The average decline in PTS symptoms due to decreases in witnessing in-home violence and increases in peer relationship quality was 0.51 and 0.65 standard deviations respectively, over the three-year study period. Reducing chronic witnessing in-home violence and promoting the development of healthy social relationships with peers are critical for PTS symptom recovery. Copyright © 2018 Elsevier Ltd. All rights reserved.
Wang, Mei-Zhen; Lai, Bai-Min; Dandekar, Ajai A; Yang, Yu-Sheng; Li, Na; Yin, Jun; Shen, Dong-Sheng
2017-08-15
Pseudomonas aeruginosa SD-1 is efficient at degrading aromatic compounds and can therefore contribute to the bioremediation of wastewater. P. aeruginosa uses quorum sensing (QS) to regulate the production of numerous secreted "public goods." In wastewater bioaugmentation applications, there are myriad nitrogen sources, and we queried whether various nitrogen sources impact the stabilities of both QS and the bacterial populations. In a laboratory strain of P. aeruginosa , PAO1, the absence of a nitrogen source has been shown to destabilize these populations through the emergence of QS mutant "cheaters." We tested the ability of SD-1 to grow in casein broth, a condition that requires QS for growth, when the nitrogen source with either NH 4 Cl, NaNO 3 , or NaNO 2 or with no added nitrogen source. There was great variability in susceptibility to invasion by QS mutant cheaters and, by extension, the stability of the SD-1 population. When grown with NH 4 Cl as an extra nitrogen source, no population collapse was observed; by contrast, two-thirds of cultures grown in the presence of NaNO 2 collapsed. In the populations that collapsed, the frequency of social cheaters exceeded 40%. NaNO 3 and NaNO 2 directly favor QS mutants of P. aeruginosa SD-1. Although the mechanism by which these nitrogen sources act is not clear, these data indicate that the metabolism of nitrogen can affect the stability of bacterial populations, an important observation for continuing industrial applications with this species. IMPORTANCE Bioaugmentation as a method to help remediate wastewater pollutant streams holds significant potential to enhance traditional methods of treatment. Addition of microbes that can catabolize organic pollutants can be an effective method to remove several toxic compounds. Such bioaugmented strains of bacteria have been shown to be susceptible to competition from the microbiota that are present in wastewater streams, limiting their potential effectiveness. Here, we
Terrill, Philip Ian; Wilson, Stephen James; Suresh, Sadasivam; Cooper, David M; Dakin, Carolyn
2010-05-01
Breathing patterns are characteristically different between infant active sleep (AS) and quiet sleep (QS), and statistical quantifications of interbreath interval (IBI) data have previously been used to discriminate between infant sleep states. It has also been identified that breathing patterns are governed by a nonlinear controller. This study aims to investigate whether nonlinear quantifications of infant IBI data are characteristically different between AS and QS, and whether they may be used to discriminate between these infant sleep states. Polysomnograms were obtained from 24 healthy infants at six months of age. Periods of AS and QS were identified, and IBI data extracted. Recurrence quantification analysis (RQA) was applied to each period, and recurrence calculated for a fixed radius in the range of 0-8 in steps of 0.02, and embedding dimensions of 4, 6, 8, and 16. When a threshold classifier was trained, the RQA variable recurrence was able to correctly classify 94.3% of periods in a test dataset. It was concluded that RQA of IBI data is able to accurately discriminate between infant sleep states. This is a promising step toward development of a minimal-channel automatic sleep state classification system.
Directory of Open Access Journals (Sweden)
Yanmang Cui
2013-12-01
Full Text Available Oxidative stress is one of the major factors in the pathogenesis of liver disease. Quercetin is a plant-based antioxidant traditionally used as a treatment for hepatic injury, but its poor solubility affects its bioavailability. We here report the regulative effects on hepatoprotection and absorption in mice of quercetin sulfation to form quercetin-5',8-disulfonate (QS, a novel synthetic compound. Oral administration of both QS and the parent quercetin at 100, 200 and 500 mg/kg·bw prior to acute CCl4 oxidative damage in mice, effectively attenuated serum alanine aminotransferase (ALT, aspartate aminotransferase (AST and lactate dehydrogenase (LDH activities and hepatic malondialdehyde (MDA levels (p < 0.05, and suppressed the CCl4-induced depletion of glutathione peroxidase (GSH-Px and total superoxide dismutase (T-SOD. Selective 5',8-sulfation of quercetin increased the hepatoprotective effect, and its relative absorption relative to quercetin (p < 0.05 as indicated by an improved 24-hour urinary excretion and a decreased fecal excretion determined by HPLC. These results and histopathological observations collectively demonstrate that quercetin sulfation increases its hepatoprotective effects and absorption in mice, and QS has potential as a chemopreventive and chemotherapeutic agent for liver diseases.
Guo, Xun; Zhang, Li-Yan; Wu, Shuai-Cheng; Xia, Fang; Fu, Yun-Xing; Wu, Yong-Li; Leng, Chun-Qing; Yi, Peng-Fei; Shen, Hai-Qing; Wei, Xu-Bin; Fu, Ben-Dong
2014-12-05
Avian pathogenic Escherichia coli (APEC) induce septicemia in chickens by invading type II pneumocytes to breach the blood-air barrier. The virulence of APEC can be regulated by quorum sensing (QS). Andrographolide is a QS inhibitor of Pseudomonas aeruginosa (P. aeruginosa). Therefore, we investigate whether andrographolide inhibits the injury of chicken type II pneumocytes by avian pathogenic E. coli O78 (APEC-O78) by disrupting the bacterial QS system. The results showed that sub-MIC of andrographolide significantly reduced the release of lactate dehydrogenase (LDH), F-actin cytoskeleton polymerization, and the degree of the adherence to chicken type II pneumocytes induced by APEC-O78. Further, we found that andrographolide significantly decreased the autoinducer-2 (AI-2) activity and the expression of virulence factors of APEC-O78. These results suggest that andrographolide reduce the pathogenicity of APEC-O78 in chicken type II pneumocytes by interfering QS and decreasing virulence. These results provide new evidence for colibacillosis prevention methods in chickens. Copyright © 2014 Elsevier B.V. All rights reserved.
Zhang, Mengli; Gong, Xiangdong; Lin, Tong; Wu, Qiuju; Ge, Yiping; Huang, Yuqing; Ge, LiYu
2018-04-01
Q-switched (QS) lasers are the gold standard for tattoo removal. The purpose of the present study was to gain a more comprehensive understanding of the factors that influence the efficacy of QS lasers and their associated complications in the removal of tattoos in China. Clinical data of 266 patients were analyzed retrospectively. The tattoo clearance rate was evaluated using the 4-point scale. The Cox regression model was applied to analyze the factors that affected the efficacy of QS lasers in tattoo removal. In addition, treatment-related adverse reactions were analyzed. The results showed that several variables had a statistically significant effect (p tattoo removal treatment, including the patients' age, the tattoo's age, type, color, or ink density and the number of treatments. A variety of adverse responses occurred during the laser treatment. The overall incidence of adverse responses was approximately 24.06%, including pigmentation, hypopigmentation, bulla formation, allergic reactions, and skin texture changes or hypertrophic scarring. Some factors may influence the efficacy of QS lasers in the treatment of tattoos and certain adverse reactions may occur during this process.
Let it go: Relationship autonomy predicts pro-relationship responses to partner transgressions.
Hadden, Benjamin W; Baker, Zachary G; Knee, C Raymond
2017-11-24
The purpose of the present research is to better understand how relationship autonomy-having more self-determined reasons for being committed to a relationship-contributes to pro-relationship responses to transgressions in romantic relationships (e.g., forgiveness and accommodation). Study 1 employed a cross-sectional design (N = 350) and Study 2 used a weekly diary (N = 121) to test associations between relationship autonomy and pro-relationship responses to transgressions. Studies 3 and 4 utilized dyadic designs (Study 3: N = 200 couples, 400 individuals; Study 4: N = 275 couples, 550 individuals) to determine how both partners' relationship autonomy is associated with pro-relationship responses. Results revealed that relationship autonomy is robustly associated with pro-relationship responses to transgressions, both as general tendencies and as responses to idiosyncratic transgressions. Results of actor-partner interdependence model (APIM) analyses in Studies 3 and 4 provide evidence that one's partner's relationship autonomy is important for promoting pro-relationship responses as well. Study 4 also found that people perceive that partners respond better to transgressions if their partner is high in relationship autonomy. This research provides consistent and compelling evidence that the degree of self-determination underlying commitment is important for understanding how people respond to transgressions in their relationships, beyond their current levels of commitment. © 2017 Wiley Periodicals, Inc.
Shomaker, Lauren B.; Furman, Wyndol
2010-01-01
This study examined how current parent-adolescent relationship qualities and adolescents’ representations of relationships with parents were related to friendship interactions in 200 adolescent-close friend dyads. Adolescents and friends were observed discussing problems during a series of structured tasks. Negative interactions with mothers were significantly related to adolescents’ greater conflict with friends, poorer focus on tasks, and poorer communication skills. Security of working models (as assessed by interview) was significantly associated with qualities of friendship interactions, whereas security of attachment styles (as assessed by questionnaire) was not. More dismissing (vs. secure) working models were associated with poorer focus on problem discussions and weaker communication skills with friends, even after accounting for gender differences and current parent-adolescent relationship qualities. We discuss possible mechanisms for the observed links between dimensions of parent-adolescent relationships and friendships. We also consider methodological and conceptual differences between working model and style measures of attachment representations. PMID:20174459
Fernandez-Luque, Luis; Singh, Meghna; Ofli, Ferda; Mejova, Yelena A; Weber, Ingmar; Aupetit, Michael; Jreige, Sahar Karim; Elmagarmid, Ahmed; Srivastava, Jaideep; Ahmedna, Mohamed
2017-04-13
The explosion of consumer electronics and social media are facilitating the rise of the Quantified Self (QS) movement where millions of users are tracking various aspects of their daily life using social media, mobile technology, and wearable devices. Data from mobile phones, wearables and social media can facilitate a better understanding of the health behaviors of individuals. At the same time, there is an unprecedented increase in childhood obesity rates worldwide. This is a cause for grave concern due to its potential long-term health consequences (e.g., diabetes or cardiovascular diseases). Childhood obesity is highly prevalent in Qatar and the Gulf Region. In this study we examine the feasibility of capturing quantified-self data from social media, wearables and mobiles within a weight lost camp for overweight children in Qatar. Over 50 children (9-12 years old) and parents used a wide range of technologies, including wearable sensors (actigraphy), mobile and social media (WhatsApp and Instagram) to collect data related to physical activity and food, that was then integrated with physiological data to gain insights about their health habits. In this paper, we report about the acquired data and visualization techniques following the 360° Quantified Self (360QS) methodology (Haddadi et al., ICHI 587-92, 2015). 360QS allows for capturing insights on the behavioral patterns of children and serves as a mechanism to reinforce education of their mothers via social media. We also identified human factors, such as gender and cultural acceptability aspects that can affect the implementation of this technology beyond a feasibility study. Furthermore, technical challenges regarding the visualization and integration of heterogeneous and sparse data sets are described in the paper. We proved the feasibility of using 360QS in childhood obesity through this pilot study. However, in order to fully implement the 360QS technology careful planning and integration in the health
Zoran Sušanj; Ana Jakopec
2012-01-01
This study was conducted to explore the relationship between different leadership styles and organizational commitment. Furthermore, it attempts to clarify the role of justice perceptions and job satisfaction as mediators of the relationship between (active and passive/avoiding) leadership styles and organizational commitment. The structural equations modeling was used to analyze data collected from a sample of participants recruited from different organizations. The results have indicated th...
Cigarette Nicotine Content as a Moderator of the Relationship Between Negative Affect and Smoking.
Robinson, Jason D; Kypriotakis, George; Karam-Hage, Maher; Green, Charles E; Hatsukami, Dorothy K; Cinciripini, Paul M; Donny, Eric C
2017-09-01
Research suggests a strong association between negative affect (NA) and smoking. However, little is known about the association between NA and smoking among individuals who switch to reduced-nicotine cigarettes. The goal of this study was to examine the extent to which cigarette nicotine content moderates the relationship between NA and smoking over time. Seven hundred and seventeen participants, 237 in the normal nicotine content (NNC; 15.8 mg/g and usual brand) cigarette group and 480 in the very low nicotine content (VLNC; 2.4 mg/g nicotine or less) cigarette group, participated in a randomized trial that examined the effects of cigarette nicotine content on smoking behavior over 6 weeks. We used parallel process latent growth curve modeling to estimate the relationship between changes in NA and changes in the numbers of cigarettes smoked per day (CPD), from baseline to 6 weeks, as a function of cigarette nicotine content. The relationship between NA and investigational CPD reduced over time for those in the VLNC group, but not for those in the NNC group. There was no significant relationship between change in PA and CPD over time for either cigarette group. Smoking VLNC cigarettes disrupts the relationship between smoking and negative affect, which may help reduce nicotine dependence. This study suggests that the association between NA and smoking behavior is reduced over time among those that smoked reduced-nicotine content cigarettes. This provides additional evidence that smoking reduced-nicotine content cigarettes may help reduce nicotine dependence. © The Author 2017. Published by Oxford University Press on behalf of the Society for Research on Nicotine and Tobacco. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Connell, Jodi L; Kim, Jiyeon; Shear, Jason B; Bard, Allen J; Whiteley, Marvin
2014-12-23
Microbes frequently live in nature as small, densely packed aggregates containing ∼10(1)-10(5) cells. These aggregates not only display distinct phenotypes, including resistance to antibiotics, but also, serve as building blocks for larger biofilm communities. Aggregates within these larger communities display nonrandom spatial organization, and recent evidence indicates that this spatial organization is critical for fitness. Studying single aggregates as well as spatially organized aggregates remains challenging because of the technical difficulties associated with manipulating small populations. Micro-3D printing is a lithographic technique capable of creating aggregates in situ by printing protein-based walls around individual cells or small populations. This 3D-printing strategy can organize bacteria in complex arrangements to investigate how spatial and environmental parameters influence social behaviors. Here, we combined micro-3D printing and scanning electrochemical microscopy (SECM) to probe quorum sensing (QS)-mediated communication in the bacterium Pseudomonas aeruginosa. Our results reveal that QS-dependent behaviors are observed within aggregates as small as 500 cells; however, aggregates larger than 2,000 bacteria are required to stimulate QS in neighboring aggregates positioned 8 μm away. These studies provide a powerful system to analyze the impact of spatial organization and aggregate size on microbial behaviors.
Novel approaches to mitigating bacterial biofilm formation and intercellular communication
Kasper, Stephen H.
Long thought of as solitary single-cell organisms, it is now widely accepted that bacteria can act and cooperate as social organisms. Phenomena such as biofilm formation and quorum sensing (QS) are two intimately intertwined cooperative behaviors that significantly contribute to the pathogenesis of many bacteria. Biofilms are surface associated communities of bacteria encased in a secreted extracellular matrix, which provides several advantages over an individualized lifestyle, such as increased protection from antimicrobial agents as well as enhanced opportunity for the exchange of genetic material. Bacterial QS is a system of population-based communication through the production, sensing, and response to chemical signals, often controlling the expression of diverse virulence factors (e.g. toxins, proteases). Biofilm formation and QS are cooperative processes that are often leveraged as bacteria coordinate infection processes, and can therefore be novel targets for anti-infective treatments that differ from conventional antibiotic treatment. Our lab has previously identified a novel class of small molecules that inhibit biofilm formation and disrupt QS by the pathogenic bacterium Pseudomonas aeruginosa. These organosulfur-based compounds are either natural products or related derivatives of the tropical plant Petiveria alliacea. Because oral biofilm (e.g. dental plaque) is a major conduit of oral and systemic disease, and is also a site for horizontal transfer for genes encoding antibiotic resistance, there exists a need for novel strategies for inhibiting oral biofilm development. Therefore, a small library (˜50 compounds) of structural derivatives was developed and screened for their ability to inhibit biofilm formation by multiple orally associated bacteria. The screening effort uncovered several related compounds that inhibited oral biofilm development. To determine how natural product-based organosulfur compounds could be inducing QS inhibitory effects, an
2010-10-01
... firm, accounting firm, etc.; (D) If a PQS or IPQ holder and QS or IFQ holder share the same office..., accounting firm, or broker of any PQS or IPQ holder with whom the QS or IFQ holder has entered into a... means the person identified on an IFQ permit. Crab LLP license history means, for any particular crab...
Hua Miao; Xiao-Rong Liu
2017-01-01
Objective: To study the relationship of different respiratory virus infection with pediatric asthma attack as well as cytokine and lymphocyte subset levels. Methods: A total of 85 children who were diagnosed with bronchial asthma in our hospital between May 2013 and March 2016 were selected as asthma group and further divided into asthma-RSV group, asthma-AV group, asthma-PIV group, asthma-IFV group and pure asthma group according to the condition of respiratory virus infection...
Clark, T. K.; Peters, B.; Gadd, N. E.; De Dios, Y. E.; Wood, S.; Bloomberg, J. J.; Mulavara, A. P.
2016-01-01
Introduction: During space exploration missions astronauts are exposed to a series of novel sensorimotor environments, requiring sensorimotor adaptation. Until adaptation is complete, sensorimotor decrements occur, affecting critical tasks such as piloted landing or docking. Of particularly interest are locomotion tasks such as emergency vehicle egress or extra-vehicular activity. While nearly all astronauts eventually adapt sufficiently, it appears there are substantial individual differences in how quickly and effectively this adaptation occurs. These individual differences in capacity for sensorimotor adaptation are poorly understood. Broadly, we aim to identify measures that may serve as pre-flight predictors of and individual's adaptation capacity to spaceflight-induced sensorimotor changes. As a first step, since spaceflight is thought to involve a reinterpretation of graviceptor cues (e.g. otolith cues from the vestibular system) we investigate the relationships between various measures of vestibular function in humans. Methods: In a set of 15 ground-based control subjects, we quantified individual differences in vestibular function using three measures: 1) ocular vestibular evoked myogenic potential (oVEMP), 2) computerized dynamic posturography and 3) vestibular perceptual thresholds. oVEMP responses are elicited using a mechanical stimuli approach. Computerized dynamic posturography was used to quantify Sensory Organization Tests (SOTs), including SOT5M which involved performing pitching head movements while balancing on a sway-reference support surface with eyes closed. We implemented a vestibular perceptual threshold task using the tilt capabilities of the Tilt-Translation Sled (TTS) at JSC. On each trial, the subject was passively roll-tilted left ear down or right ear down in the dark and verbally provided a forced-choice response regarding which direction they felt tilted. The motion profile was a single-cycle sinusoid of angular acceleration with a
Antecedents of Customer Relationship Termination
DEFF Research Database (Denmark)
Geersbro, Jens; Ritter, Thomas
To end business relationships, or to more actively terminate relationships, has long been acknowledged as part of customer relationship management. However, compared to other elements such as initiation and maintenance of relationships, little is known about the termination of business...... relationships as a managerial task. This paper contributes by (1) developing a conceptualization of relationship termination competence and (2) analyzing its antecedents. The empirical results identify termination acceptance, definition non-customers, organizational relationship termination routines......, and motivation as significant antecedents. Because of this, managers need to develop their organizations in order to use relationship termination as a vital strategy....
Görgens-Ekermans, Gina; Brand, Tamari
2012-08-01
To investigate inter-relationships between emotional intelligence (EI), work stress and burnout in a group of nurses in the Western Cape Province, South Africa. The moderating effect of EI in the stress-burnout relationship and group differences (nurses working in different wards) in burnout were also investigated. Stress and subsequent burnout commonly threaten the occupational health and well-being of nurses in South Africa and elsewhere. Developing EI in nurses may increase individual stress resistance and combat burnout. A cross-sectional research design with anonymous questionnaires was conducted. Self-report data were used. Survey data were collected from 122 nurses working in different wards at four hospitals from a private hospital group. The Swinburne University Emotional Intelligence Test, Sources of Work Stress Inventory and Maslach Burnout Inventory were used to measure EI, stress and burnout, respectively. Consistent inverse relationships between emotional control and management as dimensions of EI, and stress and burnout emerged. A differential effect of high vs. low EI on the stress-burnout relationship was evident. Workload and the work/family interface emerged as significant predictors of burnout. Respondents working in maternity, paediatric and ER wards reported more feelings of personal accomplishment than those working in general wards. Higher EI is significantly related with lower stress and burnout in a sample of South African nurses. The moderator effect of EI in the stress-burnout relationship suggests that enhanced EI may help diminish burnout development when chronic stress is experienced. EI developmental interventions, if introduced in nursing curricula, may increase emotional coping resources and enhanced social skills, which may benefit the long-term occupational health of nurses. This may be relevant in developing countries, where environmental stressors related to the organisational context (budget constraints) and wider social
De Hoogh, Annebel H B; Den Hartog, Deanne N
2009-07-01
This study examined the moderating role of personality traits in the relationship between leader behavior and burnout. In two samples, employees (N = 91; N = 190) filled out the Maslach Burnout Inventory-General Survey and rated their leader's autocratic and charismatic leader behavior and their own neuroticism and internal work locus of control. As expected, neuroticism and internal work locus of control moderated the relationship between leader behavior and burnout. Charisma was associated with lower burnout, particularly for individuals low on internal locus. The relationship between autocratic leadership and burnout was positive for neurotic individuals, whereas for emotionally stable individuals this relationship weakened. These results were consistent across two independent samples: one with individual employee ratings of manager's leadership styles and the other with aggregate ratings of manager's leadership styles among employees in diverse organizations. Thus, although charismatic and autocratic leader behavior may respectively act to hinder or enhance overload and stress, the relationship between these leadership styles and burnout differs for followers with different traits.
The Relationship between Principal Emotional Intelligence and the School as a Learning Organization
DeRoberto, Thomas
2011-01-01
The purpose of this study was to determine the nature of the relationship between the emotional intelligence of the school principal and the school as a learning organization. These constructs originated in the business world and have recently been examined within the context of education. Studies on principal emotional intelligence have shown the…
Sardana, Kabir; Garg, Vijay K; Bansal, Shivani; Goel, Khushbu
2013-12-01
Laser tattoo removal conventionally uses Q-switched (QS) lasers, but they require multiple sittings, and the end results depend largely on the type of tattoo treated. In pigmented skin, due to the competing epidermal pigment results, laser results in tattoo are slow and inadequate. To evaluate the efficacy of a combined use of ultrapulse CO2 and QS Nd:YAG (1064 nm) laser in the treatment of tattoos in Indian skin. A split-lesion trial was carried out in five patients, with the left side of tattoos receiving the QS Nd:YAG (1064 nm) and the right side, a sequential combination of Up CO2 and QS Nd: YAG at 6 weeks interval with a maximum of six sittings. Outcome assessment was carried out by a blinded assessor using standardized photography. An assessment of physician improvement score, side-effects score, and patient satisfaction score was taken during and at the end of the study. There was a statistically significant improvement on the combination side(physician improvement score -3.7 vs. 1.87: P = 0.0019) which occurred earlier with fewer sittings (1.7 vs. 6). There was no statistically significant difference in the side effects. A combination of an Up CO2 laser with QS Nd: YAG laser is a promising tool for rapid and effective removal of blue-black/blue amateur tattoo in pigmented skin. © 2013 Wiley Periodicals, Inc.
Feelings and intervention judgments as mediators in the risk perception-intention relationship.
Soureti, Anastasia; Hurling, Robert; Cobain, Mark R; van Mechelen, Willem; Chinapaw, Mai
2013-07-01
To explore the mediating role of measures of persuasion in the relationship between risk perceptions and intentions. The first study included 413 obese subjects (mean age = 45.3 years); the second study, 781 overweight subjects (mean age = 46.6 years). All measures were assessed by self-report. Feelings and intervention judgments were mediators in the relationship between risk perceptions and intention to eat healthier, do more physical activity (study 1) and intention to reduce saturated fat (study 2). Feelings was the only mediator in the relationship between risk perceptions and intention to stop smoking (study 1). Future interventions targeting risk perceptions to increase intentions are likely to be more effective if subjects find the information emotionally impactful, credible, and engaging.
Liu, Yan; Li, Xiaowei; Chen, Li; Qu, Zhiyong
2015-10-01
Using cross-sectional data collected in rural communities of two provinces of China, this study examined the protective role of perceived positive teacher-student relationship for Chinese left-behind children. The participants included 1442 children with a mean age of 14.13 classified into two groups: a left-behind group (104 boys and 110 girls) and a comparison group (588 boys and 640 girls). Self-reported questionnaires concerning self-esteem, depression, problem behaviours and the teacher-student relationship were administered. Relative to the comparison group, after controlling for age, gender and family socioeconomic status, the left-behind group was disadvantaged in terms of self-esteem and depression but not in problem behaviours. As hypothesised, the results of regression analyses indicated that teacher-student relationship positively predicted self-esteem and negatively predicted depression and problem behaviours for both groups. Moreover, the association between teacher-student relationship and depression was stronger among the left-behind group, suggesting that left-behind children were more responsive to the positive effect of a desired teacher-student relationship. Taken together, the results of our study support the idea that perceived positive teacher-student relationship may serve as a protective factor for left-behind children. Practical implications and limitations of the present study are discussed. © 2014 International Union of Psychological Science.
Negative affect as a mediator of the relationship between vigorous-intensity exercise and smoking.
Tart, Candyce D; Leyro, Teresa M; Richter, Ashley; Zvolensky, Michael J; Rosenfield, David; Smits, Jasper A J
2010-06-01
The present cross-sectional study evaluated whether people who engage in vigorous-intensity exercise are better able to regulate negative affective states, thereby changing core maintenance factors of smoking. Participants were a community sample of adults (n = 270) who completed self-report measures of physical activity, cigarette smoking, anxiety sensitivity, and negative affect. Consistent with hypothesis, vigorous-intensity exercise was related to lower levels of cigarette smoking, accounting for 10% of the variance in smoking. Additionally, negative affect mediated the relationship between vigorous-intensity physical activity and cigarette smoking, accounting for about 12% of this relation. Furthermore, these relationships were stronger for individuals with high anxiety sensitivity than for those with low anxiety sensitivity; including anxiety sensitivity as a moderator of the mediated relationship increased the amount of variance accounted for by negative affect to 17%. The findings are discussed in relation to developing further scientific insight into the mechanisms and pathways relevant to understanding the association among vigorous-intensity exercise, smoking, and emotional vulnerability. Copyright 2010 Elsevier Ltd. All rights reserved.
Jamil, Amber; Raja, Usman; Darr, Wendy
2013-01-01
This research examined the relationships between perceived psychological contract breach, felt violation, and burnout in a sample (n = 361) of employees from various organizations in Pakistan. The moderating role of contract types in these relationships was also tested. Findings supported a positive association between perceived psychological contract breach and felt violation and both were positively related to burnout. Transactional and relational contracts moderated the felt violation-burnout relationship. Scores on relational contract type tended to be higher than for transactional contract type showing some contextual influence.
Abeyta, Andrew A; Routledge, Clay; Juhl, Jacob
2015-12-01
Previous research has shown that nostalgia is a highly social emotion that provides a sense of social connectedness. In the present research, we tested a social motivational function of nostalgia. Specifically, across 7 studies we found converging evidence that nostalgia mobilizes social goals. In Study 1, nostalgia increased the importance people assigned to relationship goals and how optimistic they felt about achieving these goals. In Study 2, nostalgia increased intentions to pursue goals of connecting with friends. In Study 3, experimentally induced pessimism about achieving relationship goals instigated nostalgia. In Study 4, we found evidence that it is the interpersonal nature of nostalgia that is associated with striving to connect with others. Specifically, nostalgia about aspects of the past that were high in sociality was associated with intentions to interact with others, whereas nostalgia for aspects of the past that were low in sociality was not. In Study 5, nostalgic reflection increased friendship-approach goal striving relative to reflecting on ordinary social memories, but did not increase friendship-avoidant goal striving. Finally, in Studies 6 and 7, we found evidence that social-efficacy mediated the effect of nostalgia on striving to connect with others and striving to overcome interpersonal challenges. Together, these findings establish nostalgia as catalyst for social goal pursuit and growth. (c) 2015 APA, all rights reserved).
Development of Adolescent Relationships
de Goede, I.H.A.
2009-01-01
This dissertation on “Development of Adolescent Relationships” addresses relationships with parents, friends, and romantic partners in adolescence from a developmental perspective. By studying both parent-adolescent relationships and peer relationships at the same time, as well as interrelations between these types of relationships, this dissertation provides more information on the processes taking place in relationships during adolescence. Findings indicate that parent-adolescent relationsh...
Irrational Beliefs in Romantic Relationships as the Predictor of Aggression in Emerging Adulthood
Gündogdu, Rezzan; Yavuzer, Yasemin; Karatas, Zeynep
2018-01-01
The purpose of this study is to examine irrational beliefs in romantic relationships as the predictor of aggression in emerging adults. The study is a quantitative study done using the relational survey model. The study group is composed of 351 fourth-year students, 201 females and 150 males, who were attending three universities in Central…
An Assessment of Agency Theory as a Framework for the Government-University Relationship
Kivisto, Jussi
2008-01-01
The aim of this paper is to use agency theory as the theoretical framework for an examination of the government-university relationship and to assess the main strengths and weaknesses of the theory in this context. Because of its logically consistent framework, agency theory is able to manifest many of the complexities and difficulties that…
Becirovic, Senad
2017-01-01
This study deals with the research into the relationship between gender, motivation and achievement in learning English as a foreign language. A good command of English is of paramount importance for an individual to be successful in numerous aspects of life such as professional, personal and educational. The aim of this research was to determine…
Coping strategies as mediators in the relationship between test anxiety and academic achievement
Directory of Open Access Journals (Sweden)
Genc Ana
2017-01-01
Full Text Available In most modern societies, nearly every realm of life involves some form of evaluation of our knowledge, abilities and skills. Given the potentially significant consequences of exams, it is not surprising that they are often very stressful. This study aimed to determine the existence and nature of the relationships between level of test anxiety, coping strategies, and achieved success on a mid-term test. As well as examining the direct relations between the given variables, our primary interest was to investigate the potential mediating role of coping mechanisms between the input and output variables of the examined stressful transaction. The study was conducted on a sample of 263 students from the Psychology and German Studies Departments of the Faculty of Philosophy at the University of Novi Sad. According to our results, only emotion-focused coping mechanisms were statistically significant mediators in the relationship between level of test anxiety and mid-term test achievement. The results indicate that students with high test anxiety who employ predominantly emotion-focused coping strategies score lower on a pre-exam knowledge test.
Directory of Open Access Journals (Sweden)
Denise Queiroz Ferreira
2012-09-01
Full Text Available OBJETIVO: Avaliar em gestantes saudáveis no segundo trimestre a associação entre função sexual e qualidade de vida, e função sexual e satisfação sexual. MÉTODOS: Estudo transversal com 51 gestantes em acompanhamento em ambulatório de pré-natal de baixo risco. A função sexual foi aferida por meio do Quociente Sexual - Versão Feminina (QS-F. A qualidade de vida e a satisfação sexual foram avaliadas pelo Instrumento Abreviado de Avaliação de Qualidade de Vida da Organização Mundial da Saúde (WHOQOL-bref. Os critérios de inclusão foram idade gestacional entre a 15ª e a 26ª semana, idade materna igual ou superior a 20 anos, mínimo de 5 anos de educação escolar, ter parceiro fixo há pelo menos 6 meses, ter tido relação sexual com penetração vaginal nos últimos 15 dias. Foram excluídas mulheres vítimas de violência sexual, com história pregressa ou atual de depressão, antecedente de aborto habitual ou complicações na gestação atual (amniorrexe prematura, trabalho de parto prematuro ou hemorragia. Para a análise dos dados foram utilizados os testes do χ² e exato de Fisher e pPURPOSE: To evaluate, in healthy women in the second trimester of pregnancy, a possible association between sexual function and quality of life, and between sexual function and sexual satisfaction. METHODS: This cross-sectional study involved 51 pregnant women managed at a low-risk antenatal care clinic. Sexual function was evaluated through the Sexual Quotient - Female Version (QS-F questionnaire. Quality of life and sexual satisfaction were evaluated though the brief version of the World Health Organization Quality of Life questionnaire (WHOQOL-bref. Inclusion criteria were pregnancy between 15-26 weeks, maternal age 20 or more years, at least five years of scholling, in a relationship with a single partner for the last 6 months, having sexual intercourse with vaginal penetration in the last 15 days. We excluded women with a history
Directory of Open Access Journals (Sweden)
A.A. Moawad
2011-10-01
Full Text Available Milk from different animal species has variable levels of antimicrobial factors against some of spoilage bacteria. For example, they are significantly present in higher concentration in she-camel’s milk than in cattle or buffalo and they are more heat-resistant than their counterparts in cattle and buffalo. Spoilage bacteria are known to communicate with each other by release of signaling molecules, a phenomenon described as quorum sensing (QS. Some food matrices inhibit these signaling compounds. In this study we screened QS inhibitory activities in raw milk of cattle and camel. Ten samples each of fresh raw cow’s milk and she-camel’s milk from apparently healthy animals were screened using the bacterial model Cromobacterium violaceum. The tested cow’s raw milk samples were able to inhibit the production of QS signalling molecules acyl-homoserine lactones (AHLs produced by C. violaceum. However, she-camel’s milk samples were less effective in inhibiting such AHLs. Thus, one of the factors which influence the inhibitory activity could be derived from variation in milk chemical composition, especially in the percentage of fat which is significantly higher in tested cow’s milk samples (2.22±0.12 than in tested she-camel’s milk samples (1.44±0.35. Natural inhibition of QS signaling by cow’s milk may offer a unique means to control foodborne pathogens and reduce microbial spoilage.
Sablik, Zbigniew; Samborska-Sablik, Anna; Drożdż, Jarosław
2013-06-20
The aim of our work is to present the universality of burnout syndrome among physicians worldwide and to demonstrate selected aspects of the relationship between patients and doctors as a common factor predisposing to burnout. We looked up 20 original pieces of research from the Medline database published in the last 10 years to determine the prevalence of burnout among doctors in different countries. In all quoted works a remarkable percentage of doctors of interventional and non-interventional specialties suffered burnout. Because it is the relationship with patients that constitutes a key denominator for their work, in the discussion we have exposed an important aspect of it, destructive patient games, described on the basis of transactional analysis. Since universal burnout causes a deterioration of doctors' service, for the optimal good of the patient to survive preservation of the doctor's well-being in the patient-doctor relationship is needed everywhere.
Carr, Sandra E; Celenza, Antonio; Puddey, Ian B; Lake, Fiona
2014-07-30
Little recent published evidence explores the relationship between academic performance in medical school and performance as a junior doctor. Although many forms of assessment are used to demonstrate a medical student's knowledge or competence, these measures may not reliably predict performance in clinical practice following graduation. This descriptive cohort study explores the relationship between academic performance of medical students and workplace performance as junior doctors, including the influence of age, gender, ethnicity, clinical attachment, assessment type and summary score measures (grade point average) on performance in the workplace as measured by the Junior Doctor Assessment Tool. There were two hundred participants. There were significant correlations between performance as a Junior Doctor (combined overall score) and the grade point average (r = 0.229, P = 0.002), the score from the Year 6 Emergency Medicine attachment (r = 0.361, P gender or ethnicity on the overall combined score of performance of the junior doctor. Performance on integrated assessments from medical school is correlated to performance as a practicing physician as measured by the Junior Doctor Assessment Tool. These findings support the value of combining undergraduate assessment scores to assess competence and predict future performance.
Directory of Open Access Journals (Sweden)
Daniela Fadda
2016-02-01
Full Text Available Among personality traits, extraversion has received major theoretical and empirical attention as predictor of subjective well-being (SWB, whereas the role of emotional stability-neuroticism has been partially neglected. The present study aims to study the role of neuroticism in the relationship between introversion-extraversion and SWB. In particular, we explored if the trait of neuroticism moderates the relationships between introversion-extraversion and SWB dimensions (Satisfaction with life, Mastery, Vigour, Social Cheerfulness, directly and by mediation of self-esteem. Indeed, previous studies have suggested that self-esteem is positively associated with high extraversion and low neuroticism and that it positively mediates the relationship between SWB and personality traits in adolescents. For this purpose, a sample of high school students (N = 1173 completed the Oxford Happiness Inventory, the Rosenberg Self-Esteem Scale and the Big Five Questionnaire. In a latent variable model, we examined the interaction effects (direct and indirect of extraversion and neuroticism on SWB dimensions. Our results showed that the nature of differences between introverts and extraverts on SWB could be related to the level of neuroticism in relation to Satisfaction with life. Moreover, self-esteem mediated the relationship between personality traits and SWB. In particular, mediated moderation effect analysis showed that self-esteem mediates completely the relationship between the interaction term (extraversion x neuroticism and Mastery, and partially the relationship with Satisfaction with life. Moreover, moderated mediation effect analysis showed that high levels of neuroticism moderate the effect of extraversion on Satisfaction with life and Mastery through the mediation of self-esteem. In conclusion, our results suggest that although extraversion has a cardinal role on SWB dimensions related to Vigour and Social Cheerfulness, neuroticism and the mediating
Fadda, Daniela; Scalas, L Francesca
2016-02-01
Among personality traits, extraversion has received major theoretical and empirical attention as predictor of subjective well-being (SWB), whereas the role of emotional stability-neuroticism has been partially neglected. The present study aims to study the role of neuroticism in the relationship between introversion-extraversion and SWB. In particular, we explored if the trait of neuroticism moderates the relationships between introversion-extraversion and SWB dimensions (Satisfaction with life, Mastery, Vigour, Social Cheerfulness), directly and by mediation of self-esteem. Indeed, previous studies have suggested that self-esteem is positively associated with high extraversion and low neuroticism and that it positively mediates the relationship between SWB and personality traits in adolescents. For this purpose, a sample of high school students (N = 1173) completed the Oxford Happiness Inventory, the Rosenberg Self-Esteem Scale and the Big Five Questionnaire. In a latent variable model, we examined the interaction effects (direct and indirect) of extraversion and neuroticism on SWB dimensions. Our results showed that the nature of differences between introverts and extraverts on SWB could be related to the level of neuroticism in relation to Satisfaction with life. Moreover, self-esteem mediated the relationship between personality traits and SWB. In particular, mediated moderation effect analysis showed that self-esteem mediates completely the relationship between the interaction term (extraversion x neuroticism) and Mastery, and partially the relationship with Satisfaction with life. Moreover, moderated mediation effect analysis showed that high levels of neuroticism moderate the effect of extraversion on Satisfaction with life and Mastery through the mediation of self-esteem. In conclusion, our results suggest that although extraversion has a cardinal role on SWB dimensions related to Vigour and Social Cheerfulness, neuroticism and the mediating role of self
Fadda, Daniela; Scalas, L. Francesca
2016-01-01
Among personality traits, extraversion has received major theoretical and empirical attention as predictor of subjective well-being (SWB), whereas the role of emotional stability-neuroticism has been partially neglected. The present study aims to study the role of neuroticism in the relationship between introversion-extraversion and SWB. In particular, we explored if the trait of neuroticism moderates the relationships between introversion-extraversion and SWB dimensions (Satisfaction with life, Mastery, Vigour, Social Cheerfulness), directly and by mediation of self-esteem. Indeed, previous studies have suggested that self-esteem is positively associated with high extraversion and low neuroticism and that it positively mediates the relationship between SWB and personality traits in adolescents. For this purpose, a sample of high school students (N = 1173) completed the Oxford Happiness Inventory, the Rosenberg Self-Esteem Scale and the Big Five Questionnaire. In a latent variable model, we examined the interaction effects (direct and indirect) of extraversion and neuroticism on SWB dimensions. Our results showed that the nature of differences between introverts and extraverts on SWB could be related to the level of neuroticism in relation to Satisfaction with life. Moreover, self-esteem mediated the relationship between personality traits and SWB. In particular, mediated moderation effect analysis showed that self-esteem mediates completely the relationship between the interaction term (extraversion x neuroticism) and Mastery, and partially the relationship with Satisfaction with life. Moreover, moderated mediation effect analysis showed that high levels of neuroticism moderate the effect of extraversion on Satisfaction with life and Mastery through the mediation of self-esteem. In conclusion, our results suggest that although extraversion has a cardinal role on SWB dimensions related to Vigour and Social Cheerfulness, neuroticism and the mediating role of self
Directory of Open Access Journals (Sweden)
Julian Kopp
2017-12-01
Full Text Available The Gram-negative bacterium E. coli is the host of choice for a multitude of used recombinant proteins. Generally, cultivation is easy, media are cheap, and a high product titer can be obtained. However, harsh induction procedures using isopropyl β-d-1 thiogalactopyranoside as inducer are often referred to cause stress reactions, leading to a phenomenon known as “metabolic” or “product burden”. These high expressions of recombinant proteins mainly result in decreased growth rates and cell lysis at elevated induction times. Therefore, approaches tend to use “soft” or “tunable” induction with lactose and reduce the stress level of the production host. The usage of glucose as energy source in combination with lactose as induction reagent causes catabolite repression effects on lactose uptake kinetics and as a consequence reduced product titer. Glycerol—as an alternative carbon source—is already known to have positive impact on product formation when coupled with glucose and lactose in auto-induction systems, and has been referred to show no signs of repression when cultivated with lactose concomitantly. In recent research activities, the impact of different products on the lactose uptake using glucose as carbon source was highlighted, and a mechanistic model for glucose-lactose induction systems showed correlations between specific substrate uptake rate for glucose or glycerol (qs,C and the maximum specific lactose uptake rate (qs,lac,max. In this study, we investigated the mechanistic of glycerol uptake when using the inducer lactose. We were able to show that a product-producing strain has significantly higher inducer uptake rates when being compared to a non-producer strain. Additionally, it was shown that glycerol has beneficial effects on viability of cells and on productivity of the recombinant protein compared to glucose.
Herrera, Catherine J.; Owens, Gina P.; Mallinckrodt, Brent
2013-01-01
An online survey was used to examine 45 Hispanic male veterans' traditional machismo and caballerismo as correlates of posttraumatic stress disorder (PTSD), psychological distress, and relationship satisfaction. Higher traditional machismo was associated with higher PTSD severity and distress and lower relationship satisfaction. Psychometric…
Frei, Reto; Breitbach, Anthony S; Blackwell, Helen E
2012-05-01
We report the highly efficient syntheses of a series of focused libraries in the small molecule macroarray format using Suzuki-Miyaura and copper-catalyzed azide-alkyne cycloaddition (or "click") reactions. The libraries were based on stilbene and triazole scaffolds, which are known to have a broad range of biological activities, including quorum-sensing (QS) modulation in bacteria. The library products were generated in parallel on the macroarray in extremely short reaction times (~10-20 min) and isolated in excellent purities. Biological testing of one macroarray library post-cleavage (ex situ) revealed several potent agonists of the QS receptor, LuxR, in Vibrio fischeri. These synthetic agonists, in contrast to others that we have reported, were only active in the presence of the native QS signal in V. fischeri, which is suggestive of a different mode of activity. Notably, the results presented herein showcase the ready compatibility of the macroarray platform with chemical reactions that are commonly utilized in small molecule probe and drug discovery today. As such, this work serves to expand the utility of the small molecule macroarray as a rapid and operationally straightforward approach toward the synthesis and screening of bioactive agents.
Quasi-Particle Self-Consistent GW for Molecules.
Kaplan, F; Harding, M E; Seiler, C; Weigend, F; Evers, F; van Setten, M J
2016-06-14
We present the formalism and implementation of quasi-particle self-consistent GW (qsGW) and eigenvalue only quasi-particle self-consistent GW (evGW) adapted to standard quantum chemistry packages. Our implementation is benchmarked against high-level quantum chemistry computations (coupled-cluster theory) and experimental results using a representative set of molecules. Furthermore, we compare the qsGW approach for five molecules relevant for organic photovoltaics to self-consistent GW results (scGW) and analyze the effects of the self-consistency on the ground state density by comparing calculated dipole moments to their experimental values. We show that qsGW makes a significant improvement over conventional G0W0 and that partially self-consistent flavors (in particular evGW) can be excellent alternatives.
Relationship Ambiance and Condom Use in Greek Young Adults’ Dating Relationships
Directory of Open Access Journals (Sweden)
Panos S. Kordoutis
2012-06-01
Full Text Available We examined whether ambiance, a qualitative relationship characteristic, predicted condom use in Greek young adults’ dating relationships, along with other objective relationship characteristics, such as relationship duration and coital sex frequency. Ambiance definition was based on the fundamental companionate-passionate love distinction. Participants were 277 Greek university students, 18-25 years old, having an ongoing relationship; they provided their basic demographics and information on their relationship, such as duration and coital sex frequency. They also described their relationship, in terms of passionate and companionate ambiance, using the rating scales of an 11-item ambiance measure. Finally, they indicated whether they had used or not used a condom at first, last intercourse and consistently during the last month. We hypothesized that condoms would be used more frequently at first and last intercourse, and more consistently in relationships with predominantly companionate rather that passionate ambiance. Three logistic regression analyses revealed that ambiance predicted condom use and that condoms were used more frequently at last intercourse and more consistently in relationships of companionate rather than passionate ambiance. Further analyses indicated that ambiance qualified condom use effects of relationship duration and coital sex frequency. It is suggested that companionate ambiance focuses partners on the normative aspect of the relationship, increasing protective behavior, while passionate, on the sexual and intimate, undermining it.
Maintaining close relationships: Gratitude as a motivator and a detector of maintenance behavior
Kubacka, K.E.; Finkenauer, C.; Rusbult, C.E.; Keijsers, L.
2011-01-01
This research examined the dual function of gratitude for relationship maintenance in close relationships. In a longitudinal study among married couples, the authors tested the dyadic effects of gratitude over three time points for approximately 4 years following marriage. They found that feelings
Effects of Lignosulfonate Structure on the Surface Activity and Wettability to a Hydrophobic Powder
Directory of Open Access Journals (Sweden)
Yuanyuan Ge
2014-10-01
Full Text Available The wettability of a solid material is very important in many applications, such as food, agrochemical formulations, and cosmetics. Wettability can be improved by adding surface active agents, especially biocompatible surfactants derived from biomass. In this work, the surface activity (ability to lower the surface tension of an aqueous solution and wettability toward a hydrophobic powder by a series of sodium lignosulfonates (NaLS synthesized with different degree of sulfonation (QS and weight-average molecular weights (Mw were investigated by measuring the surface tension and contact angle. The results demonstrated NaLS with a larger Mw or lower QS had higher surface activity. Conversely, the wettability of the NaLS aqueous solution toward difenoconazole powder showed a reverse trend, i.e., NaLS with a smaller Mw or higher Qs improved the wettability to difenoconazole. The surface activity and wettability was controlled by the varying densities of the NaLS molecules at the water to air interface or the solid/liquid interface, which was dependent on the molecular structure of NaLS.
International Nuclear Information System (INIS)
Agresti, David G.
2012-01-01
In the present work, we report application of simultaneous fitting procedures to Mössbauer data acquired on the Plains of Gusev Crater by the MIMOS II spectrometer on board the Mars Exploration Rover Spirit. Based on a quantitative measure of spectrum quality, the 34 best of the ∼126 spectra acquired on the Plains are grouped together for a single simultaneous fit with a common least-squares criterion. Fitted values for the quadrupole splitting (QS) of olivine (Ol) from 200 K to 260 K are shown to lie between reported trend lines for Fo50 and Fo30 olivine, with a temperature gradient of (−11.2 ± 1.2) × 10 − 4 mm/s/K, a nearly five-fold improvement in precision over the previously reported value, enabling extrapolation to QS(Ol) = (2.93 ± 0.01) mm/s at 295 K. QS of pyroxene fit as a single doublet exhibits a temperature gradient of (−7.3 ± 2.3) × 10 − 4 mm/s/K.
Directory of Open Access Journals (Sweden)
Oliver Otti
2017-12-01
Full Text Available During wounding, tissues are disrupted so that bacteria can easily enter the host and trigger a host response. Both the host response and bacterial communication can occur through quorum sensing (QS and quorum sensing inhibition (QSI. Here, we characterize the effect of wounding on the host-associated bacterial community of the bed bug. This is a model system where the male is wounding the female during every mating. Whereas several aspects of the microbial involvement during wounding have been previously examined, it is not clear to what extent QS and QSI play a role. We find that the microbiome differs depending on mating and feeding status of female bedbugs and is specific to the location of isolation. Most organs of bedbugs harbor bacteria, which are capable of both QS and QSI signaling. By focusing on the prokaryotic quorum communication system, we provide a baseline for future research in this unique system. We advocate the bedbug system as suitable for studying the effects of bacteria on reproduction and for addressing prokaryote and eukaryote communication during wounding.
Steinle, Claus; Schiele, Holger; Ernst, Tanja
2014-01-01
Purpose: A severe problem in supplier selection refers to moral hazard: suppliers not behaving in the expected way once contracted. Principal-agent theory could provide insights on how to reduce this problem. Because buyer–supplier relationships can be interpreted as principal-agent situations, the
Czech Academy of Sciences Publication Activity Database
Hofer, Michal; Pospíšil, Milan; Znojil, V.; Holá, Jiřina; Vacek, Antonín; Štreitová, Denisa
2008-01-01
Roč. 57, č. 2 (2008), s. 307-310 ISSN 0862-8408 R&D Projects: GA AV ČR(CZ) 1QS500040507 Grant - others:GA ČR(CZ) GA305/08/0158 Program:GA Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : hematopoiesis * cyclooxygenase-2 inhibition * treatment of myelosuppression Subject RIV: BO - Biophysics Impact factor: 1.653, year: 2008