WorldWideScience

Sample records for pyrrole insecticide chlorfenapyr

  1. Evaluation of the pyrrole insecticide chlorfenapyr for the control of Culex quinquefasciatus Say.

    Science.gov (United States)

    Raghavendra, K; Barik, T K; Bhatt, R M; Srivastava, H C; Sreehari, U; Dash, A P

    2011-04-01

    Culex quinquefasciatus Say (Diptera: Culicidae) is a widely distributed mosquito vector species in India and also in other tropical regions of the world. This species is implicated in the transmission of lymphatic filariasis in many countries. This species is reported to be widely resistant to insecticides of different classes in current use. In the present study, bio-efficacy of chlorfenapyr, an insecticide of pyrrole class with a novel mode of action was tested for the control of Cx. quinquefasciatus. Studies were performed to determine the diagnostic dosage; residual efficacy on different artificially fabricated substrates, namely wood, mud, mud+lime, cement and cement+distemper; to assess cross-resistance with different insecticides; and synergism/antagonism using piperonyl butoxide (PBO). A dosage of 5.0% chlorfenapyr was determined as diagnostic dosage with 2 h exposure and 48 h holding period for assessing the susceptibility of mosquitoes. The residual efficacy was observed up to 34 weeks on wood and mud+lime substrates while on other substrates, it was about 15 weeks at a dosage of 400mg a.i./m(2). Laboratory-reared strains of Cx. quinquefasciatus showed cross-resistance, whereas field-collected mosquitoes showed absence of cross-resistance to chlorfenapyr. Potentiation bioassays showed antagonistic effect of PBO to chlorfenapyr toxicity owing to the involvement of oxidases in the initial step of a conversion of pro-insecticide chlorfenapyr to toxic form CL 303268. The present study results have shown that chlorfenapyr can be a potential insecticide for the control of multiple insecticide resistant strains of Cx. quinquefasciatus. However, in countries where indoor residual spray (IRS) is not targeted for the control of this species, like in India, chlorfenapyr used in IRS for the control of malaria vectors in rural and peri-urban areas can additionally provide control of Cx. quinquefasciatus also. Copyright © 2011 Elsevier B.V. All rights reserved.

  2. Evaluation of the pyrrole insecticide chlorfenapyr against pyrethroid resistant and susceptible Anopheles funestus (Diptera: Culicidae).

    Science.gov (United States)

    Oliver, S V; Kaiser, M L; Wood, O R; Coetzee, M; Rowland, M; Brooke, B D

    2010-01-01

    To evaluate the pyrrole insecticide chlorfenapyr, which has a novel non-neurotoxic mode of action and is a promising alternative to conventional adulticides, against Anopheles funestus. The toxicity of a range of concentrations of chlorfenapyr against pyrethroid resistant and susceptible laboratory reared southern African An. funestus was assessed using standard WHO protocols and analysed using probit analysis. The pyrethroid resistant strain showed consistently higher LD50 and LD95 values compared to the susceptible strain, but these differences were not statistically significant and the magnitude was twofold at most. The LD50 values recorded for An. funestus are approximately three-fold higher than those reported elsewhere for other species of anopheline. Monooxygenase based pyrethroid resistance in An. funestus does not influence the toxic effect of chlorfenapyr. It is unlikely that such a small decrease in susceptibility of An. funestus to chlorfenapyr relative to other anophelines would have any operational implications. Chlorfenapyr is an important addition to insecticides available for malaria vector control, and could be used as a resistance management tool to either circumvent or slow the development of resistance.

  3. The activity of the pyrrole insecticide chlorfenapyr in mosquito bioassay: towards a more rational testing and screening of non-neurotoxic insecticides for malaria vector control

    OpenAIRE

    Oxborough, RM; N'Guessan, R.; Jones, R.; Kitau, J; Ngufor, C; Malone, D; Mosha, FW; Rowland, MW

    2015-01-01

    Background\\ud The rapid selection of pyrethroid resistance throughout sub-Saharan Africa is a serious threat to malaria vector control. Chlorfenapyr is a pyrrole insecticide which shows no cross resistance to insecticide classes normally used for vector control and is effective on mosquito nets under experimental hut conditions. Unlike neurotoxic insecticides, chlorfenapyr owes its toxicity to disruption of metabolic pathways in mitochondria that enable cellular respiration. A series of exper...

  4. Chlorfenapyr: a pyrrole insecticide for the control of pyrethroid or DDT resistant Anopheles gambiae (Diptera: Culicidae) mosquitoes.

    Science.gov (United States)

    N'Guessan, R; Boko, P; Odjo, A; Akogbéto, M; Yates, A; Rowland, M

    2007-04-01

    Owing to the development and spread of pyrethroid resistance in Anopheles gambiae in Africa there is an urgent need to develop alternative insecticides to supplement the pyrethroids. Chlorfenapyr is a pyrrole insecticide first commercialized for the control of agricultural pests and termites. Performance against An. gambiae bearing kdr (pyrethroid and DDT resistance) or Ace-1(R) insensitive acetylcholinesterase (organophosphate and carbamate resistance) mechanisms was studied using a variety of adult bioassay tests including a simulated-experimental hut system (tunnel tests) that allows uninhibited mosquito behaviour/insecticide interactions. Strains resistant to pyrethroids and organophosphates showed no cross resistance to chlorfenapyr. In cone bioassays on treated netting the mortality of adult mosquitoes showed an unexpected curvilinear response, with highest mortality occurring at intermediate dosages. Adults expressed irritability to chlorfenapyr at higher dosages, which might explain the dosage-mortality trend. Toxic activity of chlorfenapyr was slow compared to conventional neurotoxic insecticides and additional mortality occurred between 24h and 72 h. In tunnel tests, the dosage-mortality trend showed a more typical sigmoid response and most mortality occurred during the first 24h. Mosquito penetration through the holed, treated netting showed only limited inhibition and blood-feeding was not inhibited. Mortality rates in the kdr strain exposed to chlorfenapyr treated netting in tunnel tests were much higher than with permethrin treated netting over the same 100-500 mg/m(2) dosage range. Chlorfenapyr has potential for malaria control in treated-net or residual spraying applications in areas where mosquitoes are pyrethroid resistant. For treated-net applications chlorfenapyr might be combined with pyrethroid as a mixture to provide personal protection as well as to give control of resistant mosquitoes.

  5. The activity of the pyrrole insecticide chlorfenapyr in mosquito bioassay: towards a more rational testing and screening of non-neurotoxic insecticides for malaria vector control.

    Science.gov (United States)

    Oxborough, Richard M; N'Guessan, Raphael; Jones, Rebecca; Kitau, Jovin; Ngufor, Corine; Malone, David; Mosha, Franklin W; Rowland, Mark W

    2015-03-24

    The rapid selection of pyrethroid resistance throughout sub-Saharan Africa is a serious threat to malaria vector control. Chlorfenapyr is a pyrrole insecticide which shows no cross resistance to insecticide classes normally used for vector control and is effective on mosquito nets under experimental hut conditions. Unlike neurotoxic insecticides, chlorfenapyr owes its toxicity to disruption of metabolic pathways in mitochondria that enable cellular respiration. A series of experiments explored whether standard World Health Organization (WHO) guidelines for evaluation of long-lasting insecticidal nets, developed through testing of pyrethroid insecticides, are suitable for evaluation of non-neurotoxic insecticides. The efficacy of WHO recommended cone, cylinder and tunnel tests was compared for pyrethroids and chlorfenapyr. To establish bioassay exposure times predictive of insecticide-treated net (ITN) efficacy in experimental hut trials, standard three-minute bioassays of pyrethroid and chlorfenapyr ITNs were compared with longer exposures. Mosquito behaviour and response to chlorfenapyr ITN in bioassays conducted at night were compared to day and across a range of temperatures representative of highland and lowland transmission. Standard three-minute bioassay of chlorfenapyr produced extremely low levels of mortality compared to pyrethroids. Thirty-minute day-time bioassay produced mortality closer to hut efficacy of chlorfenapyr ITN but still fell short of the WHO threshold. Overnight tunnel test with chlorfenapyr produced 100% mortality and exceeded the WHO threshold of 80%. The endogenous circadian activity rhythm of anophelines results in inactivity by day and raised metabolism and flight activity by night. A model which explains improved toxicity of chlorfenapyr ITN when tested at night, and during the day at higher ambient temperature, is that activation of chlorfenapyr and disruption of respiratory pathways is enhanced when the insect is more metabolically

  6. Evaluation of indoor residual spraying with the pyrrole insecticide chlorfenapyr against pyrethroid-susceptible Anopheles arabiensis and pyrethroid-resistant Culex quinquefasciatus mosquitoes.

    Science.gov (United States)

    Oxborough, R M; Kitau, J; Matowo, J; Mndeme, R; Feston, E; Boko, P; Odjo, A; Metonnou, C G; Irish, S; N'guessan, R; Mosha, F W; Rowland, M W

    2010-10-01

    Chlorfenapyr is a pyrrole insecticide with a unique non-neurological mode of action. Laboratory bioassays of chlorfenapyr comparing the mortality of pyrethroid-susceptible and -resistant Anopheles gambiae s.s. and Culex quinquefasciatus mosquitoes indicated that operational cross-resistance is unlikely to occur (resistance ratio ranged between 0 and 2.1). Three trials of chlorfenapyr indoor residual spraying were undertaken in experimental huts in an area of rice irrigation in northern Tanzania that supports breeding of A. arabiensis. Daily mosquito collections were undertaken to assess product performance primarily in terms of mortality. In the second trial, 250mg/m(2) and 500mg/m(2) chlorfenapyr were tested for residual efficacy over 6 months. Both dosages killed 54% of C. quinquefasciatus, whilst for A. arabiensis 250mg/m(2) killed 48% compared with 41% for 500mg/m(2); mortality was as high at the end of the trial as at the beginning. In the third trial, 250mg/m(2) chlorfenapyr was compared with the pyrethroid alpha-cypermethrin dosed at 30mg/m(2). Chlorfenapyr performance was equivalent to the pyrethroid against A. arabiensis, with both insecticides killing 50% of mosquitoes. Chlorfenapyr killed a significantly higher proportion of pyrethroid-resistant C. quinquefasciatus (56%) compared with alpha-cypermethrin (17%). Chlorfenapyr has the potential to be an important addition to the limited arsenal of public health insecticides for indoor residual control of A. arabiensis and pyrethroid-resistant species of mosquito. Copyright © 2010 Royal Society of Tropical Medicine and Hygiene.

  7. Experimental hut evaluation of the pyrrole insecticide chlorfenapyr on bed nets for the control of Anopheles arabiensis and Culex quinquefasciatus.

    Science.gov (United States)

    Mosha, F W; Lyimo, I N; Oxborough, R M; Malima, R; Tenu, F; Matowo, J; Feston, E; Mndeme, R; Magesa, S M; Rowland, M

    2008-05-01

    To determine the efficacy of chlorfenapyr against Anopheles arabiensis and Culex quinquefasciatus in East Africa and to identify effective dosages for net treatment in comparison with the commonly used pyrethroid deltamethrin. Chlorfenapyr was evaluated on bed nets in experimental huts against A. arabiensis and C. quinquefasciatus in Northern Tanzania, at application rates of 100-500 mg/m(2). In experimental huts, mortality rates in A. arabiensis were high (46.0-63.9%) for all dosages of chlorfenapyr and were similar to that of deltamethrin-treated nets. Mortality rates in C. quinquefasciatus were higher for chlorfenapyr than for deltamethrin. Despite a reputation for being slow acting, >90% of insecticide-induced mortality in laboratory tunnel tests and experimental huts occurred within 24 h, and the speed of killing was no slower than for deltamethrin-treated nets. Chlorfenapyr induced low irritability and knockdown, which explains the relatively small reduction in blood-feeding rate. Combining chlorfenapyr with a more excito-repellent pyrethroid on bed nets for improved personal protection, control of pyrethroid-resistant mosquitoes and pyrethroid resistance management would be advantageous.

  8. Chlorfenapyr (A Pyrrole Insecticide) Applied Alone or as a Mixture with Alpha-Cypermethrin for Indoor Residual Spraying against Pyrethroid Resistant Anopheles gambiae sl: An Experimental Hut Study in Cove, Benin.

    Science.gov (United States)

    Ngufor, Corine; Critchley, Jessica; Fagbohoun, Josias; N'Guessan, Raphael; Todjinou, Damien; Rowland, Mark

    2016-01-01

    Indoor spraying of walls and ceilings with residual insecticide remains a primary method of malaria control. Insecticide resistance in malaria vectors is a growing problem. Novel insecticides for indoor residual spraying (IRS) which can improve the control of pyrethroid resistant malaria vectors are urgently needed. Insecticide mixtures have the potential to improve efficacy or even to manage resistance in some situations but this possibility remains underexplored experimentally. Chlorfenapyr is a novel pyrrole insecticide which has shown potential to improve the control of mosquitoes which are resistant to current WHO-approved insecticides. The efficacy of IRS with chlorfenapyr applied alone or as a mixture with alpha-cypermeththrin (a pyrethroid) was evaluated in experimental huts in Cove, Southern Benin against wild free flying pyrethroid resistant Anopheles gambiae sl. Comparison was made with IRS with alpha-cypermethrin alone. Fortnightly 30-minute in situ cone bioassays were performed to assess the residual efficacy of the insecticides on the treated hut walls. Survival rates of wild An gambiae from the Cove hut site in WHO resistance bioassays performed during the trial were >90% with permethrin and deltamethrin treated papers. Mortality of free-flying mosquitoes entering the experimental huts was 4% in the control hut. Mortality with alpha-cypermethrin IRS did not differ from the control (5%, P>0.656). The highest mortality was achieved with chlorfenapyr alone (63%). The alpha-cypermethrin + chlorfenapyr mixture killed fewer mosquitoes than chlorfenapyr alone (43% vs. 63%, P<0.001). While the cone bioassays showed a more rapid decline in residual mortality with chlorfenapyr IRS to <30% after only 2 weeks, fortnightly mortality rates of wild free-flying An gambiae entering the chlorfenapyr IRS huts were consistently high (50-70%) and prolonged, lasting over 4 months. IRS with chlorfenapyr shows potential to significantly improve the control of malaria

  9. Chlorfenapyr, a Potent Alternative Insecticide of Phoxim To Control Bradysia odoriphaga (Diptera: Sciaridae).

    Science.gov (United States)

    Zhao, Yunhe; Wang, Qiuhong; Wang, Yao; Zhang, Zhengqun; Wei, Yan; Liu, Feng; Zhou, Chenggang; Mu, Wei

    2017-07-26

    Bradysia odoriphaga is the major pest affecting Chinese chive production, and in China, it has developed widespread resistance to organophosphorus insecticides. Chlorfenapyr is a promising pyrrole insecticide with a unique mechanism of action that does not confer cross-resistance to neurotoxic insecticides. However, the effect of chlorfenapyr on organophosphate-resistant B. odoriphaga is not well understood. The present study evaluated the potential of chlorfenapyr for the control of phoxim-resistant B. odoriphaga. The results showed that chlorfenapyr had significant insecticidal activity to B. odoriphaga in multiple developmental stages, and there were no significant differences in susceptibility between the field (phoxim-resistant) and laboratory (phoxim-susceptible) populations. The pot experiment and field trials confirmed the results of our laboratory bioassays. In the field trial, chlorfenapyr applied at 3.0, 6.0, or 12.0 kg of active ingredient (a.i.)/ha significantly decreased the number of B. odoriphaga and improved the yield compared to phoxim at 6.0 kg of a.i./ha and the control conditions. Moreover, the final residues of chlorfenapyr on plants were below the maximum residue limits (MRLs) as a result of its non-systemic activity. These results demonstrate that chlorfenapyr has potential as a potent alternative to phoxim for controlling B. odoriphaga.

  10. Chlorfenapyr: irritant effect compared to other insecticides and its intrinsic toxicity in multiple-insecticide-susceptible and -resistant Anopheles stephensi (Diptera: Culicidae).

    Science.gov (United States)

    Verma, Vaishali; Elamathi, N; Velamuri, Poonam S; Sreehari, U; Agrawal, O P; Raghavendra, K

    2015-03-01

    For effective management of vector resistance there is a need for new insecticide molecules with novel modes of action. For desired toxic effect of an insecticide, apart from other behavioural aspects, toxicity and chemical nature of the molecule are important that may cause irritability in the mosquito to the insecticide affecting the uptake. In this study, a pyrrole class insecticide, chlorfenapyr (a late acting insecticide) was tested for its irritability against multiple-insecticide-susceptible and -resistant strains of Anopheles stephensi Liston 1901 (Diptera: Culicidae). Studies were conducted to assess the irritability due to chlorfenapyr, DDT, malathion, deltamethrin and permethrin and intrinsic toxicity of chlorfenapyr in multiple-insecticide-susceptible and -resistant laboratory strains of An. stephensi following standard WHO methods. Chlorfenapyr molecule has shown least irritant effect against susceptible and resistant strains among all the insecticides tested allowing more landing time to the vector species on the impregnated surfaces to pick-up lethal dose. Chlorfenapyr could be an ideal insecticide for management of multiple-insecticide-resistance including pyrethroids.

  11. Evaluation of efficacy of Interceptor® G2, a long-lasting insecticide net coated with a mixture of chlorfenapyr and alpha-cypermethrin, against pyrethroid resistant Anopheles gambiae s.l. in Burkina Faso

    National Research Council Canada - National Science Library

    Koama Bayili; Severin Ndo; Moussa Namountougou; Roger Sanou; Abdoulaye Ouattara; Roch K Dabire; Anicet G Ouedraogo; David Malone; Abdoulaye Diabate

    2017-01-01

    .... In the present WHOPES phase II analogue study, the utility of chlorfenapyr, a pyrrole class insecticide mixed with alpha-cypermethrin on a long-lasting mosquito bed net was evaluated against Anopheles gambiae s.l...

  12. Synthesis, insecticidal, and acaricidal activities of novel 2-aryl-pyrrole derivatives containing ester groups.

    Science.gov (United States)

    Zhao, Yu; Li, Yongqiang; Ou, Xiaoming; Zhang, Pengxiang; Huang, Zhiqiang; Bi, Fuchun; Huang, Runqiu; Wang, Qingmin

    2008-11-12

    A series of novel 2-aryl-pyrrole derivatives containing ester groups were synthesized, and their structures were characterized by (1)H NMR spectroscopy and elemental analysis. The insecticidal activities against oriental armyworm, mosquito, diamondback moth, green rice leafhopper, and bean aphids and acaricidal activities against spider mite of these new compounds were evaluated. The results of bioassays indicated that some of these title compounds exhibited excellent insecticidal and acaricidal activities. The insecticidal activities against oriental armyworm of compounds IVa, IVd, IVe, IVf, IVg, IVi, IVk, and IVp were equal to commercialized Chlorfenapyr, and the insecticidal activities of most of compounds IVb, IVc, IVd, IVf, IVg, IVj, IVk, IVl, IVs, IVt, IVu, IVw, IVx, IVz, and Chlorfenapyr against mosquito at 0.10 mg kg (-1) were 100%, and the acaricidal activities of compounds IVd, IVe, IVf, IVg, IVh, IVi, and IVk were equal or superior to Chlorfenapyr. Especially, the results indicated that the acaricidal activity of [4-bromo-2-(4-chlorophenyl)-3-cyano-5-(trifluoromethyl)pyrrol-1-yl]methyl 3-methylbutanoate ( IVg) against spider mite was 2.65-fold as high as that of Chlorfenapyr from the value of LC 50.

  13. Design, synthesis, and biological evaluation of 2-benzylpyrroles and 2-benzoylpyrroles based on structures of insecticidal chlorfenapyr and natural pyrrolomycins.

    Science.gov (United States)

    Liu, Yu-Xiu; Zhang, Peng-Xiang; Li, Yong-Qiang; Song, Hai-Bin; Wang, Qing-Min

    2014-08-01

    Based on structures of insecticidal chlorfenapyr and antibiotic natural pyrrolomycins, a series of new 2-benzylpyrroles and 2-benzoylpyrroles (with or without ethoxymethyl group on the nitrogen of pyrrole) were designed and synthesized. These compounds or their parent compounds possess weak acidity and high lipophilicity, the two characteristic properties for uncouplers of oxidative phosphorylation; therefore, they are expected to have insecticidal and acaricidal activity. The bioassay result verified that both 2-benzylpyrroles 17 and 2-benzoylpyrroles 19 had varied degrees of insecticidal activity against oriental armyworm depending on the substituents on the benzene ring, but they did not give any acaricidal activity. Conversely, most N-alkylated compounds 18 and 20 exhibited both insecticidal activity and acaricidal activity, of which compound 18i [4-bromo-2-(2,4-dichlorobenzyl)-1-(ethoxymethyl) -5-(trifluoromethyl) -1H-pyrrole-3-carbonitrile] has IC50 as low as 10-20 mg L(-1) on both activities.

  14. ITN mixtures of chlorfenapyr (Pyrrole) and alphacypermethrin (Pyrethroid) for control of pyrethroid resistant Anopheles arabiensis and Culex quinquefasciatus.

    Science.gov (United States)

    Oxborough, Richard M; Kitau, Jovin; Matowo, Johnson; Feston, Emmanuel; Mndeme, Rajab; Mosha, Franklin W; Rowland, Mark W

    2013-01-01

    Pyrethroid resistant Anopheles gambiae malaria vectors are widespread throughout sub-Saharan Africa and continued efficacy of pyrethroid ITNs is under threat. Chlorfenapyr is a promising pyrrole insecticide with a unique mechanism of action conferring no cross-resistance to existing public health insecticides. Mixtures of chlorfenapyr (CFP) and alphacypermethrin (alpha) may provide additional benefits over chlorfenapyr or alphacypermethrin used alone. An ITN mixture of CFP 100 mg/m(2)+alpha 25 mg/m(2) was compared with CFP 100 mg/m(2) and alpha 25 mg/m(2) in a small-scale experimental hut trial in an area of wild An. arabiensis. The same treatments were evaluated in tunnel tests against insectary-reared pyrethroid susceptible and resistant Culex quinquefasciatus. Performance was measured in terms of insecticide-induced mortality, and blood-feeding inhibition. Tunnel tests showed that mixtures of CFP 100+ alpha 25 were 1.2 and 1.5 times more effective at killing susceptible Cx. quinquefasciatus than either Alpha 25 (P = 0.001) or CFP 100 (P = 0.001) ITNs. Mixtures of CFP100+ alpha 25 were 2.2 and 1.2 times more effective against resistant Cx. quinquefasciatus than either alpha 25 (P = 0.001) or CFP100 (P = 0.003) ITNs. CFP 100+ alpha 25 produced higher levels of blood-feeding inhibition than CFP alone for susceptible (94 vs 46%, P = 0.001) and resistant (84 vs 53%, P = 0.001) strains. In experimental huts the mixture of CFP 100+ Alpha 25 killed 58% of An. arabiensis, compared with 50% for alpha and 49% for CFP, though the differences were not significant. Blood-feeding inhibition was highest in the mixture with a 76% reduction compared to the untreated net (P = 0.001). ITN mixtures of chlorfenapyr and alphacypermethrin should restore effective control of resistant populations of An. gambiae malaria vectors, provide protection from blood-feeding, and may have benefits for resistance management, particularly in areas with low or moderate

  15. ITN mixtures of chlorfenapyr (Pyrrole and alphacypermethrin (Pyrethroid for control of pyrethroid resistant Anopheles arabiensis and Culex quinquefasciatus.

    Directory of Open Access Journals (Sweden)

    Richard M Oxborough

    Full Text Available Pyrethroid resistant Anopheles gambiae malaria vectors are widespread throughout sub-Saharan Africa and continued efficacy of pyrethroid ITNs is under threat. Chlorfenapyr is a promising pyrrole insecticide with a unique mechanism of action conferring no cross-resistance to existing public health insecticides. Mixtures of chlorfenapyr (CFP and alphacypermethrin (alpha may provide additional benefits over chlorfenapyr or alphacypermethrin used alone. An ITN mixture of CFP 100 mg/m(2+alpha 25 mg/m(2 was compared with CFP 100 mg/m(2 and alpha 25 mg/m(2 in a small-scale experimental hut trial in an area of wild An. arabiensis. The same treatments were evaluated in tunnel tests against insectary-reared pyrethroid susceptible and resistant Culex quinquefasciatus. Performance was measured in terms of insecticide-induced mortality, and blood-feeding inhibition. Tunnel tests showed that mixtures of CFP 100+ alpha 25 were 1.2 and 1.5 times more effective at killing susceptible Cx. quinquefasciatus than either Alpha 25 (P = 0.001 or CFP 100 (P = 0.001 ITNs. Mixtures of CFP100+ alpha 25 were 2.2 and 1.2 times more effective against resistant Cx. quinquefasciatus than either alpha 25 (P = 0.001 or CFP100 (P = 0.003 ITNs. CFP 100+ alpha 25 produced higher levels of blood-feeding inhibition than CFP alone for susceptible (94 vs 46%, P = 0.001 and resistant (84 vs 53%, P = 0.001 strains. In experimental huts the mixture of CFP 100+ Alpha 25 killed 58% of An. arabiensis, compared with 50% for alpha and 49% for CFP, though the differences were not significant. Blood-feeding inhibition was highest in the mixture with a 76% reduction compared to the untreated net (P = 0.001. ITN mixtures of chlorfenapyr and alphacypermethrin should restore effective control of resistant populations of An. gambiae malaria vectors, provide protection from blood-feeding, and may have benefits for resistance management, particularly in areas with low or

  16. Chlorfenapyr: a new insecticide with novel mode of action can control pyrethroid resistant malaria vectors

    OpenAIRE

    Srivastava Harish C; Bhatt Rajendra M; Sharma Poonam; Barik Tapan K; Raghavendra Kamaraju; Sreehari Uragayala; Dash Aditya P

    2011-01-01

    Abstract Background Malaria vectors have acquired widespread resistance to many of the currently used insecticides, including synthetic pyrethroids. Hence, there is an urgent need to develop alternative insecticides for effective management of insecticide resistance in malaria vectors. In the present study, chlorfenapyr was evaluated against Anopheles culicifacies and Anopheles stephensi for its possible use in vector control. Methods Efficacy of chlorfenapyr against An. culicifacies and An. ...

  17. Chlorfenapyr (A Pyrrole Insecticide) Applied Alone or as a Mixture with Alpha-Cypermethrin for Indoor Residual Spraying against Pyrethroid Resistant Anopheles gambiae sl: An Experimental Hut Study in Cove, Benin

    OpenAIRE

    Ngufor, C; Critchley, J; Fagbohoun, J; N'Guessan, R.; Todjinou, D; Rowland, M

    2016-01-01

    Background Indoor spraying of walls and ceilings with residual insecticide remains a primary method of malaria control. Insecticide resistance in malaria vectors is a growing problem. Novel insecticides for indoor residual spraying (IRS) which can improve the control of pyrethroid resistant malaria vectors are urgently needed. Insecticide mixtures have the potential to improve efficacy or even to manage resistance in some situations but this possibility remains underexplored experimentally. C...

  18. Design, synthesis, and biological evaluation of various α-substituted benzylpyrroles based on the structures of insecticidal chlorfenapyr and natural pyrrolomycins.

    Science.gov (United States)

    Ma, Qiaoqiao; Liu, Yuxiu; Zhang, Pengxiang; Li, Yongqiang; Xiong, Lixia; Wang, Qingmin

    2014-07-02

    On the basis of the structures of chlorfenapyr and dioxapyrrolomycin, a series of 2-benzylpyrroles with a hydroxyl, an alkyloxy, an acyloxy, an alkylsulfanyl, or an oxime moiety at the α-position of benzyl were designed and synthesized. Their insecticidal, acaricidal, and fungicidal activities were extensively investigated. The structure-activity relationship showed that benzylpyrroles bearing shorter α-alkyloxy groups gave better activities against most of the insect species; the alkylation of pyrrole usually gave increased activity. Among all compounds, (4-bromo-2-(α-(2,2,2-trifluoroethoxy)-4-chlorobenzyl)-1-(ethoxymethyl)-5-(trifluoromethyl)-1H-pyrrole-3-carbonitrile) (5'j) exhibited the most outstanding insecticidal activities against oriental armyworm (IC₅₀=10 mg L⁻¹), diamondback moth (0.07 mg L⁻¹), corn borer (50 mg L⁻¹), and mosquito (0.04 mg L⁻¹), which are very close to those of chlorfenapyr (5, 0.08, <25, and <0.025 mg L⁻¹, respectively). In addition, some compounds also exhibited a broad or selective fungicidal spectrum.

  19. Chlorfenapyr: a new insecticide with novel mode of action can control pyrethroid resistant malaria vectors

    Directory of Open Access Journals (Sweden)

    Srivastava Harish C

    2011-01-01

    Full Text Available Abstract Background Malaria vectors have acquired widespread resistance to many of the currently used insecticides, including synthetic pyrethroids. Hence, there is an urgent need to develop alternative insecticides for effective management of insecticide resistance in malaria vectors. In the present study, chlorfenapyr was evaluated against Anopheles culicifacies and Anopheles stephensi for its possible use in vector control. Methods Efficacy of chlorfenapyr against An. culicifacies and An. stephensi was assessed using adult bioassay tests. In the laboratory, determination of diagnostic dose, assessment of residual activity on different substrates, cross-resistance pattern with different insecticides and potentiation studies using piperonyl butoxide were undertaken by following standard procedures. Potential cross-resistance patterns were assessed on field populations of An. culicifacies. Results A dose of 5.0% chlorfenapyr was determined as the diagnostic concentration for assessing susceptibility applying the WHO tube test method in anopheline mosquitoes with 2 h exposure and 48 h holding period. The DDT-resistant/malathion-deltamethrin-susceptible strain of An. culicifacies species C showed higher LD50 and LD99 (0.67 and 2.39% respectively values than the DDT-malathion-deltamethrin susceptible An. culicifacies species A (0.41 and 2.0% respectively and An. stephensi strains (0.43 and 2.13% respectively and there was no statistically significant difference in mortalities among the three mosquito species tested (p > 0.05. Residual activity of chlorfenapyr a.i. of 400 mg/m2 on five fabricated substrates, namely wood, mud, mud+lime, cement and cement + distemper was found to be effective up to 24 weeks against An. culicifacies and up to 34 weeks against An. stephensi. No cross-resistance to DDT, malathion, bendiocarb and deltamethrin was observed with chlorfenapyr in laboratory-reared strains of An. stephensi and field-caught An. culicifacies

  20. Chlorfenapyr: a new insecticide with novel mode of action can control pyrethroid resistant malaria vectors.

    Science.gov (United States)

    Raghavendra, Kamaraju; Barik, Tapan K; Sharma, Poonam; Bhatt, Rajendra M; Srivastava, Harish C; Sreehari, Uragayala; Dash, Aditya P

    2011-01-25

    Malaria vectors have acquired widespread resistance to many of the currently used insecticides, including synthetic pyrethroids. Hence, there is an urgent need to develop alternative insecticides for effective management of insecticide resistance in malaria vectors. In the present study, chlorfenapyr was evaluated against Anopheles culicifacies and Anopheles stephensi for its possible use in vector control. Efficacy of chlorfenapyr against An. culicifacies and An. stephensi was assessed using adult bioassay tests. In the laboratory, determination of diagnostic dose, assessment of residual activity on different substrates, cross-resistance pattern with different insecticides and potentiation studies using piperonyl butoxide were undertaken by following standard procedures. Potential cross-resistance patterns were assessed on field populations of An. culicifacies. A dose of 5.0% chlorfenapyr was determined as the diagnostic concentration for assessing susceptibility applying the WHO tube test method in anopheline mosquitoes with 2 h exposure and 48 h holding period. The DDT-resistant/malathion-deltamethrin-susceptible strain of An. culicifacies species C showed higher LD50 and LD99 (0.67 and 2.39% respectively) values than the DDT-malathion-deltamethrin susceptible An. culicifacies species A (0.41 and 2.0% respectively) and An. stephensi strains (0.43 and 2.13% respectively) and there was no statistically significant difference in mortalities among the three mosquito species tested (p > 0.05). Residual activity of chlorfenapyr a.i. of 400 mg/m2 on five fabricated substrates, namely wood, mud, mud+lime, cement and cement + distemper was found to be effective up to 24 weeks against An. culicifacies and up to 34 weeks against An. stephensi. No cross-resistance to DDT, malathion, bendiocarb and deltamethrin was observed with chlorfenapyr in laboratory-reared strains of An. stephensi and field-caught An. culicifacies. Potentiation studies demonstrated the antagonistic

  1. Degradation dynamics of chlorfenapyr residue in chili, cabbage and soil.

    Science.gov (United States)

    Ditya, Papia; Das, S P; Sarkar, P K; Bhattacharyya, Anjan

    2010-05-01

    Chlorfenapyr is a pyrrole group of insecticide, [4-bromo-2-(4-chlorophenyl)-1-ethoxymethyl-5-trifluoromethyl-1H-pyrrole-3-carbonitrile]used as broad spectrum insecticide/acaricide to control whitefly, thrips, caterpillars, mites, leafminers, aphids, etc., chlorfenapyr 10% SC formulation was applied on chili and cabbage twice @ 75 and 100 g a.i./ha along with untreated control. Chlorfenapyr was dissipated in chili, cabbage and soil following the first-order kinetics (logC/C(0) = -kt). The half lives of chlorfenapyr in chili, cabbage and soil were varying from 2.93 to 2.96 days, 2.98 to 3.62 days and 4.06 to 4.36 days respectively, according to the application rate.

  2. Evaluation of efficacy of Interceptor(®) G2, a long-lasting insecticide net coated with a mixture of chlorfenapyr and alpha-cypermethrin, against pyrethroid resistant Anopheles gambiae s.l. in Burkina Faso.

    Science.gov (United States)

    Bayili, Koama; N'do, Severin; Namountougou, Moussa; Sanou, Roger; Ouattara, Abdoulaye; Dabiré, Roch K; Ouédraogo, Anicet G; Malone, David; Diabaté, Abdoulaye

    2017-05-08

    Malaria vectors have acquired widespread resistance throughout sub-Saharan Africa to many of the currently used insecticides. Hence, there is an urgent need to develop alternative strategies including the development of new insecticides for effective management of insecticide resistance. To maintain progress against malaria, it is necessary to identify other residual insecticides for mosquito nets. In the present WHOPES phase II analogue study, the utility of chlorfenapyr, a pyrrole class insecticide mixed with alpha-cypermethrin on a long-lasting mosquito bed net was evaluated against Anopheles gambiae s.l. Bed nets treated with chlorfenapyr and alpha-cypermethrin and mixture of both compounds were tested for their efficacy on mosquitoes. Washed (20 times) and unwashed of each type of treated nets and were tested according to WHOPES guidelines. Efficacy of nets were expressed in terms of blood-feeding inhibition rate, deterrence, induced exophily and mortality rate. The evaluation was conducted in experimental huts of Vallée du Kou seven (VK7) in Burkina Faso (West Africa) following WHOPES phase II guidelines. In addition, a WHOPES phase I evaluation was also performed. Mixture treated nets killed significantly (P  0.05) different from nets treated with chlorfenapyr 200 mg/m(2) unwashed (86%). The washed and unwashed nets treated with the mixtures resulted in personal protection against An. gambiae s.l. biting 34 and 44%. In contrast the personal protection observed for washed and unwashed alpha-cypermethrin treated nets generated (14 and 24%), and chlorfenapyr solo treated net was rather low (22%). Among all nets trialled, the combination of chlorfenapyr and alpha-cypermethrin on bed nets provided better mortality in phase II after 20 washes. Results suggest that this combination could be a potential insecticide resistance management tool for preventing malaria transmission in areas compromised by the spread of pyrethroid resistance.

  3. Genetics, realized heritability and possible mechanism of chlorfenapyr resistance in Oxycarenus hyalinipennis (Lygaeidae: Hemiptera).

    Science.gov (United States)

    Ullah, Saif; Shah, Rizwan Mustafa; Shad, Sarfraz Ali

    2016-10-01

    Dusky cotton bug (DCB), Oxycarenus hyalinipennis (Lygaeidae: Hemiptera) is a serious pest of cotton and other malvaceous plants. Chlorfenapyr, a broad spectrum, N-substituted, halogenated pyrrole insecticide is used extensively to control many insect pests in cotton, including DCB. In this study, we investigated a field strain of DCB to assess its potential to develop resistance to chlorfenapyr. After six generations of continuous selection pressure with chlorfenapyr, DCB had a 7.24-fold and 149.06-fold resistance ratio (RR) at G1 and G6, respectively. The genetic basis of inheritance of chlorfenapyr resistance was also studied by crossing the chlorfenapyr selected (Chlorfenapyr-SEL) and laboratory population (Lab-PK). Results revealed an autosomal and incompletely dominant mode of inheritance for chlorfenapyr resistance in the Chlorfenapyr-SEL population of DCB. The results of the monogenic model test showed chlorfenapyr resistance was controlled by multiple genes. Estimated realized heritability for chlorfenapyr resistance in the tested DCB strain was 0.123. Synergism bioassays with piperonyl butoxide and S, S, S-butyl phosphorotrithioate revealed chlorfenapyr resistance might be due to esterase activity. These results would be useful for devising an effective resistance management strategy against DCB. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Effect of chlorfenapyr on cypermethrin-resistant Culex pipiens pallens Coq mosquitoes.

    Science.gov (United States)

    Yuan, J Z; Li, Q F; Huang, J B; Gao, J F

    2015-03-01

    Chlorfenapyr is a promising pyrrole insecticide with a unique mechanism of action that does not confer cross-resistance to neurotoxic insecticides. The effect of chlorfenapyr on pyrethorid-resistant Culex pipiens pallens Coq (Diptera: Culicidae) has not been fully investigated under laboratory conditions. In this study, cypermethrin-resistant C. p. pallens exhibited 376.79-fold and 395.40-fold increase in resistance to cypermethrin compared with susceptible strains after exposure for 24 and 48h, respectively. Larvae and adults were tested for susceptibility using dipping, topical, and impregnated paper methods as recommended by the WHO. No cross-resistance to chlorfenapyr was found. Increased mortality was apparent between 48 and 72h, indicating a slow rate of toxic activity. Synergism experiments with piperonyl butoxide (PBO) showed an antagonistic effect on chlorfenapyr toxicity. Mixtures of chlorfenapyr and cypermethrin could therefore provide additional benefits over either insecticide used alone. Mixtures of 5ng/ml chlorfenapyr and 500ng/ml cypermethrin exhibited a slight synergistic effect on cypermethrin-resistant mosquitoes (3.33, 6.84 and 2.34% after 24, 48 and 72h exposure, respectively. This activity was lost when the chlorfenapyr concentration was increased to 10 or 20ng/ml. Chlorfenapyr showed quite good results for pyrethroid-resistant C. p. pallens, and could improve public health by reducing the occurrence of mosquito bites and subsequently protecting against transmission of lymphatic filariasis and Japanese encephalitis. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Development and Validation of an HPLC Method for the Simultaneous Determination of Fipronil, Chlorfenapyr, and Pyriproxyfen in Insecticide Formulations.

    Science.gov (United States)

    Hafeez, Anum; Tawab, Iffat Abdul; Iqbal, Sajid

    2016-09-01

    In this study, the analytical method development and validation of an HPLC assay for simultaneous determination of fipronil, chlorfenapyr, and pyriproxyfen in formulation products is described. On the basis of solubility and chromatographic separation with good resolution, acetonitrile-water (80 + 20) was selected as the mobile phase in isocratic mode with a flow rate of 1 mL/min. Chromatographic separations were performed on a Beckman C18 analytical column (4.6 mm × 15 cm, 5 μm particle size; Musa Jee & Sons, Karachi, Pakistan). The retention times for fipronil, chlorfenapyr, and pyriproxyfen were 3.70, 8.61 and 10.09 min, respectively. Calibration curves of all studied insecticides were linear in the concentration range of 20 to 800 μg/mL, with R(2) > 0.997. The LODs of fipronil, chlorfenapyr, and pyriproxyfen were 15.1, 13.3, and 20.0 μg/mL, respectively, whereas the LOQs were 45.9, 40.3, and 60.6 μg/mL. Interday precision was RSD, % <2 for all formulation types, whereas intraday precision was <3. The accuracy of the proposed method was determined by interlaboratory comparison. The z-score for all formulation results were <2.The proposed method is low-cost, green, accurate, and precise and can suitably be used for the simultaneous quantitative determination of fipronil, chlorfenapyr, and pyriproxyfen in their formulations.

  6. [Case report of acute death on the 7th day due to exposure to the vapor of the insecticide chlorfenapyr].

    Science.gov (United States)

    Hoshiko, Michiko; Naito, Shinji; Koga, Mitsuaki; Mori, Mihoko; Hara, Kunio; Ishitake, Tatsuya

    2007-04-01

    We present the case of a 55-year-old male agricultural worker who complained of severe general fatigue and hyperperspiration after exposure to an insecticide vapor. He worked in a tea plantation and used chlorfenapyr, a broad spectrum for harmful insects, without any protective mask or clothes. After one day of insecticide spray work, he gradually began to complain of general fatigue, hyperperspiration, nausea and vomiting. At first, he was diagnosed as being dehydrated and was treated with fluid replacement therapy. Although he received this conservative therapy, there was no effect on the above mentioned symptoms. On the 7th day of the onset of his symptoms, his consciousness level deteriorated rapidly and body temperature exceeded 40 degrees C. No cerebral vascular disease or meningitis was observed. Finally, he died despite intensive care. The findings of the clinical course and laboratory data suggest a clinical diagnosis of acute pesticide poisoning due to exposure to chlorfenapyr vapor. We suggest that agricultural workers should use this insecticide with caution and sufficient protective gear.

  7. Efficacy of chlorfenapyr against adult Tribolium castaneum exposed on concrete: effects of exposure interval, concentration, and the presence of a food source after exposure

    Science.gov (United States)

    Chlorfenapyr, an insecticidal pyrrole, was applied to concrete arenas at concentrations of 1.1, 0.825, 0.55, and 0.275 g of active ingredient m2. Adult Tribolium castaneum (Herbst), the red flour beetle were exposed for 2, 4, or 8 hours at each concentration, then removed and held either with or w...

  8. Fate and effects of the insecticide-miticide chlorfenapyr in outdoor aquatic microcosms.

    Science.gov (United States)

    Rand, Gary M

    2004-05-01

    The concentrations of chlorfenapyr in water and sediment in a lentic pond following early and late applications in a Florida crop treatment program were predicted using PRZM and EXAMS modeling and incorporating 30 years of actual rainfall data. An outdoor microcosm study was also conducted to determine the fate of chlorfenapyr and its effects on zooplankton, macroinvertebrates, phytoplankton, and fish in a freshwater system under exposure conditions representing simulated surface runoff and/or spray drift. The microcosm design used a regression model with five treatments (i.e., 300 microg/L spray, 30 microg/L spray, 15 microg/L spray and 30 microg/L runoff, 1.2 microg/L spray and 2.5 microg/L runoff, 30 microg/L runoff) plus a control. Chlorfenapyr was applied as an aqueous suspension concentrate (36% a.i.) to six microcosm tanks (30.9 m3). The no-observed-effect-concentration (NOEC) for zooplankton was the water concentration produced from the combination 1.2 microg/L spray and 2.5 microg/L runoff treatment. The NOEC for bluegill sunfish was the water concentration produced from the 30 microg/L runoff, which was significantly higher than the exposure concentrations from the lowest combination treatment. Chlorfenapyr was more toxic via spray to the water than via an exposure simulating surface runoff. The 96-h time weighted average concentrations (TWAs) from the lowest joint treatment and the 30 microg/L runoff treatment in the microcosm study were similar to model-predicted water 96-h TWA concentrations from early and late applications. The toxicity data from laboratory and microcosm studies along with water exposure data indicate low hazard to zooplankton species in the water column. Although chlorfenapyr remained in sediment, TWAs concentrations from the microcosm study along with model-predicted concentrations indicate low hazard to benthic invertebrate species based on acute toxicity to amphipods in the laboratory. Results from this assessment indicate that

  9. Who is the real killer? Chlorfenapyr or detergent micelle-chlorfenapyr complex?

    Science.gov (United States)

    Periasamy, Srinivasan; Deng, Jou-Fang; Liu, Ming-Yie

    2017-09-01

    1. Chlorfenapyr [4-bromo-2-(4-chlorophenyl)-1-(ethoxymethl)-5-(trifluoromethyl)-1H-pyrrole-3-carbonitrile] is a commonly employed pesticide throughout the world. The mechanism of chlorfenapyr action is to uncouple oxidative phosphorylation in the mitochondria. The characteristic features of chlorfenapyr intoxication are high fever, rhabdomyolysis and neurologic symptoms that gradually get worse until death. 2. In recent years, suicide attempt cases using commercial chlorfenapyr pesticide were reported. Even small doses of commercial chlorfenapyr pesticide intoxication caused human fatality. However, world health organization (WHO) has classified chlorfenapyr as class 2-moderately hazardous chemical. Animal studies using technical grade (94.5%; AC 7504-59A) chlorfenapyr in 0.5% carboxy methyl cellulose as the vehicle, single dose through oral route in male rats were well tolerated. 3. We planned a therapeutic strategy for suicidal chlorfenapyr intoxication, therefore we evaluated the three different toxic doses of chlorfenapyr (10% chlorfenapyr and 90% detergent) through oral route in male rats for human extrapolation. The major difference between the technical grade chlorfenapyr and commercial grade chlorfenapyr was the vehicle. In the technical grade chlorfenapyr study, 0.5% carboxy methyl cellulose was used as a vehicle, whereas in the present study 90% detergent acted as a vehicle. The LD50 of commercial grade chlorfenapyr-40.63 mg/kg bw, which was approximately tenfold decrease than technical grade chlorfenapyr, LD50 - 441 mg/kg bw. 4. The combination of chlorfenapyr and detergent, a deadly cocktail to form micelle complex that can greatly influence bioavailability by attaching to biological membranes in vivo. To conclude, the enhanced bioavailability of chlorfenapyr by the detergent causes the fatality in suicidal attempts using chlorfenapyr.

  10. Mosquito nets treated with a mixture of chlorfenapyr and alphacypermethrin control pyrethroid resistant Anopheles gambiae and Culex quinquefasciatus mosquitoes in West Africa.

    Science.gov (United States)

    N'Guessan, Raphael; Ngufor, Corine; Kudom, Andreas A; Boko, Pelagie; Odjo, Abibathou; Malone, David; Rowland, Mark

    2014-01-01

    The effectiveness of insecticide treated nets is under threat across Africa south of the Sahara from the selection of pyrethroid resistance in Anopheles gambiae mosquitoes. To maintain progress against malaria it is necessary to identify alternative residual insecticides for mosquito nets. Mixtures of pyrethroid and insecticides with novel mode of action provide scope for both improved control and management of resistance through concurrent exposure to unrelated insecticides. The pyrrole chlorfenapyr and the pyrethroid alphacypermethrin were tested individually and as a mixture on mosquito nets in an experimental hut trial in southern Benin against pyrethroid resistant An gambiae and Culex quinquefasciatus mosquitoes. The nets were deliberately holed to simulate the effect of wear and tear. The nets treated with the mixture of chlorfenapyr 200 mg/m² and alphacypermethrin 25 mg/m² killed a proportion of An gambiae (77%, 95%CI: 66-86%) significantly greater than nets treated with alphacypermethrin 25 mg/m(2) (30%, 95%CI: 21-41%) but not significantly different from nets treated with chlorfenapyr 200 mg/m² (69%, 95%CI: 57-78%). The nets treated with the mixtures procured personal protection against An gambiae biting(58-62%) by a greater margin than the alphacypermethrin treated net (39%), whereas the chlorfenapyr treated net was not protective. A similar trend in mortality and blood feeding inhibition between treatments was observed in Cx quinquefasciatus to that seen in An. gambiae, although the effects were lower. A mixture of alphacypermethrin with chlorfenapyr applied at 100 mg/m² had an effect similar to the mixture with chlorfenapyr at 200 mg/m². The effectiveness of ITNs against pyrethroid resistant mosquitoes was restored by the mixture: the alphacypermethrin component reduced human-vector contact while the chlorfenapyr controlled pyrethroid-resistant mosquitoes. The complementary action of these unrelated insecticides demonstrates that the combination on

  11. Combining indoor residual spraying with chlorfenapyr and long-lasting insecticidal bed nets for improved control of pyrethroid-resistant Anopheles gambiae: an experimental hut trial in Benin

    Directory of Open Access Journals (Sweden)

    Ngufor Corine

    2011-11-01

    Full Text Available Abstract Background Neither indoor residual spraying (IRS nor long-lasting insecticidal nets (LLINs are able to fully interrupt transmission in holoendemic Africa as single interventions. The combining of IRS and LLINs presents an opportunity for improved control and management of pyrethroid resistance through the simultaneous presentation of unrelated insecticides. Method Chlorfenapyr IRS and a pyrethroid-impregnated polyester LLIN (WHO approved were tested separately and together in experimental huts in southern Benin against pyrethroid resistant Anopheles gambiae and Culex quinquefasciatus. The bed nets were deliberately holed with either six or 80 holes to examine the effect of increasing wear and tear on protectiveness. Anopheles gambiae were genotyped for the kdr gene to assess the combination's potential to prevent the selection of pyrethroid resistance. Results The frequency of kdr was 84%. The overall mortality rates of An. gambiae were 37% and 49% with the six-hole and 80-hole LLINs, respectively, and reached 57% with chlorfenapyr IRS. Overall mortality rates were significantly higher with the combination treatments (82-83% than with the LLIN or IRS individual treatments. Blood feeding (mosquito biting rates were lowest with the 6-hole LLIN (12%, intermediate with the 80-hole LLIN (32% and highest with untreated nets (56% with the 6-hole and 54% with the 80-hole nets. Blood feeding (biting rates and repellency of mosquitoes with the combination of LLIN and chlorfenapyr IRS showed significant improvement compared to the IRS treatment but did not differ from the LLIN treatments indicating that the LLINs were the primary agents of personal protection. The combination killed significantly higher proportions of Cx. quinquefasciatus (51%, 41% than the LLIN (15%, 13% or IRS (32% treatments. Conclusion The chlorfenapyr IRS component was largely responsible for controlling pyrethroid-resistant mosquitoes and the LLIN component was largely

  12. Combining indoor residual spraying with chlorfenapyr and long-lasting insecticidal bed nets for improved control of pyrethroid-resistant Anopheles gambiae: an experimental hut trial in Benin.

    Science.gov (United States)

    Ngufor, Corine; N'Guessan, Raphael; Boko, Pelagie; Odjo, Abibatou; Vigninou, Estelle; Asidi, Alex; Akogbeto, Martin; Rowland, Mark

    2011-11-16

    Neither indoor residual spraying (IRS) nor long-lasting insecticidal nets (LLINs) are able to fully interrupt transmission in holoendemic Africa as single interventions. The combining of IRS and LLINs presents an opportunity for improved control and management of pyrethroid resistance through the simultaneous presentation of unrelated insecticides. Chlorfenapyr IRS and a pyrethroid-impregnated polyester LLIN (WHO approved) were tested separately and together in experimental huts in southern Benin against pyrethroid resistant Anopheles gambiae and Culex quinquefasciatus. The bed nets were deliberately holed with either six or 80 holes to examine the effect of increasing wear and tear on protectiveness. Anopheles gambiae were genotyped for the kdr gene to assess the combination's potential to prevent the selection of pyrethroid resistance. The frequency of kdr was 84%. The overall mortality rates of An. gambiae were 37% and 49% with the six-hole and 80-hole LLINs, respectively, and reached 57% with chlorfenapyr IRS. Overall mortality rates were significantly higher with the combination treatments (82-83%) than with the LLIN or IRS individual treatments. Blood feeding (mosquito biting) rates were lowest with the 6-hole LLIN (12%), intermediate with the 80-hole LLIN (32%) and highest with untreated nets (56% with the 6-hole and 54% with the 80-hole nets). Blood feeding (biting) rates and repellency of mosquitoes with the combination of LLIN and chlorfenapyr IRS showed significant improvement compared to the IRS treatment but did not differ from the LLIN treatments indicating that the LLINs were the primary agents of personal protection. The combination killed significantly higher proportions of Cx. quinquefasciatus (51%, 41%) than the LLIN (15%, 13%) or IRS (32%) treatments. The chlorfenapyr IRS component was largely responsible for controlling pyrethroid-resistant mosquitoes and the LLIN component was largely responsible for blood feeding inhibition and personal

  13. Mosquito Nets Treated with a Mixture of Chlorfenapyr and Alphacypermethrin Control Pyrethroid Resistant Anopheles gambiae and Culex quinquefasciatus Mosquitoes in West Africa: e87710

    National Research Council Canada - National Science Library

    Corine Ngufor; Andreas A Kudom; Pelagie Boko; Abibathou Odjo; David Malone; Mark Rowland

    2014-01-01

    .... Methods The pyrrole chlorfenapyr and the pyrethroid alphacypermethrin were tested individually and as a mixture on mosquito nets in an experimental hut trial in southern Benin against pyrethroid...

  14. A case of survival after chlorfenapyr intoxication with acute pancreatitis

    OpenAIRE

    Ku, Jae Eun; Joo, Young Seon; You, Je Sung; Chung, Sung Phil; Lee, Hahn Shick

    2015-01-01

    Chlorfenapyr is a moderately hazardous insecticide. There have been previous reports of chlorfenapyr intoxication, but none have reported patient survival or an association with pancreatitis. A 61-year-old woman was brought to the emergency department with vomiting after ingesting 10 mL chlorfenapyr in a suicide attempt 1 hour before. The patient was treated with gastric lavage and activated charcoal, then transferred to the intensive care unit. Initial laboratory data were unremarkable excep...

  15. A Chlorfenapyr Mixture Net Interceptor® G2 Shows High Efficacy and Wash Durability against Resistant Mosquitoes in West Africa.

    Science.gov (United States)

    N'Guessan, Raphael; Odjo, Abibatou; Ngufor, Corine; Malone, David; Rowland, Mark

    2016-01-01

    Malaria control through use of long-lasting insecticidal nets (LN) is threatened by the selection of anopheline mosquitoes strongly resistant to pyrethroid insecticides. To sustain future effectiveness it is essential to identify and evaluate novel insecticides suitable for nets. Mixtures of two insecticides with contrasting mode of action have the potential to kill resistant vectors and restore transmission control provided the formulation can withstand regular washing over the net's life span. The efficacy of a novel mixture LN, Interceptor® G2, that combines the pyrrole chlorfenapyr and pyrethroid alpha-cypermethrin was evaluated under controlled household conditions (experimental hut trial) and by laboratory bioassay against pyrethroid resistant An. gambiae in Benin before and after standardized washing. Comparison arms included standard alpha-cypermethrin LN, nets hand-treated with chlorfenapyr-only and untreated nets. The chlorfenapyr-alphacypermethrin LN demonstrated improved efficacy and wash resistance compared to a standard alpha-cypermethrin LN against pyrethroid resistant mosquitoes (resistance ratio 207). In experimental hut trial alpha-cypermethrin LN killed only 20% (95% CI 15-26%) of host-seeking An. gambiae whilst mixture LN killed 71% (95% CI 65-77%). Mixture LN washed 20 times killed 65% (95% CI 58-71%), and thus intensive washing reduced efficacy by only 6% (95% CI 1.3-11%). The chlorfenapyr net killed 76% (95% CI 70-81%). Personal protection and blood feeding inhibition did not differ between mixture and pyrethroid LN; however, the mixture LN was 2.5 (95% CI: 2.1-3.1) times more protective than untreated nets. Standard WHO cone bioassays conducted during day time hours failed to anticipate field efficacy but overnight tunnel tests successfully predicted mixture LN and chlorfenapyr net efficacy in field trials. Interceptor® G2 LN demonstrates the potential to control transmission and provide community protection over the normal lifespan of

  16. Mosquito nets treated with a mixture of chlorfenapyr and alphacypermethrin control pyrethroid resistant Anopheles gambiae and Culex quinquefasciatus mosquitoes in West Africa.

    Directory of Open Access Journals (Sweden)

    Raphael N'Guessan

    Full Text Available BACKGROUND: The effectiveness of insecticide treated nets is under threat across Africa south of the Sahara from the selection of pyrethroid resistance in Anopheles gambiae mosquitoes. To maintain progress against malaria it is necessary to identify alternative residual insecticides for mosquito nets. Mixtures of pyrethroid and insecticides with novel mode of action provide scope for both improved control and management of resistance through concurrent exposure to unrelated insecticides. METHODS: The pyrrole chlorfenapyr and the pyrethroid alphacypermethrin were tested individually and as a mixture on mosquito nets in an experimental hut trial in southern Benin against pyrethroid resistant An gambiae and Culex quinquefasciatus mosquitoes. The nets were deliberately holed to simulate the effect of wear and tear. RESULTS: The nets treated with the mixture of chlorfenapyr 200 mg/m² and alphacypermethrin 25 mg/m² killed a proportion of An gambiae (77%, 95%CI: 66-86% significantly greater than nets treated with alphacypermethrin 25 mg/m(2 (30%, 95%CI: 21-41% but not significantly different from nets treated with chlorfenapyr 200 mg/m² (69%, 95%CI: 57-78%. The nets treated with the mixtures procured personal protection against An gambiae biting(58-62% by a greater margin than the alphacypermethrin treated net (39%, whereas the chlorfenapyr treated net was not protective. A similar trend in mortality and blood feeding inhibition between treatments was observed in Cx quinquefasciatus to that seen in An. gambiae, although the effects were lower. A mixture of alphacypermethrin with chlorfenapyr applied at 100 mg/m² had an effect similar to the mixture with chlorfenapyr at 200 mg/m². CONCLUSION: The effectiveness of ITNs against pyrethroid resistant mosquitoes was restored by the mixture: the alphacypermethrin component reduced human-vector contact while the chlorfenapyr controlled pyrethroid-resistant mosquitoes. The complementary action of these

  17. Combining indoor residual spraying with chlorfenapyr and long-lasting insecticidal bed nets for improved control of pyrethroid-resistant Anopheles gambiae: an experimental hut trial in Benin

    National Research Council Canada - National Science Library

    Ngufor, Corine; N'Guessan, Raphael; Boko, Pelagie; Odjo, Abibatou; Vigninou, Estelle; Asidi, Alex; Akogbeto, Martin; Rowland, Mark

    2011-01-01

    .... Chlorfenapyr IRS and a pyrethroid-impregnated polyester LLIN (WHO approved) were tested separately and together in experimental huts in southern Benin against pyrethroid resistant Anopheles gambiae and Culex quinquefasciatus...

  18. A case of survival after chlorfenapyr intoxication with acute pancreatitis.

    Science.gov (United States)

    Ku, Jae Eun; Joo, Young Seon; You, Je Sung; Chung, Sung Phil; Lee, Hahn Shick

    2015-03-01

    Chlorfenapyr is a moderately hazardous insecticide. There have been previous reports of chlorfenapyr intoxication, but none have reported patient survival or an association with pancreatitis. A 61-year-old woman was brought to the emergency department with vomiting after ingesting 10 mL chlorfenapyr in a suicide attempt 1 hour before. The patient was treated with gastric lavage and activated charcoal, then transferred to the intensive care unit. Initial laboratory data were unremarkable except for elevated amylase/lipase levels (134/222 U/L), which were even higher 7 days later and remained elevated for 2 weeks. Abdominal computed tomography showed diffuse pancreatic swelling. The patient improved with conservative care and was discharged to home 19 days after admission. This is the first reported case of survival after chlorfenapyr intoxication. We recommend early aggressive management in the emergency department and close monitoring in the intensive care unit to detect and treat potentially fatal deterioration after chlorfenapyr intoxication.

  19. Monitoring Chlorfenapyr in Green Tea during the Manufacturing Process

    Science.gov (United States)

    Takahashi, Atsushi; Kishi, Yasuhiro; Ogawa, Hideyuki; Nakajima, Kenta

    In order to clarify the change in the leaves of agricultural chemicals during the green tea manufacturing process, we analyzed chlorfenapyr in tea leaves obtained at each processing stage by using an immunoassay. Chlorfenapyr is a novel broad-spectrum insecticide-miticide registered in many countries for the control of various insects and mite pests. Chlorfenapyr is stable and persistent in the environment. Furthermore, it is widely applied for tea cultivation in Japan. Therefore, we selected chlorfenapyr for analysis in this study. In the unrefined tea (Aracha) manufacturing process, the highest level of chlorfenapyr was 16.5 ppm, which was obtained in tea powder separated from leaves at the secondary drying stage. However, the level at the other processing stages in tea leaves was approximately 9 ppm, and no significant difference in the chlorfenapyr level was detected between the processing stages. After Aracha processing, tea leaves are classified on the basis of their size, shape and color; this is the refined tea (Shiagecha) manufacturing process. After this process, although a high level of chlorfenapyr was detected in bud tea (8.1 ppm) and honcha (on-grade tea; 6.2 ppm), the level in the other classified teas was approximately 4.0 ppm. Thus, this paper shows the difference in the chlorfenapyr level in tea leaves obtained at each processing stage. This indicated that there are significant differences in the agricultural chemical levels between the green tea processing stages.

  20. Which intervention is better for malaria vector control: insecticide mixture long-lasting insecticidal nets or standard pyrethroid nets combined with indoor residual spraying?

    Science.gov (United States)

    Ngufor, Corine; Fagbohoun, Josias; Critchley, Jessica; N'Guessan, Raphael; Todjinou, Damien; Malone, David; Akogbeto, Martin; Rowland, Mark

    2017-08-16

    Malaria control today is threatened by widespread insecticide resistance in vector populations. The World Health Organization (WHO) recommends the use of a mixture of unrelated insecticides for indoor residual spraying (IRS) and long-lasting insecticidal nets (LNs) or as a combination of interventions for improved vector control and insecticide resistance management. Studies investigating the efficacy of these different strategies are necessary. The efficacy of Interceptor(®) G2 LN, a newly developed LN treated with a mixture of chlorfenapyr (a pyrrole) and alpha-cypermethrin (a pyrethroid), was compared to a combined chlorfenapyr IRS and Interceptor(®) LN (a standard alpha-cypermethrin LN) intervention in experimental huts in Cove Southern Benin, against wild, free-flying, pyrethroid-resistant Anopheles gambiae s.l. A direct comparison was also made with a pyrethroid-only net (Interceptor(®) LN) alone and chorfenapyr IRS alone. WHO resistance bioassays performed during the trial demonstrated a pyrethroid resistance frequency of >90% in the wild An. gambiae s.l. from the Cove hut site. Mortality in the control (untreated net) hut was 5%. Mortality with Interceptor(®) LN (24%) was lower than with chlorfenapyr IRS alone (59%, P chlorfenapyr IRS intervention and the mixture net (Interceptor(®) G2 LN) provided significantly higher mortality rates (73 and 76%, respectively) and these did not differ significantly between both treatments (P = 0.15). Interceptor LN induced 46% blood-feeding inhibition compared to the control untreated net, while chlorfenapyr IRS alone provided none. Both mixture/combination strategies also induced substantial levels of blood-feeding inhibition (38% with combined interventions and 30% with Interceptor(®) G2 LN). A similar trend of improved mortality of pyrethroid-resistant An. gambiae s.l. from Cove was observed with Interceptor(®) G2 LN (79%) compared to Interceptor LN (42%, P chlorfenapyr and alpha-cypermethrin together as a

  1. Chlorfenapyr and mallard ducks: overview, study design, macroscopic effects, and analytical chemistry.

    Science.gov (United States)

    Albers, Peter H; Klein, Patrice N; Green, David E; Melancon, Mark J; Bradley, Brian P; Noguchi, George

    2006-02-01

    The first commercial pesticide derived from a class of compounds known as halogenated pyrroles was registered for use in the United States in 2001. Chlorfenapyr degrades slowly in soil, sediment, and water and is highly toxic to birds. Information on biochemical or histological endpoints in birds is lacking; therefore, a two-year study was conducted to provide information needed to develop diagnostic criteria for chlorfenapyr toxicosis. In the first year, male mallard ducks were fed concentrations of 0, 2, 5, or 10 ppm technical chlorfenapyr or 5 ppm of a formulated product in their diet during a 10-week chronic exposure study. Survival, body weight, feed consumption (removal), behavior, and molt progression were monitored. Feed and liver were analyzed for chlorfenapyr and two metabolites. Five of 10 ducks in the 10-ppm group died, and neurotoxic effects were observed in the 5- and 10-ppm groups. Feed removal increased for ducks receiving chlorfenapyr and body weights of 5- and 10-ppm ducks were reduced. Loss of body fat, muscle atrophy, and bile retention were suggestive of metabolic disruption or a decreased ability to digest and absorb nutrients. Liver and kidney weights and liver and kidney weight/body weight ratios exhibited a positive response to concentrations of chlorfenapyr in the diet. Emaciation and elevated organ weight/body weight ratios are candidates for a suite of indicators of chronic chlorfenapyr exposure. Liver is the preferred tissue for chemical confirmation of exposure.

  2. Chlorfenapyr and mallard ducks: overview, study design, macroscopic effects, and analytical chemistry

    Science.gov (United States)

    Albers, P.H.; Klein, P.N.; Green, D.E.; Melancon, M.J.; Bradley, B.P.; Noguchi, G.

    2006-01-01

    The first commercial pesticide derived from a class of compounds known as halogenated pyrroles was registered for use in the United States in 2001. Chlorfenapyr degrades slowly in soil, sediment, and water and is highly toxic to birds. Information on biochemical or histological endpoints in birds is lacking; therefore, a two-year study was conducted to provide information needed to develop diagnostic criteria for chlorfenapyr toxicosis. In the first year, male mallard ducks were fed concentrations of 0, 2, 5, or 10 ppm technical chlorfenapyr or 5 ppm of a formulated product in their diet during a 10-week chronic exposure study. Survival, body weight, feed consumption (removal), behavior, and molt progression were monitored. Feed and liver were analyzed for chlorfenapyr and two metabolites. Five of 10 ducks in the 10-ppm group died, and neurotoxic effects were observed in the 5- and 10-ppm groups. Feed removal increased for ducks receiving chlorfenapyr and body weights of 5- and 10-ppm ducks were reduced. Loss of body fat, muscle atrophy, and bile retention were suggestive of metabolic disruption or a decreased ability to digest and absorb nutrients. Liver and kidney weights and liver and kidney weight/body weight ratios exhibited a positive response to concentrations of chlorfenapyr in the diet. Emaciation and elevated organ weight/body weight ratios are candidates for a suite of indicators of chronic chlorfenapyr exposure. Liver is the preferred tissue for chemical confirmation of exposure.

  3. Insecticide resistance in bedbugs in Thailand and laboratory evaluation of insecticides for the control of Cimex hemipterus and Cimex lectularius (Hemiptera: Cimicidae).

    Science.gov (United States)

    Tawatsin, Apiwat; Thavara, Usavadee; Chompoosri, Jakkrawarn; Phusup, Yutthana; Jonjang, Nisarat; Khumsawads, Chayada; Bhakdeenuan, Payu; Sawanpanyalert, Pathom; Asavadachanukorn, Preecha; Mulla, Mir S; Siriyasatien, Padet; Debboun, Mustapha

    2011-09-01

    Bedbugs are found in many countries around the world, and in some regions they are resistant to numerous insecticides. This study surveyed bedbugs in Thailand and determined their resistance to insecticides. The surveys were carried out in six provinces that attract large numbers of foreign tourists: Bangkok, Chonburi, Chiang Mai, Ubon Ratchathani, Phuket, and Krabi. Bedbugs were collected from hotels and colonized in the laboratory to evaluate their resistance to insecticides. Cimex hemipterus (F.) was found in some hotels in Bangkok, Chonburi, Phuket, and Krabi, whereas Cimex lectularius L. was found only in hotels in Chiang Mai. No bedbugs were found in Ubon Ratchathani. The colonized bedbugs showed resistance to groups of insecticides, including organochlorines (dichlorodiphenyl trichloroethane, dieldrin), carbamates (bendiocarb, propoxur), organophosphates (malathion, fenitrothion), and pyrethroids (cyfluthrin, deltamethrin, permethrin, lambda-cyhalothrin, etofenprox) in tests using World Health Organization insecticide-impregnated papers. The new insecticides imidacloprid (neonicotinoid group), chlorfenapyr (pyrrole group), and fipronil (phenylpyrazole group) were effective against the bedbugs; however, organophosphate (diazinon), carbamates (fenobucarb, propoxur), and pyrethroids (bifenthrin, cypermethrin, esfenvalerate, etofenprox) were ineffective. Aerosols containing various pyrethroid insecticides with two to four different active ingredients were effective against the bedbugs. The results obtained from this study suggested that both species of bedbugs in Thailand have developed marked resistance to various groups of insecticides, especially those in the pyrethroid group, which are the most common insecticides used for pest control. Therefore, an integrated pest management should be implemented for managing bedbugs in Thailand.

  4. Activity of bifenthrin, chlorfenapyr, fipronil, and thiamethoxam against Argentine ants (Hymenoptera: Formicidae).

    Science.gov (United States)

    Wiltz, B A; Suiter, D R; Gardner, W A

    2009-12-01

    Bifenthrin, chlorfenapyr, fipronil, and thiamethoxam were evaluated for activity against the Argentine ant, Linepithema humile (Mayr) (Hymenoptera: Formicidae). Mobility impairment and lethal times were determined after topical treatments. Ants were immobilized most quickly by bifenthrin, followed by chlorfenapyr and thiamethoxam. After 2 h, the number of fipronil-treated ants unable to walk out of test arenas did not differ from control ants. Median lethal time (LT50) after topical treatment was lowest in the bifenthrin treatment, followed by thiamethoxam, chlorfenapyr, and then fipronil. Mortality due to horizontal exposure was evaluated at 10, 20, or 30 degrees C, with topically treated ant corpses serving as donors. There was low to moderate horizontal activity in bifenthrin and chlorfenapyr treatments, with no temperature effect in bifenthrin treatments and a positive temperature effect in chlorfenapyr treatments. Mortality in the fipronil treatments was highest and was positively correlated with temperature. Thiamethoxam treatments did not differ from controls at 10 degrees C, but mortality increased with temperature. To evaluate contact activity, either all of 20% of the ants in a cohort were exposed to insecticide-treated pine needles. In both tests, mortality was highest in fipronil and bifenthrin treatments, followed by thiamethoxam, with lowest mortality in chlorfenapyr treatments. Effectiveness as a barrier was evaluated by providing a choice between bridges treated with insecticide or water. Although bifenthrin did not provide an impenetrable barrier, it was the only treatment having fewer ants than its paired control. Mortality data suggest that lack of recruitment rather than repellency account for this result.

  5. Efficacy of chlorfenapyr against adult Tribofium castaneum exposed on concrete: effects of exposure interval, concentration and the presence of a food source after exposure

    Institute of Scientific and Technical Information of China (English)

    Frank H. Arthur

    2009-01-01

    Chlorfenapyr, an insecticidal pyrrole, was applied to concrete arenas at concentrations of 1.1, 0.825, 0.55, and 0.275 g of active ingredient [AI]/m2. Adult Tribolium castaneum (Herbst), the red flour beetle, were exposed for 2, 4, or 8 h at each concentration, then removed and held either with or without food (wheat flour) for 7 days. Survival was assessed when the beetles were removed from the exposure arenas and daily during the post-exposure period. In the presence of food, survival was high regardless of concentration and the day on which post-treatment survival was assessed, but survival did decrease as the exposure period increased from 4 to 8 h. When the beetles were not given food after exposure, survival at each concentration and exposure period declined during the 1-week post-exposure assessments. This pattern of decrease could be described by linear and non-linear equations. Results show the presence of food material greatly compromised effectiveness of the insecticide, and emphasize the importance of cleaning and sanitation in conjunction with insecticide treatments.

  6. Toxicity, repellency, and transfer of chlorfenapyr against western subterranean termites (Isoptera: Rhinotermitidae).

    Science.gov (United States)

    Rust, Michael K; Saran, Raj K

    2006-06-01

    Chlorfenapyr is a slow-acting insecticide against western subterranean termite, Reticulitermes hesperus Banks, when applied to sand. The LD50 at day 7 for workers is 29.98 ng per termite and considerably higher than that of chlorpyrifos (14.01), cypermethrin (3.21), and fipronil (0.16). Brief exposures to sand treated with chlorfenapyr resulted in dose-dependent mortality over a broad range of concentrations. Brief 1-h exposures to > or =75 ppm provided >88% kill of termites at day 7. Chlorfenapyr deposits did not repel termites, even at 300 ppm. Termites tunneled from 0.1 to 1.8 cm into sand treated with 10- to 300-ppm chlorfenapyr deposits, resulting in > or =70% mortality. Within 1 h after being exposed to 50 ppm chlorfenapyr, approximately 17% of the termites exhibited impaired responses to synthetic trail pheromone. By 4 h, nearly 60% of the workers were not able to follow a 10 fg/cm pheromone trail. There was a direct linear relationship of the uptake of [14C]chlorfenapyr as concentration and duration of exposure increased. The percentage of chlorfenapyr transferred to recipients varied from 13.3 to 38.4%. Donors exposed for 1 h transferred a greater percentage of chlorfenapyr than did donors exposed for 4 h. A 1-h exposure on 100-ppm deposits provided sufficient uptake to kill 100% of the donors and sufficient transfer to kill 96% of the recipients. There was not enough transfer for recipients to serve as secondary donors and kill other termites. Horizontal transfer is limited to contact with the original donor and by the decreased mobility of workers within 4-8 h after exposure to treated sand. The effectiveness of chlorfenapyr barrier treatments is primarily due to its nonrepellency and delayed toxicity.

  7. Detection of Reduced Susceptibility to Chlorfenapyr- and Bifenthrin-Containing Products in Field Populations of the Bed Bug (Hemiptera: Cimicidae).

    Science.gov (United States)

    Ashbrook, Aaron R; Scharf, Michael E; Bennett, Gary W; Gondhalekar, Ameya D

    2017-06-01

    Insecticide resistance is a major impediment for effective control of Cimex lectularius L. Previous resistance detection studies with bed bugs have focused on certain pyrethroid, neonicotinoid, organochlorine, organophosphate, and carbamate insecticides. Within the pyrethroid class, resistance studies have mostly been limited to deltamethrin, lambda-cyhalothrin, and alpha- and beta-cyfluthrin. The goal of this study was to develop diagnostic concentration bioassays for assessing bed bug susceptibility levels to chlorfenapyr- and bifenthrin-containing products. First, glass vial and filter paper bioassay methods were compared for their utility in susceptibility monitoring. Statistical comparison of toxicity data between bioassays indicated that the vial assay was less confounded by assay susbtrate effects, required less insecticide, and was faster, especially for chlorfenapyr. Next, using vial diagnostic concentrations (LC99) for each insecticide, 10 laboratory-adapted field strains and the Harlan lab-susceptible strain were screened for susceptibility to chlorfenapyr and bifenthrin. The results of this study reveal recent bed bug susceptibility levels to certain chlorfenapyr- and bifenthrin-containing products. Reduced susceptibility was detected in three and five field strains to chlorfenapyr and bifenthrin, respectively. Detection of reduced susceptibility suggests that certain strains may be segregating toward greater chlorfenapyr and bifenthrin resistance. These results merit continuous resistance monitoring efforts to detect chlorfenapyr and bifenthrin susceptibility shifts. Additionally, to reduce insecticide selection pressures and delay resistance development, adoption of integrated bed bug control strategies that combine chemical and nonchemical methods is recommended. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  8. Evaluation of chlorfenapyr for control of the bed bug, Cimex lectularius L.

    Science.gov (United States)

    Romero, Alvaro; Potter, Michael F; Haynes, Kenneth F

    2010-11-01

    The presence of bed bug populations resistant to pyrethroids demands the development of new control tactics, including the use of insecticides with new modes of action. Insecticides that disrupt oxidative phosphorylation in insect mitochondria can be an option. Laboratory assays were used to measure the toxicity of chlorfenapyr to susceptible strains and two strains highly resistant to pyrethroids. The effectiveness of two chlorfenapyr-based formulations was compared, and behavioral responses of bed bugs to dry residues of aerosol sprays were evaluated. Chlorfenapyr was effective against all bed bug strains, killing them at a similar rate, regardless of their susceptibility status to pyrethroids. Dry residues aged for 4 months were as toxic as fresh dry residues. The aerosol formulation had contact activity and caused faster mortality than a water-based formulation. Bed bugs did not avoid resting on surfaces treated with aerosol. Chlorfenapyr is an option for controlling pyrethroid-resistant bed bugs. While it does not cause quick knockdown, its long residual activity and no avoidance behavior of bed bugs to dry residues appear to make this insecticide suitable for bed bug control. A faster insecticidal effect is obtained with the aerosol formulation, suggesting greater bioavailability of the toxicant. Copyright © 2010 Society of Chemical Industry.

  9. Linear alcohol ethoxylates: insecticidal and synergistic effects on German cockroaches (Blattodea: Blattellidae) and other insects.

    Science.gov (United States)

    Sims, Steven R; Appel, Arthur G

    2007-06-01

    Sixteen linear ethoxylated alcohol surfactants (AEOs) were studied to determine their contact insecticidal activity to adult German cockroaches, Blattella germanica (L.) (Blattodea: Blattellidae). Within groups of AEOs of equal carbon chain length, insecticidal activity, measured as LT50 values (in minutes) and 24-h mortality after treatment, was inversely related to the amount of ethoxylation. There was a highly significant negative relationship between the hydrophile-lipophile balance (HLB) value of the AEO and contact toxicity. The AEO with the lowest HLB value, Tomadol 23-1 (HLB = 3.7), produced the greatest 24-h cockroach mortality. The contact activity of Tomadol 23-1 was evaluated against a wide range of other insect species. Most species were killed within 24 h by direct exposure (1-4 microl of a 50% ethanol solution) to Tomadol 23-1 or by spray exposure to an aqueous solution. Tomadol 23-1, at a sublethal concentration, was tested in combination with representative members of the carbamate, nicotinoid, organophosphate, pyrethrum, pyrethroid, and pyrrole insecticide classes. Significant synergism was demonstrated in combinations of Tomadol 23-1 and chlorfenapyr, clothianidin, imidacloprid, thiamethoxam, and pyrethrum. Tomadol 23-1 significantly reduced the insecticidal activity of propoxur, suggesting antagonism. The insecticidal activity of Tomadol 23-1 was synergized by coapplication with a sublethal amount of piperonyl butoxide, indicating the involvement of cytochrome P450 microsomal monooxygenases in insect metabolism of AEO surfactants.

  10. Activity of bifenthrin, chlorfenapyr, fipronil, and thiamethoxam against red imported fire ants (Hymenoptera: Formicidae).

    Science.gov (United States)

    Wiltz, B A; Suiter, D R; Gardner, W A

    2010-06-01

    Bifenthrin, chlorfenapyr, fipronil, and thiamethoxam were evaluated for activity against the red imported fire ant, Solenopsis invicta Buren (Hymenoptera: Formicidae). Mobility impairment and lethal times were determined after topical treatments. Both immobilization and mortality occurred most quickly with bifenthrin, followed by thiamethoxam, chlorfenapyr, and fipronil. Mortality due to horizontal exposure was evaluated at 10, 20, or 30 degrees C, with three ratios of topically treated donor ant corpses to live recipients (5, 10, or 20% donors). Bifenthrin had the greatest horizontal activity of the chemicals tested. For chlorfenapyr, the only treatments having higher mortality than controls were the highest percentage donors at either 10 or 30 degrees C. Horizontal activity of fipronil was temperature dependent only with the highest proportion of donors and was lower than that ofbifenthrin but higher than that of chlorfenapyr or thiamethoxam. Mean mortality due to thiamethoxam was similar to that with chlorfenapyr. Significant mortality occurred in all of the 20 and 30 degrees C thiamethoxam treatments, but none of the 10 degrees C treatments. Effectiveness as a barrier was evaluated by providing a choice between bridges treated with insecticide or water. Although bifenthrin did not provide an impenetrable barrier, it was the only treatment having fewer ants than its paired control bridge. Mortality data suggest that a reduction in recruitment rather than repellency account for this result.

  11. Clinical and radiological findings in chlorfenapyr poisoning

    OpenAIRE

    Vemuri Rama Tharaknath; Prabhakar, Y. V. S.; K Suseel Kumar; Noorthi Kalyan Babu

    2013-01-01

    This is a case report of suicidal ingestion of chlorfenapyr, presenting with neurological complications after a latent period of more than a week, and rapidly progressing to death within days of symptoms. Chlorfenapyr is a moderately hazardous pesticide according to World Health Organization toxicity classification, and kills target organism by depriving it of energy through interference with oxidative phosphorylation at mitochondrial level. A pro-pesticide, chlorfenapyr takes time to convert...

  12. Food source provisioning and susceptibility of immature and adult Tribolium castaneum on concrete partially treated with chlorfenapyr (Phantom®)

    Science.gov (United States)

    A series of experiments were conducted in which adults, pupae, and 4-week-old larvae of Tribolium castaneum (Herbst), the red flour beetle, were exposed separately on concrete arenas partially treated (14.4 % of the total area) with the insecticide chlorfenapyr (Phantom®) at 1.1 g active ingredient/...

  13. Toxicity, persistence, and efficacy of spinosad, chlorfenapyr, and thiamethoxam on eggplant when applied against the eggplant flea beetle (Coleoptera: Chrysomelidae).

    Science.gov (United States)

    McLeod, Paul; Diaz, Francisco J; Johnson, Donn T

    2002-04-01

    A laboratory bioassay was developed for determining the toxicity of spinosad, chlorfenapyr, and thiamethoxam against the eggplant flea beetle, Epitrix fuscula Crotch, on eggplant foliage. Four days after initial exposure, LC50 values were 1.99, 2.50, and 0.88 ppm for spinosad, chlorfenapyr, and thiamethoxam, respectively. By dividing the recommended field rate in ppm by the LC50 value, a field toxicity ratio was determined and ranged from 13.5 for spinosad to 73.9 for thiamethoxam. The high ratios suggest that field rates for all three insecticides could likely be reduced. This was supported by field studies in 2000 in which reduced rates of spinosad and thiamethoxam significantly reduced flea beetle numbers on eggplant. Mortality produced by thiamethoxam occurred more quickly than that for the other tested materials as shown with LT50 values of 1.8, 3.0, and 3.6 and days for thiamethoxam, chlorfenapyr, and spinosad, respectively. Persistence studies indicated that while all three of the tested compounds initially produced high levels of mortality, chlorfenapyr and thiamethoxam produced 50% or greater mortality after 6 d. Our data suggest that future management strategies for E. fuscula on eggplant can be successfully altered to meet the changing needs of the producer. Spinosad was recently registered, is effective against the E. fuscula, and offers a viable alternative to carbamate and pyrethroid insecticides. Thiamethoxam and chlorfenapyr offer high levels of toxicity to E. fuscula and upon registration will offer additional effective tools for management.

  14. Clinical and radiological findings in chlorfenapyr poisoning.

    Science.gov (United States)

    Tharaknath, Vemuri Rama; Prabhakar, Y V S; Kumar, K Suseel; Babu, Noorthi Kalyan

    2013-04-01

    This is a case report of suicidal ingestion of chlorfenapyr, presenting with neurological complications after a latent period of more than a week, and rapidly progressing to death within days of symptoms. Chlorfenapyr is a moderately hazardous pesticide according to World Health Organization toxicity classification, and kills target organism by depriving it of energy through interference with oxidative phosphorylation at mitochondrial level. A pro-pesticide, chlorfenapyr takes time to convert to its active form and either this active form or a toxic metabolite causes delayed neurological symptoms. It causes significant neurotoxicity in rat models. This case report provides for the first time from India (second worldwide), clinical and "radiological evidence" (magnetic resonance imaging showing demyelinating/oedematous changes) of "chlorfenapyr neurotoxicity in humans." It also highlights the "latent period" between ingestion and onset of fatal manifestations. Earlier, similar case reports of human deaths with delayed onset neurological symptoms, due to chlorfenapyr poisoning have been reported, from Japan, Columbia, and Korea.

  15. 76 FR 34937 - Amitraz, Bentazon, Bifenthrin, Chlorfenapyr, Cyfluthrin, Deltamethrin, et al

    Science.gov (United States)

    2011-06-15

    ...In accordance with current Agency practice to describe more clearly the measurement and scope or coverage of tolerances, EPA is proposing minor revisions to tolerance expressions for a number of pesticide active ingredients, including the insecticides amitraz, bifenthrin, chlorfenapyr, cyfluthrin, deltamethrin, esfenvalerate, fenpropathrin, and pyridaben; the fungicide metalaxyl; the herbicides bentazon, quizalofop ethyl, sodium acifluorfen, and tebuthiuron; and the plant growth regulator ethephon. Also, EPA proposes to remove several expired tolerances for quizalofop ethyl.

  16. Using a Lethality Index to Assess Susceptibility of Tribolium confusum and Oryzaephilus surinamensis to Insecticides

    National Research Council Canada - National Science Library

    Agrafioti, Paraskevi; Athanassiou, Christos G; Vassilakos, Thomas N; Vlontzos, George; Arthur, Frank H

    2015-01-01

    We evaluated knockdown caused by four insecticides: alpha-cypermethrin, chlorfenapyr, pirimiphos-methyl and fipronil against adults of Tribolium confusum Jacquelin Duval, the confused flour beetle and Oryzaephilus surinamensis (L...

  17. Clinical and radiological findings in chlorfenapyr poisoning

    National Research Council Canada - National Science Library

    Tharaknath, Vemuri Rama; Prabhakar, Y V S; Kumar, K Suseel; Babu, Noorthi Kalyan

    2013-01-01

    This is a case report of suicidal ingestion of chlorfenapyr, presenting with neurological complications after a latent period of more than a week, and rapidly progressing to death within days of symptoms...

  18. Using a Lethality Index to Assess Susceptibility of Tribolium confusum and Oryzaephilus surinamensis to Insecticides: e0142044

    National Research Council Canada - National Science Library

    Agrafioti, Paraskevi; Athanassiou, Christos G; Vassilakos, Thomas N; Vlontzos, George; Arthur, Frank H

    2015-01-01

    We evaluated knockdown caused by four insecticides: alpha-cypermethrin, chlorfenapyr, pirimiphos-methyl and fipronil against adults of Tribolium confusum Jacquelin Duval, the confused flour beetle and Oryzaephilus surinamensis (L...

  19. Clinical and radiological findings in chlorfenapyr poisoning

    Directory of Open Access Journals (Sweden)

    Vemuri Rama Tharaknath

    2013-01-01

    Full Text Available This is a case report of suicidal ingestion of chlorfenapyr, presenting with neurological complications after a latent period of more than a week, and rapidly progressing to death within days of symptoms. Chlorfenapyr is a moderately hazardous pesticide according to World Health Organization toxicity classification, and kills target organism by depriving it of energy through interference with oxidative phosphorylation at mitochondrial level. A pro-pesticide, chlorfenapyr takes time to convert to its active form and either this active form or a toxic metabolite causes delayed neurological symptoms. It causes significant neurotoxicity in rat models. This case report provides for the first time from India (second worldwide, clinical and "radiological evidence" (magnetic resonance imaging showing demyelinating/oedematous changes of "chlorfenapyr neurotoxicity in humans." It also highlights the "latent period" between ingestion and onset of fatal manifestations. Earlier, similar case reports of human deaths with delayed onset neurological symptoms, due to chlorfenapyr poisoning have been reported, from Japan, Columbia, and Korea.

  20. Using a lethality index to assess susceptibility of Tribolium confusum and Oryzaephilus surinamensis to insecticides

    Science.gov (United States)

    We evaluated the knockdown effect caused by four insecticides: alpha-cypermethrin, chlorfenapyr, pirimiphos-methyl and fipronil against Tribolium confusum and Oryzaephilus surinamensis adults. Furthermore, for the same species and insecticides, we developed a “lethality index”, to assess knockdown p...

  1. 40 CFR 180.513 - Chlorfenapyr; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Chlorfenapyr; tolerances for residues. 180.513 Section 180.513 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.513 Chlorfenapyr; tolerances for residues. ...

  2. Synthesis, crystal structure, and insecticidal activity of novel N-alkyloxyoxalyl derivatives of 2-arylpyrrole.

    Science.gov (United States)

    Zhao, Yu; Mao, Chunhui; Li, Yongqiang; Zhang, Pengxiang; Huang, Zhiqiang; Bi, Fuchun; Huang, Runqiu; Wang, Qingmin

    2008-08-27

    Two series of novel N-alkyloxyoxalyl derivatives of 2-arylpyrrole were synthesized, and their structures were characterized by (1)H NMR spectroscopy, elemental analysis, and single-crystal X-ray diffraction analysis. The insecticidal activities of the new compounds were evaluated. The results of bioassays indicated that some of these title compounds exhibited excellent insecticidal activities, and their insecticidal activities against oriental armyworm, mosquito, and spider mite are comparable to those of the commercialized Chlorfenapyr.

  3. Toxicity from Intra-Abdominal Injection of Chlorfenapyr

    OpenAIRE

    Jina Lee; Jun Hyun Lee; Jong Min Baek; Do Sang Lee; Il Young Park; Jong Man Won; Ki Young Sung

    2013-01-01

    Introduction. Chlorfenapyr is commonly used for food crops in Korea. However, chlorfenapyr toxicity in humans has not yet been studied. Case. A 74-year-old man was admitted to the emergency room after he intra-abdominally injected 20 mL of chlorfenapyr in an attempt to commit suicide. Emergency surgery was performed and accumulation of approximately 500 mL of reactive fluid in the abdomen was observed. The entire small intestine showed congestion. After surgery, additional surgery to drain th...

  4. Activity of Bifenthrin, Chlorfenapyr, Fipronil, and Thiamethoxam against Argentine Ants (Hymenoptera: Formicidae)

    Science.gov (United States)

    Bifenthrin, chlorfenapyr, fipronil, and thiamethoxam were evaluated for activity against the Argentine ant, Linepithema humile (Mayr). Mobility impairment and lethal times were determined following topical treatments. Ants were immobilized most quickly by bifenthrin, followed by chlorfenapyr and th...

  5. Activity of Bifenthrin, Chlorfenapyr, Fipronil, and Thiamethoxam against Red Imported Fire Ants (Hymenoptera: Formicidae)

    Science.gov (United States)

    Bifenthrin, chlorfenapyr, fipronil, and thiamethoxam were evaluated for activity against the Argentine ant, Linepithema humile (Mayr). Mobility impairment and lethal times were determined following topical treatments. Ants were immobilized most quickly by bifenthrin, followed by chlorfenapyr and thi...

  6. A patient fatality following the ingestion of a small amount of chlorfenapyr.

    Science.gov (United States)

    Kang, Changwoo; Kim, Dong Hoon; Kim, Seong Chun; Kim, Dong Seob

    2014-07-01

    Chlorfenapyr has been used worldwide for agricultural pest control since 1995. Despite its widespread use, acute human poisoning data are insufficient; only a small number of fatalities from chlorfenapyr poisoning have been reported. The signs and symptoms of chlorfenapyr toxicity include nausea, vomiting, fever, rhabdomyolysis, among others. In addition, central nervous system effects in association with delayed toxicity have also been observed. Here, we detail a fatality resulting from delayed chlorfenapyr toxicity following the ingestion of a small amount of pesticide.

  7. Behavioral responses of the bed bug to insecticide residues.

    Science.gov (United States)

    Romero, Alvaro; Potter, Michael F; Haynes, Kenneth F

    2009-01-01

    The recent resurgence of bed bugs, Cimex lectularius L. (Heteroptera: Cimicidae), has increased the demand for information about effective control tactics. Several studies have focused on determining the susceptibility of bed bug populations to insecticides. However, behavioral responses of bed bugs to insecticide residues could influence their efficacy. The behavioral responses of bed bugs to deltamethrin and chlorfenapyr, two commonly used insecticides for bed bug control in the United States, were evaluated. In two-choice tests, grouped insects and individual insects avoided resting on filter paper treated with deltamethrin. Insects did not avoid surfaces treated with chlorfenapyr. Harborages, containing feces and eggs and treated with a deltamethrin-based product, remained attractive to individuals from a strain resistant to pyrethroids. Video recordings of bed bugs indicated that insects increased activity when they contacted sublethal doses of deltamethrin. Insecticide barriers of chlorfenapyr or deltamethrin did not prevent bed bugs from reaching a warmed blood source and acquiring blood meals. We discuss the impact of these responses on bed bug control practices.

  8. Toxicity from intra-abdominal injection of chlorfenapyr.

    Science.gov (United States)

    Lee, Jina; Lee, Jun Hyun; Baek, Jong Min; Lee, Do Sang; Park, Il Young; Won, Jong Man; Sung, Ki Young

    2013-01-01

    Introduction. Chlorfenapyr is commonly used for food crops in Korea. However, chlorfenapyr toxicity in humans has not yet been studied. Case. A 74-year-old man was admitted to the emergency room after he intra-abdominally injected 20 mL of chlorfenapyr in an attempt to commit suicide. Emergency surgery was performed and accumulation of approximately 500 mL of reactive fluid in the abdomen was observed. The entire small intestine showed congestion. After surgery, additional surgery to drain the fluid was performed on POD 12. But immediately after administration of general anesthesia, flat rhythm was observed by electrocardiogram (ECG) monitoring, requiring cardiopulmonary resuscitation (CPR). Discussion. The color of the bowel was purple, indicating ischemic injury. This could be attributed to direct absorption of the substance through the peritoneum, leading to chemical injury to the small intestine serosa, unlike in the case of oral ingestion. This resulted in an ischemic change in the small intestine, eventually leading to sepsis. Conclusion. Only a few cases of chlorfenapyr toxicity have been reported in the literature, and death occurred in all cases, including our case. Therefore, careful and aggressive treatments are necessary. This is the first reported case of intra-abdominal injection of chlorfenapyr.

  9. Toxicity from Intra-Abdominal Injection of Chlorfenapyr

    Directory of Open Access Journals (Sweden)

    Jina Lee

    2013-01-01

    Full Text Available Introduction. Chlorfenapyr is commonly used for food crops in Korea. However, chlorfenapyr toxicity in humans has not yet been studied. Case. A 74-year-old man was admitted to the emergency room after he intra-abdominally injected 20 mL of chlorfenapyr in an attempt to commit suicide. Emergency surgery was performed and accumulation of approximately 500 mL of reactive fluid in the abdomen was observed. The entire small intestine showed congestion. After surgery, additional surgery to drain the fluid was performed on POD 12. But immediately after administration of general anesthesia, flat rhythm was observed by electrocardiogram (ECG monitoring, requiring cardiopulmonary resuscitation (CPR. Discussion. The color of the bowel was purple, indicating ischemic injury. This could be attributed to direct absorption of the substance through the peritoneum, leading to chemical injury to the small intestine serosa, unlike in the case of oral ingestion. This resulted in an ischemic change in the small intestine, eventually leading to sepsis. Conclusion. Only a few cases of chlorfenapyr toxicity have been reported in the literature, and death occurred in all cases, including our case. Therefore, careful and aggressive treatments are necessary. This is the first reported case of intra-abdominal injection of chlorfenapyr.

  10. Acute lethal and behavioral sublethal responses of two stored-product psocids to surface insecticides.

    Science.gov (United States)

    Guedes, Raul Narciso C; Campbell, James F; Arthur, Frank H; Opit, George P; Zhu, Kun Yan; Throne, James E

    2008-12-01

    The psocids Liposcelis bostrychophila Badonnel and L. entomophila (Enderlein) (Liposcelididae) are emerging pests of stored products. Although their behavior, particularly their high mobility, may contribute to the reported relatively low efficacy of insecticides against them, studies to investigate this have not been conducted. The present study aimed to assess the label rate efficacy of three commercial insecticides (beta-cyfluthrin, chlorfenapyr and pyrethrins) applied on concrete surfaces against L. bostrychophila and L. entomophila, and also their sublethal effect on the mobility of these species. The synthetic insecticides beta-cyfluthrin and chlorfenapyr showed high short-term efficacy (LT(95)or= 4 days). Liposcelis bostrychophila was slightly more tolerant (>or=1.2x) than L. entomophila to all three insecticides. Behavioral assays with fully sprayed and half-sprayed concrete arenas indicated that the insecticides reduced the mobility of both species. Pyrethrins seem to elicit weak repellence in L. bostrychophila. beta-Cyfluthrin and chlorfenapyr were effective against both psocid species, but not pyrethrins. The mobility of both species does not seem to play a major role in the differential selectivity observed, but the lower mobility of L. bostrychophila may be a contributing factor to its higher insecticide tolerance.

  11. Evaluation of novel insecticides for control of dengue vector Aedes aegypti (Diptera: Culicidae).

    Science.gov (United States)

    Paul, Ayesa; Harrington, Laura C; Scott, Jeffrey G

    2006-01-01

    Insecticides are one of the major tools for controlling vector populations and for reducing the transmission of human pathogens. However, there are few new insecticides being developed and marketed for vector control. Herein, we report on the toxicity of six novel insecticides to both adult and larval Aedes aegypti (L). and the toxicity of three novel insect growth regulators (IGRs) to larvae. Four insecticides were highly or moderately toxic to larvae with LC50 values of 16 (chlorfenapyr), 70 (hydramethylnon), 79 (indoxacarb), and 84 ng/ml (imidacloprid). Diafenthiuron and chlorfenapyr were moderately toxic to adult mosquitoes with LC50 values of 13 and 92 ng/cm2, respectively. Imidacloprid was strongly synergized by piperonyl butoxide (PBO) in Ae. aegypti adults, suggesting that neonicotinoids are intrinsically very toxic to adult mosquitoes (in the absence of detoxification). The effect of PBO on the toxicity in adults and larvae was considerably different, both in terms of the insecticides that were synergized (or antagonized for chlorfenapyr versus adults) and in terms of the degree of synergism. This result implies that the cytochrome P450s involved in metabolism of these insecticides are different between adults and larvae. Pyriproxyfen was confirmed as a potent IGR (EC50 of 0.0017 ng/ml) for mosquitoes, although tebufenozide lacked activity. The potential for use of these materials in mosquito control is discussed.

  12. Physiological selectivity and activity reduction of insecticides by rainfall to predatory wasps of Tuta absoluta.

    Science.gov (United States)

    Barros, Emerson C; Bacci, Leandro; Picanco, Marcelo C; Martins, Júlio C; Rosado, Jander F; Silva, Gerson A

    2015-01-01

    In this study, we carried out three bioassays with nine used insecticides in tomato crops to identify their efficiency against tomato leaf miner Tuta absoluta, the physiological selectivity and the activity reduction of insecticides by three rain regimes to predatory wasps Protonectarina sylveirae and Polybia scutellaris. We assessed the mortality caused by the recommended doses of abamectin, beta-cyfluthrin, cartap, chlorfenapyr, etofenprox, methamidophos, permethrin, phenthoate and spinosad to T. absoluta and wasps at the moment of application. In addition, we evaluated the wasp mortality due to the insecticides for 30 days on plants that did not receive rain and on plants that received 4 or 125 mm of rain. Spinosad, cartap, chlorfenapyr, phenthoate, abamectin and methamidophos caused mortality higher than 90% to T. absoluta, whereas the pyrethroids beta-cyfluthrin, etofenprox and permethrin caused mortality between 8.5% and 46.25%. At the moment of application, all the insecticides were highly toxic to the wasps, causing mortality higher than 80%. In the absence of rain, all the insecticides continued to cause high mortality to the wasps for 30 days after the application. The toxicity of spinosad and methamidophos on both wasp species; beta-cyfluthrin on P. sylveirae and chlorfenapyr and abamectin on P. scutellaris, decreased when the plants received 4 mm of rain. In contrast, the other insecticides only showed reduced toxicity on the wasps when the plants received 125 mm of rain.

  13. Effect of feeding status on mortality response of adult bed bugs (Hemiptera: Cimicidae) to some insecticide products.

    Science.gov (United States)

    Choe, Dong-Hwan; Campbell, Kathleen

    2014-06-01

    Fresh and aged residual deposits of several insecticide products were tested against bed bug adults to determine if a recent bloodmeal affected their mortality response to the residues. The bed bugs with a recent bloodmeal survived significantly longer compared with the unfed ones on their exposure to fresh or aged residual deposits of chlorfenapyr and aged residual deposits of deltamethrin on a wooden substrate. Even though the survival time of fed bed bugs was significantly longer than that of unfed ones on their exposure to fresh residue of deltamethrin and aged residue of desiccant pyrethrin dust, these treatments resulted in similarly high final mortalities regardless of feeding status of the insects. Mortality responses of fed and unfed bed bugs were similar to fresh or aged residual deposits of imidacloprid + cyfluthrin combination and fresh residual deposits of desiccant pyrethrin dust. Topical application assays indicated that a recent bloodmeal significantly increased the bed bug's survival time for chlorfenapyr, but not for deltamethrin. Pyrethroid-resistant bed bugs also showed a similar increase in their survival time for chlorfenapyr after a bloodmeal. The comparison of mortality responses between fed and unfed bed bugs treated with similar amount of chlorfenapyr per fresh body weight indicated that increased body mass was not the primary cause for this bloodmeal-induced tolerance increase for chlorfenapyr. Because the surviving bed bugs can continue ovipositing, the effectiveness of chlorfenapyr residual deposits in bed bug harborages could be significantly affected by the feeding status of the adult bed bug populations.

  14. Ecotoxicological study of insecticide effects on arthropods in common bean.

    Science.gov (United States)

    de Barros, Emerson Cristi; Ventura, Hudson Vaner; Gontijo, Pablo Costa; Pereira, Renata Ramos; Picanço, Marcelo Coutinho

    2015-01-01

    Arthropods are an important group of macroorganisms that work to maintain ecosystem health. Despite the agricultural benefits of chemical control against arthropod pests, insecticides can cause environmental damage. We examined the effects of one and two applications of the insecticides chlorfenapyr (0.18 liters a.i. ha-1) and methamidophos (0.45 liters a.i. ha-1), both independently and in combination, on arthropods in plots of common bean. The experiment was repeated for two growing seasons. Principal response curve, richness estimator, and Shannon-Wiener diversity index analyses were performed. The insecticides generally affected the frequency, richness, diversity, and relative abundance of the arthropods. In addition, the arthropods did not experience recovery after the insecticide applications. The results suggest that the insecticide impacts were sufficiently drastic to eliminate many taxa from the studied common bean plots. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  15. Chlorfenapyr-Induced Toxic Leukoencephalopathy with Radiologic Reversibility: A Case Report and Literature Review.

    Science.gov (United States)

    Baek, Byung Hyun; Kim, Seul Kee; Yoon, Woong; Heo, Tae Wook; Lee, Yun Young; Kang, Heoung Keun

    2016-01-01

    Chlorfenapyr is a widely used, moderately hazardous pesticide. Previous reports have indicated that chlorfenapyr intoxication can be fatal in humans. We reported the first non-fatal case of chlorfenapyr-induced toxic leukoencephalopathy in a 44-year-old female with resolution of extensive and abnormal signal intensities in white matter tracts throughout the brain, brain stem, and spinal cord on serial magnetic resonance imaging.

  16. Chlorfenapyr-Induced Toxic Leukoencephalopathy with Radiologic Reversibility: A Case Report and Literature Review

    OpenAIRE

    Baek, Byung Hyun; Kim, Seul Kee; Yoon, Woong; Heo, Tae Wook; Lee, Yun Young; Kang, Heoung Keun

    2016-01-01

    Chlorfenapyr is a widely used, moderately hazardous pesticide. Previous reports have indicated that chlorfenapyr intoxication can be fatal in humans. We reported the first non-fatal case of chlorfenapyr-induced toxic leukoencephalopathy in a 44-year-old female with resolution of extensive and abnormal signal intensities in white matter tracts throughout the brain, brain stem, and spinal cord on serial magnetic resonance imaging.

  17. A patient fatality following the ingestion of a small amount of chlorfenapyr

    OpenAIRE

    Changwoo Kang; Dong Hoon Kim; Seong Chun Kim; Dong Seob Kim

    2014-01-01

    Chlorfenapyr has been used worldwide for agricultural pest control since 1995. Despite its widespread use, acute human poisoning data are insufficient; only a small number of fatalities from chlorfenapyr poisoning have been reported. The signs and symptoms of chlorfenapyr toxicity include nausea, vomiting, fever, rhabdomyolysis, among others. In addition, central nervous system effects in association with delayed toxicity have also been observed. Here, we detail a fatality resulting from dela...

  18. Chlorfenapyr-induced toxic leukoencephalopathy with radiologic reversibility: A case report and literature review

    Energy Technology Data Exchange (ETDEWEB)

    Baek, Byung Hyun; Kim, Seul Kee; Yoon, Woong; Heo, Tae Wook; Lee, Yun Young [Dept. of Radiology, Chonnam National University Hospital, Gwangju (Korea, Republic of); Kang, Heonung Keun [Dept. of Radiology, Chonnam National University Hwasun Hospital, Hwasun (Korea, Republic of)

    2016-04-15

    Chlorfenapyr is a widely used, moderately hazardous pesticide. Previous reports have indicated that chlorfenapyr intoxication can be fatal in humans. We reported the first non-fatal case of chlorfenapyr-induced toxic leukoencephalopathy in a 44-year-old female with resolution of extensive and abnormal signal intensities in white matter tracts throughout the brain, brain stem, and spinal cord on serial magnetic resonance imaging.

  19. A patient fatality following the ingestion of a small amount of chlorfenapyr

    Directory of Open Access Journals (Sweden)

    Changwoo Kang

    2014-01-01

    Full Text Available Chlorfenapyr has been used worldwide for agricultural pest control since 1995. Despite its widespread use, acute human poisoning data are insufficient; only a small number of fatalities from chlorfenapyr poisoning have been reported. The signs and symptoms of chlorfenapyr toxicity include nausea, vomiting, fever, rhabdomyolysis, among others. In addition, central nervous system effects in association with delayed toxicity have also been observed. Here, we detail a fatality resulting from delayed chlorfenapyr toxicity following the ingestion of a small amount of pesticide.

  20. Posttreatment Feeding Affects Mortality of Bed Bugs (Hemiptera: Cimicidae) Exposed to Insecticides.

    Science.gov (United States)

    Singh, Narinderpal; Wang, Changlu; Cooper, Richard

    2016-02-01

    Insecticide sprays and dusts are used for controlling bed bugs, Cimex lectularius L. In natural environments, bed bugs have daily access to hosts after they are exposed to insecticides. The established laboratory insecticide bioassay protocols do not provide feeding after insecticide treatments, which can result in inflated mortality compared with what would be encountered in the field. We evaluated the effect of posttreatment feeding on mortality of bed bugs treated with different insecticides. None of the insecticides tested had a significant effect on the amount of blood consumed and percent feeding. The effect of posttreatment feeding on bed bug mortality varied among different insecticides. Feeding significantly reduced mortality in bed bugs exposed to deltamethrin spray, an essential oil mixture (Bed Bug Fix) spray, and diatomaceous earth dust. Feeding increased the mean survival time for bed bugs treated with chlorfenapyr spray and a spray containing an essential oil mixture (Ecoraider), but did not affect the final mortality. First instars hatched from eggs treated with chlorfenapyr liquid spray had reduced feeding compared with nymphs hatched from nontreated eggs. Those nymphs hatched from eggs treated with chlorfenapyr liquid spray and successfully fed had reduced mortality and a higher mean survival time than those without feeding. We conclude that the availability of a bloodmeal after insecticide exposure has a significant effect on bed bug mortality. Protocols for insecticide efficacy testing should consider offering a bloodmeal to the treated bed bugs within 1 to 3 d after treatment. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. Insecticide poisoning

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/002832.htm Insecticide poisoning To use the sharing features on this page, please enable JavaScript. Insecticide is a chemical that kills bugs. Insecticide poisoning ...

  2. Transfer of chlorfenapyr among workers of Reticulitermes flavipes (Isoptera: Rhinotermitidae) in the laboratory

    Science.gov (United States)

    Thomas G. Shelton; Joseph E. Mulroonery; Terence L. Wagner

    2006-01-01

    The potential for transfer of chlorfenapyr among subterranean termites was investigated using a donor-recipient (5:95 ratio) experiment. In one experiment, workers of Reticulitermes flavipeS(Kollar) (Isoptera: Rhinotermitidae) were exposed to treated sand at 0,50,100,250, and 500 ppm chlorfenapyr (wt [AI] /wt sand). Exposed workers were allowed to...

  3. Mobility, longevity and activity of chlorfenapyr in soils treated at a termiticidal rate.

    Science.gov (United States)

    Peterson, Chris J; Davis, Robert W

    2013-01-01

    The mobility, longevity and termiticidal activity of chlorfenapyr applied to soils at the termiticidal labeled rate was evaluated for 30 months after treatment (MAT) in a greenhouse study. There was little dissipation of chlorfenapyr in soil treated at the labeled rate for perimeter treatments for the prevention and control of termite infestations. Chlorfenapyr was detected in soil immediately below the initially treated soil in the packed soil columns. This was likely due to settling of soil. The treated soil remained toxic to subterranean termites in 3 and 7 day bioassays over the duration of the study. The treated soil displayed slow-acting properties regarding toxicity to termites. Trace amounts of chlorfenapyr were detected in the eluates of packed soil cones. The commercial formulation of chlorfenapyr used in this study (21.45% concentrate diluted to 0.125% prior to application) killed 100% of the tested subterranean termites for at least 30 months. Copyright © 2012 Society of Chemical Industry.

  4. Comparison of Insecticide Susceptibilities of Empoasca vitis (Hemiptera: Cicadellidae) from Three Main Tea-Growing Regions in China.

    Science.gov (United States)

    Wei, Qi; Yu, Hua-Yang; Niu, Chun-Dong; Yao, Rong; Wu, Shun-Fan; Chen, Zhuo; Gao, Cong-Fen

    2015-06-01

    Empoasca vitis (Göthe) is an important insect pest in tea-growing areas of China, and chemical control is the main tactic for the management of this pest. Due to the pressure of increasing insecticide resistance and more stringent food safety regulations, development of sound IPM strategies for E. vitis is an urgent matter. This study comparatively evaluated four field populations of E. vitis from three different tea-growing regions in China for their susceptibilities to eight insecticides using a simple leaf-dip methodology. E. vitis was found to be most sensitive to indoxacarb (LC505 mg/liter) and sophocarpidine (LC50>95 mg/liter, a botanical pesticide) regardless of populations. Population (geographical) variations were higher for indoxacarb and imidacloprid than other compounds. Judging by the 95% fiducial limits of LC50 values, all populations had similar susceptibilities to chlorfenapyr, bifenthrin, and acetamiprid or imidacloprid. Correlation analysis suggested that chlorfenapyr and indoxacarb or isoprocarb may have a high risk of cross resistance. Considering potency (LC50) and maximum residual levels, chlorfenapyr and bifenthrin are good insecticide options followed by acetamiprid and indoxacarb. These results provide valuable information to intelligently select insecticides for IPM programs that are efficacious against E. vitis while also managing insecticide resistance and maximum residual levels for tea production in China. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Effects of introducing theanine or glutamic acid core to tralopyril on systemicity and insecticidal activity.

    Science.gov (United States)

    Yang, Wen; Chen, Yao; Zhang, Ying; Gao, Xiu-Bing; Zhou, Yu-Feng

    2017-09-01

    Tralopyril was the active agent of a pro-insecticide chlorfenapyr. To simultaneously solve the problems of the phytotoxicity and non-systemic insecticidal activity of tralopyril, four new tralopyril conjugates containing theanine or glutamic acid moieties were designed and synthesized. Their phytotoxicity to tea shoot, phloem systemicity, and insecticidal activity were evaluated. Phytotoxic symptoms were not observed after the tea shoots were exposed to the four conjugates at concentrations of 2mM. The phloem mobility test on Ricinus communis L. seedlings confirmed that all four conjugates were mobile in the sieve tubes. Results of insecticidal activity against the third-instar larvae of Plutella xylostella showed that only conjugate 20 exhibited activity with an LC50 value of 0.5882±0.0504mM. After root application to tea seedlings, conjugate 20 showed obviously systemic insecticidal activity against Dendrothrips minowai Priesner, while chlorfenapyr showed no attribute of that. A new conjugate as potential phloem mobile pro-insecticide candidate was provided and so a novel strategy of pro-insecticide for improved phloem systemicity was proposed. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. Biological activity of two new pyrrole derivatives against stored-product species: influence of temperature and relative humidity.

    Science.gov (United States)

    Boukouvala, M C; Kavallieratos, N G; Athanassiou, C G; Hadjiarapoglou, L P

    2016-08-01

    Members of the pyrrole group are likely to have interesting properties that merit additional investigation as insecticides at the post-harvest stages of agricultural commodities. In the present work, the insecticidal effect of two new pyrrole derivatives, ethyl 3-(benzylthio)-4,6-dioxo-5-phenyl-2,4,5,6-tetrahydropyrrolo[3,4-c]pyrrole-carboxylate (3i) and isopropyl 3-(benzylthio)-4,6-dioxo-5-phenyl-2,4,5,6-tetrahydropyrrolo[3,4-c]pyrrole-carboxylate (3k) were studied as stored-wheat protectants against two major stored-product insect species, the confused flour beetle, Tribolium confusum Jaquelin du Val adults and larvae and the Mediterranean flour moth, Ephestia kuehniella Zeller larvae at different doses (0.1, 1 and 10 ppm), exposure intervals (7, 14 and 21 days), temperatures (20, 25 and 30°C) and relative humidity (55 and 75%) levels. For T. confusum adults, in the case of the pyrrole derivative 3i, mortality was low and it did not exceed 32.2% in wheat treated with 10 ppm 3i at 30°C and 55% relative humidity. Progeny production was very low (confusum larvae, in the case of the pyrrole derivative 3i, at the highest dose, mortality was 82.2% at 25°C and 55% relative humidity whereas in the case of 3k it reached 77.8% at the same combination. In contrast, mortality at 75% relative humidity remained very low and did not exceed 13.3%. For E. kuehniella larvae, the highest mortalities, 44.4 and 63.3%, were observed in 10 ppm at 25°C and 55% relative humidity for both pyrrole derivatives. The compounds tested here have a certain insecticidal effect, but this effect is moderated by the exposure, the target species, the temperature and the relative humidity.

  7. Abiotic and biotic factors affect efficacy of chlorfenapyr for control of stored-product insect pests.

    Science.gov (United States)

    Kavallieratos, Nickolas G; Athanassiou, Christos G; Hatzikonstantinou, Ann N; Kavallieratou, Helen N

    2011-08-01

    Laboratory bioassays were conducted to assess pyrole chlorfenapyr as a potential grain protectant against adults of Rhyzopertha dominica, Sitophilus oryzae, Prostephanus truncatus, Tribolium confusum, and Liposcelis bostrychophila. Factors such as dose (0.01, 0.1, 0.5, 1, 5, and 10 ppm), exposure interval (7 and 14 days), temperature (20, 25, and 30°C), relative humidity (RH; 55 and 75%), and commodity (wheat, maize, barley, and paddy rice) were evaluated. Progeny production was assessed after 74 days of exposure. For L. bostrychophila and T. confusum the increase of dose increased mortality. After 7 or 14 days of exposure, mortality was low at doses of ≤ 1 ppm and did not exceed 23 or 36%, respectively, for L. bostrychophila or 13 or 58%, respectively, for T. confusum. After 14 days of exposure, mortality of S. oryzae at 30°C and 75% RH was 82.2%. Mortality of P. truncatus was considerably higher than that of the other species. At 0.5 ppm, mortality exceeded 81% after 7 days of exposure and 91% after 14 days of exposure. Progeny production of L. bostrychophila was extremely high. Very few progeny were found for T. confusum. For S. oryzae, offspring emergence was high, except at 20°C and 55% RH. For P. truncatus, progeny production in the treated maize was not avoided, even at 10 ppm. In the case of S. oryzae, at 0.1 ppm and after 14 days of exposure, mortality in wheat was higher than in the other three commodities. For R. dominica, mortality was low at 0.1 and 1 ppm for paddy rice but reached 74.4% in barley after 14 days of exposure. For T. confusum, mortality was low at 0.1 and 1 ppm in all commodities. For progeny production counts, for S. oryzae or R. dominica, adult emergence was higher in paddy rice than in the other three commodities. Finally, overall T. confusum progeny was low. Chlorfenapyr efficacy varied remarkably among the combinations tested, and it may be a viable grain protectant in combination with other insecticides.

  8. Transferof chlorfenapyr among workers of Reticulitermnes flavipes (Isoptera: Rhinotermitidae) in the laboratory.

    Science.gov (United States)

    Shelton, Thomas G; Mulrooney, Joseph E; Wagner, Terence L

    2006-06-01

    The potential for transfer of chlorfenapyr among subterranean termites was investigated using a donor-recipient (5:95 ratio) experiment. In one experiment, workers of Reticulitermes flavipes (Kollar) (Isoptera: Rhinotermitidae) were exposed to treated sand at 0, 50, 100, 250, and 500 ppm chlorfenapyr (wt [AI]/wt sand). Exposed workers were allowed to interact with untreated nestmates for 14 d, after which mortality was assessed. The three colonies responded differently to the treatments in this experiment. For two colonies, donor exposure rates of 500 ppm (as well as 250 ppm for colony B) chlorfenapyr resulted in significantly greater recipient mortality than controls. For colony C, donor chlorfenapyr exposure did not significantly influence recipient mortality. In a second experiment examining donor mortality over time, donor termites exposed to all test concentrations of chlorfenapyr (except for 0 ppm) suffered 100% mortality within 5 d. Analysis of donor termite body washes using gas chromatography indicated a linear uptake of chlorfenapyr by termites over the concentration range studied. Thus, for this concentration range, no upper limit (saturation plateau) of termite uptake for chlorfenapyr was reached.

  9. Evaluation of a commercial immunoassay for the detection of chlorfenapyr in agricultural samples by comparison with gas chromatography and mass spectrometric detection.

    Science.gov (United States)

    Watanabe, Eiki; Baba, Koji; Eun, Heesoo; Arao, Tomohito; Ishii, Yasuo; Ueji, Masako; Endo, Shozo

    2005-05-13

    A commercially available enzyme-linked immunosorbent assay (ELISA) kit with a high affinity monoclonal antibody was applied to residual analysis of insecticide chlorfenapyr in agricultural samples, and drawn a parallel between the ELISA and gas chromatography (GC) with mass spectrometry (MS). For standards prepared in water containing 5% (v/v) methanol, the sensitivity (I50 value), the dynamic range, and the limit of detection of the ELISA kit were 2.3, 1 - 10, and 0.1 ng/g, respectively. The used monoclonal antibody in the ELISA kit had a high selectivity. The ELISA kit was applied to the determination of chlorfenapyr in two kinds of fruits (apple and peach). The examination of the influence of these matrices on the reliability of the assay performance indicated that the ELISA could determine it in these samples near the regulation values in Japan simply by diluting the methanolic extract or by concentrating it, without any clean-up procedures. Recovery and precision of the proposed ELISA method were assessed by fortifying fruit samples with chlorfenapyr ranging from 0.05 to 1.5 microg/g. Mean recoveries were 94.2 and 90.3% for apple and peach, and coefficients of variation were below 16% in most cases. The results obtained from the proposed ELISA method correlate well the reference GC/MS method for both fruit samples (r > 0.98). These considerations make the ELISA kit very useful analytical tool for monitoring and regulatory programs, without the need of complex and expensive instrumentation.

  10. Biochemical analysis of a chlorfenapyr-selected resistant strain of Tetranychus urticae Koch.

    Science.gov (United States)

    Van Leeuwen, Thomas; Van Pottelberge, Steven; Tirry, Luc

    2006-05-01

    Tetranychus urticae Koch has recently developed resistance to chlorfenapyr in Australia and Japan, but no attempt has yet been made to describe the biochemical mechanisms involved in chlorfenapyr resistance. In this study a laboratory-selected chlorfenapyr-resistant strain was investigated. Resistance to chlorfenapyr was associated with a strong increase in esterase activity and P450 mono-oxygenase (MO) activity but a decrease in 3,3',5,5'-tetramethylbenzidine (TMBZ) peroxidation activity. Differences in esterase activities between susceptible and resistant strains increased with increasing carbon number of the aliphatic side-chain of the nitrophenol substrate. A 4.4-fold increase in the O-deethylation of 7-ethoxy-4-trifluoromethyl coumarin (7-EFC) mediated by P450 MOs was detected. Remarkably, the resistant strain showed only half of the total TMBZ peroxidation activity found in the susceptible strain. The activity of these enzymes was further determined on different crosses and back-crosses of both strains. Results indicated that activities correlated with chlorfenapyr susceptibility and could be considered as biochemical markers. Esterase isozymes of both strains and their crosses were separated with isoelectric focusing (IEF) and visualised after activity staining. It was clear that two distinct zones of enhanced esterase activity were present in the chlorfenapyr-resistant strain (EST 11, pI = 4.88 and EST 16, pI = 4.71). EST 11 was identified with inhibitors as a carboxylesterase. The relative presence and intensity of these esterase zones changed in the different crosses and could be seen as a marker for chlorfenapyr resistance. Glutathione-S-transferase and glucose-6-phosphate dehydrogenase activities were not significantly different between strains. A twofold decrease in TMBZ peroxidase activity in the resistant strain could reflect decreased activation of chlorfenapyr. On the basis of these results the involvement of P450 MOs and esterases in the

  11. Chlorfenapyr resistance in two-spotted spider mite (Acari: Tetranychidae) from Australian cotton.

    Science.gov (United States)

    Herron, G A; Rophail, J; Wilson, L J

    2004-01-01

    The responses of Tetranychus urticae Koch from Australian cotton to chlorfenapyr has been monitored since the 1997--1998 growing season. Resistance was first detected in the 2001--2002 season and then increased quickly in both level and proportion of resistant strains detected. In response, the resistance management strategy for chlorfenapyr use in cotton was altered and now recommends a further restriction of use from two to one spray per season. There was no evidence of negative cross-resistance to the pyrethroid bifenthrin, but chlorfenapyr was associated with an undefined negative cross-resistance.

  12. Determination of pyrazole and pyrrole pesticides in environmental water samples by solid-phase extraction using multi-walled carbon nanotubes as adsorbent coupled with high-performance liquid chromatography.

    Science.gov (United States)

    Ma, Jiping; Lu, Xi; Xia, Yan; Yan, Fengli

    2015-02-01

    A solid-phase extraction (SPE) method using multi-walled carbon nanotubes as adsorbent coupled with high-performance liquid chromatography was developed for the determination of four pyrazole and pyrrole pesticides (fenpyroximate, chlorfenapyr, fipronil and flusilazole) in environmental water samples. Several parameters, such as extraction adsorbent, elution solvent and volume and sample loading flow rate were optimized to obtain high SPE recoveries and extraction efficiency. The calibration curves for the pesticides extracted were linear in the range of 0.05-10 μg L(-1) for chlorfenapyr and fenpyroximate and 0.05-20 μg L(-1) for fipronil and flusilazole, with the correlation coefficients (r(2)) between 0.9966 and 0.9990. The method gave good precisions (relative standard deviation %) from 2.9 to 10.1% for real spiked samples from reservoir water and seawater; method recoveries ranged 92.2-105.9 and 98.5-103.9% for real spiked samples from reservoir water and seawater, respectively. Limits of detection (S/N = 3) for the method were determined to be 8-19 ng L(-1). The optimized method was successfully applied to the determination of four pesticides of pyrazoles and pyrroles in real environmental water samples. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  13. Resistance of Dusky Cotton Bug, Oxycarenus hyalinipennis Costa (Lygaidae: Hemiptera), to Conventional and Novel Chemistry Insecticides.

    Science.gov (United States)

    Ullah, Saif; Shad, Sarfraz Ali; Abbas, Naeem

    2016-02-01

    The dusky cotton bug, Oxycarenus hyalinipennis Costa (Lygaidae: Hemiptera), is polyphagous in nature and has become one of the severe sucking pests of cotton in Pakistan. O. hyalinipennis has the potential to develop resistance to a number of insecticides, and as a result, O. hyalinipennis outbreaks occur. There is no previous study from Pakistan regarding O. hyalinipennis resistance to insecticides. Therefore, the aim of this study was to assess the resistance of different field populations of O. hyalinipennis to conventional (bifenthrin, deltamethrin, lambda-cyhalothrin, profenofos, triazophos) and novel chemistry (emamectin benzoate, spinosad, chlorfenapyr, imidacloprid, and nitenpyram) insecticides. Five populations of O. hyalinipennis, collected from Multan, Khanewal, Muzaffargarh, Lodhran, and Bahawalpur, were tested for resistance to selected insecticides by the leaf dip method. For three pyrethroids, the resistance ratios were in the range of 14- to 30-fold for bifenthrin, 2.14- to 8.41-fold for deltamethrin, and 9.12- to 16-fold for lambda-cyhalothrin, compared with the laboratory susceptible strain (Lab-PK). For two organophosphates, the range of resistance ratios was 12- to 14-fold for profenofos and 9.04- to 15-fold for triazophos. For five novel chemistry insecticides, the range of resistance ratios was 4.68- to 9.83-fold for emamectin benzoate, 6.38- to 17-fold for spinosad, 16- to 46-fold for chlorfenapyr, 11- to 22-fold for imidacloprid, and 1.32- to 11-fold for nitenpyram. Regular assessment of resistance to insecticides and integrated management plans like judicious use of insecticides and rotation of insecticides along with different modes of action are required to delay resistance development in O. hyalinipennis. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. Cyclo[n]pyrroles and methods thereto

    Energy Technology Data Exchange (ETDEWEB)

    Sessler, Jonathan L.; Seidel, Daniel; Bolze, Frederic R.; Koehler, Thomas

    2006-01-10

    The present invention provides an oxidative coupling procedure that allows efficient synthesis of novel cyclo[n]pyrrole macrocycles. Therefore, the present invention provides cyclo[n]pyrroles where n is 6, 7, 8, 9, 10, 11, or 12, and derivatives, multimers, isomers, and ion and neutral molecule complexes thereof as new compositions of matter. A protonated form of cyclo[n]pyrrole displays a gap of up to 700 nm between strong Soret and Q-like absorption bands in the electronic spectrum, demonstrating no significant ground state absorption in the visible portion of the electronic spectrum. Uses of cyclo[n]pyrroles as separation media, nonlinear optical materials, information storage media and infrared filters are provided.

  15. Laboratory evaluations of insecticide product efficacy for control of Cimex lectularius.

    Science.gov (United States)

    Moore, David J; Miller, Dini M

    2006-12-01

    A susceptible, laboratory strain of bed bug, Cimex lectularius L., was used to determine the efficacy of insecticide products labeled or possessing a site label for bed bug control. Field strain bed bugs also were used to evaluate one insecticide product. The lethal time (LT),, values calculated for the laboratory strain bed bugs indicated that all of the pyrethroid products killed significantly faster than chlorfenapyr (0.5% [AIl; Phantom: BASF; LT50 = 10 d and 9 h). lamda-Cyhalothrin (0.03%; Demand CS; Syngenta) was the fastest acting insecticide (LT50 = 20 min), followed by bifenthrin (0.02% [AI]; Talstar One, FMC; LT50 = 53 min), deltamethrin (0.06% [AI]; Suspend SC; Bayer; LT50 = 61 min), and permethrin (0.05%; Dragnet SFR; FMC; LT50 = 88 min). The field strain bed bugs exposed to deltamethrin had an LT50 value of 14 day 8 h, indicating that the field strain was significantly less susceptible to deltamethrin than the laboratory strain. Chlorfenapyr exposure did not prevent the laboratory strain bed bugs from mating and laying eggs, nor did it prevent the eggs from hatching during the 2-wk exposure period. Surprisingly, none of the insecticides tested, including the pyrethroids, were repellent to laboratory strain bed bugs. Bed bugs rested on pyrethroid-treated panels and remained in contact with the panels until they died (2 h). Chlorfenapyr was also not repellent to bed bugs, but it caused no mortality during the 2-h test period. This study suggests that although pyrethroids were effective for controlling laboratory strain bed bugs, there is the potential for significant resistance in field strains. This study also determined that pyrethroid products were not repellent to bed bugs and would not cause bed bug aggregations to scatter or avoid treated surfaces.

  16. Metal organic frameworks (MOFs) for magnetic solid-phase extraction of pyrazole/pyrrole pesticides in environmental water samples followed by HPLC-DAD determination.

    Science.gov (United States)

    Ma, Jiping; Yao, Zhidan; Hou, Liwei; Lu, Wenhui; Yang, Qipeng; Li, Jinhua; Chen, Lingxin

    2016-12-01

    Magnetic metal-organic frameworks (MOFs, [MIL-101]) were prepared and used as magnetic solid-phase extraction (MSPE) adsorbents for preconcentration of four kinds of pyrazole/pyrrole pesticides (flusilazole, fipronil, chlorfenapyr, and fenpyroximate) in environmental water samples, followed by high-performance liquid chromatography-diode-array detector (HPLC-DAD) determination. Several variables affecting MSPE efficiency were systematically investigated, including amount of MIL-101, extraction time, sample pH, salt concentration, type of desorption solvent and desorption number of times. Under optimized conditions, excellent linearity was achieved in the range of 5.0-200.0μg/L for flusilazole and fipronil, and 2.0-200.0μg/L for chlorfenapyr and fenpyroximate, with correlation coefficients r>0.9911. Limits of detection and quantification were 0.3-1.5μg/L and 1.0-5.0μg/L, respectively. The intra-day and inter-day precision (relative standard deviation, n=6, %) at three spiked levels were 1.1-5.4% and 3.9-7.8% in terms of peak area, respectively. The method recoveries at three fortified concentration levels ranged from 81.8% to 107.5% for reservoir water samples, 81.0-99.5% for river water samples, and 80.2-106.5% for seawater samples. The developed MOFs based MSPE coupled with HPLC method proved to be a convenient, rapid and eco-friendly alternative to the sensitive determination of pyrazole/pyrrole pesticides with high repeatability and excellent practical applicability.

  17. Synergism of insecticides provides evidence of metabolic mechanisms of resistance in the obliquebanded leafroller Choristoneura rosaceana (Lepidoptera: Tortricidae).

    Science.gov (United States)

    Ahmad, Mushtaq; Hollingworth, Robert M

    2004-05-01

    The interactions between six insecticides (indoxacarb, cypermethrin, chlorpyrifos, azinphosmethyl, tebufenozide and chlorfenapyr) and three potential synergists, (piperonyl butoxide (PBO), S,S,S-tributyl phosphorotrithioate (DEF) and diethyl maleate (DEM)) were studied by dietary exposure in a multi-resistant and a susceptible strain of the obliquebanded leafroller, Choristoneura rosaceana (Harris). The synergists did not produce appreciable synergism with most of the insecticides in the susceptible strain. Except for tebufenozide, PBO synergized all the insecticides to varying degrees in the resistant strain. A very high level of synergism by PBO was found with indoxacarb, which reduced the resistance level from 705- to 20-fold when PBO was administered alone and to around 10-fold when used in combination with DEF. DEF also synergized indoxacarb, cypermethrin, chlorpyrifos, azinphosmethyl and tebufenozide in the resistant strain. DEM produced synergism of indoxacarb, chlorpyrifos, azinphos-methyl and chlorfenapyr in the resistant strain. DEM was highly synergistic to cypermethrin, and to some extent to tebufenozide in both the susceptible and resistant strains equally, implying that detoxification by glutathione S-transferases was not a mechanism of resistance for these insecticides. The high level of synergism seen with DEM in the case of cypermethrin may be due to an increase in oxidative stress resulting from the removal of the antioxidant, glutathione. These studies indicate that enhanced detoxification, often mediated by cytochrome P-450 monooxygenases, but with probable esterase and glutathione S-transferase contributions in some cases, is the major mechanism imparting resistance to different insecticides in C. rosaceana.

  18. A new pyrrole alkaloid from seeds of Castanea sativa.

    Science.gov (United States)

    Hiermann, Alois; Kedwani, Samir; Schramm, Hans Wolfgang; Seger, Christoph

    2002-02-01

    A new pyrrole alkaloid, methyl-(5-formyl-1H-pyrrole-2-yl)-4-hydroxybutyrate (1), was isolated from sweet chestnut seeds and its structure elucidated on the basis of data from NMR spectroscopy and by comparison with synthetic analogues.

  19. Acute toxicities and sublethal effects of some conventional insecticides on Trichogramma chilonis (Hymenoptera: Trichogrammatidae).

    Science.gov (United States)

    Wang, De-Sen; He, Yu-Rong; Guo, Xiang-Ling; Luo, Yong-Li

    2012-08-01

    The acute toxicity of 10 conventional insecticides to adult of Trichogramma chilonis Ishii (Hymenoptera: Trichogrammatidae) was bioassayed by membrane method, and then their sublethal effects on the parasitoid were evaluated in the laboratory. Based on sublethal concentration (LC30) values at 8 h after treatment, we determined that adult T. chilonis were the most susceptible to chlorfenapyr, followed by fipronil, spinosad, avermectins, beta-cypermethrin, and cartap, with lethal concentration (LC)30 values of 0.3133, 0.3269, 1.5408, 3.2961, 6.1469, and 9.021 mg/liter, respectively. The field-recommended concentrations of chlorfluazuron, indoxacarb, Bacillus thuringiensis, and tebufenozide caused Cartap and spinosad also reduced longevity (8 and 7.9 d) and fecundity (110.77 and 117.2) of treated adults, but cartap enhanced the female percentage of F1 offspring (61.6%), resulting a statistical higher R0, r(m), and lambda of treated T. chilonis. In contrast, chlorfluazuron and tebufenozide increased longevity (16.4 and 15.4 d) and fecundity (248 and 256.9) of treated adults but slightly decreased the female percentage of F1 offspring (31.4 and 38.1%). Although chlorfenapyr showed no adverse influence on longevity and fecundity, it remarkably reduced the female percentage of F1 offspring (13.5%), leading to a lower R0, r(m), and lambda of treated T. chilonis. Indoxacarb, B. thuringiensis, and beta-cypermethrin had no obvious sublethal effects on the longevity and fecundity of treated adults. Based on these results, we consider B. thuringienesis, chlorfluazuron, indoxacarb, beta-cypermethrin, and tebufenozide safe to T. chilonis, suggesting that these insecticides are compatible with this parasitoid when being used in the field. However, fipronil, chlorfenapyr, spinosad, and avermectins were very harmful to T. chilonis. Timing of application of these insecticides was critical.

  20. Toxicity of nine insecticides on four natural enemies of Spodoptera exigua.

    Science.gov (United States)

    Liu, Yongqiang; Li, Xiangying; Zhou, Chao; Liu, Feng; Mu, Wei

    2016-12-13

    Spodoptera exigua, which feeds on various crops worldwide, has natural enemies that are susceptible to the insecticides used against S. exigua. We investigate the toxicity and residue risk of 9 insecticides on the development of H. axyridis, C. sinica, S. manilae and T. remus. S. manilae and T. remus adults were sensitive to all 9 insecticides (LC50 less than 2.75 mg a.i. liter(-1)), while H. axyridis and C. sinica adults were less sensitive (LC50 between 6 × 10(-5) mg a.i. liter(-1) and 78.95 mg a.i. liter(-1)). Emamectin benzoate, spinosad, indoxacarb, alpha-cypermethrin, chlorfenapyr and chlorantraniliprole showed no toxicity on H. axyridis, C. sinica, S. manilae and T. remus pupae with the recommended field concentrations. The risk analysis indicated that chlorantraniliprole is harmless to larvae of four natural enemies and adult of H. axyridis, C. sinica and S. manilae. Emamectin benzoate and spinosad had higher safety to the development of H. axyridis, C. sinica, S. manilae and T. remus with the risk duration less than 4d. Indoxacarb, tebufenozide, chlorfenapyr, methomyl, alpha-cypermethrin and chlorpyrifos showed dangerously toxic and long risk duration on S. manilae and T. remus adults.

  1. Control of pyrethroid-resistant Anopheles gambiae and Culex quinquefasciatus mosquitoes with chlorfenapyr in Benin.

    Science.gov (United States)

    N'Guessan, Raphael; Boko, Pelagie; Odjo, Abiba; Knols, Bart; Akogbeto, Martin; Rowland, Mark

    2009-04-01

    To compare the efficacy of chlorfenapyr applied on mosquito nets and as an indoor residual spray against populations of Anopheles gambiae and Culex quinquefasciatus in an area of Benin that shows problematic levels of pyrethroid resistance. Eight-week trial conducted in experimental huts. Indoor residual spraying killed 82.9% of An. gambiae overall (mean mortality: 79.5%) compared to 53.5% overall (mean mortality: 61.7%) in the hut containing the lower dosed ITN. Analysis of data on a fortnightly basis showed high levels of mosquito mortality and blood-feeding inhibition during the first few weeks after treatment. Control of C. quinquefasciatus by the IRS and ITN interventions showed a similar trend to that of An. gambiae and though the average level of mortality was lower it was still much higher than with pyrethroid treatments against this population. Chlorfenapyr's reputation for being rather slow acting was evident particularly at lower dosages. The treatments showed no evidence of excito-repellent activity in this trial. Chlorfenapyr has the potential to control pyrethroid resistant populations of A. gambiae. There is a need to develop long-lasting formulations of chlorfenapyr to prolong its residual life on nets and sprayed surfaces. On nets it could be combined with a contact irritant pyrethroid to give improved protection against mosquito biting while killing pyrethroid-resistant mosquitoes that come into contact with the net.

  2. Control of pyrethroid-resistant Anopheles gambiae and Culex quinquefasciatus mosquitoes with chlorfenapyr in Benin

    NARCIS (Netherlands)

    N'Guessan, R.; Boko, P.; Odjo, A.; Knols, B.G.J.; Akogbeto, M.; Rowland, M.

    2009-01-01

    Objective To compare the efficacy of chlorfenapyr applied on mosquito nets and as an indoor residual spray against populations of Anopheles gambiae and Culex quinquefasciatus in an area of Benin that shows problematic levels of pyrethroid resistance. Method Eight-week trial conducted in experimental

  3. Control of pyrethroid-resistant Anopheles gambiae and Culex quinquefasciatus mosquitoes with chlorfenapyr in Benin

    NARCIS (Netherlands)

    N'Guessan, R.; Boko, P.; Odjo, A.; Knols, B.G.J.; Akogbeto, M.; Rowland, M.

    2009-01-01

    Objective To compare the efficacy of chlorfenapyr applied on mosquito nets and as an indoor residual spray against populations of Anopheles gambiae and Culex quinquefasciatus in an area of Benin that shows problematic levels of pyrethroid resistance. Method Eight-week trial conducted in experimental

  4. BRIEF COMMUNICATIONS: Picosecond spectroscopy of pyrrol pigments

    Science.gov (United States)

    Lippitsch, M. E.; Leitner, A.; Riegler, M.; Aussenegg, F. R.

    1982-05-01

    Picosecond fluorescence and absorption spectroscopy methods were used to study pyrromethenone, pyrromethene, and biliverdin. These methods made it possible to determine some details of the kinetics of various relaxation mechanisms. The results obtained provided a better understanding of the biological action of pyrrol pigments.

  5. Tris[2-(pyrrol-2-ylmethyleneaminoethyl]amine

    Directory of Open Access Journals (Sweden)

    Hongbing Fu

    2008-03-01

    Full Text Available The title compound, C21H27N7, was synthesized by reaction of tris(2-aminoethylamine and pyrrole-2-carbaldehyde in ethanol at room temperature. The structure is stabilized by intra- and intermolecular C—H...N and N—H...N hydrogen-bonding interactions.

  6. First detection of chlorfenapyr (Secure) resistance in two-spotted spider mite (Acari: Tetranychidae) from nectarines in an Australian orchard.

    Science.gov (United States)

    Herron, G A; Rophail, J

    2003-01-01

    Chlorfenapyr resistance (2.9- and 19.9-fold respectively at LC50 and LC99 level) was detected in Tetranychus urticae Koch causing control failure following a single application of product to nectarines.

  7. Flexible supercapacitor based on electrochemically synthesized pyrrole formyl pyrrole copolymer coated on carbon microfibers

    Science.gov (United States)

    Gholami, Mehrdad; Moozarm Nia, Pooria; Narimani, Leila; Sokhakian, Mehran; Alias, Yatimah

    2016-08-01

    The main objective of this work is to prepare a flexible supercapacitor using electrochemically synthesized pyrrole formyl pyrrole copolymer P(Py-co-FPy) coated on the carbon microfibers. Due to difficulties of working with carbon microfibers, glassy carbon was used to find out optimized conditions by varying mole ratio of pyrrole and formyl pyrrole monomers on the capacitance value. The prepared electrodes were characterized using Fourier transform infrared spectroscopy (FT-IR), field emission scanning electron microscope (FESEM), Brunauer-Emmett-Teller (BET) analysis, cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS). Then the X-ray photoelectron spectroscopy (XPS) was used to characterize the optimized electrode. The specific capacitance is calculated using cyclic voltammetry, charge/discharge method, and impedance spectroscopy. The charge/discharge study reveals that the best specific capacitance is estimated to be 220.3 mF cm-2 for equal mole fraction of pyrrole and formyl pyrrole Py (0.1)-FP (0.1) at discharge current of 3 × 10-4 A. This optimized electrode keeps about 92% of its capacitance value in high current of discharging. The specific capacitances calculated by all the mentioned methods are in agreement with each other. Finally, the found optimized conditions were successfully applied to produce a flexible supercapacitor on the surface of carbon microfibers.

  8. Electrochemical polypyrrole formation from pyrrole 'adlayer'.

    Science.gov (United States)

    Plausinaitis, Deivis; Sinkevicius, Linas; Mikoliunaite, Lina; Plausinaitiene, Valentina; Ramanaviciene, Almira; Ramanavicius, Arunas

    2017-01-04

    In this research study, we investigated the morphology of polypyrrole nanostructures, which were formed during the electrochemical deposition of conducting polymer. An electrochemical quartz crystal microbalance (EQCM) cell equipped with a flow-through system was employed to exchange solutions of different compositions within the EQCM cell. When bare PBS buffer in the EQCM cell was exchanged with PBS buffer with pyrrole we observed a distinct increase in the resonance frequency Δf. This change in the resonance frequency and electrical capacitance, which was calculated from electrochemical impedance spectroscopy (EIS) data, illustrate that pyrrole on the surface of the gold electrode formed an adsorbed layer (adlayer). The formation of a pyrrole adlayer before the potential pulse that induced polymerization was investigated by QCM-based measurements. The electrochemical polymerization of this adlayer was induced by a single potential pulse and a nanostructured layer, which consisted of adsorbed polypyrrole (Ppy) nanoparticles with a diameter of 50 nm, was formed. QCM and EIS data revealed that by the next cycle of the electrochemical formation of Ppy, which was investigated after flow-through-based exchange of solutions, the initially formed Ppy surface was covered by the adlayer of pyrrole. This adlayer was desorbed when pyrrole was removed from the solution. When electrochemical polymerization was performed using 50 potential pulses, a Ppy layer, which had more complex morphology, was formed on the EQCM crystal. Scanning electron microscopy showed that the conductivity of this layer was unequally distributed. We observed that the polypyrrole layer formed by electrochemical deposition, which was performed using potential pulses, was formed out of aggregated spherical Ppy particles with a diameter of 50 nm.

  9. Using a Lethality Index to Assess Susceptibility of Tribolium confusum and Oryzaephilus surinamensis to Insecticides.

    Directory of Open Access Journals (Sweden)

    Paraskevi Agrafioti

    Full Text Available We evaluated knockdown caused by four insecticides: alpha-cypermethrin, chlorfenapyr, pirimiphos-methyl and fipronil against adults of Tribolium confusum Jacquelin Duval, the confused flour beetle and Oryzaephilus surinamensis (L., the sawtoothed grain beetle. Bioassays were conducted on concrete and metal surfaces. Adults of the tested species were exposed on both surfaces treated with the above insecticides at two doses (low and high. Knockdown assessment was done after 15, 30 and 60 min of adult exposure in the treated surfaces. Also, after 1, 3, 5, 7 and 14 d of exposure, a lethality index was calculated with an equation resulting to values from 0 to 100, where 100 indicated complete mortality and 0 complete survival. We also developed a lethality index by ranking each adult on each surface from 0 to 4, 0: adults moved normally, 1: adults were knocked down, but were able to walk for short intervals, 2: adults were knocked down and unable to walk, but with visible movement of antennae etc., 3: adults were knocked down, with very minimal movement of the tarsi and the antennae and 4: adults were dead (no movement. Knockdown of adults immediately after exposure (15-60 min was higher for pirimiphos-methyl followed by alpha-cypermethrin, for both dose rates tested and species, but only on the metal surface. The lethality index was nearly 100 for all insecticides after 5d of exposure for O. surinamensis, while for T. confusum the adult lethality index was considerably lower for alpha-cypermethrin, suggesting that that recovery from knockdown occurred. Chlorfenapyr was the only insecticide that was more effective on concrete than on metal, while the reverse was noted for the other three insecticides. These results show that knockdown has different levels, which can be used as indicators of insect mortality or recovery.

  10. Monitoring for Insecticide Resistance in Asian Citrus Psyllid (Hemiptera: Psyllidae) Populations in Florida.

    Science.gov (United States)

    Kanga, Lambert H B; Eason, Julius; Haseeb, Muhammad; Qureshi, Jawwad; Stansly, Philip

    2016-04-01

    The development of insecticide resistance in Asian citrus psyllid, Diaphorina citri Kuwayama, populations is a serious threat to the citrus industry. As a contribution to a resistance management strategy, we developed a glass vial technique to monitor field populations of Asian citrus psyllid for insecticide resistance. Diagnostic concentrations needed to separate susceptible genotypes from resistant individuals were determined for cypermethrin (0.5 μg per vial), malathion (1.0 μg per vial), diazinon (1.0 μg per vial), carbaryl (1.0 μg per vial), carbofuran (0.1 μg per vial), methomyl (1.0 μg per vial), propoxur (1.0 μg per vial), endosulfan (1.0 μg per vial), imidacloprid (0.5 μg per vial), acetamiprid (5.0 μg per vial), chlorfenapyr (2.5 μg per vial), and fenpyroximate (2.5 μg per vial). In 2014, resistance to two carbamate insecticides (carbaryl and carbofuran), one organophosphate (malathion), one pyrethroid (cypermethrin), and one pyrazole (fenpyroximate) was detected in field populations of Asian citrus psyllid in Immokalee, FL. There was no resistance detected to diazinon, methomyl, propoxur, endosulfan, imidacloprid, and chlorfenapyr. The levels of insecticide resistance were variable and unstable, suggesting that resistance could be successfully managed. The results validate the use of the glass vial bioassay to monitor for resistance in Asian citrus psyllid populations and provide the basis for the development of a resistance management strategy designed to extend the efficacy of all classes of insecticides used for control of the Asian citrus psyllid.

  11. Using a Lethality Index to Assess Susceptibility of Tribolium confusum and Oryzaephilus surinamensis to Insecticides.

    Science.gov (United States)

    Agrafioti, Paraskevi; Athanassiou, Christos G; Vassilakos, Thomas N; Vlontzos, George; Arthur, Frank H

    2015-01-01

    We evaluated knockdown caused by four insecticides: alpha-cypermethrin, chlorfenapyr, pirimiphos-methyl and fipronil against adults of Tribolium confusum Jacquelin Duval, the confused flour beetle and Oryzaephilus surinamensis (L.), the sawtoothed grain beetle. Bioassays were conducted on concrete and metal surfaces. Adults of the tested species were exposed on both surfaces treated with the above insecticides at two doses (low and high). Knockdown assessment was done after 15, 30 and 60 min of adult exposure in the treated surfaces. Also, after 1, 3, 5, 7 and 14 d of exposure, a lethality index was calculated with an equation resulting to values from 0 to 100, where 100 indicated complete mortality and 0 complete survival. We also developed a lethality index by ranking each adult on each surface from 0 to 4, 0: adults moved normally, 1: adults were knocked down, but were able to walk for short intervals, 2: adults were knocked down and unable to walk, but with visible movement of antennae etc., 3: adults were knocked down, with very minimal movement of the tarsi and the antennae and 4: adults were dead (no movement). Knockdown of adults immediately after exposure (15-60 min) was higher for pirimiphos-methyl followed by alpha-cypermethrin, for both dose rates tested and species, but only on the metal surface. The lethality index was nearly 100 for all insecticides after 5d of exposure for O. surinamensis, while for T. confusum the adult lethality index was considerably lower for alpha-cypermethrin, suggesting that that recovery from knockdown occurred. Chlorfenapyr was the only insecticide that was more effective on concrete than on metal, while the reverse was noted for the other three insecticides. These results show that knockdown has different levels, which can be used as indicators of insect mortality or recovery.

  12. Insecticide resistance status of field populations of Spodoptera exigua (Lepidoptera: Noctuidae) from China.

    Science.gov (United States)

    Che, Wunan; Shi, Tian; Wu, Yidong; Yang, Yihua

    2013-08-01

    Beet armyworm, Spodoptera exigua (Hübner), is a serious pest of vegetables in China, and its control is heavily dependent on chemical insecticides. The current resistance status of nine insecticides was investigated in 16 field populations collected from seven provinces of China during 2009-2012. Compared with the susceptible strain WH-S, some field populations evolved various levels of resistance to eight of the nine insecticides tested: emamectin benzoate (4- to 348-fold), indoxacarb (2- to 41-fold), spinosad (5- to 38-fold), chlorantraniliprole (2- to 44-fold), tebufenozide (2- to 87-fold), chlorfluazuron (3- to 31-fold), cypermethrin (79- to 1240-fold), and chlorpyrifos (8- to 3,080-fold), but no significant resistance was detected to chlorfenapyr (0.4- to 7-fold). This indicates that chlorfenapyr has no cross-resistance with these other currently used insecticides. Four consecutive years' resistance screening at two places shows that resistance patterns were different between populations from Luhe (Jiangsu Province) and Fengxian (Shanghai), which are approximately 300 km apart. Resistance levels to chlorpyrifos were much higher in populations from Luhe (877- to 3,080-fold) than from Fengxian (8- to 110-fold). Fengxian populations developed moderate levels of resistance to tebufenozide (13- to 87-fold), but no resistance in Luhe populations (2- to 6-fold). However, Luhe populations developed moderate levels of resistance to chlorfluazuron (21- to 31-fold), but there was no resistance in Fengxian populations (3- to 5-fold). It is suggested that local insecticide selection determined resistance patterns although S. exigua has long-distance migratory potential. Adaptive resistance management tactics (such as rotations) should be designed and implemented based on the resistance patterns of S. exigua for each geographic area.

  13. Using a Lethality Index to Assess Susceptibility of Tribolium confusum and Oryzaephilus surinamensis to Insecticides

    Science.gov (United States)

    Vlontzos, George; Arthur, Frank H.

    2015-01-01

    We evaluated knockdown caused by four insecticides: alpha-cypermethrin, chlorfenapyr, pirimiphos-methyl and fipronil against adults of Tribolium confusum Jacquelin Duval, the confused flour beetle and Oryzaephilus surinamensis (L.), the sawtoothed grain beetle. Bioassays were conducted on concrete and metal surfaces. Adults of the tested species were exposed on both surfaces treated with the above insecticides at two doses (low and high). Knockdown assessment was done after 15, 30 and 60 min of adult exposure in the treated surfaces. Also, after 1, 3, 5, 7 and 14 d of exposure, a lethality index was calculated with an equation resulting to values from 0 to 100, where 100 indicated complete mortality and 0 complete survival. We also developed a lethality index by ranking each adult on each surface from 0 to 4, 0: adults moved normally, 1: adults were knocked down, but were able to walk for short intervals, 2: adults were knocked down and unable to walk, but with visible movement of antennae etc., 3: adults were knocked down, with very minimal movement of the tarsi and the antennae and 4: adults were dead (no movement). Knockdown of adults immediately after exposure (15–60 min) was higher for pirimiphos-methyl followed by alpha-cypermethrin, for both dose rates tested and species, but only on the metal surface. The lethality index was nearly 100 for all insecticides after 5d of exposure for O. surinamensis, while for T. confusum the adult lethality index was considerably lower for alpha-cypermethrin, suggesting that that recovery from knockdown occurred. Chlorfenapyr was the only insecticide that was more effective on concrete than on metal, while the reverse was noted for the other three insecticides. These results show that knockdown has different levels, which can be used as indicators of insect mortality or recovery. PMID:26560316

  14. HPLC/UV analysis of chlorfenapyr residues in cabbage and soil to study the dynamics of different formulations.

    Science.gov (United States)

    Cao, Yongsong; Chen, Jiuxin; Wang, Yuelong; Liang, Ji; Chen, Lihua; Lu, Yitong

    2005-11-01

    The chlorfenapyr analysis method of residue, its degradation and final residue in soil and cabbage were studied. Residues of chlorfenapyr were extracted from soil and cabbage with acetone/water, purified by liquid/liquid partition and chromatographic column, concentrated to a small volume, and then determined by HPLC equipped with UV detector. The mean accuracy of analytical method were 93.3% and 90.6% in soil and cabbage, respectively; the precision (repeatability) in cabbage ranging from 1.7% to 11.8%, in soil ranging from 2.8% to 11.2%; the precision (reproducibility) in cabbage ranged from 2.2% to 12.1%, in soil it ranged from 2.4% to 11.5%. The minimum detectable amount of chlorfenapyr was 0.65 ng, the minimum detectable concentration was 0.0162 mg kg-1. The degradation of chlorfenapyr formulations in soil and cabbage was determined. The results showed that chlorfenapyr nanoformulation and suspension concentration degradation in soil coincided with C=0.2538 e-0.1612t, C=0.537 e-0.1754t, respectively; the half-lives were about 4.3 d and 3.9 d, respectively. Two kinds of chlorfenapyr formulation degradation in cabbage coincided with C=4.0431 e-0.3103t, C=6.9611 e-0.2686t respectively; the half-lives were about 2.2 d and 2.6, d, respectively. When chlorfenapyr formulations were applied according to the double recommended dose, the final residues in cabbage were much lower than the USA EPA's maximum residue limit of 1 mg kg-1 in vegetables. The degradation rate of chlorfenapyr nanoformulation was faster than that of suspension concentration, and the former residue was also less in soil. Therefore, a harvest interval should be more than 5 d, and a dosage of 900 mL/hm2 was suggested for chlorfenapyr suspension concentration, which could be considered as safe to human beings and animals. Chlorfenapyr nanoformulation was safer than suspension concentration, its harvest interval and dosage can attain a high level.

  15. Vibrational Overtone Spectroscopy of Pyrrole and Pyrrolidine

    Science.gov (United States)

    1991-05-23

    general pattern is a strong peak accompanied by two or three weaker peaks to lower energy. For instance, the 13,305 cm-I band in pyrrole has three weaker...Orza, J.M. Anales de Quimica 1984, 80, 59. 29. Navarro, R.; Orza, J.M. Anales de Quimica 1982, 79, 557. 30. Xie, Y; Fan, K.; Boggs,J., Molec. Phys

  16. Chlorfenapyr ear tags to control Haematobia irritans (L.) (Diptera: Muscidae) on cattle.

    Science.gov (United States)

    Guglielmone, A A; Volpogni, M M; Scherling, N; Cobeñas, M M; Mangold, A J; Anziani, O S; Ioppolo, M; Doscher, M

    2000-11-01

    The efficacy of ear tags containing 30% chlorfenapyr (total tag weight=13g) to control natural Haematobia irritans (L.) infestations was evaluated for Holstein heifers in Rafaela, province of Santa Fe, Argentina. A group of heifers (TG) was treated with two ear tags (one tag per ear). A control group (ACG) was maintained in a paddock adjacent to the TG paddock and, a distant control group (DCG) was maintained 700m apart from the other groups. From day 4 to day 98 after treatment, H. irritans infestations of ACG were significantly higher (Pchlorfenapyr control period, with an efficacy higher than 90% to reduce horn fly populations, lasted for 9 weeks when TG infestation was compared to fly numbers in ACG, but increased to 12 weeks in comparison to DCG. The results of this study show that ear tags impregnated with chlorfenapyr are a useful alternative to pyrethroids and organo-phosphate compounds for horn fly control.

  17. Residue behavior and risk assessment of mixed formulation of imidacloprid and chlorfenapyr in chieh-qua under field conditions.

    Science.gov (United States)

    Huang, Jian Xiang; Liu, Cong Yun; Lu, Da Hai; Chen, Jia Jia; Deng, Yi Cai; Wang, Fu Hua

    2015-10-01

    A simple and rapid method based on high-performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS) was developed for the simultaneous determination of imidacloprid and chlorfenapyr residues in chieh-qua. Field trials were designed to investigate the dissipation and terminal residue behavior of the mixed formulation of imidacloprid and chlorfenapyr in chieh-qua in Guangzhou and Nanning areas. Risk assessment was performed by calculating the risk quotient (RQ) values. The developed analytical method exhibited recoveries of 89.9-110.3% with relative standard deviations (RSDs) of 2.8-12.5% at the spiked levels of 0.01, 0.10, and 1.00 mg/kg. The limit of detection (LOD) was 0.003 mg/kg, and the limit of quantification (LOQ) was 0.01 mg/kg for both imidacloprid and chlorfenapyr. It was found that the half-lives of imidacloprid in chieh-qua under field conditions were 3.3 and 3.5 days in Guangzhou and Nanning at a dose of 180 g ai/ha, while the half-lives of chlorfenapyr were 3.3 and 2.6 days, respectively. The terminal residues of imidacloprid and chlorfenapyr were from 0.01 to 0.21 mg/kg and from 0.01 to 0.46 mg/kg, respectively. Results of dietary exposure assessment showed that the RQ values were much lower than 1, indicating that the risk of imidacloprid and chlorfenapyr applied in chieh-qua was negligible to human health under recommended dosage and good agricultural practices. The proposed study would provide guidance for safe and reasonable use of imidacloprid and chlorfenapyr in chieh-qua cultivation in China.

  18. Food source and residual efficacy of chlorfenapyr on sealed and unsealed concrete

    Science.gov (United States)

    Adult Tribolium castaneum (Herbst), the red flour beetle, were exposed at 1 day, and 2, 4, and 6 weeks post-treatment on sealed and unsealed concrete arenas treated with chlorfenapyr at rates of 2.8, 6.9, 13.5, 20.6, 27.5 mg active ingredient/m2. Beetles were held either with or without flour, and a...

  19. Flexible supercapacitor based on electrochemically synthesized pyrrole formyl pyrrole copolymer coated on carbon microfibers

    Energy Technology Data Exchange (ETDEWEB)

    Gholami, Mehrdad, E-mail: mehrdad897@um.edu.my [University of Malaya center for ionic liquids, Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur (Malaysia); Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur (Malaysia); Department of Chemistry, Marvdasht Branch, Islamic Azad University, P.O. Box 465, Marvdasht (Iran, Islamic Republic of); Moozarm Nia, Pooria, E-mail: pooriamn@yahoo.com [University of Malaya center for ionic liquids, Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur (Malaysia); Narimani, Leila, E-mail: Narimani.leila@gmail.com [University of Malaya center for ionic liquids, Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur (Malaysia); Sokhakian, Mehran, E-mail: m.sokhakian@gmail.com [University of Malaya center for ionic liquids, Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur (Malaysia); Alias, Yatimah, E-mail: yatimah70@um.edu.my [University of Malaya center for ionic liquids, Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur (Malaysia); Department of Chemistry, Faculty of Science, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2016-08-15

    Highlights: • A Flexible supercapacitor prepared by carbon microfibers coated with P(Py-co-FPy). • The variation of capacitance with different mole ratio of monomers is investigated. • The capacitance measured by different electrochemical methods. • This flexible supercapacitor can be discharged in higher currents for longer time. - Abstract: The main objective of this work is to prepare a flexible supercapacitor using electrochemically synthesized pyrrole formyl pyrrole copolymer P(Py-co-FPy) coated on the carbon microfibers. Due to difficulties of working with carbon microfibers, glassy carbon was used to find out optimized conditions by varying mole ratio of pyrrole and formyl pyrrole monomers on the capacitance value. The prepared electrodes were characterized using Fourier transform infrared spectroscopy (FT-IR), field emission scanning electron microscope (FESEM), Brunauer–Emmett–Teller (BET) analysis, cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS). Then the X-ray photoelectron spectroscopy (XPS) was used to characterize the optimized electrode. The specific capacitance is calculated using cyclic voltammetry, charge/discharge method, and impedance spectroscopy. The charge/discharge study reveals that the best specific capacitance is estimated to be 220.3 mF cm{sup −2} for equal mole fraction of pyrrole and formyl pyrrole Py (0.1)-FP (0.1) at discharge current of 3 × 10{sup −4} A. This optimized electrode keeps about 92% of its capacitance value in high current of discharging. The specific capacitances calculated by all the mentioned methods are in agreement with each other. Finally, the found optimized conditions were successfully applied to produce a flexible supercapacitor on the surface of carbon microfibers.

  20. Method validation and dissipation dynamics of chlorfenapyr in squash and okra.

    Science.gov (United States)

    Abdel Ghani, Sherif B; Abdallah, Osama I

    2016-03-01

    QuEChERS method combined with GC-IT-MS was developed and validated for the determination of chlorfenapyr residues in squash and okra matrices. Method accuracy, repeatability, linearity and specificity were investigated. Matrix effect was discussed. Determination coefficients (R(2)) were 0.9992 and 0.9987 in both matrices. LODs were 2.4 and 2.2μg/kg, while LOQs were 8.2 and 7.3μg/kg. Method accuracy ranged from 92.76% to 106.49%. Method precision RSDs were ⩽12.59%. A field trial to assess chlorfenapyr dissipation behavior was carried out. The developed method was employed in analyzing field samples. Dissipation behavior followed first order kinetics in both crops. Half-life values (t1/2) ranged from 0.2 to 6.58days with determination coefficient (R(2)) ranged from 0.78 to 0.96. The developed method was utilized for surveying chlorfenapyr residues in squash and okra samples collected from the market. Monitoring results are discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Cytotoxic and genotoxic effects of abamectin, chlorfenapyr, and imidacloprid on CHOK1 cells.

    Science.gov (United States)

    Al-Sarar, Ali S; Abobakr, Yasser; Bayoumi, Alaa E; Hussein, Hamdy I

    2015-11-01

    The cytotoxicity and genotoxicity of abamectin, chlorfenapyr, and imidacloprid have been evaluated on the Chinese hamster ovary (CHOK1) cells. Neutral red incorporation (NRI), total cellular protein content (TCP), and methyl tetrazolium (MTT) assays were followed to estimate the mid-point cytotoxicity values, NRI50, TCP50, and MTT50, respectively. The effects of the sublethal concentration (NRI25) on glutathione S-transferase (GST), glutathione reductase (GRD), glutathione peroxidase (GPX), and total glutathione content have been evaluated in the presence and absence of reduced glutathione (GSH), vitamin C, and vitamin E. The genotoxicity was evaluated using chromosomal aberrations (CA), micronucleus (MN) formation, and DNA fragmentation techniques in the presence and absence of the metabolic activation system, S9 mix. Abamectin was the most cytotoxic pesticide followed by chlorfenapyr, while imidacloprid was the least cytotoxic one. The glutathione redox cycle components were altered by the tested pesticides in the absence and presence of the tested antioxidants. The results of genotoxicity indicate that abamectin, chlorfenapyr, and imidacloprid have potential genotoxic effects on CHOK1 cells under the experimental conditions.

  2. Residual efficacy of chlorfenapyr for control of stored-product psocids (Psocoptera).

    Science.gov (United States)

    Athanassiou, Christos G; Kavallieratos, Nickolas G; Arthur, Frank H; Throne, James E

    2014-04-01

    The residual effect of chlorfenapyr (Phantom) was evaluated for residual control of three stored-product psocid species: Liposcelis bostrychophila Badonnel, Liposcelis entomophila (Enderlein), and Liposcelis paeta Pearman (Psocoptera: Liposcelididae). Chlorfenapyr was applied to individual arenas with a concrete surface at rates of 0, 2.8, 13.8, 20.6, 27.5, 55, and 110 mg active ingredient (AI)/m2. Adults were exposed on the treated arenas and mortality assessed after 1, 2, and 3 d. The procedures were repeated weekly on the same treated arenas for 3 wk to assess residual efficacy. At each week, mortality of all species was low after 1 d of exposure but notably increased after 2 or 3 d. L. entomophila was the most susceptible species, with 99-100% mortality at rates of 13.8 mg/m2 or higher. Similarly, mortality of L. paeta after 3 d of exposure at the same concentration ranged from 92 to 100%. L. bostrychophila was the least susceptible species, with mortality of 27.5 mg/m2. Complete mortality of all species occurred after 3 d exposure at the highest rate tested of 110 mg/m2. Thus, our results show that chlorfenapyr is effective against major psocid species at the application rates evaluated in this study.

  3. Probing the hydrolytic reactivity of 2-difluoromethyl pyrroles.

    Science.gov (United States)

    Melanson, Jennifer A; Figliola, Carlotta; Smithen, Deborah A; Kajetanowicz, Aleksandra K; Thompson, Alison

    2016-12-20

    α-Difluoromethyl pyrroles were found to be stable while N-protected with an electron-withdrawing group. Due to the propensity of pyrroles to access azafulvenium-like intermediates, the C-F bonds of an α-difluoromethyl substituent are labile under hydrolytic conditions. The presence of certain electron-withdrawing substituents about the pyrrolic ring can accelerate this process, as determined through a kinetic comparison of the deprotection and subsequent hydrolysis reactions of N-protected β-aryl α-difluoromethyl pyrroles.

  4. Lethal and sublethal effects of insecticide residues on Orius insidiosus (Hemiptera: Anthocoridae) and Geocoris punctipes (Hemiptera: Lygaeidae).

    Science.gov (United States)

    Elzen, G W

    2001-02-01

    Laboratory-reared predators, the insidious flower bug, Orius insidiosus (Say), and big-eyed bug Geocoris punctipes (Say), were exposed to 10 insecticides, including three newer insecticides with novel modes of action, using a residual insecticide bioassay. These species are important predators of several economic pests of cotton. Insecticides tested were: azinphos-methyl, imidacloprid, spinosad, tebufenozide, fipronil, endosulfan, chlorfenapyr, cyfluthrin, profenofos, and malathion. There was considerable variation in response between both species tested to the insecticides. Tebufenozide and cyfluthrin were significantly less toxic to male O. insidiosus than malathion. Tebufenozide was also significantly less toxic to female O. insidiosus than malathion. Imidacloprid, tebufenozide, and spinosad were significantly less toxic to male G. punctipes than chlorfenapyr, endosulfan, and fipronil. Spinosad, tebufenozide, and azinphos-methyl were significantly less toxic to female G. punctipes than fipronil and endosulfan. Fecundity of O. insidiosus was significantly greater in the spinosad treatment compared with other treatments including the control. Consumption of bollworm, Helicoverpa zea (Boddie), eggs by O. insidiosus was significantly lower in the fipronil, profenofos, and cyfluthrin treatments compared with other treatments including the control. Consumption of H. zea eggs by G. punctipes was significantly lower in the malathion, profenofos, endosulfan, fipronil, azinphos-methyl, and imidacloprid treatments compared with the control. Egg consumption by G. punctipes was not significantly different in the tebufenozide treatment compared with the control. The lower toxicity of spinosad to G. punctipes is consistent with other reports. Based on these results, the following insecticides are not compatible with integrated pest management of cotton pests: malathion, endosulfan, profenofos, fipronil, and cyfluthrin; while imidacloprid, tebufenozide, azinphos-methyl, and

  5. Morphology and electrical properties of electrochemically synthesized pyrrole-formyl pyrrole copolymer

    Science.gov (United States)

    Gholami, Mehrdad; Nia, Pooria Moozarm; Alias, Yatimah

    2015-12-01

    A direct electrochemical copolymerization of pyrrole-formyl pyrrole (Py-co-FPy) was carried out by oxidative copolymerization of formyl pyrrole and pyrrole in LiClO4 aqueous solution through galvanostatic method. The (Py-co-FPy) copolymer was characterized using Fourier-transform infrared spectroscopy (FT-IR), field emission scanning electron microscope (FESEM), energy-filtering transmission electron microscope (EFTEM), thermal gravimetric analysis (TGA), X-ray photoelectron spectroscopy (XPS), cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS). The FESEM images showed that the synthesized copolymer had a hollow whelk-like helixes structure, which justifies the enhancement of charge transportation through the copolymer film. Cyclic voltammetry studies revealed that the electrocatalytic activity of synthesized copolymer has improved and the surface coverage in copolymer enhanced 1.6 times compared to polypyrrole alone. Besides, (Py-co-FPy) copolymer showed 2.5 times lower electrochemical charge transfer resistance (Rct) value in impedance spectroscopy. Therefore, this copolymer has a strong potential to be used in several applications such as sensor applications.

  6. Multiple Resistances Against Formulated Organophosphates, Pyrethroids, and Newer-Chemistry Insecticides in Populations of Helicoverpa armigera (Lepidoptera: Noctuidae) from Pakistan.

    Science.gov (United States)

    Qayyum, Mirza Abdul; Wakil, Waqas; Arif, Muhammad Jalal; Sahi, Shahbaz Talib; Saeed, Noor Abid; Russell, Derek Allan

    2015-02-01

    Field populations of Helicoverpa armigera Hübner from 15 localities across the Punjab, Pakistan, were assessed by the leaf dip method for resistance against formulated organophosphates, pyrethroids, and newer insecticide groups. Resistance levels in H. armigera have been incrementally increasing for organophosphate and pyrethroid insecticides after decades of use in Pakistan. Resistance ratios (RRs) documented for organophosphates were 24- to 116-fold for profenofos and 22- to 87-fold for chlorpyrifos. For pyrethroids, RRs were 3- to 69-fold for cypermethrin and 3- to 27-fold for deltamethrin. Resistance levels against newer chemistries were 2- to 24-fold for chlorfenapyr, 1- to 22-fold for spinosad, 1- to 20-fold for indoxacarb, 1- to 18-fold for abamectin, and 1- to 16-fold for emamectin benzoate. Resistant populations of H. armigera were mainly in the southern part of the Punjab, Pakistan. The most resistant populations were collected from Pakpattan, Multan, and Muzzafargarh. Of the nine insecticides tested, LC50 and LC90 values were lower for newer insecticide groups; resistance levels were moderate to very high against organophosphates, very low to high against pyrethroids, and very low to low against the newer-chemistry insecticides. These findings suggest that the newer-chemistry insecticides with different modes of action could be included in insecticide rotations or replace the older insecticides. Supplementing the use of synthetic insecticides with safer alternatives could help to successfully lower the farmer's reliance on insecticides and the incidence of resistance due to repeated use of insecticides against major insect pests. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  7. Revisiting the relaxation dynamics of isolated pyrrole

    Energy Technology Data Exchange (ETDEWEB)

    Montero, Raúl; Ovejas, Virginia; Fernández-Fernández, Marta; Longarte, Asier, E-mail: asier.longarte@ehu.es [Departamento de Química Física, Universidad del País Vasco (UPV/EHU), Apart. 644, 48080 Bilbao (Spain); Peralta Conde, Álvaro [Centro de Láseres Pulsados (CLPU), Edificio M3, Parque Científico, 37185 Villamayor (Spain)

    2014-07-07

    Herein, the interpretation of the femtosecond-scale temporal evolution of the pyrrole ion signal, after excitation in the 267–217 nm interval, recently published by our group [R. Montero, A. Peralta Conde, V. Ovejas, M. Fernández-Fernández, F. Castaño, J. R. Vázquez de Aldana, and A. Longarte, J. Chem. Phys.137, 064317 (2012)] is re-visited. The observation of a shift in the pyrrole{sup +} transient respect to zero delay reference, initially attributed to ultrafast dynamics on the πσ{sup *} type state (3s a{sub 1} ← π 1a{sub 2}), is demonstrated to be caused by the existence of pump + probe populated states, along the ionization process. The influence of these resonances in pump-prone ionization experiments, when multi-photon probes are used, and the significance of a proper zero-time reference, is discussed. The possibility of preparing the πσ{sup *} state by direct excitation is investigated by collecting 1 + 1 photoelectron spectra, at excitation wavelengths ranging from 255 to 219 nm. No conclusive evidences of ionization through this state are found.

  8. Physiological selectivity of insecticides to adult of Doru luteipes (Scudder, 1876 (Dermaptera: Forficulidae

    Directory of Open Access Journals (Sweden)

    Ana Carolina Maciel Redoan

    Full Text Available Doru luteipes (SCUDDER, 1876 is considered one of the best natural enemies of the fall armyworm Spodoptera frugiperda (J. E. Smith, 1797 (Lepidoptera: Noctuidae, feeding on their eggs and small caterpillars. For its conservation it is necessary to use selective insecticides to S. frugiperda and harmless to the predator. Therefore, objective of the present work was to evaluate the toxicity of insecticides registered to control of S. frugiperda. It was conducted bioassays with D. luteipes adults treated with insecticides directly by exposure to residues of compounds applied on glass plates and the consumption of eggs of S. frugiperda contaminated and offered each one, 24 and 48 hours after treatment. The insecticides were classified according to indices proposed by IOBC/WPRS. For adults D. luteipes treated directly with insecticides, triflumuron was harmless (class 1; chlorfenapyr and etofenprox as slightly harmful (class 2 teflubenzuron/α-cypermethrin and spinosad moderately harmful (class 3 and thiamethoxan/λ-cyhalothrin harmful (class 4. In bioassay exposure of D. luteipes residues of insecticides applied to glass plates, all products were harmful to the predator, except triflumuron which was considered slightly harmful. The survival of adults after consumption of contaminated eggs was 46.7% for the insecticide tiametoxam/λ-cialotrina considered slightly harmful to the predator. The other insecticides were innocuous. Due to the low toxicity presented by the triflumuron to the D. luteipes adults, this compound can be recommended in programs aimed at integrated pest management the preservation of this natural enemy. All other products must be evaluated in greenhouse and field to prove its toxicity.

  9. 新烟碱类杀虫剂对家蚕的急性毒性评价与中毒症状观察%Acute Toxicity Evaluation of Neonicotinoid Insecticides to Bombyx mori and Observation of Toxic Symptoms

    Institute of Scientific and Technical Information of China (English)

    崔新倩; 张骞; 姜辉; 林荣华; 王开运

    2012-01-01

    great security risk on silkworm.The major poisoning symptoms on silkworm after treatment with neonicotinoid insecticides included antifeeding,body twisting into "C" or "S" shape,and head tumidity etc.In the other 3 insecticides,the antibiotic insecticide abamectin belonged to virulent toxicity grade and had the highest toxicity among all tested pesticides.Its main poisoning symptoms on silkworm were vomiting,head or tail bending upwards,and antifeeding etc.The organophosphate insecticide chlorpyrifos belonged to high toxicity grade and its poisoning symptoms on silkworm were similar to neonicotinoid insecticides.The pyrroles insecticide chlorfenapyr belonged to middle toxicity grade.In consideration of their virulent toxicity on silkworm,it is suggested that neonicotinoid insecticides should be used far away from mulberry field to avoid damage on sericultural production.

  10. Field resistance of Spodoptera litura (Lepidoptera: Noctuidae) to organophosphates, pyrethroids, carbamates and four newer chemistry insecticides in Hunan, China.

    Science.gov (United States)

    Tong, Hong; Su, Qi; Zhou, Xiaomao; Bai, Lianyang

    2013-01-01

    The present studies were carried out to evaluate resistance in the populations of Spodoptera litura Fab. (Lepidoptera, Noctuidae) from five districts of Hunan Province in China to various insecticides from 2010 to 2012 using a standard leaf dip bioassay method. For organophosphates and pyrethroids, resistance ratios compared with a susceptible Lab-BJ strain were in the range of 14-229-fold for organophosphates and 12-227-fold for pyrethroids. Similarly, relative low levels of resistance to emamectin, indoxacarb, and chlorfenapyr were observed in all five populations. In contrast, the resistance to carbamates (thiodicarb or methomyl) was significantly higher than that of organophosphates, pyrethroids and newer chemistry insecticides. The pairwise correlation coefficients of LC50 values indicated that the newer chemistry insecticides and old generation insecticides were not significant except abamectin, which was negatively significantly correlated with methomyl. A significant correlation was observed between thiodicarb, methomyl, and deltamethrin, whereas resistance to bifenthrin showed no correlations with resistance to other insecticides except deltamethrin. The results are discussed in relation to integrated pest management for S. litura with special reference to management of field evolved resistance to insecticides.

  11. Pyrrole-Pyridine and Pyrrole-Naphthyridine Hosts for Anion Recognition

    Directory of Open Access Journals (Sweden)

    M. Angeles García

    2015-05-01

    Full Text Available The association constants of the complexes formed by two hosts containing pyrrole, amide and azine (pyridine and 1,8-naphthyridine groups and six guests, all monoanions (Cl−, CH3CO2−, NO3−, H2PO4−, BF4−, PF6−, have been determined using NMR titrations. The X-ray crystal structure of the host N2,N5-bis(6-methylpyridin-2-yl-3,4-diphenyl-1H-pyrrole- 2,5-dicarboxamide (1 has been solved (P21/c monoclinic space group. B3LYP/6-31G(d,p and calculations were carried out in an attempt to rationalize the trends observed in the experimental association constants.

  12. On the fluorescence of pyrrole derivative oligomer

    Energy Technology Data Exchange (ETDEWEB)

    Guimaraes, Jeconias Rocha; Amazonas, Jarlesson Gama; Alberto Brito Silva Junior, Carlos [Pos-Graduacao em Fisica, Universidade Federal do Para, 66075-110 Belem, Para (Brazil); Melo, Celso P. de [Departamento de Fisica, Universidade Federal de Pernambuco, 50670-020 Recife, Pernambuco (Brazil); Laks, Bernardo [Instituto de Fisica, UNICAMP, 13083-970 Campinas, Sao Paulo (Brazil); Nero, Jordan del [Departamento de Fisica, Universidade Federal do Para, 66075-110 Belem, Para (Brazil)], E-mail: jordan@ufpa.br

    2008-08-01

    In this work we have investigated the ground state and others eletronic properties of the biosensor 3-methyl pyrrole-4-carboxilic acid (MPC) oligomers and related compounds. We considered the systems described by a DFT/B3LYP/6-31G* type Hamiltonian and explored the effects due to the presence of conformational defects. Furthermore the excited states have been determined by a post Hartree-Fock CI methodology. The results revealed the existence of different electronic patterns for the MPC if compared to the ones existing for the oligopyrrole derivative systems. The response of one of investigated polymers (MPC) was found to be critically dependent on the radicals linked to the studied oligomer chain structure so that the electronic structure analyses should be easily improved by choosing a proper set of preparation parameters to design conducting polymers with desirable properties.

  13. Hydroquinone–pyrrole dyads with varied linkers

    Directory of Open Access Journals (Sweden)

    Hao Huang

    2016-01-01

    Full Text Available A series of pyrroles functionalized in the 3-position with p-dimethoxybenzene via various linkers (CH2, CH2CH2, CH=CH, C≡C has been synthesized. Their electronic properties have been deduced from 1H NMR, 13C NMR, and UV–vis spectra to detect possible interactions between the two aromatic subunits. The extent of conjugation between the subunits is largely controlled by the nature of the linker, with the largest conjugation found with the trans-ethene linker and the weakest with the aliphatic linkers. DFT calculations revealed substantial changes in the HOMO–LUMO gap that correlated with the extent of conjugation found experimentally. The results of this work are expected to open up for use of the investigated compounds as components of redox-active materials in sustainable, organic electrical energy storage devices.

  14. Activity of Selected Formulated Biorational and Synthetic Insecticides Against Larvae of Helicoverpa armigera (Lepidoptera: Noctuidae).

    Science.gov (United States)

    Vivan, L M; Torres, J B; Fernandes, P L S

    2017-02-01

    This work studied 17 insecticides belonging to nucleopolyhedrovirus (NPV), Bacillus thuringiensis (Bt kurstaki and Bt aizawai), benzoylureas (insect growth regulators [IGRs]), carbamates, organophosphates, spinosyns, and diamides against larvae of Helicoverpa armigera (Hübner), invasive species in the South American continent. Larvae of different instars were fed for 7 d with untreated or insecticide-treated diets. Mortality was recorded daily for 7 d, and surviving larvae were individually weighed on the seventh day. The NPV and Bt insecticides caused 100% mortality of first-instar larvae and first-instar and second-instar larvae, respectively. However, both NPV and Bt-based products caused low mortality of third-instar larvae and did not kill older larvae. The IGR lufenuron was highly effective against all three ages of larvae tested, whereas teflubenzuron and triflumuron produced maximum 60% mortality of second-instar larvae and lower than 50% to older larvae. Thiodicarb, chlorantraniliprole, indoxacarb, chlorpyrifos, and chlorfenapyr, irrespective of tested age, caused 100% mortality of larvae, with the last two insecticides reaching 100% mortality within 2 d of feeding on the treated diet. Flubendiamide caused lower mortality but significantly affected the weight of surviving larvae, whereas neither spinosad nor methomyl produced significant mortality or affected the weight of larvae. Based on the results, the age of H. armigera larvae plays an important role in the recommendation of NPV and Bt insecticides. Furthermore, there are potential options between biological and synthetic insecticides tested against H. armigera, and recording larval size during monitoring, in addition to the infestation level, should be considered when recommending biological-based insecticides to control this pest. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  15. Development of Diagnostic Insecticide Concentrations and Assessment of Insecticide Susceptibility in German Cockroach (Dictyoptera: Blattellidae) Field Strains Collected From Public Housing

    Science.gov (United States)

    Fardisi, Mahsa; Gondhalekar, Ameya D.

    2017-01-01

    Abstract Insecticide resistance in German cockroaches (Blattella germanica (L.)) has been a barrier to effective control since its first documentation in the 1950s. A necessary first step toward managing resistance is to understand insecticide susceptibility profiles in field-collected strains so that active ingredients (AIs) with lowest resistance levels can be identified. As a first step in this study, diagnostic concentrations (DCs) were determined for 14 insecticide AIs based on lethal concentrations that killed 99% or 90% of the individuals from a susceptible lab strain (JWax-S). Next, cockroaches were collected from two low-income multifamily housing complexes in Danville, IL, and Indianapolis, IN, and used to establish laboratory strains. These strains were screened against the 14 AI-DCs in vial bioassays, and susceptibility profiles were determined by comparing percent mortalities between the field strains relative to the JWax-S strain. Results revealed lowest resistance of field strains to boric acid, abamectin, dinotefuran, clothianidin, thiamethoxam, and chlorfenapyr. For the AIs hydramethylnon and imidacloprid, field strains did not display survivorship different than the lab strain, but >90% mortality was never achieved. Lastly, both field strains displayed resistance to indoxacarb, fipronil, acetamiprid, beta-cyfluthrin, bifenthrin, and lambda-cyhalothrin, but at varying levels. These results satisfy two objectives. First, baseline monitoring DCs were established for 14 insecticides presently registered for use against cockroaches, which represents a useful resource. Second, our findings reveal insecticide AIs with lowest resistance levels for use in forthcoming field studies that will investigate impacts of different insecticide deployment strategies on resistance management and evolution in cockroach field populations. PMID:28334270

  16. STUDY OF ELECTROPOLIMERIZATION PROCESSES OF PYRROLE BY CYCLIC VOLTAMMETRIC TECHNIQUE

    Directory of Open Access Journals (Sweden)

    Adhitasari Suratman

    2010-06-01

    Full Text Available Electropolymerization processes and electrochemical properties of polypyrrole as electroactive polymer have been studied by cyclic voltammetric technique. Pyrrole was electropolymerized to form polypyrrole in water-based solvent containing sodium perchlorate as supporting electrolyte in several pH values. The pH of the solutions were varied by using Britton Robinson buffer. The results showed that oxidation potential limit of electropolymerization processes of pyrrole was 1220 mV vs Ag/AgCl reference electrode. It can be seen that cyclic voltammetric respon of polypyrrole membrane that was prepared by electropolymerization processes of pyrrole at the scanning rate of 100 mV/s was stable. While the processes of pyrrole electropolymerization carried out at the variation of pH showed that the best condition was at the pH range of 2 - 6.   Keywords: polypyrolle, electropolymer, voltammetric technique

  17. Toxicity of 25 synthetic insecticides to the field population of Culex quinquefasciatus Say.

    Science.gov (United States)

    Shah, Rizwan Mustafa; Alam, Mahbob; Ahmad, Daniyal; Waqas, Muhammad; Ali, Qasim; Binyamin, Muhammad; Shad, Sarfraz Ali

    2016-11-01

    The Culex quinquefaciatus Say, commonly known as the southern house mosquito, is well known for biting nuisance and vectoring of some fatal diseases. Synthetic chemicals have been relied upon as the major control measure to control mosquitoes. Therefore, we have evaluated 21 insecticides belonging to different chemical classes for their toxicity to C. quinquefaciatus females. Chlorfenapyr was the most toxic adulticide among all the tested insecticides. Among pyrethroids, deltamethrin was the least toxic adulticide, and all other have same toxicity. In case of organophosphates, the chlorpyrifos was the most toxic insecticide. Neonicotinoids such as acetamiprid, nitenpyram, and clothianidin have similar toxicity based on overlapping of 95 % confidence intervals (CI) and were more toxic when compared with the imidacloprid. The spinetoram was more toxic as compared with the spinosad (based on non-overlapping 95 % Cl). In case of ketoenoles, spirotetrament was more toxic as compared with the spiromesifen. Emamectin benzoate was the most toxic insecticide when compared with fipronil and indoxacarb. We also have tested four insect growth regulators (IGRS) including lufenuron, methoxyfenozide, pyriproxyfen, and cyromazine as larvicides. The lufenuron and pyriproxyfen have similar toxicity based upon their overlapping 95 % CI and were more toxic as compared with the methoxyfenozide and cyromazine. The methoxyfenozide was the moderately toxic among all the tested IGRS, and cyromazine was the least toxic among all the tested IGRS. These results will prove helpful in effectuating an effective integrated vector management program for C. quinquefaciatus.

  18. Polymerization of Pyrrole and Thiophene on Polyethylene Adipate Electrodes

    OpenAIRE

    Erturan, Seyfettin; TORAMAN, Burcu YALVAÇ and Sena

    1998-01-01

    Polymerizations of pyrrole and thiophene on a platinum foil coated by polyethylene adipate (PEA) were carried out in acetonitrile by electrochemical methods. Different compositions of semi-conducting composite films of PEA/Polypyrrole(PPy), PEA/Polythiophene(PT) were prepared by the electrochemical polymerization of pyrrole and thiophene on PEA electrode. The polymerization was possible only for a certain thickness of the polyethylene adipate(PEA) on the platinum. Conductivities of PEA/PPy, P...

  19. An Electrochemical Investigation into a Series of Tricyanovinylated Pyrrole Moieties

    NARCIS (Netherlands)

    McCormac, Timothy; Farrell, David; Browne, Wesley; Vos, Johannes G.

    2004-01-01

    The electrochemical behavior of three tri-cyanovinylated pyrrole species namely, 2-tricyanovinyl-pyrrole (C4H4N-C5N3), 2-tricyanovinyl-N-methylpyrrole (C5H6N-C5N3) and 2-tricyanovinyl-N-phenylpyrrole (C10H8N-C5N3), has been studied. All compounds were found to exhibit both an irreversible oxidation

  20. Synergistic action of octopamine receptor agonists on the activity of selected novel insecticides for control of dengue vector Aedes aegypti (Diptera: Culicidae) mosquito.

    Science.gov (United States)

    Ahmed, Mohamed Ahmed Ibrahim; Vogel, Christoph Franz Adam

    2015-05-01

    Studying insecticide resistance in mosquitoes has attracted the attention of many scientists to elucidate the pathways of resistance development and to design novel strategies in order to prevent or minimize the spread and evolution of resistance. Here, we tested the synergistic action of piperonyl butoxide (PBO) and two octopamine receptor (OR) agonists, amitraz (AMZ) and chlordimeform (CDM) on selected novel insecticides to increase their lethal action on the fourth instar larvae of Aedes aegypti L. However, chlorfenapyr was the most toxic insecticide (LC50 = 193, 102, and 48 ng/ml, after 24, 48, and 72 h exposure, respectively) tested. Further, PBO synergized all insecticides and the most toxic combinatorial insecticide was nitenpyram even after 48 and 72 h exposure. In addition, OR agonists significantly synergized most of the selected insecticides especially after 48 and 72 h exposure. The results imply that the synergistic effects of amitraz are a promising approach in increasing the potency of certain insecticides in controlling the dengue vector Ae. aegypti mosquito.

  1. Simple two-step synthesis of 2,4-disubstituted pyrroles and 3,5-disubstituted pyrrole-2-carbonitriles from enones

    Directory of Open Access Journals (Sweden)

    Murat Kucukdisli

    2014-02-01

    Full Text Available The cyclocondensation of enones with aminoacetonitrile furnishes 3,4-dihydro-2H-pyrrole-2-carbonitriles which can be readily converted to 2,4-disubstituted pyrroles by microwave-induced dehydrocyanation. Alternatively, oxidation of the intermediates produces 3,5-disubstituted pyrrole-2-carbonitriles.

  2. Efficacy of chlorfenapyr (AC 303630) experimental pour-on and CyLence formulations against naturally acquired louse infestations on cattle in New York.

    Science.gov (United States)

    Kaufman, P E; Rutz, D A; Doscher, M E; Albright, R

    2001-05-22

    The four chlorfenapyr formulations examined provided 100% control of both the nymphal and adult stages of naturally acquired Bovicola bovis (L.) on cattle up to 35 days after application. Treatment with 6mg chlorfenapyr per kg BW in a 0.12ml per kg BW formulation was as effective as treatment with CyLence (cyfluthrin) in controlling naturally acquired Solenopotes capillatus (Enderlein) on cattle for 35 days. Percent reduction was never greater than 90% with any chlorfenapyr application against Linognathus vituli (L.). However, percent reduction was greater than 90% with CyLence from day 21 through 35. No adverse effects were noted on cattle from any of the chlorfenapyr dosages used.

  3. The harmonic force field and vibrational spectra of pyrrole

    Science.gov (United States)

    Xie, Yaoming; Fan, Kangnian; Boggs, James E.

    The complete harmonic vibrational force field of pyrrole has been calculated by the ab initio gradient method at the Hartree-Fock level using the 4-21 basis set. The force field was then scaled with a set of six factors transferred from benzene, and the vibrational spectrum of pyrrole was calculated. This a priori prediction, made with no reference to observations on pyrrole, agreed with the known experimental fundamental frequencies with a mean deviation of 12 cm-1 for in-plane modes and 20 cm-1 for out-of-plane modes except for the NH wagging and NH stretch. A new set of ten scale factors was next obtained by direct fitting of the computed force field to the observed pyrrole spectrum, producing the best force field obtainable by combined use of the theoretical and experimental information. This force field reproduced the entire pyrrole spectrum with mean deviations of 4·2 cm-1 (in-plane) and 5·9 cm-1 (out-of-plane). The spectra of three deuterated forms of pyrrole were also computed. Infrared absorption intensities were calculated and proved very useful in examining assignments of the two ring torsional modes and the CH stretching modes.

  4. Synthesis, autoxidation and photooxidation of hindered pyrrole derivatives. Hindered pyrrolic nitroxide radicals; Synthese, autoxydation et photoxidation de pyrroles encombres radicaux nitroxydes pyrroliques encombres

    Energy Technology Data Exchange (ETDEWEB)

    Ramasseul, R. [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1969-07-01

    2,5-di-t-butyl and 2,3,5-tri-t-butyl pyrrole are prepared from pinacoline and their structure is confirmed by comparison with 2,5-di-t-butyl furan and thiophene (I.R., U.V. and N.M.R. {sup 13}C satellites observation giving J{sub 13{sub C-H}} and J{sub H{sub 3}-H{sub 4}}). The sensitized photooxidation of these hindered pyrroles gives corresponding hydroperoxides which most likely structure is determined using physical and chemical methods. Oxidation of 2,5-di-t-butyl and 2,3,5-tri-t-butyl pyrrole by hydrogen peroxide in presence of inorganic per-acid of by p-nitro-perbenzoic acid does not give the pyrrolic nitroxides in contrast with secondary amines. Some N-hydroxypyrroles are then prepared from pinacoline and ethyl pivaloyl-acetate. Their oxidation by lead dioxide gives the corresponding pyrrolic nitroxides. 2,5-di-t-butyl 3,4-di-ethoxycarbonyl pyrryl 1-oxy is isolated and studied spectroscopically (visible and U.V., E.P.R.). In marked contrast with ordinary nitroxides it does not show solvent effect. It can be compared with 2,4-di-t-butyl cyclopentadienone, a carbon analog. For both, the long wave length transition does not show the usual n - {pi}* behaviour; that is confirmed by E.P.R. Using Huckel method for pyrrolic nitroxide skeleton, it is possible to have a good interpretation of experimental data. (author) [French] Les di-t-butyl 2,5 et tri-t-butyl-2,3,5 pyrrole sont synthetises a partir de la pinacoline et leur structure confirmee par comparaison avec les di-t-butyl-2,5 furanne et thiophene (I.R., U.V. et R.M.N.: observation des satellites {sup 13}C conduisant a la mesure des J{sub 13{sub C-H}} et J{sub H{sub 3}{sub -H{sub 4}}). La photoxydation sensibilisee de ces pyrroles encombres conduit aux hydroperoxydes correspondants dont la structure la plus probable est determinee par les methodes physicochimiques. L'oxydation des di-t-butyl-2,5 et tri-t-butyl-2,3,5 pyrrole par l'eau oxygenee en presence de peracide mineral ou par l'acide p

  5. Assessment of insecticide resistance after the outbreak of diamondback moth (Lepidoptera: Plutellidae) in California in 1997.

    Science.gov (United States)

    Shelton, A M; Sances, F V; Hawley, J; Tang, J D; Boune, M; Jungers, D; Collins, H L; Farias, J

    2000-06-01

    During an outbreak of the diamondback moth, Plutella xylostella (L.), in California in 1997, nine populations were collected from the major broccoli areas throughout the state. Populations were assayed for their susceptibility to currently used materials (Bacillus thuringiensis subsp. kurstaki, permethrin, and methomyl) and to newer materials that had not yet been commercially used in California (spinosad, emamectin benzoate, and chlorfenapyr). For the currently used insecticides, elevated levels of resistance were seen only with permethrin and seven of the nine populations had tolerance ratios (TR) of > 100. With the newer chemistries, TR values were all < 15. To compare potential cross-tolerance, TR values of the currently used insecticides were compared with TR values of the newer insecticides. There were significant relationships found between: methomyl and emamectin benzoate, methomyl and spinosad, and permethrin and spinosad. Further biochemical studies are needed to confirm the actual mechanisms that lead to these relationships and field tests are needed to determine what impact, if any, such TR levels would have on control in the field. These data indicate that resistance to at least one of the commonly used insecticides (permethrin) may have played a role in the outbreak during 1997. However, other factors may have been at least equally important. The winter of 1996-1997 was warmer than normal, and during the period from February through August of 1997 the amount of rainfall was < 50% of normal. Hot and dry conditions are known to be conducive to outbreaks of P. xylostella. These data add to an overall knowledge about the geographic variation of resistance in P. xylostella populations within the United States. They also serve as a baseline for monitoring changes in susceptibility to these newer insecticides and can also help explain the occurrence of outbreaks caused by factors other than insecticide resistance.

  6. Insecticide Rotation Programs with Entomopathogenic Organisms for Suppression of Western Flower Thrips (Thysanoptera: Thripidae) Adult Populations under Greenhouse Conditions.

    Science.gov (United States)

    Kivett, Jessica M; Cloyd, Raymond A; Bello, Nora M

    2015-08-01

    Western flower thrips, Frankliniella occidentalis (Pergande), is one of the most destructive insect pests of greenhouse production systems with the ability to develop resistance to a wide variety of insecticides. A common resistance management strategy is rotating insecticides with different modes of action. By incorporating entomopathogenic organisms (fungi and bacteria), which have discrete modes of action compared to standard insecticides, greenhouse producers may preserve the effectiveness of insecticides used for suppression of western flower thrips populations. The objective of this study was to determine how different rotation programs that include entomopathogenic organisms (Beauveria bassiana, Isaria fumosoroseus, Metarhizium anisopliae, and Chromobacterium subtsugae) and commonly used standard insecticides (spinosad, chlorfenapyr, abamectin, and pyridalyl) may impact the population dynamics of western flower thrips adult populations by means of suppression. Eight-week rotation programs were applied to chrysanthemum, Dendranthema x morifolium plants and weekly counts of western flower thrips adults captured on yellow sticky cards were recorded as a means to evaluate the impact of the rotation programs. A final quality assessment of damage caused by western flower thrips feeding on foliage and flowers was also recorded. Furthermore, a cost comparison of each rotation program was conducted. Overall, insecticide rotation programs that incorporated entomopathogenic organisms were not significantly different than the standard insecticide rotation programs without entomopathogenic organisms in suppressing western flower thrips adult populations. However, there were no significant differences among any of the rotation programs compared to the water control. Moreover, there was no differential effect of the rotation programs on foliage and flower quality. Cost savings of up to 34% (in US dollars) are possible when including entomopathogenic organisms in the

  7. Effect of gamma radiation on the toxicity of milbemectin and chlorfenapyr in acaricide resistant and susceptible strains of Tetranychus urticae Koch (Acari: Tetranychidae)

    Energy Technology Data Exchange (ETDEWEB)

    Nicastro, Roberto L.; Arthur, Valter; Machi, Andre R., E-mail: rnicastro@cena.usp.br, E-mail: arthur@cena.usp.br [Laboratorio de Radiobiologia e Ambiente (CENA/USP), Piracicaba, SP (Brazil); Sato, Mario E., E-mail: mesato@biologico.sp.gov.br [Laboratorio de Acarologia, Instituto Biologico, Campinas, SP (Brazil)

    2011-07-01

    The spider mite Tetranychus urticae Koch is considered one of the most important phytophagous mites, causing considerable damage in several agricultural crops. The aim of this study was to evaluate the effect of gamma radiation on the toxicity of the acaricides milbemectin and chlorfenapyr in resistant and susceptible strains of T. urticae. The R and S strains for milbemectin and chlorfenapyr were irradiated with gamma radiation at Gamma cell-220 source at doses of 5, 10, 20, 40 e 80 Gy. Five concentrations of milbemectin and chlorfenapyr were evaluated, making applications 24 hours after irradiation. Mites of the controls were sprayed with the same acaricide concentrations used for the R and S strains but they were not exposed to gamma radiation. Experiments on the effects of gamma radiation on the growth rates of mites for acaricide resistant and susceptible strains of T. urticae were also carried out. Tests with the Milbemectin S strain showed an increased susceptibility to the acaricide milbemectin, when the mites were irradiated (20 Gy), in comparison with the control (non irradiated mites). For the Milbemectin R strain, there was no significant influence of gamma irradiation on the toxicity of milbemectin to the mites of this strain. For the Chlorfenapyr S strain, the effect of gamma radiation was similar to that observed for Milbemectin S strain, with increased toxicity of chlorfenapyr to the mites of this susceptible strain. In the case of the Chlorfenapyr R strain, the mites exposed to gamma radiation showed to be more tolerant to chlorfenapyr, considering the LC{sub 10} values. The same trend was observed for the LC{sub 50} values, however, there was no significant difference with the control. The experiments showed that doses of 200 and 300 Gy eliminated the mite populations of acaricide resistant and susceptible strains of T. urticae, in a period of ten days. The dose of 100 Gy did not lead to total elimination of the mite populations, but reduced

  8. Electrogenerated poly(pyrrole-lactosyl and poly(pyrrole-3’-sialyllactosyl interfaces: towards the impedimetric detection of lectins

    Directory of Open Access Journals (Sweden)

    Chantal eGondran

    2013-07-01

    Full Text Available This paper reports on the impedimetric transduction of binding reaction between polymerized saccharides and target lectins. The controlled potential electro-oxidation of pyrrole-lactosyl and pyrrole-3’-sialyllactosyl at 0.95 V vs Ag/AgCl, provides thin and reproducible poly(pyrrole-saccharide films. The affinity binding of two lectins: Arachis hypogaea, (PNA and Maackia amurensis (MAA onto poly(pyrrole-lactosyl and poly(pyrrole-3’-sialyllactosyl electrodes, was demonstrated by cyclic voltammetry in presence of ruthenium hexamine and hydroquinone. In addition, rotating disk experiments were carried out to determine the permeability of both polypyrrole films and its evolution after incubating with lectin target. Finally, the possibility of using the poly(pyrrole-lactosyl or poly(pyrrole-3’-siallyllactosyl films for the impedimetric transduction of the lectin binding reaction, was investigated with hydroquinone (2×10-3 mol L-1 as a redox probe in phosphate buffer. The resuting impedance spectra were interpreted and modeled as an equivalent circuit indicating that charge transfer resistance (Rct and relaxation frequency (f° parameters are sensitive to the lectin binding. Rct increases from 77 to 97 Ω cm2 for PNA binding and from 93 to 131 Ω cm2 for MAA binding. In parallel, f° decreases from 276 to 222 Hz for PNA binding and from 223 to 131 Hz for MAA binding. This evolution of both parameters reflects the steric hindrances generated by the immobilised lectins towards the permeation of the redox probe.

  9. Susceptibility of field populations of the diamondback moth, Plutella xylostella, to a selection of insecticides in Central China.

    Science.gov (United States)

    Zhang, Shuzhen; Zhang, Xiaolei; Shen, Jun; Mao, Kaikai; You, Hong; Li, Jianhong

    2016-09-01

    The diamondback moth (DBM), Plutella xylostella (L.) (Lepidoptera: Plutellidae), is a globally distributed and important economic pest. Chemical control is the primary approach to regulate populations of this pest. However, resistance to insecticides evolves following heavy and frequent use. Therefore, the insecticide resistance in field populations of P. xylostella collected from Central China from 2013 to 2014 was determined with a leaf-dipping method. Based on the results of the monitoring, P. xylostella has developed high levels of resistance to beta-cypermethrin (resistance ratio=69.76-335.76-fold), Bt (WG-001) (RR=35.43-167.36), and chlorfluazuron (RR=13.60-104.95) and medium levels of resistance to chlorantraniliprole (RR=1.19-14.26), chlorfenapyr (RR=4.22-13.44), spinosad (RR=5.89-21.45), indoxacarb (RR=4.01-34.45), and abamectin (RR=23.88-95.15). By contrast, the field populations of P. xylostella remained susceptible to or developed low levels of resistance to diafenthiuron (RR=1.61-8.05), spinetoram (RR=0.88-2.35), and cyantraniliprole (RR=0.4-2.15). Moreover, the LC50 values of field populations of P. xylostella were highly positively correlated between chlorantraniliprole and cyantraniliprole (r=0.88, P=0.045), chlorantraniliprole and spinosad (r=0.66, P=0.039), spinosad and diafenthiuron (r=0.57, P=0.0060), and chlorfenapyr and diafenthiuron (r=0.51, P=0.016). Additionally, the activities of detoxification enzymes in field populations of P. xylostella were significantly positively correlated with the log LC50 values of chlorantraniliprole and spinosad. The results of this study provide an important base for developing effective and successful strategies to manage insecticide resistance in P. xylostella.

  10. Polycondensation of pyrrole and benzaldehyde catalyzed by Maghnite–H+

    Directory of Open Access Journals (Sweden)

    2007-07-01

    Full Text Available Rapid synthesis of poly[(pyrrole-2,5-diyl-co-(benzylidene] was achieved under microwave irradiation via the condensation of pyrrole and benzaldehyde in 1,2-dichloroethane using acid exchanged montmorillonite clay called Maghnite–H+ (Mag–H+ as an efficient catalyst. The effect of the amount of catalyst and of time on the polymerization yield and on the viscosity of the polymers was studied. Compared with conventional static interfacial polymerization, the microwave-radiation polymerization reaction proceeded rapidly and was completed within 35 s. The conjugated polymer was characterized by means of 1H-NMR, X-ray diffraction, FT-IR spectroscopy and AFM. The X-ray data showed the presence of a backbone form of the [(pyrrole-2,5-diyl-co-(benzylidene] formed.

  11. Mortality patterns in Coptotermes gestroi (Blattodea: Rhinotermitidae) following horizontal transfer of nonrepellent and repellent insecticides: effects of donor:recipient ratio and exposure time.

    Science.gov (United States)

    Neoh, Kok-Boon; Yeoh, Boon-Hoi; Lee, Chow-Yang

    2014-08-01

    The donor: recipient ratio and the time of donor exposure to termiticide required for maximal toxicant transfer among termites are crucial information for the development of termite management plans. Most of the available information on termiticide toxicity came from temperate zonal termite species, whereas little is known about tropical Asian species. In this study, mortality patterns of recipient termites, Coptotermes gestroi (Wasmann) subjected to seven formulated insecticide exposures under different donor exposure times and donor: recipient ratios were examined. For fipronil, lethal transfer was not affected by donor exposure time but was affected by the mixing ratio. The moderate-to-less toxic termiticides (imidacloprid, indoxacarb, bifenthrin, chlorfenapyr, and chlorantraniliprole) required long exposure time and a high mixing ratio to ensure maximal uptake by recipient workers compared with fipronil. For chlorantraniliprole and chlorfenapyr, donors must constitute > 30% of the donor-recipient mixture to achieve 100% mortality of the recipient workers. Among the termiticides tested, cyantraniliprole was the most fast-killing insecticide against C. gestroi. The potential of lethal transfer among recipient termites does not necessarily require both high donor exposure time and a high mixing ratio, but the toxicity of a given termiticide against termites must be factored in to achieve colony elimination.

  12. Determination of four heterocyclic insecticides by ionic liquid dispersive liquid-liquid microextraction in water samples.

    Science.gov (United States)

    Liu, Yu; Zhao, Ercheng; Zhu, Wentao; Gao, Haixiang; Zhou, Zhiqiang

    2009-02-01

    A novel microextraction method termed ionic liquid dispersive liquid-liquid microextraction (IL-DLLME) combining high-performance liquid chromatography with diode array detection (HPLC-DAD) was developed for the determination of insecticides in water samples. Four heterocyclic insecticides (fipronil, chlorfenapyr, buprofezin, and hexythiazox) were selected as the model compounds for validating this new method. This technique combines extraction and concentration of the analytes into one step, and the ionic liquid was used instead of a volatile organic solvent as the extraction solvent. Several important parameters influencing the IL-DLLME extraction efficiency such as the volume of extraction solvent, the type and volume of disperser solvent, extraction time, centrifugation time, salt effect as well as acid addition were investigated. Under the optimized conditions, good enrichment factors (209-276) and accepted recoveries (79-110%) were obtained for the extraction of the target analytes in water samples. The calibration curves were linear with correlation coefficient ranged from 0.9947 to 0.9973 in the concentration level of 2-100 microg/L, and the relative standard deviations (RSDs, n=5) were 4.5-10.7%. The limits of detection for the four insecticides were 0.53-1.28 microg/L at a signal-to-noise ratio (S/N) of 3.

  13. Genetic basis of resistances to chlorfenapyr and etoxazole in the two-spotted spider mite (Acari: Tetranychidae).

    Science.gov (United States)

    Uesugi, R; Goka, K; Osakabe, Mh

    2002-12-01

    We studied the genetic basis of resistance to two new acaricides, chlorfenapyr and etoxazole, which have different chemical structures and modes of action in the two-spotted spider mite, Tetranychus urticae Koch. The resistance ratios calculated from the LC50s of resistant and susceptible strains were 483 for chlorfenapyr and >100,000 for etoxazole. Mortality caused by the two acaricides in F1 progeny from reciprocal crosses between the resistant and susceptible strains indicated that the modes of inheritance of resistance to chlorfenapyr and etoxazole were completely dominant and completely recessive, respectively. Mortality in F2 progeny indicated that for both acaricides, the resistance was under monogenic control. Repeated backcross experiments indicated a linkage relationship among the two acaricide resistances and malate dehydrogenase, although phosphoglucoisomerase was not linked with them. The recombination ratio between the resistances was 14.8%. From this result, we suggest that heavy spraying of the two acaricides will lead to apparent cross-resistance as a consequence of crossing over; the two resistance genes are so close to each other that it would be difficult to segregate them once they came together on the same chromosome.

  14. Determination of chlorfenapyr in leek grown under greenhouse conditions with GC-μECD and confirmation by mass spectrometry.

    Science.gov (United States)

    Rahman, Md Musfiqur; Choi, Jeong-Heui; Abd El-Aty, A M; Park, Jong Hyouk; Park, Ji-Yeon; Im, Geon-Jae; Shim, Jae-Han

    2012-02-01

    A simple analytical method was developed for the determination of chlorfenapyr residues in leeks grown under greenhouse conditions. Residues were extracted by salting out, analyzed by gas chromatography with microelectron-capture detection, and confirmed via gas chromatography-mass spectrometry. The calibration curves were found to be linear with correlation coefficients (r(2) ) in excess of 0.998. The limits of detection and quantification were 0.0015 and 0.005 mg kg(-1) , respectively. For validation purposes, recovery studies were carried out at low and high levels. Yield recovery rates were 87.27-89.64% with a relative standard deviation <6%. A maximum of 0.32 mg kg(-1) of chlorfenapyr residue was detected in leek sample sprayed three times at 7 day intervals until 7 days prior to harvest. The results of this study suggest that chlorfenapyr is acceptable for application in/on leeks under the recommended dosage regimen. Copyright © 2011 John Wiley & Sons, Ltd.

  15. 3-Phenyl-1-(pyrrol-2-ylprop-2-en-1-one

    Directory of Open Access Journals (Sweden)

    Zhen-Qi Gong

    2008-01-01

    Full Text Available The title molecule, C13H11NO, is almost flat, the angle between the pyrrole and the phenyl rings being 10.9 (1°. The atoms of the central C3O unit are coplanar, with a mean deviation from the plane of 0.001 (1 Å. The angles between this plane and the pyrrole and phenyl rings are 3.3 (1 and 8.0 (1°, respectively. The molecules form centrosymmetric dimers through a pair of N—H...O hydrogen bonds with an R22(10 motif.

  16. A colorimetric tetrathiafulvalene-calix 4 pyrrole anion sensor

    DEFF Research Database (Denmark)

    Nielsen, K. A.

    2012-01-01

    The interaction and colorimetric sensing properties of a tetrathiafulvalene substituted calix[4]pyrrole sensor with anions were investigated using H-1 NMR and absorption spectroscopic techniques. Visual color changes were observed upon addition of different anions (Cl-, Br-, CN-, and AcO-) to a s......The interaction and colorimetric sensing properties of a tetrathiafulvalene substituted calix[4]pyrrole sensor with anions were investigated using H-1 NMR and absorption spectroscopic techniques. Visual color changes were observed upon addition of different anions (Cl-, Br-, CN-, and Ac......O-) to a solution of the sensor. (C) 2012 Elsevier Ltd. All rights reserved....

  17. Versatile functionalization of nanoelectrodes by oligonucleotides via pyrrole electrochemistry.

    Science.gov (United States)

    Descamps, Emeline; Nguyen, Khoa; Bouchain-Gautier, Christelle; Filoramo, Arianna; Goux-Capes, Laurence; Goffman, Marcello; Bourgoin, Jean-Philippe; Mailley, Pascal; Livache, Thierry

    2010-11-15

    Surface modification at the nanometer scale is a challenge for the future of molecular electronics. In particular, the precise anchoring and electrical addressing of biological scaffolds such as complex DNA nanonetworks is of importance for generating bio-directed assemblies of nano-objects for nanocircuit purposes. Herein, we consider the individual modification of nanoelectrodes with different oligonucleotide sequences by an electrochemically driven co-polymerization process of pyrrole and modified oligonucleotide sequences bearing pyrrole monomers. We demonstrate that this one-step technique presents the advantages of simplicity, localization of surface modification, mechanical, biological and chemical stability of the coatings, and high lateral resolution.

  18. Insecticide Susceptibility of Field-Collected Populations of Culex tritaeniorhynchus in the Republic of Korea

    Science.gov (United States)

    Yoo, Dae-Hyun; Shin, E-Hyun; Lee, Dong-Kyu; Ahn, Young Joon; Kim, Hyun-Kyung; Kim, Seong-Yoon; Park, Chan

    2013-01-01

    The toxicities of 10 insecticides were examined against late third instar Culex tritaeniorhynchus Giles (Diptera: Culicidae) using the direct-contact mortality bioassay. Six geospatially-distant field mosquitoes were collected from Chuncheon-si, Hwaseong, Seosan. Jeonju, Daegu, and Busan in the Republic of Korea. Marked regional variations of insecticide susceptibility were observed. Field populations of Seosan, Jeonju, and Daegu from agricultural areas showed higher to extremely higher insecticide susceptibility to pyrethroids than those of Chuncheon-si, Hwaseong, and Busan strains from non-agricultural areas. Extremely high to low levels of susceptibility were measured: bifenthrin, susceptible ratio (SR) = 2.7–896.3; β-cyfluthrin, SR = 1.8–633.3; α-cypermethrin, SR = 1.2–1,051.9; deltamethrin, SR = 1.3–711.1; permethrin, SR = 1.5–1,053.4; etofenprox, SR = 2.2–29.3; chlorfenapyr, SR = 5.1–103.6; chlorpyrifos, SR = 2.3– 337.0; fenitrothion, SR = 2.0–142.3; and fenthion, SR = 1.4–186.2. Cx. tritaeniorhynchus populations from rice paddies had been under heavy selection pressure due to the agricultural insecticides, and that's why the mosquito species demonstrated high resistance to pyrethroids, which were used for a long time to control agricultural pests in the localities. These results indicate that careful selection and rotational use of these insecticides may result in continued satisfactory control against field populations of Japanese encephalitis vector mosquitoes. PMID:23879898

  19. Impact of insecticides used to control Spodoptera frugiperda (J.E. Smith in corn on survival, sex ratio, and reproduction of Trichogramma pretiosum Riley offspring

    Directory of Open Access Journals (Sweden)

    Jander R Souza

    2013-06-01

    Full Text Available Corn (Zea mays L. is cultivated in large areas and considered one of the world's major cereal crops. There are several arthropod pests that can reduce its production such as the fall armyworm, Spodoptera frugiperda (J.E. Smith (Lep.: Noctuidae, which is considered to be the main pest for corn. Fall armyworm is primarily controlled by insecticides. The use of biological control agents to manage this pest is growing with an emphasis on the egg parasitoid Trichogramma pretiosum Riley (Hym.: Trichogrammatidae. Thus, the aim of this research was to evaluate the impact of the following insecticides (g ai L-1 beta-cypermethrin (0.03, chlorfenapyr (0.60, chlorpyrifos (0.96, spinosad (0.16, etofenprox (0.10, triflumuron (0.08, alfa-cypermethrin/teflubenzuron (0.0425/0.0425, and lambda-cyhalothrin/thiamethoxam (0.11/0.083 on survival, sex ratio, reproduction, and T. pretiosum offspring. Distilled water was used as a control. Commercial insecticide formulations were diluted in distilled water. Bioassays used Anagasta kuehniella eggs treated with insecticides which were afterwards exposed to parasitism. Bioassays were conducted under controlled conditions at 25 ± 2 °C, 70 ± 10% RH, and 12:12 h photoperiod. Alfa-cypermethrin/teflubenzuron, beta-cypermethrin, chlorpyrifos, chlorfenapyr, spinosad, etofenprox, and lambda-cyhalothrin/thiamethoxam reduced parasitism capacity of maternal generation females as well as the percentage of insect emergence from the F1 generation. Only triflumuron was selective for T. pretiosum and can be recommended along with this parasitoid in fall armyworm management programs in corn.

  20. An ab-initio study of pyrrole and imidazole arylamides

    Directory of Open Access Journals (Sweden)

    Abramyan Ara M.

    2013-01-01

    Full Text Available Arylamide foldamers have been shown to have a number of biological and medicinal applications. For example, a class of pyrrole-imidazole polyamide foldamers is capable of binding specific DNA sequences and preventing development of various gene disorders, most importantly cancer. Molecular dynamics (MD simulations can provide crucial details in understanding the atomic level events related to foldamer/DNA binding. An important first step in the accurate simulation of these foldamer/DNA systems is the reparametrization of force field parameters for torsion around the aryl-amide bonds. Here we highlight our Density Functional Theory (DFT potential energy profiles and derived force field parameters for four aryl-amide bond types for the pyrrole and imidazole building blocks extensively used in foldamer design for the DNA-binding polyamides. These results contribute to developing of computational tools for an appropriate molecular modeling of pyrrole-imidazole polyamide/DNA binding, and provide an insight into the chemical factors that influence the flexibility of the pyrrole-imidazole polyamides, and their binding to DNA.

  1. Insecticides and Biological Control

    Science.gov (United States)

    Furness, G. O.

    1972-01-01

    Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

  2. Insecticide Compendium. MP-29.

    Science.gov (United States)

    Spackman, Everett W.; And Others

    This document presents information on most of the known insecticides and their general usage, toxicity, formulation, compound type, manufacturers, and the chemical, trade and common names applied to each compound. (CS)

  3. Insecticide Compendium. MP-29.

    Science.gov (United States)

    Spackman, Everett W.; And Others

    This document presents information on most of the known insecticides and their general usage, toxicity, formulation, compound type, manufacturers, and the chemical, trade and common names applied to each compound. (CS)

  4. Insecticides and Biological Control

    Science.gov (United States)

    Furness, G. O.

    1972-01-01

    Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

  5. More about Insecticides

    Directory of Open Access Journals (Sweden)

    E.K. Hartwig

    1980-09-01

    Full Text Available An insecticide is a chemical used to kill insects. Insect control can also include other materials such as repellents, oils, antifeedants and attractants. Ideally, an insecticide would effectively control any target insect exposed to it and would be harmless to man and his domestic animals. It would also be readily available in necessary quantitie s , s table chemically, noninflammable, easily prepared and applied, noncorrosive, non-staining, and would have no undesirable odour.

  6. Proteases as Insecticidal Agents

    OpenAIRE

    Robert L. Harrison; Bonning, Bryony C.

    2010-01-01

    Proteases from a variety of sources (viruses, bacteria, fungi, plants, and insects) have toxicity towards insects. Some of these insecticidal proteases evolved as venom components, herbivore resistance factors, or microbial pathogenicity factors, while other proteases play roles in insect development or digestion, but exert an insecticidal effect when over-expressed from genetically engineered plants or microbial pathogens. Many of these proteases are cysteine proteases, although insect-toxic...

  7. Organophosphorus Insecticide Pharmacokinetics

    Energy Technology Data Exchange (ETDEWEB)

    Timchalk, Charles

    2010-01-01

    This chapter highlights a number of current and future applications of pharmacokinetics to assess organophosphate (OP) insecticide dosimetry, biological response and risk in humans exposed to these agents. Organophosphates represent a large family of pesticides where insecticidal as well as toxicological mode of action is associated with their ability to target and inhibit acetylcholinesterase (AChE). Pharmacokinetics entails the quantitative integration of physiological and metabolic processes associated with the absorption, distribution, metabolism and excretion (ADME) of drugs and xenobiotics. Pharmacokinetic studies provide important data on the amount of toxicant delivered to a target site as well as species-, age-, gender-specific and dose-dependent differences in biological response. These studies have been conducted with organophosphorus insecticides in multiple species, at various dose levels, and across different routes of exposure to understand their in vivo pharmacokinetics and how they contribute to the observed toxicological response. To access human exposure to organophosphorus insecticides, human pharmacokinetic studies have been conducted and used to develop biological monitoring strategies based on the quantitation of key metabolites in biological fluids. Pharmacokinetic studies with these insecticides are also useful to facilitate extrapolation of dosimetry and biological response from animals to humans and for the assessment of human health risk. In this regard, physiologically based pharmacokinetic and pharmacodynamic (PBPK/PD) models are being utilized to assess risk and understand the toxicological implications of known or suspected exposures to various insecticides. In this chapter a number of examples are presented that illustrate the utility and limitation of pharmacokinetic studies to address human health concerns associated with organophosphorus insecticides.

  8. Electrochemical synthesis and surface characterization of (pyrrole+2-methylfuran) copolymer

    Science.gov (United States)

    Djaouane, Linda; Nessark, Belkacem; Sibous, Lakhdar

    2017-02-01

    Electrochemical copolymerization of pyrrole (Py) and 2-methylfuran (2 MF) was performed on platinum and ITO substrates in acetonitrile/lithium perchlorate solution, using cyclic voltammetry method. The electrochemical behavior of the modified electrode surface by polypyrrole, poly(2-methylfuran) homopolymers and (pyrrole+2-methylfuran) copolymer was characterized by cyclic voltammetry, electrochemical impedance spectroscopy (EIS), UV-visible spectroscopy, atomic force microscopy (AFM) and scanning electron microscopy (SEM). The cyclic voltammetry shows anodic and cathodic peaks which are characteristic of the oxidation and the reduction of the formed films. The electrochemical impedance spectroscopy confirmed the results obtained by cyclic voltammetry. AFM and SEM analyses proved as well that the morphology and the electrochemical properties of the polypyrrole film are modified in the presence of 2-methylfuran.

  9. Comparison of the effect of insecticides on three strains of Tyrophagus putrescentiae (Acari: Astigmata) using an impregnated filter paper test and a growth test.

    Science.gov (United States)

    Stara, Jitka; Nesvorna, Marta; Hubert, Jan

    2014-07-01

    In this study, we compared the efficacy of insecticides against three strains of Tyrophagus putrescentiae using an impregnated filter paper test and a growth test. We tested the suppressive activity of commercial insecticides and their analytical standards (pirimiphos-methyl, cypermethrin, deltamethrin, chlorfenapyr, β-cyfluthrin). The strains of T. putrescentiae originated from a laboratory, a field and dog food. The mortality of the mites due to active ingredients and analytical standards was tested using an impregnated filter paper test after 24 h. Lethal doses, LD50 , LD95 and LD99 were determined. A growth test was used to observe the suppressive effect of the active ingredients on mites at 21 days after application of the active ingredients to wheat grain. The effective doses ED50 , ED95 and ED99 were determined, indicating the concentration at which the population was reduced by 50, 95 and 99% more than control. Cypermethrin, β-cyfluthrin and a formulation of deltamethrin with piperonylbutoxide in the pesticide K-Othrine showed low toxicity to mites. High toxicity was observed for chlorfenapyr (LD50 : 0.1-1 µg cm(-2) ; ED50 : 0.11-1.2 µg g(-1) ) and pirimiphos-methyl (LD50 : 0.01-0.06 µg cm(-2) ; ED50 : 0.2-12 µg g(-1) ). We did not find significant differences among the compared strains in terms of their sensitivity to highly toxic insecticides. The obtained results showed that a filter paper test is a more sensitive method of identifying differences in pesticide susceptibility among strains, but the efficacy of pesticides against one species should be tested using a growth test. © 2013 Society of Chemical Industry.

  10. Multiphoton ionization of pyrrole-water mixed clusters

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Multiphoton ionization of the hydrogen-bonded pyrrole-water clusters ( C4H5 N)n H2O)m is studied with a reflectron—time of flight mass spectrometer at 355 nm. With increasing partial concentration of pyrrole in a gas mixture source, a series of poly-pyrrole-water binary-mixed cluster ions can be observed, including unprotonated cluster ions [(C4H5N)x (H2O)y]* , protonated cluster ions [(C4H5N)x (H2O)yH]* and dehydrogenated cluster ions [ ( C4 H4 N) ( C4 H5 N) x ( H2O) y ] + . Ab initio calculations of their structures, bond strengths, charge distributions and re action energies are carried out. Stable structures of these clusters are obtained from the calculations. A probable forma tion mechanism of the cluster ions [(C4H5N)x(H2O)y] + , [(C4H5N)x (H2O)y]H+ and [(C4H4N) (C4H5N)x (H2O)y]-is supposed to be the ionization of clusters followed by dissociation.

  11. Electropolymerization of pyrrole on silanized polycrystalline titanium substrates

    Energy Technology Data Exchange (ETDEWEB)

    Mekhalif, Z. [Laboratory of Chemistry and Electrochemistry of Surfaces, University of Namur (FUNDP), Rue de Bruxelles, 61, B-5000 Namur (Belgium)], E-mail: zineb.mekhalif@fundp.ac.be; Cossement, D.; Hevesi, L.; Delhalle, J. [Laboratory of Chemistry and Electrochemistry of Surfaces, University of Namur (FUNDP), Rue de Bruxelles, 61, B-5000 Namur (Belgium)

    2008-04-30

    In this work is reported the silanization of titanium substrates and subsequent polymerization of pyrrole on the resulting substrates. First, titanium substrates were modified by n-hexyltrichlorosilane (HTCS) and 6-(1'-pyrrolyl)-n-hexyltrichlorosilane (PyHTCS). The corresponding self-assembled monolayers were characterized by X-ray photoelectron spectroscopy and contact angle measurements. They were found to be densely packed. Second, pyrrole was electrochemically polymerized on silanized titanium substrates. Chronoamperometry was used to study the growth of polypyrrole films. The polymer films were characterized by qualitative peel tests, cyclic voltametry and scanning electron spectroscopy. Polypyrrole grown from PyHTCS was found to adherent as compared to HTCS modified and bare substrates. Cyclic voltametry indicated that polymer films formed from PyHTCS have an oxidation peak potential located at higher values than HTCS-modified and bare substrates. Moreover, the films grown on the three types of substrates were found to be equally uniform. Finally, we improved the electrochemical properties of the polypyrrole films using a two-step process, electroreticulation of the PyHTCS monolayers followed by a pyrrole polymerization.

  12. Resistance to Insecticides in Insects

    OpenAIRE

    2005-01-01

    In recent years, the frequent usage of insecticides in struggle aganist insects, has caused development of resistance to those chemicals in insects. The increase in dosage of insecticide used due to development of resistance in insects, causes important problems in terms of environment and human health. This study includes topics such as insecticides which are used frequently in insect struggle, insecticide resistant types, genetic changes posing resistance, enzymes of resistance and resistan...

  13. Effects of selected insecticides on Diadegma semiclausum(Hymenoptera: Ichneumonidae) and Oomyzus sokolowskii (Hymenoptera: Eulophidae), parasitoids of Plutella xylostella (Lepidoptera: Plutellidae)

    Institute of Scientific and Technical Information of China (English)

    MUHAMMADHASEEB; HIROSHIAMANO; TONG-XIANLIU

    2005-01-01

    act Field doses of six selected insecticides were tested against the immature (pupae)and mature (adult) stages of Diadegma semiclausum (Hellén) and Oomyzus sokolowskii(Kurdjumov), parasitoids of the diamondback moth, Plutella xylostella (L.). Effects ofcontact toxicity (direct spraying) of the six insecticides on emergence of parasitoids were found negligible on both species except permethrin which caused 37.5% mortality. All adults of both parasitoid species died 24 hours after exposure to chlorfenapyr, emamectin benzoate and permethrin. In contrast, the three insect growth regulators (IGRs), chlorfluazuron,flufenoxuron and teflubenzuron, were found harmless to both species, and adult mortality of both parasitoid species was 0-16.7%. However, parasitism by the females of both parasitoid species was severely impaired when the females were offered the three IGR diluted solutions for 24 hours. Effects of oral toxicities of the IGRs on longevity of both parasitoids after 12 hours exposure were found to be significandy different between males and females. Compatibility of tested insecticides with D. semiclausum and O. sokolowskii and integration of compatible insecticides with these parasitoids in integrated pest management programs of crucifers are discussed.

  14. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  15. Novel and efficient supramolecular synthesis of pyrroles in the presence of β-cyclodextrin in water

    Institute of Scientific and Technical Information of China (English)

    K. Ramesh; K. Karnakar; G. Satish; Y.V.D. Nageswar

    2012-01-01

    A simple and efficient synthesis of highly substituted pyrroles was achieved in water medium via multi-component strategy,using amine,DMAD/DEAD as well as phenacyl bromide catalyzed by β-CD.Utilizing this protocol various pyrrole derivatives were synthesized in good to excellent yields.

  16. Microfabrication of proangiogenic cell-laden alginate-g-pyrrole hydrogels.

    Science.gov (United States)

    DeVolder, Ross J; Zill, Andrew T; Jeong, Jae H; Kong, Hyunjoon

    2012-11-01

    Cells have been extensively studied for their uses in various therapies because of their capacities to produce therapeutic proteins and recreate new tissues. It has often been suggested that the efficacy of cell therapies can greatly be improved through the ability to localize and regulate cellular activities at a transplantation site; however, the technologies for this control are lacking. Therefore, this study reports a cell-Laden hydrogel patch engineered to support the proliferation and angiogenic growth factor expression of cells adhered to their surfaces, and to further promote neovascularization. Hydrogels consisting of alginate chemically linked with pyrrole units, termed alginate-g-pyrrole, were prepared through an oxidative cross-linking reaction between pyrrole units. Fibroblasts adhered to the alginate-g-pyrrole hydrogels, and exhibited increased proliferation and overall vascular endothelial growth factor (VEGF) expression, compared to those on pyrrole-free hydrogels. Furthermore, the alginate-g-pyrrole hydrogel surfaces were modified to present microposts, subsequently increasing the amount of pyrrole units on their surfaces. Cells adhered to the microfabricated gel surfaces exhibited increased proliferation and overall VEGF expression proportional to the density of the microposts. The resulting micropatterned alginate-g-pyrrole hydrogels exhibited increases in the size and density of mature blood vessels when implanted on chick chorioallantoic membranes (CAMs). The hydrogel system developed in this study will be broadly useful for improving the efficacy of a wide array of cell-based wound healing and tissue regenerative therapies.

  17. Interesting reactivity of diketones with pyrrole under acidic condition

    Indian Academy of Sciences (India)

    Sanjeev Pran Mahanta; Pradeepta Kumar Panda

    2011-09-01

    The acid catalysed condensation of diketones with pyrrole did not result in the formation of expected divergent bisdipyrromethane always; instead the product depends on the chain length of the diketones, in particular the distance between the two carbonyl functional groups.When the two carbonyl groups are linked via one or two methylene groups, unusual ring annulation occurs resulting in the formation of various bridged bipyrroles. However, on further increase in the length of the spacer, between the two carbonyl groups, synthesis of the expected bisdipyrromethanes could be achieved.

  18. Pyrrolic Amide: A New Hydrogen Bond Building Block for Self-assembly

    Institute of Scientific and Technical Information of China (English)

    YIN Zhen-Ming; LI Jian-Feng; HE Jia-Qi; ZHU Xiao-Qing; CHENG Jin-Pei

    2003-01-01

    @@ Molecular self-assembly has emerged as a powerful technology for the synthesis of nanostructured materials. In design of various molecular assemblies, hydrogen bonding is a preferably selected intra- or inter-molecular weak interaction in recent research by virtue of the directionality and specificity. The research for novel hydrogen bond building blocks that self-assembly into well defined structures is great important not only for gaining an understanding of the concepts of self-assembly but also for the design of new molecular materials. Pyrrolic amide moiety has one hydrogen bond acceptor (C =O) and two hydrogen bond donors (pyrrole NH and amide NH). By deliberately design, pyrrolic amide compounds would be new kinds hydrogen bond building blocks. So, pyrrolic amide compounds 1 ~ 6, which bear one, two or three pyrrolic amide moieties respectively, were designed and synthesized.

  19. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  20. 2-Ethyl 4-methyl 5-ethyl-3-methyl-1H-pyrrole-2,4-dicarboxylate

    Directory of Open Access Journals (Sweden)

    Gui-Fen Lu

    2012-02-01

    Full Text Available The title pyrrole derivative compound, C12H17NO4, was synthesized from methyl 3-oxopentanoate by a Knorr-type reaction and contains a pyrrole ring to which two diagonal alkoxycarbonyl groups and two diagonal alkyl substituents are attached. The methylcarbonyl and ethylcarbonyl substituents are approximately co-planar with the pyrrole ring, making dihedral angles of 5.64 (2 and 3.44 (1°, respectively. In the crystal, adjacent molecules are assembled by pairs of N—H...O hydrogen bonds into dimers in a head-to-head mode.

  1. 2-Pyrrole Carboxylic Acid Nitro-Phenylamide: New Colorimetric Sensor for Anion

    Institute of Scientific and Technical Information of China (English)

    YIN Zhen-Ming; YANG Wen-Zhi; HE Jia-Qi; ZHU Xiao-Qing; CHENG Jin-Pei

    2003-01-01

    @@ Due to the role played by anions in the field of biology and environmental chemistry, the development of selec tive and sensitive chemosensor for anion sensing is a topic of current attention. Colorimetric anion sensor, which does not require the use of a potentiostate or spectrometer to detect redox or optical perturbation, can give immediate qualitative anion sensing information by visual detection and therefore has advantages over other molecular sensors.According the anion binding ability of some pyrrolic amides reported by Schmuck and Gale, we linked the color reporter group of nitroanile to pyrrole moiety and synthesized two 2-pyrrole carboxylic acid nitro-phenylamides (1 and 2).

  2. Genetic analysis and cross-resistance spectrum of a laboratory-selected chlorfenapyr resistant strain of two-spotted spider mite (Acari: Tetranychidae).

    Science.gov (United States)

    Van Leeuwen, Thomas; Stillatus, Vincent; Tirry, Luc

    2004-01-01

    A laboratory susceptible strain of Tetranychus urticae was selected with chlorfenapyr resulting in a resistant strain. After 12 cycles of exposure, the resistance ratio (RR) calculated from the LC50s of susceptible and selected strain was 580. The resistant strain was screened with 16 currently used acaricides for cross-resistance. Cross-resistance was detected with amitraz (RR = 19.1), bifenthrin (RR = 1.3), bromopropylate (RR = 7.5), clofentezine (RR = 29.6) and dimethoate (RR = 17.6). No cross-resistance was detected with the new molecules acequinocyl, bifenazate and spirodiclofen. Mortality caused by chlorfenapyr in the F1 progeny from reciprocal crosses between both strains indicated that the mode of inheritance was incomplete recessive. Mortality in F2 progeny indicated that the resistance was under the control of more than one gene. Synergist experiments with S,S,S-tributylphosphorotrithioate (DEF), piperonylbutoxide (PBO) and diethylmaleate (DEM), which are inhibitors of esterases, monooxygenases and glutathion-S-transferases respectively, suggested a major role of esterases in the resistance to chlorfenapyr.

  3. A Submarine Journey: The Pyrrole-Imidazole Alkaloids

    Directory of Open Access Journals (Sweden)

    Alessandra Scolaro

    2009-11-01

    Full Text Available In his most celebrated tale “The Picture of Dorian Gray”, Oscar Wilde stated that “those who go beneath the surface do so at their peril”. This sentence could be a prophetical warning for the practitioner who voluntarily challenges himself with trying to synthesize marine sponge-deriving pyrrole-imidazole alkaloids. This now nearly triple-digit membered community has been growing exponentially in the last 20 years, both in terms of new representatives and topological complexity − from simple, achiral oroidin to the breathtaking 12-ring stylissadines A and B, each possessing 16 stereocenters. While the biosynthesis and the role in the sponge economy of most of these alkaloids still lies in the realm of speculations, significant biological activities for some of them have clearly emerged. This review will account for the progress in achieving the total synthesis of the more biologically enticing members of this class of natural products.

  4. A submarine journey: the pyrrole-imidazole alkaloids.

    Science.gov (United States)

    Forte, Barbara; Malgesini, Beatrice; Piutti, Claudia; Quartieri, Francesca; Scolaro, Alessandra; Papeo, Gianluca

    2009-11-27

    In his most celebrated tale "The Picture of Dorian Gray", Oscar Wilde stated that "those who go beneath the surface do so at their peril". This sentence could be a prophetical warning for the practitioner who voluntarily challenges himself with trying to synthesize marine sponge-deriving pyrrole-imidazole alkaloids. This now nearly triple-digit membered community has been growing exponentially in the last 20 years, both in terms of new representatives and topological complexity--from simple, achiral oroidin to the breathtaking 12-ring stylissadines A and B, each possessing 16 stereocenters. While the biosynthesis and the role in the sponge economy of most of these alkaloids still lies in the realm of speculations, significant biological activities for some of them have clearly emerged. This review will account for the progress in achieving the total synthesis of the more biologically enticing members of this class of natural products.

  5. A Submarine Journey: The Pyrrole-Imidazole Alkaloids †

    Science.gov (United States)

    Forte, Barbara; Malgesini, Beatrice; Piutti, Claudia; Quartieri, Francesca; Scolaro, Alessandra; Papeo, Gianluca

    2009-01-01

    In his most celebrated tale “The Picture of Dorian Gray”, Oscar Wilde stated that “those who go beneath the surface do so at their peril”. This sentence could be a prophetical warning for the practitioner who voluntarily challenges himself with trying to synthesize marine sponge-deriving pyrrole-imidazole alkaloids. This now nearly triple-digit membered community has been growing exponentially in the last 20 years, both in terms of new representatives and topological complexity – from simple, achiral oroidin to the breathtaking 12-ring stylissadines A and B, each possessing 16 stereocenters. While the biosynthesis and the role in the sponge economy of most of these alkaloids still lies in the realm of speculations, significant biological activities for some of them have clearly emerged. This review will account for the progress in achieving the total synthesis of the more biologically enticing members of this class of natural products. PMID:20098608

  6. (4-Butoxyphenyl(1H-pyrrol-2-ylmethanone

    Directory of Open Access Journals (Sweden)

    Rajni Kant

    2012-05-01

    Full Text Available The asymmetric unit of the title compound, C15H17NO2, contains two independent molecules in which the dihedral angles between the pyrrole and benzene rings are 42.43 (9 and 45.70 (9°. In both molecules, the butoxy chains are disordered over two sets of sites, with occupancy ratios of 0.701 (7:0.299 (7 and 0.869 (4:0.131 (4. Each molecule forms a dimer with an inversion-related molecule, through a pair of N—H...O hydrogen bonds. Weak C—H...O interactions link these dimers in the crystal structure.

  7. Experimental and theoretical study of 4-formyl pyrrole derived aroylhydrazones

    Science.gov (United States)

    Rawat, Poonam; Singh, R. N.

    2015-03-01

    Two new 4-formyl pyrrole derived aroylhydrazones (3a, b) from ethyl 4-formyl-3,5-dimetyl-1H-pyrrole-2-carboxylate and aroylhydrazides (3,5-dinitrobenzohydrazide/2-hydrazinocarbonyl-N-phenyl-acetamide) have been synthesized and characterized by various spectroscopic techniques 1H NMR, Mass, UV-Visible and FT-IR. The calculated thermodynamic parameters show that the formation of 3a as spontaneous, whereas 3b as non-spontaneous. TD-DFT has been used to calculate the absorption wavelengths, oscillator strength (f) and the nature of electronic excitations. Natural bond orbital (NBO) analysis has been carried out to explore the various conjugative and hyperconjugative interactions and their second order stabilization energy (E(2)) within monomer and its dimer. The dimer formation of 3a, 3b due to result of intermolecular hydrogen bonding N1sbnd H30⋯O84, N1sbnd H28⋯O60 is obvious in 1H NMR, NBO and FT-IR as down field chemical shifts, n(O84) → σ∗(N1sbnd H30), n(O60) → σ∗(N1sbnd H28) interactions, vibrational red shifts, respectively. To determine the strength and nature of hydrogen bonding, topological parameters at bond critical points (BCP) have been analyzed by 'Quantum theory of Atoms in molecules' (QTAIM) in detail. The global electrophilicity index (ω) has been calculated to determine the relative electrophilic strength of molecules. The local reactivity descriptors analyses such as Fukui functions (fk+, fk-), local softnesses (sk+, sk-) and electrophilicity indices (ωk+, ωk-) have been performed to determine the reactive sites within molecules. The first hyperpolarizabilities (β0) of 3a, b have been computed to evaluate the non-linear optical (NLO) response of the investigated molecules.

  8. Bioactivity of 6 Insecticides to Different Developmental Stages ofPlutella xylostella (L.)%6种杀虫剂对小菜蛾不同虫态室内活性研究

    Institute of Scientific and Technical Information of China (English)

    洪珊珊; 贾变桃; 李琴; 张琰锋

    2014-01-01

    Bioactivities of chlorfenapyr, lufenuron, chlorantraniliprole, indoxacarb, abamectin and spinosad to eggs, larvae, pupae and adults ofPlutella xylostella were studied by egg-dipping method, leaf-dipping method, immersion method and residual film method in the laboratory. The results showed that the six insecticides had excellent effects on larvaeof P. xylostella. Chlorfenapyr and spinosad had quick bioactivities after 24 h treatment, and the corrected mortalities were above 90%. The corrected mortalities of chlorfenapyr, chlorantraniliprole, abamectin and spinosadreached 100% after 72 h treatment, the corrected mortality of indoxacarb were 98.2%. All of the six insecticides had certain ovicidal effects, ovicidal activity of lufenuron was high, abamectin and spinosad had low ovicidal activities, but could kill neonate larvae and decrease survival rates of larvae. The survival rates of 2nd instar larvae were below 10% after eggs treated with field doses of all six insecticides. Among six insecticides, chlorfenapyr and indoxacarb showed higher toxic to pupae and adults ofP. xylostella, the other four insecticides had a little or no toxic to pupae and adults ofP. xylostella.%为了解不同杀虫剂对小菜蛾的杀虫活性,采用浸卵法、浸叶法、浸渍法和药膜法分别测定了6种杀虫剂(虫螨腈、虱螨脲、氯虫苯甲酰胺、茚虫威、阿维菌素和多杀霉素)对小菜蛾卵、幼虫、蛹和成虫4种不同虫态的室内活性。结果表明:田间推荐剂量下,6种杀虫剂对小菜蛾幼虫具有很高的杀虫活性,虫螨腈和多杀霉素具有速效性,药后24 h校正死亡率在90%以上。药后72 h,虫螨腈、氯虫苯甲酰胺、阿维菌素和多杀霉素这4种药剂校正死亡率达100%。此外,6种杀虫剂均具有一定的杀卵作用,杀卵活性最强的是虱螨脲,多杀霉素和阿维菌素的杀卵作用较差。尽管有些杀虫剂杀卵作用稍差,但这些药剂可以杀死初孵幼虫

  9. One-Pot Conversion of Carbohydrates into Pyrrole-2-carbaldehydes as Sustainable Platform Chemicals.

    Science.gov (United States)

    Adhikary, Nirmal Das; Kwon, Sunjeong; Chung, Wook-Jin; Koo, Sangho

    2015-08-07

    A practical conversion method of carbohydrates into N-substituted 5-(hydroxymethyl)pyrrole-2-carbaldehydes (pyrralines) was developed by the reaction with primary amines and oxalic acid in DMSO at 90 °C. Further cyclization of the highly functionalized pyrralines afforded the pyrrole-fused poly-heterocyclic compounds as potential intermediates for drugs, food flavors, and functional materials. The mild Maillard variant of carbohydrates and amino esters in heated DMSO with oxalic acid expeditiously produced the pyrrole-2-carbaldehyde skeleton, which can be concisely transformed into the pyrrole alkaloid natural products, 2-benzyl- and 2-methylpyrrolo[1,4]oxazin-3-ones 8 and 9, lobechine 10, and (-)-hanishin 11 in 23-32% overall yields from each carbohydrate.

  10. Poly [(pyrrole-2, 5-diyl) co(4-Nitro benzylidene)]: A new synthetic approach and electronic properties

    Science.gov (United States)

    Gherras, H.; Hachemaoui, A.; Yahiaoui, A.; Belbachir, M.; Belfedal, A.

    2012-02-01

    A new poly (heteroarylene methylene) containing one to four α-pyrrole rings alternating with an sp3-carbon atom in the main chain were synthesized and characterized. The synthesized poly [(pyrrole-2, 5-diyl)-co-(4-nitrobenzylidene)] was found to be highly dehydrogenated, thus resulting in black materials with conjugated segments larger than a single pyrrole ring. The conjugated polymers containing alternating aromatic and quinoid heteroarylene moieties in the main chain were prepared by polycondensation of 4-nitrobenzaldehyde and pyrrole catalysed by Maghnite-H+. The new polymer is useful precursors to small-bandgap polymers based on poly (heteroarylene methines) and is also useful model system for the investigation of the effects of π-conjugation length on the electronic and optical properties of conjugated polymers.

  11. Auto-oligomerization and hydration of pyrrole revealed by x-ray absorption spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Advanced Light Source; Schwartz, Craig P.; Uejio, Janel S.; Duffin, Andrew M.; England, Alice H.; Prendergast, David; Saykally, Richard J

    2009-05-29

    Near edge x-ray absorption fine structure (NEXAFS) spectra have been measured at the carbon and nitrogen K-edges of the prototypical aromatic molecule, pyrrole, both in the gas phase and when solvated in water, and compared with spectra simulated using a combination of classical molecular dynamics and first principles density functional theory in the excited state core hole approximation. The excellent agreement enabled detailed assignments. Pyrrole is highly reactive, particularly in water, and reaction products formed by the auto-oligomerization of pyrrole are identified. The solvated spectra have been measured at two different temperatures, indicating that the final states remain largely unaffected by both hydration and temperature. This is somewhat unexpected, since the nitrogen in pyrrole can donate a hydrogen bond to water.

  12. Biosynthesis, asymmetric synthesis, and pharmacology, including cellular targets, of the pyrrole-2-aminoimidazole marine alkaloids

    Digital Repository Service at National Institute of Oceanography (India)

    Al-Mourabit, A.; Zancanella, M.A.; Tilvi, S.; Romo, D.

    The pyrrole-2-aminoimidazole (P-2-AI) alkaloids are a growing family of marine alkaloids, now numbering well over 150 members, with high topographical and biological information content. Their intriguing structural complexity, rich and compact...

  13. Synthesis and biological activity of pyrrole analogues of combretastatin A-4.

    Science.gov (United States)

    Jung, Eun-Kyung; Leung, Euphemia; Barker, David

    2016-07-01

    A series of pyrrole analogues of combretastatin (CA-4) were synthesized and tested for their anti-proliferative activity. The highly diastereoselective acyl-Claisen rearrangement was used to provide 2,3-syn disubstituted morpholine amides which were used as precursors for the various analogues. This synthesis allows for the preparation of 1,2- and 2,3-diaryl-1H-pyrroles which are both geometrically similar to CA-4. These pyrrolic analogues were tested for their anti-proliferative activity against two human cell lines, K562 and MDA-MB-231 with 2,3-diaryl-1H-pyrrole 35 exhibiting the most potent activity with IC50 value of 0.07μM against MDA-MB-231 cell line.

  14. Synthesis of highly functionalized pyrroles from primary amines and activated acetylenes in water

    Institute of Scientific and Technical Information of China (English)

    S.Zahra Sayyed-Alangi; Zinatossadat Hossaini; Faramarz Rostami-Charati

    2012-01-01

    Stable derivatives of pyrroles were prepared using multicomponent reactions of dialkyl acetylenedicarboxylate,primary amine and propiolate in the presence of N-methylimidazole in water at room temperature in good yields.

  15. Pyrrole as a promising electrolyte additive to trap polysulfides for lithium-sulfur batteries

    Science.gov (United States)

    Yang, Wu; Yang, Wang; Song, Ailing; Gao, Lijun; Sun, Gang; Shao, Guangjie

    2017-04-01

    Lithium-sulfur batteries are a promising energy storage devices beyond conventional lithium ion batteries. However, the ;shuttle effect; of soluble polysulfides is a major barrier between electrodes, resulting in rapid capacity fading. To address above issue, pyrrole has been investigated as an electrolyte additive to trap polysulfides. When pyrrole is added into electrolyte, a surface protective layer of polypyrrole can be formed on the sulfur cathode, which not only acts as a conductive agent to provide an effective electron conduction path but also acts as an absorbing agent and barrier layer suppressing the diffusion of polysulfide intermediates. The results demonstrate that an appropriate amount of pyrrole added into the electrolyte leads to excellent cycling stability and rate capability. Apparently, pyrrole is an effective additive for the entrapment of polysulfides of lithium-sulfur batteries.

  16. Synthesis of new pyrrole-containing biomolecules as building blocks for functionalized polypyrroles in nanobiotechnology

    Energy Technology Data Exchange (ETDEWEB)

    Karsten, S; Liebscher, J [Department of Chemistry, Humboldt-Universitaet zu Berlin, Brook-Taylor-Str. 2, 12489 Berlin (Germany); Nan, A; Turcu, R, E-mail: sebastian.karsten@chemie.hu-berlin.d, E-mail: liebscher@chemie.hu-berlin.d [National Instiute of Research and Development for Isotopic and Molecular Technologies, Donath 65-103, RO-400293 Cluj-Napoca (Romania)

    2009-08-01

    New pyrroles were synthesized wherein biomolecules such as {alpha}-amino acids, peptides or carbohydrates are attached to position 1 or 3 via suitable linkers. These conjugates were copolymerized with pyrrole by chemical polymerisation alone giving corresponding copolymers or in the presence of magnetic iron oxid nanoparticles resulting in functionalized core-shell-nanoparticles. Such products are interesting for biosensing, imaging or separation of biomaterials. They were characterized by several methods such as TEM, HRTEM, FTIR and measuring of magnetization.

  17. A convenient synthesis of pyrroles catalyzed by acidic resin under solvent-free condition

    Institute of Scientific and Technical Information of China (English)

    Shi

    2010-01-01

    A convenient and effective Paal-Knorr condensations of 2,5-hexanedione with most amines have been carried out at room temperature under solvent-free condition. Macroporous strongly acidic styrol resin (D001) as a novel, efficient, cost-effective, and reusable solid acid catalyst for the synthesis of pyrroles under the same conditions. The pyrroles were obtained in high yields in short reaction times.

  18. (E-2,4,6-Trimethyl-N-[(1H-pyrrol-2-ylmethylidene]aniline

    Directory of Open Access Journals (Sweden)

    Wolfgang Imhof

    2013-01-01

    Full Text Available The title compound, C14H16N2, is a pyrrole-2-carbaldimine ligand that shows an E conformation at the imine double bond. The dihedral angle between the rings is 78.3 (1°. In the crystal, pairs of molecules form centrosymmetric dimers [graph-set descriptor is presumably R22(10] via N—H...N hydrogen bonds between the pyrrole N—H group and the imine N atom of a neighbouring molecule.

  19. Egg Hatch Rate and Nymphal Survival of the Bed Bug (Hemiptera: Cimicidae) After Exposure to Insecticide Sprays.

    Science.gov (United States)

    Hinson, K R; Benson, E P; Zungoli, P A; Bridges, W C; Ellis, B R

    2016-12-01

    Few studies have addressed the efficacy of insecticides used against eggs and first-instar nymphs of the bed bug, Cimex lectularius L. (Hemiptera: Cimicidae). Insect eggs are often resistant to insecticides; therefore, information on which products are effective is important. We evaluated the efficacy of four commonly used insecticide sprays applied directly to bed bug eggs. We also evaluated the efficacy of these insecticides to first-instar nymphs exposed to residuals resulting from directly spraying eggs. Temprid SC (beta-cyfluthrin, imidacloprid) was the most effective insecticide at preventing egg hatch (13% hatch rate) for pyrethroid-resistant, field-strain (Jersey City) bed bugs compared with a control (water [99% hatch rate]), Bedlam (MGK-264, sumithrin [84% hatch rate]), Demand CS (lambda-cyhalothrin [91% hatch rate]), and Phantom SC (chlorfenapyr [95% hatch rate]). Demand CS and Temprid SC were most effective at preventing egg hatch (0%) for an insecticide-susceptible (Harold Harlan) strain, followed by Bedlam (28%). Phantom SC produced a hatch rate similar to the control (97% and 96%, respectively). Harold Harlan-strain nymphs showed 100% survival for the control but 0% survival for Bedlam and Phantom SC. Jersey City-strain nymphs showed 100% survival for the control, 99% survival for Bedlam, 0% survival for Demand CS, 4% survival for Phantom SC, and 38% survival for Temprid SC. Demand CS was less effective at preventing hatch (91% hatch rate) of Jersey City-strain nymphs but was the only product to kill all nymphs (0% survival). One of the least effective products for preventing Jersey City-strain egg hatch (Phantom SC, 95% hatch rate) was the second most effective at killing nymphs, leaving only six of 141 alive. These findings indicate that survival of directly sprayed eggs and residually exposed, first-instar nymphs varies by strain, life stage, and product used. © The Authors 2016. Published by Oxford University Press on behalf of Entomological

  20. Influence of Pyranose and Spacer Arm Structures on Phloem Mobility and Insecticidal Activity of New Tralopyril Derivatives

    Directory of Open Access Journals (Sweden)

    Yao Chen

    2017-06-01

    Full Text Available Six new conjugates were designed and synthesized by introducing glucose, methyl glucuronate or glucuronic acid moieties on tralopyril. Phytotoxicity and phloem mobility results demonstrated that the introduction of glucose, methyl glucuronate or glucuronic acid moieties can simultaneously solve the tough phytotoxicity problem and phloem mobility transformation of tralopyril. Conjugates 12 and 18 containing the glucuronic acid moiety exhibited higher phloem mobility than conjugates 9, 11, 15 and 17. Conjugates 15, 17 and 18 with methoxymethyl groups on the tralopyril pyrrole nitrogen atom showed activity against Plutella xylostella, while conjugates 9, 11 and 12 with a methene group on the pyrrole N showed no activity. Cabbage roots were incubated in a buffered solution containing conjugates 15, 17 and 18 at 4 mM for 72 h. Only 18 showed systemic insecticidal activity with 100% mortalityagainst P. xylostella, while 15 and 17 showed lower activity andchlorfenapyr showed no activity. The glucuronic acid promoiety imparted more phloem mobility to tralopyril than glucose and methyl glucuronate. The methoxymethyl group bond on the tralopyril skeleton was the key factor in determining the insecticidal activity of the conjugates. A promising systemic proinsecticide containing glucuronic acid and tralopyril moieties was proposed.

  1. Influence of Pyranose and Spacer Arm Structures on Phloem Mobility and Insecticidal Activity of New Tralopyril Derivatives.

    Science.gov (United States)

    Chen, Yao; Lei, Zhi Wei; Zhang, Ying; Yang, Wen; Liu, Hui Fang; Zhou, Yu Feng; Yang, Mao Fa

    2017-06-25

    Six new conjugates were designed and synthesized by introducing glucose, methyl glucuronate or glucuronic acid moieties on tralopyril. Phytotoxicity and phloem mobility results demonstrated that the introduction of glucose, methyl glucuronate or glucuronic acid moieties can simultaneously solve the tough phytotoxicity problem and phloem mobility transformation of tralopyril. Conjugates 12 and 18 containing the glucuronic acid moiety exhibited higher phloem mobility than conjugates 9, 11, 15 and 17. Conjugates 15, 17 and 18 with methoxymethyl groups on the tralopyril pyrrole nitrogen atom showed activity against Plutella xylostella, while conjugates 9, 11 and 12 with a methene group on the pyrrole N showed no activity. Cabbage roots were incubated in a buffered solution containing conjugates 15, 17 and 18 at 4 mM for 72 h. Only 18 showed systemic insecticidal activity with 100% mortalityagainst P. xylostella, while 15 and 17 showed lower activity andchlorfenapyr showed no activity. The glucuronic acid promoiety imparted more phloem mobility to tralopyril than glucose and methyl glucuronate. The methoxymethyl group bond on the tralopyril skeleton was the key factor in determining the insecticidal activity of the conjugates. A promising systemic proinsecticide containing glucuronic acid and tralopyril moieties was proposed.

  2. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product.

  3. An Efficient and Short Route for the Synthesis of Reverse Pyrrole Ribonucleosides

    Directory of Open Access Journals (Sweden)

    Pereira Letícia O. R.

    2002-01-01

    Full Text Available The synthesis of reverse pyrrole ribonucleosides methyl 5-C-(4-acetyl-5-methyl-pyrrol-1-yl-2,3-O-isopropylidene-5-deoxy- beta-D-ribofuranoside (10, methyl 5-C-(4-ethoxycarbonyl-5-methyl-pyrrol-1-yl-2,3-O-isopropylidene-5-deoxy- beta-D-ribofuranoside (11, methyl 5-C-(4-acetyl-5-methyl-pyrrol-1-yl-5-deoxy-beta-D-ribofuranoside (12, methyl 5-C-(4-ethoxycarbonyl-5-methyl-pyrrol-1-yl-5-deoxy- beta-D-ribofuranoside (13, methyl 5-deoxy-5-C-(3'-formyl-4'-hydroxypropyl-pyrrol-1'-yl-2,3-O-isopropylidene- beta-D-ribofuranoside (16 and methyl 5-deoxy-5-C-(3'-formyl-pyrrol-1'-yl-2,3-O-isopropylidene- beta-D-ribofuranoside (18 are described starting from readily available methyl 5-amino-5-deoxy-2,3-O-isopropylidene-beta-D-ribofuranoside (9. The synthetic strategy for the construction of the heterocyclic ring was based on the nucleophilic attack of (9 to 4-acetyl-2-n-butoxy-5-methyl-4,5-dihydrofuran (4, 4-carbetoxy-2-n-butoxy-5-methyl-4,5-dihydrofuran (5, 4-formyl-2-n-butoxy-4,5-dihydrofuran (6 and 4-formyl-1-methyl dioxabyciclo[3.3.0]oct-3-en (8, in situ. The later compounds were obtained from reaction between 3-diazo-2,4-pentadione (1, ethyl 2-diazoacetoacetate (2 or diazomalonaldehyde (3 and enol ethers using dirhodium tetraacetate as a catalyst.

  4. SELETIVIDADE DE CHLORFENAPYR E FENBUTATIN-OXIDE SOBRE DUAS ESPÉCIES DE ÁCAROS PREDADORES (ACARI: PHYTOSEIIDAE EM CITROS

    Directory of Open Access Journals (Sweden)

    REIS PAULO REBELLES

    2001-01-01

    Full Text Available Com o uso de bioensaios, verificaram-se os efeitos residual de contato, ovicida e de persistência dos produtos chlorfenapyr e fenbutatin-oxide sobre duas espécies de ácaros predadores, Iphiseiodes zuluagai Denmark & Muma e Euseius alatus DeLeon (Acari: Phytoseiidae, associados ao ácaro da leprose-dos-citros Brevipalpus phoenicis (Geijskes (Acari: Tenuipalpidae. O efeito total sobre os adultos foi estudado por meio do método residual de contato com pulverização em superfície de vidro, conforme metodologia da IOBC. O efeito ovicida foi avaliado por meio de pulverização direta sobre os ovos dos ácaros predadores, também em superfície de vidro. A persistência dos produtos foi avaliada em laboratório, em arenas confeccionadas com folhas de laranjeira pulverizadas no campo, aos 0; 5; 15 e 30 dias após a aplicação. Os resultados obtidos mostraram que chlorfenapyr foi nocivo ao I. zuluagai e E. alatus e o fenbutatin-oxide foi levemente nocivo a E. alatus e inócuo a I. zuluagai. Nenhum dos produtos apresentou efeito ovicida. Fenbutatin-oxide apresentou baixa persistência para ambas as espécies de ácaros predadores, e chlorfenapyr, na dosagem de 31,3 ml, foi de baixa persistência, enquanto, na dosagem de 62,5 ml, foi moderadamente persistente. O fenbutatin-oxide apresentou-se inócuo e levemente nocivo aos ácaros predadores I. zuluagai e E. alatus, respectivamente, e de baixa persistência para ambas as espécies

  5. Organic-inorganic interactions in the system of pyrrole-hematite-water at elevated temperatures and pressures

    Science.gov (United States)

    Ding, Kangle

    2015-11-01

    The distribution and abundance of pyrrolic compounds in sediments and crude oils are most likely influenced by inorganic sedimentary components. In this paper, thermal simulation experiments on the system pyrrole-hematite-water were carried out at elevated temperatures and pressures in order to investigate the effect of organic-inorganic interactions on the preservation of pyrrolic compounds. Compositions of the reaction products were analyzed with GC-MS and GC-FID methods. In the closed system pyrrole-hematite-water, the nitrogen-oxygen exchange obviously occurred at temperatures above 350ºC in accordance with the thermochemical calculation. Large amounts of furan and ammonia were generated after simulation experiments, indicating that the conversion of pyrrole into furan was the dominant reaction. Thermochemical exchange effect between organic nitrogen and inorganic oxygen was obviously facilitated by elevated temperatures and found to be catalyzed by hematite, but inhibited by the increasing volume of water. Thermodynamically water spontaneously reacts with pyrrole above 300ºC. The reaction of pyrrole-hematite-water is an exothermic process in which the reaction heat positively correlates with temperature. The heat released was estimated as 9.0 KJ/(mol) pyrrole - 15.0 KJ/(mol) pyrrole in typical oil reservoirs (100ºC-150ºC) and 15.0-23.0 KJ/(mol) pyrrole in typical gas reservoirs (150ºC-200ºC). The calculated activation energy of the nitrogen-oxygen atom exchange is about 129.59 kJ/mol. According to the experimental results, a small amount of water may effectively initiate the nitrogen-oxygen exchange. The study would improve our evaluating of the preservation and fate of pyrrolic compounds in deeply buried geologic settings and further understanding of thermochemical processes behind the degradation of petroleum.

  6. Protonation sites in gaseous pyrrole and imidazole: a neutralization-reionization and ab initio study.

    Science.gov (United States)

    Nguyen, V Q; Turecek, F

    1996-10-01

    Mild gas-phase acids C4H9+ and NH4+ protonate pyrrole at C-2 and C-3 but not at the nitrogen atom, as determined by deuterium labeling and neutralization-reionization mass spectrometry. Proton affinities in pyrrole are calculated by MP2/6-311G(2d,p) as 866, 845 and 786 kJ mol-1 for protonation at C-2, C-3 and N, respectively. Vertical neutralization of protonated pyrrole generates bound radicals that in part dissociate by loss of hydrogen atoms. Unimolecular loss of hydrogen atom from C-2- and C-3-protonated pyrrole cations is preceded by proton migration in the ring. Protonation of gaseous imidazole is predicted to occur exclusively at the N-3 imine nitrogen to yield a stable aromatic cation. Proton affinities in imidazole are calculated as 941, 804, 791, 791 and 724 for the N-3, C-4, C-2, C-5 and N-1 positions, respectively. Radicals derived from protonated imidazole are only weakly bound. Vertical neutralization of N-3-protonated imidazole is accompanied by large Franck-Condon effects which deposit on average 183 kJ mol-1 vibrational energy in the radicals formed. The radicals dissociate unimolecularly by loss of hydrogen atom, which involves both direct N-H bond cleavage and isomerization to the more stable C-2 H-isomer. Potential energy barriers to isomerizations and dissociations in protonated pyrrole and imidazole isomers and their radicals were investigated by ab initio calculations.

  7. Synthesis and Reactions of Furo[2,3-b]pyrroles

    Directory of Open Access Journals (Sweden)

    A. Lycka

    1997-04-01

    Full Text Available Methyl 6H-furo[2,3-b]pyrrole-5-carboxylate (2a was prepared by thermolysis of the corresponding methyl 2-azido-3-(3-furylpropenoate (1. 6-Methyl (2b and 6-benzyl (2c derivatives were obtained using phase-transfer catalysis conditions (PTC. The formylation of 2a-2c gave 2-formylated compounds (3a-3c. Compounds 4b, 4c were prepared by reactions of corresponding esters 2b, 2c with hydrazine in refluxing ethanol. By reaction of 3a-3c with hydroxylammonium chloride in acetic anhydride in the presence of pyridine, methyl 2-cyano-6-R1-furo[2,3-b]pyrrole-5-carboxylates (5a-5c were obtained. The reaction of these compounds with sodium azide and ammonium chloride in dimethylformamide led to methyl 2-(5'-tetrazolyl-6-R1-furo[2,3-b]pyrrole-5-carboxylates (6a-6c. A series of 5-methoxycarbonyl-6-R1-furo[2,3-b]pyrrole-2-carbaldehyde N,N-dimethylhydrazones (7a-7c was prepared from methyl 2-formyl-6-R1-furo[2,3-b]pyrrole-5-carboxylates (3a-3c and unsym-dimethylhydrazine. The correlation of the 13C and 15N chemical shifts with the data of the calculated (AM1 net atomic charges is discussed.

  8. Synthesis of star-shaped pyrrole and thiophene functionalized monomers and optoelectrochemical properties of corresponding copolymers

    Energy Technology Data Exchange (ETDEWEB)

    Ak, Metin [Middle East Technical University, Department of Chemistry, 06531 Ankara (Turkey); Pamukkale University, Department of Chemistry, 20020 Denizli (Turkey); Toppare, Levent [Middle East Technical University, Department of Chemistry, 06531 Ankara (Turkey)], E-mail: toppare@metu.edu.tr

    2009-04-15

    Star-shaped thiophene and pyrrole functionalized monomers namely 2,4,6-tris(4-(1H-pyrrol-1-yl)phenoxy)-1,3,5-triazine (TriaPy) and 2,4,6-tris(4-(1H-pyrrol-1-yl)phenoxy)-1,3,5-triazine (TriaTh) were synthesized from 2,4,6-trichloro-1,3,5-triazine, thiophen-3-ylmethanol and 4-(1H-pyrrol-1-yl)phenol. Electrochemical copolymerization of monomers with thiophene and pyrrole was achieved in tetrabutylammonium tetrafluoroborate/acetonitrile (TBAFB/AN). Resulting copolymers were characterized by Fourier transform infrared (FTIR) spectrometer, cyclic voltammetry (CV) and conductivity measurements. Spectroelectrochemical analysis reflected that copolymer films have low {lambda}{sub max} for {pi}-{pi}* electronic transitions accompanied with a rather high band gap compared to polythiophene and polypyrrole. Switching abilities of copolymer films were evaluated by a kinetic study via measuring the transmittance (%T) at the maximum contrast.

  9. Electrophilic surface sites as precondition for the chemisorption of pyrrole on GaAs(001) surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Bruhn, Thomas [Institut für Festkörperphysik, Technische Universität Berlin, Hardenbergstr.36, D-10623 Berlin (Germany); Leibniz-Institut für Analytische Wissenschaften - ISAS - e.V., Albert-Einstein-Str.9, 12489 Berlin (Germany); Fimland, Bjørn-Ove [Department of Electronics and Telecommunications, Norwegian University of Science and Technology, NO-7491 Trondheim (Norway); Vogt, Patrick, E-mail: patrick.vogt@tu-berlin.de [Institut für Festkörperphysik, Technische Universität Berlin, Hardenbergstr.36, D-10623 Berlin (Germany)

    2015-03-14

    We report how the presence of electrophilic surface sites influences the adsorption mechanism of pyrrole on GaAs(001) surfaces. For this purpose, we have investigated the adsorption behavior of pyrrole on different GaAs(001) reconstructions with different stoichiometries and thus different surface chemistries. The interfaces were characterized by x-ray photoelectron spectroscopy, scanning tunneling microscopy, and by reflectance anisotropy spectroscopy in a spectral range between 1.5 and 5 eV. On the As-rich c(4 × 4) reconstruction that exhibits only nucleophilic surface sites, pyrrole was found to physisorb on the surface without any significant modification of the structural and electronic properties of the surface. On the Ga-rich GaAs(001)-(4 × 2)/(6 × 6) reconstructions which exhibit nucleophilic as well as electrophilic surface sites, pyrrole was found to form stable covalent bonds mainly to the electrophilic (charge deficient) Ga atoms of the surface. These results clearly demonstrate that the existence of electrophilic surface sites is a crucial precondition for the chemisorption of pyrrole on GaAs(001) surfaces.

  10. SELETIVIDADE DE CHLORFENAPYR E FENBUTATIN-OXIDE SOBRE DUAS ESPÉCIES DE ÁCAROS PREDADORES (ACARI: PHYTOSEIIDAE) EM CITROS

    OpenAIRE

    REIS PAULO REBELLES; SOUSA ÉLBER OLIVEIRA

    2001-01-01

    Com o uso de bioensaios, verificaram-se os efeitos residual de contato, ovicida e de persistência dos produtos chlorfenapyr e fenbutatin-oxide sobre duas espécies de ácaros predadores, Iphiseiodes zuluagai Denmark & Muma e Euseius alatus DeLeon (Acari: Phytoseiidae), associados ao ácaro da leprose-dos-citros Brevipalpus phoenicis (Geijskes) (Acari: Tenuipalpidae). O efeito total sobre os adultos foi estudado por meio do método residual de contato com pulverização em superfície de vidro, confo...

  11. Synthesis of insecticidal sucrose esters

    Institute of Scientific and Technical Information of China (English)

    Song Zi-juan; Li Shu-jun; Chen Xi; Liu Li-mei; Song Zhan-qian

    2006-01-01

    Some synthetic sucrose esters (SE) are a relatively new class of insecticidal compounds produced by reacting sugars with fatty acids, which are safe for the environment. Especially, sucrose esters composed of C6-C12 fatty acids have desirable insecticidal properties against many soft-bodied arthropod pests. In our study, sucrose octanoate which has the highest activity against a range of arthropod species was synthesized by a trans-esterification method and proved its insecticidal property. Under the condition of a homogeneous liquid, sucrose octanoate was prepared by reacting ethyl octanoate with sucrose at reduced pressure; the yield was 79.11%. Sucrose octanoate synthesized was identified and its property analyzed by IR, TLC and spectrophotometric analysis. It was shown that the ratio of monoester to polyester in sucrose octanoate was 1.48:1. The insecticidal activity of the synthetic sucrose octanoate was evaluated at a concentration of 4 and 8 mg·mL-1. The mortality of first-instar larvae ofLymantria dispar from its contact toxicity was 72.5% after 36 hours, the revision insect reduced rate of Aphis glycines reached above 80% at 4 and 8 mg·mL-1 after being treated for 5 days. Since the SE products are nontoxic to humans and higher animals, fully biodegradable and hydrolyzed to readily metabolizable sucrose and fatty acid, they are not harmful to crops and appear to be good insecticide candidates.

  12. A novel and facile approach for synthesis of 5-amino-7-aryl-6-cyano-4-pyrano[3,2-]pyrroles

    Indian Academy of Sciences (India)

    Reza Sandaroos; Saman Damavandi

    2012-07-01

    An efficient and iron-catalysed synthesis of 4-pyrano[3,2-]pyrrole is reported. The reactions proceed through a one-pot, three component cyclocondensation of 3-hydroxypyrrole, malononitrile and various aldehydes to afford 4-pyrano[3,2-]pyrrole derivatives in moderate to good yield using ferric hydrogensulphate, Fe(HSO4)3, as the catalyst.

  13. Synthesis of poly[(pyrrole-2,5-diyl)-co-(4-hydroxylbenzylidene)] catalysed by Maghnite– H+

    OpenAIRE

    Bouhadjar Larbi; Aïcha Hachemaoui; Yahiaoui Ahmed; Bouchama Abdelghani; Chikh Karime; Belbachir Mohamed

    2014-01-01

    Rapid synthesis of poly[(pyrrole-2,5-diyl)-co-(4-hydroxylbenzylidene)] was achieve via the condensation of pyrrole and 4-hydroxylbenzylidene in dichloromethane using acid exchanged montmorillonite clay called Maghnite– H+ (Mag–H+) as an efficient catalyst The conjugated polymer was characterized by means of 1H-NMR, UV-visible, FT-IR spectroscopy and TGA.

  14. A Chlorfenapyr Mixture Net Interceptor® G2 Shows High Efficacy and Wash Durability against Resistant Mosquitoes in West Africa.

    OpenAIRE

    N'Guessan, R.; Odjo, A; Ngufor, C; Malone, D.; Rowland, M

    2016-01-01

    Background Malaria control through use of long-lasting insecticidal nets (LN) is threatened by the selection of anopheline mosquitoes strongly resistant to pyrethroid insecticides. To sustain future effectiveness it is essential to identify and evaluate novel insecticides suitable for nets. Mixtures of two insecticides with contrasting mode of action have the potential to kill resistant vectors and restore transmission control provided the formulation can withstand regular washing over the ne...

  15. Separation of Phenolic Compounds and Organic Anions Using ODS Column Coated with Meso-octamethylcalix[4]pyrrole and Water as Eluent

    Institute of Scientific and Technical Information of China (English)

    Li Jun HE; Shi Jun SHAO; Yong GUO; Hua Jiao MA; Xia LIU; Sheng Xiang JIANG

    2003-01-01

    Octadecylsilanized silica (ODS) was coated with meso-octamethylcalix[4]pyrrole toobtain a novel calix[4]pyrrole containing stationary phase for HPLC. Compared to ODS, the newstationary phase showed a relatively large retention and an improved separation for phenoliccompounds and organic anions, using pure water as mobile phase. The results can be ascribed tothe interaction between analytes and calix[4]pyrrole.

  16. Self-Assembly of Dimeric Tetrathiafulvalene-Calix 4 pyrrole: Receptor for 1,375-Trinitrobenzene

    DEFF Research Database (Denmark)

    Nielsen, K. A.; Stein, P. C.

    2011-01-01

    The synthesis and binding properties of a tetrathiafulvalene (TTF)-calix[4]pyrrole receptor 2 appended with one 3,5-dinitrobenzoate guest moiety are reported. The preliminary studies revealed that the receptor is self-compiexing into a dimer receptor 2 center dot 2. The self-complexation of the r......The synthesis and binding properties of a tetrathiafulvalene (TTF)-calix[4]pyrrole receptor 2 appended with one 3,5-dinitrobenzoate guest moiety are reported. The preliminary studies revealed that the receptor is self-compiexing into a dimer receptor 2 center dot 2. The self...

  17. Dispersive micro-solid phase extraction based on self-assembling, ionic liquid-coated magnetic particles for the determination of clofentezine and chlorfenapyr in environmental water samples.

    Science.gov (United States)

    Peng, Bing; Zhang, Jiaheng; Lu, Runhua; Zhang, Sanbing; Zhou, Wenfeng; Gao, Haixiang

    2013-11-21

    Two ionic liquid-coated-Fe3O4 magnetic particles (IL-Fe3O4 MPs) were developed for use in two types of dispersive micro-solid phase extraction (D-μ-SPE) for the high-performance liquid chromatographic analysis of clofentezine and chlorfenapyr in environmental water samples. Self-assembling IL-Fe3O4 MPs were used in D-μ-SPE as adsorbents. Two D-μ-SPE extraction methods, namely, direct dispersive micro-solid phase extraction (d-D-μ-SPE) and in situ solvent formation-based dispersive micro-solid phase extraction (ISF-D-μ-SPE), were proposed, using [C8MIM][PF6] to extract analytes through two pathways. Lower IL doses were required in the extraction process compared with those in other IL-based methods. Fe3O4 MPs can also be recycled and reused after extraction and are thus environmentally friendly. These newly developed methods were demonstrated to be feasible for use in the quantitation of clofentezine and chlorfenapyr at trace levels, with lower limit of detection values ranging from 0.4 to 0.5 ng mL(-1) for d-D-μ-SPE and 0.4 ng mL(-1) for ISF-D-μ-SPE. Finally, relative standard deviations of less than 6.0% were obtained.

  18. Hydrolytic study of the copolymer Poly pyrrole/ Polyethyleneglycol and Poly pyrrole synthesized by plasma; Estudio hidrolitico del copolimero polipirrol/polietilenglicol y polipirrol sintetizado por plasma

    Energy Technology Data Exchange (ETDEWEB)

    Colin, E.; Enriquez, M.A.; Olayo, M.G.; Cruz, G.J.; Carapia, L.; Romero, M. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Morales, J.; Olayo, R. [UAM-I, A.P. 55-534 Iztapalapa, Mexico D.F. (Mexico)

    2006-07-01

    In this work the study about the hydrolytic compatibility of semiconductor polymers, copolymer Poly pyrrole/ Polyethyleneglycol (PPy/PEG) and Poly pyrrole (PPy) for their possible use as biomaterials. The polymers were synthesized by plasma between 10 and 100 W, with discharges of splendor RF to 13.5 MHz with resistive coupling. The hydrolytic affinity was evaluated calculating the contact angle with solutions of NaCl, NaCl-MgSO{sub 4} and Krebs-Ringer. The results show a hydrophilicity increment due to the increase of the surface ruggedness with the synthesis energy. On the contrary, the crystallinity diminishes when increasing the power in PPy and it stays approximately constant in PPy/PEG. The electric conductivity presents a growth from 2 to 4 magnitude orders in function of the water content in the polymers. (Author)

  19. Intramolecular redox reaction for the synthesis of N-aryl pyrroles catalyzed by Lewis acids.

    Science.gov (United States)

    Du, Hong-Jin; Zhen, Le; Wen, Xiaoan; Xu, Qing-Long; Sun, Hongbin

    2014-12-21

    An efficient approach to synthesize N-aryl pyrroles via Lewis acid-mediated 1,5-hydride shift and isomerization of 2-(3-pyrroline-1-yl)arylaldehydes has been achieved in up to 89% yield. This methodology is applicable to the synthesis of fluorazene derivatives as electron donor (D)/acceptor (A) molecules.

  20. Identification of a new electron-transfer relaxation pathway in photoexcited pyrrole dimers.

    Science.gov (United States)

    Neville, Simon P; Kirkby, Oliver M; Kaltsoyannis, Nikolas; Worth, Graham A; Fielding, Helen H

    2016-04-21

    Photoinduced electron transfer is central to many biological processes and technological applications, such as the harvesting of solar energy and molecular electronics. The electron donor and acceptor units involved in electron transfer are often held in place by covalent bonds, π-π interactions or hydrogen bonds. Here, using time-resolved photoelectron spectroscopy and ab initio calculations, we reveal the existence of a new, low-energy, photoinduced electron-transfer mechanism in molecules held together by an NH⋯π bond. Specifically, we capture the electron-transfer process in a pyrrole dimer, from the excited π-system of the donor pyrrole to a Rydberg orbital localized on the N-atom of the acceptor pyrrole, mediated by an N-H stretch on the acceptor molecule. The resulting charge-transfer state is surprisingly long lived and leads to efficient electronic relaxation. We propose that this relaxation pathway plays an important role in biological and technological systems containing the pyrrole building block.

  1. Identification of a new electron-transfer relaxation pathway in photoexcited pyrrole dimers

    Science.gov (United States)

    Neville, Simon P.; Kirkby, Oliver M.; Kaltsoyannis, Nikolas; Worth, Graham A.; Fielding, Helen H.

    2016-04-01

    Photoinduced electron transfer is central to many biological processes and technological applications, such as the harvesting of solar energy and molecular electronics. The electron donor and acceptor units involved in electron transfer are often held in place by covalent bonds, π-π interactions or hydrogen bonds. Here, using time-resolved photoelectron spectroscopy and ab initio calculations, we reveal the existence of a new, low-energy, photoinduced electron-transfer mechanism in molecules held together by an NH⋯π bond. Specifically, we capture the electron-transfer process in a pyrrole dimer, from the excited π-system of the donor pyrrole to a Rydberg orbital localized on the N-atom of the acceptor pyrrole, mediated by an N-H stretch on the acceptor molecule. The resulting charge-transfer state is surprisingly long lived and leads to efficient electronic relaxation. We propose that this relaxation pathway plays an important role in biological and technological systems containing the pyrrole building block.

  2. Synthesis and recognition properties of higher order tetrathiafulvalene (TTF) calix n pyrroles (n=4-6)

    DEFF Research Database (Denmark)

    Park, J. S.; Bejger, C.; Larsen, K. R.

    2012-01-01

    of the condensation reaction, the expanded calix[n]pyrroles (n = 5 and 6) are characterized by a larger cavity size and a higher number of TTF units (albeit the same empirical formula). Analysis of the binding isotherms obtained from UV-Vis spectroscopic titrations carried out in CHCl3 in the presence of both anionic...

  3. Cellular fibronectin and von Willebrand factor concentrations in plasma of rats treated with monocrotaline pyrrole

    NARCIS (Netherlands)

    Schultze, A.E.; Emeis, J.J.; Roth, R.A.

    1996-01-01

    The monocrotaline pyrrole (MCTP)-treated rat is a useful model for the study of certain chronic pulmonary vascular diseases. A single, i.v. administration of a low dose of MCTP causes pneumotoxicity, pulmonary vascular remodeling, sustained increases in pulmonary arterial pressure, and right ventric

  4. Synthesis of Iso-condensed Heteroaromatic Pyrroles and Their Application in the Preparation of Conducting Polymers

    Institute of Scientific and Technical Information of China (English)

    Chin-Kang Sha; Su-Ya Cheng; Yuan-Liang Kuo; Liu Chia-Lin; V. Raghukumar

    2004-01-01

    Iso-condensed heteroaromatic pyrroles 1 are 10 -electron aromatic compounds. They are of interest from both theoretical and synthetic points of view. They are the cyclic analogues of heteroaromatic ortho-quinodimethanes 2, and can react with dienophiles in a Diels-Alder reaction to give the synthetically useful cycloadducts 3. Many of them are also of potential pharmaceutical importance because they are isosteric with indoles. Iso-condensed heteroaromatic pyrroles 1 can be used also as the monomers for the synthesis of new conducting polymers 5 with special properties and characteristics. However, the methods for the efficient preparation of the iso-condensed heteroaromatic pyrroles are quite limited. Iso-condensed heteroaromatic pyrroles are generally unstable in acidic conditions and are easily oxidized by air. In our laboratories, we developed three methods for the preparation of this labile heterocyclic ring system under acidic, neutral, and basic conditions.1 Synthesis of the conjugated systems such as 6 for OLED applications will also be discussed.

  5. EFICIÊNCIA DE INSETICIDAS PARA O CONTROLE DE Plutella xylostella (LEPIDOPTERA: PLUTELLIDAE NA CULTURA DO REPOLHO (Brassica oleracea var. capitata COMPARISON OF INSECTICIDE CONTROL EFFECTIVENESS OF Plutella xylostella (LEPIDOPTERA: PLUTELLIDAE IN CABBAGE

    Directory of Open Access Journals (Sweden)

    Fábio Shigeo Takatsuka

    2007-09-01

    Full Text Available

    O presente trabalho foi conduzido em uma área sob plantio contínuo de repolho (Brassica oleracea var. capitata em Goianápolis - GO, no período de setembro a novembro de 1996, visando comparar inseticidas para o controle da traça-das-crucíferas (Plutella xylostella. O delineamento experimental foi em blocos ao acaso com oito tratamentos e quatro repetições. Os tratamentos utilizados foram: teflubenzuron, nas doses de 25 mL, 30 mL e 40 mL de produto comercial (p.c./100 L de água; chlorfenapyr, nas doses de 30 mL, 50 mL e 100 mL de p.c./100 L de água; deltamethrin, na dose de 30 mL de p.c./100 L de água; e testemunha. Para cada tratamento realizaram-se aplicações semanais após o transplantio. As avaliações foram realizadas na colheita, contando-se o número de furos causados pela traça, em cinco cabeças comerciais de repolho, tomadas ao acaso, por parcela. Pôde-se concluir que os inseticidas teflubenzuron e chlorfenapyr foram mais eficientes que deltamethrin no controle da traça-das-crucíferas P. xylostella nas doses testadas.

    PALAVRAS-CHAVE: Inseticida; traça; controle químico.

    The research was carried out in an area under continuous cabbage cropping (Brassica oleracea var. capitata in Goianápolis, Goiás State, Brazil, from September to November 1996. The aim was to compare insecticides for diamondback moth (Plutella xylostella control. The experimental design was randomized blocks with eight treatments and four replications. The treatments were teflubenzuron in the doses of 25 mL, 30 mL and 40 mL of commercial product (c.p. / 100 L of water; chlorfenapyr in the doses of 30 mL, 50 mL and 100 mL of c.p./ 100 L of water; deltamethrin in the dose of 30 mL of c.p. / 100 L of water; and control. Treatments were applied weekly

  6. Nucleophilic and electrophilic cyclization of N-alkyne-substituted pyrrole derivatives: Synthesis of pyrrolopyrazinone, pyrrolotriazinone, and pyrrolooxazinone moieties

    Directory of Open Access Journals (Sweden)

    Işıl Yenice

    2017-05-01

    Full Text Available Intramolecular nucleophilic and electrophilic cyclization of N-alkyne-substituted pyrrole esters is described. Efficient routes towards the synthesis of pyrrolopyrazinone, pyrrolotriazinone and pyrrolooxazinone have been developed. First, N-alkyne-substituted pyrrole ester derivatives were synthesized. Introduction of various substituents into the alkyne functionality was accomplished by a copper-catalyzed cross-coupling reaction. Nucleophilic cyclization of N-alkyne-substituted methyl 1H-pyrrole-2-carboxylates with hydrazine afforded the 6-exo-dig/6-endo-dig cyclization products depending on the electronic nature of the substituents attached to the alkyne. On the other hand, cyclization of N-alkyne-substituted methyl 1H-pyrrole-2-carboxylates with iodine only resulted in the formation of the 6-endo-dig cyclization product regardless of the substitution of the alkyne functionality.

  7. Use of Graphite Oxide and Graphene Oxide as Catalysts in the Synthesis of Dipyrromethane and Calix[4]pyrrole

    Directory of Open Access Journals (Sweden)

    Sweta Mishra

    2011-08-01

    Full Text Available Graphite oxide and graphene oxides have been used as solid catalysts for the synthesis of 5,5-dialkyldipyrromethanes and calix[4]pyrroles in organic and aqueous solutions at room temperature.

  8. DABCO-promoted facile and convenient synthesis of novel isoxazolyl-1H-2,3-pyrrole dicarboxylates

    Institute of Scientific and Technical Information of China (English)

    Rajanarendar Eligeti; Kishore Baireddy; Ramakrishna Saini

    2013-01-01

    Synthesis of isoxazolyl-1H-2,3-pyrrole dicarboxylate (4) was simply achieved by one-pot three component reaction of isoxazole amine (1) with diethyl acetylenedicarboxylate (DEAD) (2),and glyoxal (3),in acetonitrile catalyzed by diazabicyclo octane (DABCO).

  9. 杀虫剂对不同发育阶段拟澳洲赤眼蜂的安全性评估%Safety of Ten Insecticides to Different Developmental Stages of Trichogramma confusum Viggiani (Hymenoptera: Trichogrammatidae)

    Institute of Scientific and Technical Information of China (English)

    王德森; 何余容; 郭祥令; 罗永丽; 谢梅琼

    2012-01-01

    在实验室条件下通过药膜法和卵卡浸渍法测定了10种蔬菜田防治小菜蛾Plutella xylostella(L.)的常用杀虫剂对拟澳洲赤眼蜂Trichogramma confusum Viggiani的影响,旨在评估各药剂对该蜂不同发育阶段的安全性,为小菜蛾防治过程中杀虫剂的合理施用提供科学依据。结果表明,高效氯氰菊酯、多杀菌素、阿维菌素、溴虫腈和杀螟丹对拟澳洲赤眼蜂成蜂有明显的触杀毒性。杀螟丹处理显著降低羽化率(0~34.37%),在卵期和预蛹期处理还导致拟澳洲赤眼蜂畸形;多杀菌素在成虫期前的各处理均显著影响拟澳洲赤眼蜂的发育;溴虫腈在卵期、幼虫期和蛹期处理对拟澳洲赤眼蜂的发育存在不同程度的影响;而氟啶脲、茚虫威、苏云金芽孢杆菌、虫酰肼和丁醚脲对拟澳洲赤眼蜂成蜂及各发育虫态均较安全,为小菜蛾生防区理想的配合药剂。%Effect of ten insecticides on Trichogramma confusum Viggiani was determined and their safety to different developmental stages of the parasitoid was evaluated under laboratory condition by insecticide film method and dipping method. The results showed that betacypermethrin, spinosad, avermectins, chlorfenapyr and cartap had significant toxic effect on wasp adult survival. Cartap reduced emergence rate (0--34.37%) of T. confusum when the parasitoid was treated at each preimaginal developmental stage. And treatment with cartap at both egg and prepupa stages resulted in higher rate of deformity in the emerged adults than that in the control. Spinosad and chlorfenapyr significantly affected development of T. confusum when applied to preimaginal developmental stages. Chlorfluazuron, indoxacarb, Bacillus thuringiensis, tebufenozide and diafenthiuron were relatively safe to T. confusum, suggesting that these insecticides are compatible with the parasitoid.

  10. Synthesis of poly[(pyrrole-2,5-diyl-co-(4-hydroxylbenzylidene] catalysed by Maghnite– H+

    Directory of Open Access Journals (Sweden)

    Bouhadjar Larbi

    2014-01-01

    Full Text Available Rapid synthesis of poly[(pyrrole-2,5-diyl-co-(4-hydroxylbenzylidene] was achieve via the condensation of pyrrole and 4-hydroxylbenzylidene in dichloromethane using acid exchanged montmorillonite clay called Maghnite– H+ (Mag–H+ as an efficient catalyst The conjugated polymer was characterized by means of 1H-NMR, UV-visible, FT-IR spectroscopy and TGA.

  11. Developing novel C-4 analogues of pyrrole-based antitubulin agents: weak but critical hydrogen bonding in the colchicine site.

    Science.gov (United States)

    Da, Chenxiao; Telang, Nakul; Hall, Kayleigh; Kluball, Emily; Barelli, Peter; Finzel, Kara; Jia, Xin; Gupton, John T; Mooberry, Susan L; Kellogg, Glen E

    2013-01-01

    The synthesis, biological evaluation and molecular modeling of a series of pyrrole compounds related to 3,5-dibromo-4-(3,4-dimethoxyphenyl)-1H-pyrrole-2-carboxylic acid that evaluates and optimizes C-4 substituents are reported. The key factor for microtubule depolymerization activity appears to be the presence of an appropriately positioned acceptor for Cys241β in the otherwise hydrophobic subpocket A.

  12. Convenient synthesis of substituted pyrroles via a cerium (IV ammonium nitrate (CAN-catalyzed Paal–Knorr reaction

    Directory of Open Access Journals (Sweden)

    Ahmed Kamal

    2016-07-01

    Full Text Available A screening of various cerium salts for promoting the Paal–Knorr pyrrole synthesis revealed the superiority of cerium (IV ammonium nitrate (CAN as a catalyst. Excellent yields of substituted pyrroles were obtained in CAN-catalyzed Paal–Knorr reactions of 1,4-diketones with various amines. The protocol is noteworthy for the mild reaction condition, short reaction times, scalability and easy isolation of products and high yields of the products.

  13. Toxicidade de inseticidas utilizados na cultura do tomateiro a Trichogramma pretiosum Toxicity of insecticides used in tomato crop to Trichogramma pretiosum

    Directory of Open Access Journals (Sweden)

    Alexandre Pinho Moura

    2005-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a toxicidade dos inseticidas acetamipride (0,05 g L-1 de i.a., clorfenapir (0,12 g L-1 de i.a., imidaclopride (1,16 g L-1 de i.a., tiaclopride (0,48 g L-1 de i.a. e tiametoxam (0,05 g L-1 de i.a. a Trichogramma pretiosum em diferentes fases imaturas. Ovos de Anagasta kuehniella foram aderidos em cartelas de cartolina azul e expostos ao parasitismo de T. pretiosum por 48 horas. Os ovos supostamente parasitados, contendo os parasitóides no período de ovo-larva e nas fases de pré-pupa e pupa, foram imersos nas caldas químicas e em água (testemunha por cinco segundos, e mantidos em câmara climatizada a 24±1ºC, UR de 70±10% e 12 horas de fotófase. Clorfenapir e imidaclopride reduziram em 76,0% e 64,4%, respectivamente, a emergência de indivíduos da geração F1 de T. pretiosum. A razão sexual dos indivíduos da geração F1 não foi afetada por nenhum dos compostos avaliados, variando de 0,7 a 0,8. Clorfenapir reduziu em aproximadamente 50% a taxa de parasitismo de T. pretiosum da geração F1. Acetamipride e tiametoxam foram inofensivos ao parasitóide e podem ser utilizados em associação com essa espécie no controle de pragas na cultura do tomateiro.The aim of this work was to evaluate the toxicity of the insecticides acetamiprid (0.05 g L-1 a.i., chlorfenapyr (0.12 g L-1 a.i., imidacloprid (1.16 g L-1 a.i., thiacloprid (0.48 g L-1 a.i. and thiamethoxam (0.05 g L-1 a.i. to Trichogramma pretiosum, in different immature stages. Eggs of Anagasta kuehniella glued in blue paper cards were offered to females of T. pretiosum for 48 hours. After the parasitization, the eggs were treated by dipping the cards into the chemical solutions or in water for five seconds after they reached the egg-larval, prepupal and pupal stages. The bioassays were carried out under controlled conditions, at 24±1ºC, RH of 70±10% and 12 hours of photophase. Both chlorfenapyr and imidacloprid reduced in 76.0% and 64

  14. Evaluation on control efficacy of Sprodoptera litura (Fabricius) with 4 kinds of insecticides on Vigna unguiculata%4种杀虫剂防治豇豆斜纹夜蛾的防效比较试验

    Institute of Scientific and Technical Information of China (English)

    秦双; 陈海燕; 潘飞; 吉训聪

    2014-01-01

    通过应用4种药剂防治豇豆斜纹夜蛾药效试验,结果表明,5%氯虫苯甲酰胺悬浮剂防效最好,速效性和持效性都较好,20%氟虫双酰胺水分散粒剂、24%虫螨腈悬浮剂和24%甲氧虫酰肼悬浮剂等药剂也表现出较好的效果,持效期7d以上,生产上防治时可轮换或混合使用。%The efficacies of 4 insecticides were evaluated against Sprodoptera litura (Fabricius) with Vigna unguiculata in field trial. The results showed control efficiency of 5% chlorantraniliprole was the best with rapid efficacy and long efficacy. 20% flubendiamide, 24% chlorfenapyr and 24% methoxyfenozide in the trials had good control effects too, and the effects can be sustained for more than 7 days. These insecticides can be used on the production.

  15. Effect of Pyrrole and N-Methylpyrrole Coatings on Corrosion Resistance of Mild Steel

    Institute of Scientific and Technical Information of China (English)

    AliAshrafi; M.A.Golozarl; S.Mallakpour; AliGhasemi

    2004-01-01

    Electrochemical polymerizations of various ratios of pyrrole and methylpyrrole monomers were performed in aqueous toluene-4-sulfinic acid sodium salt (T4SNa) electrolyte, using galvanostatic method, pH of electrolyte was adjusted by p-toluene sulfonic acid (PTSA). In order to prevent corrosion of mild steel substrates during coating deposition, specimens were pretreated in 0.5M oxalic acid solution, employing galvanostatic method. This would passivate the steel substrate and facilitate the coating process as well. Corrosion resistance of coated substrates was investigated in 1M NaCl solution using Tafel polarization technique. In addition, using scanning electron microscopy (SEM), morphological characterization of coatings produced, was investigated. Regarding the corrosion characteristics, results obtained revealed that the ratio of 1 to 1(Pyrrole/Methylpyrrole) could play an important role.

  16. Ab initio multiple cloning simulations of pyrrole photodissociation: TKER spectra and velocity map imaging.

    Science.gov (United States)

    Makhov, Dmitry V; Saita, Kenichiro; Martinez, Todd J; Shalashilin, Dmitrii V

    2015-02-07

    We report a detailed computational simulation of the photodissociation of pyrrole using the ab initio Multiple Cloning (AIMC) method implemented within MOLPRO. The efficiency of the AIMC implementation, employing train basis sets, linear approximation for matrix elements, and Ehrenfest configuration cloning, allows us to accumulate significant statistics. We calculate and analyze the total kinetic energy release (TKER) spectrum and Velocity Map Imaging (VMI) of pyrrole and compare the results directly with experimental measurements. Both the TKER spectrum and the structure of the velocity map image (VMI) are well reproduced. Previously, it has been assumed that the isotropic component of the VMI arises from long time statistical dissociation. Instead, our simulations suggest that ultrafast dynamics contributes significantly to both low and high energy portions of the TKER spectrum.

  17. 3-/3,5-Pyrrole-substituted BODIPY derivatives and their photophysical and electrochemical studies

    Indian Academy of Sciences (India)

    KARTHIKA J KADASSERY; AKANKSHA NIMESH; SANOJ RAJ; NEERAJ AGARWAL

    2016-09-01

    Nucleophilic substitution on 3-bromo/3,5-dibromo-4,4'-difluoro-8-(aryl)-4-bora-3a,4a-diaza-sindacene (BODIPY), substituted with anisyl or thienyl at meso positions, with neat pyrrole afforded the mono and di-pyrrole substituted BODIPYs 1–4 in good yields. Large bathochromic shifts, upto ∼180 nm in absorption maxima (581–682 nm), and fluorescence maxima (606–695 nm) were observed for these BODIPYs. Absorption and fluorescence properties were studied in different solvents to compare the effect of mono and di substitution on BODIPY. The Lippert-Mataga equations were used which predict strong polarization of monosubstituted BODIPYs. Electrochemical studies were carried out to find the oxidation potential and HOMO energy levels were calculated. Theoretical studies of 1–4 provide the insight on the electron density distribution in 1–4. Theoretical and experimental photo-physical studies in different solvents were correlated to findthe substituent effects on BODIPY.

  18. Effect of Pyrrole and N-Methylpyrrole Coatings on Corrosion Resistance of Mild Steel

    Institute of Scientific and Technical Information of China (English)

    Ali Ashrafi; M.A.Golozar; S.Mailakpour; Ali Ghasemi

    2004-01-01

    Electrochemical polymerizations of various ratios of pyrrole and methylpyrrole monomers were performed in aqueous toluene-4-sulfinic acid sodium salt (T4SNa) electrolyte, using galvanostatic method. pH of electrolyte was adjusted by p-toluene sulfonic acid (PTSA). In order to prevent corrosion of mild steel substrates during coating deposition,specimens were pretreated in 0.5M oxalic acid solution, employing galvanostatic method. This would passivate the steel substrate and facilitate the coating process as well. Corrosion resistance of coated substrates was investigated in 1M NaCl solution using Tafel polarization technique. In addition, using scanning electron microscopy (SEM), morphological characterization of coatings produced, was investigated. Regarding the corrosion characteristics, results obtained revealed that the ratio of 1 to 1 (Pyrrole/Methylpyrrole) could play an important role.

  19. Conjugated polymers with pyrrole as the conjugated bridge: synthesis, characterization, and two-photon absorption properties.

    Science.gov (United States)

    Li, Qianqian; Zhong, Cheng; Huang, Jing; Huang, Zhenli; Pei, Zhiguo; Liu, Jun; Qin, Jingui; Li, Zhen

    2011-07-14

    The synthesis, one- and two-photon absorption (2PA) and emission properties of two novel pyrrole-based conjugated polymers (P1 and P2) are reported. They emitted strong yellow-green and orange fluorescence with fluorescent quantum yields (Φ) of 46 and 33%, respectively. Their maximal 2PA cross sections (δ) measured by the two-photon-induced fluorescence method using femtosecond laser pulses in THF were 2392 and 1938 GM per repeating unit, respectively, indicating that the 2PA chromophores consisting of the triphenylamine with nonplanar structure as the donor and electron-rich pyrrole as the conjugated bridge could be the effective repeating units to enhance the δ values.

  20. Dichloridobis(4-pyridylmethyl 1H-pyrrole-2-carboxylate-κNzinc

    Directory of Open Access Journals (Sweden)

    Guilong Zhang

    2012-03-01

    Full Text Available In the title molecule, [ZnCl2(C11H10N2O22], the ZnII ion, situated on a twofold axis, is in a distorted tetrahedral coordination environment formed by two chloride anions and two pyridine N atoms of the two organic ligands. In the pyrrole-2-carboxylate unit, the pyrrole N—H group and the carbonyl group point approximately in the same direction. The dihedral angle between the two pyridine rings is 54.8 (3°. The complex molecules are connected into chains extending along [101] by N—H...Cl hydrogen bonds. The chains are further assembled into (-101 layers by C—H...O and C—H...Cl interactions.

  1. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  2. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  3. Poly(pyrrole) microwires fabrication process on flexible thermoplastics polymers: application as a biosensing material

    OpenAIRE

    Garcia-Cruz, Alvaro; Lee, Michael; Zine, Nadia; Sigaud, Monique; Bausells, Joan; Errachid, Abdelhamid

    2015-01-01

    The authors would like to thank to Carole FARRE (Institute of Analytical Sciences, Univ. Lyon I) for the optical microscopy guidance; International audience; We present a new low-cost technology to fabricate poly(pyrrole) microwires (PPy-mu Ws)by micro contact printing (mu CP) and controlled chemical polymerization (mu CP-CCP) using three different techniques ("grafting printing", "addressed printing", and "direct printing". These developed techniques provide a platform to regulate PPy wire s...

  4. Determination of solvation and binding site profile within electropolymerised poly(pyrrole-N-propionic acid)

    DEFF Research Database (Denmark)

    Glidle, A.; Swann, M.J.; Gadegaard, Nikolaj

    2000-01-01

    Specular neutron reflectivity measurements were performed on electropolymerised films of poly(pyrrole-N-propionic acid) to determine the degree to which the solvents are capable of supporting biological macromolecules can penetrate the polymer film. The permeation profile of Ni2+ ions which chela...... to the polymer's carboxylic acid moieties for subsequent modified protein binding was also determined. (C) 2000 Elsevier Science B.V. All rights reserved....

  5. TTF derivative of 2,5-aromatic disubstituted pyrrole, synthesis and electronic study

    Science.gov (United States)

    Fomina, Lioudmila; León, Chistopher; Bizarro, Monserrat; Baeza, Alejandro; Gómez-Vidales, Virginia; Sansores, L. Enrique; Salcedo, Roberto

    2016-03-01

    TTF derivative of substituted pyrrole was obtained by means electrochemical synthesis, the resultant colored mix was characterized by Mass spectrometry, NMR and EPR studies, its intrinsic electronic behavior was measured by a four point probe method, besides theoretical calculations were carried out on the possible structures of the resultant molecular adduct. All the results show that there is a net transfer of an electron between both organic moieties in solution giving place to a semiconductor species.

  6. Selective Colorimetric Fluoride Sensor: A Heteroditopic Re-ceptor Combining Pyrrolic Amide with Urea

    Institute of Scientific and Technical Information of China (English)

    YIN Zhenming; LIU Shangyuan

    2009-01-01

    A heteroditopic anion receptor, beating one pyrrolic amide site and a urea site, has been synthesized. UV-Vis spectrum studies in CH3CN solution revealed that the receptor had higher anion binding ability than the homoditopic one. A naked-eye detectable color change, from colorless to yellow, of the receptor solution took place when fluoride was added, which indicates that the receptor has potential application to selective colorimetric fluo-ride sensing.

  7. tert-Butyl 2-borono-1H-pyrrole-1-carboxylate

    Directory of Open Access Journals (Sweden)

    Zheng Zhong

    2009-04-01

    Full Text Available In the crystal structure of the title compound, C9H14BNO4, the boronic acid group and carbamate groups are nearly co-planar with the pyrrole ring, making dihedral angles of 0.1 (2 and 2.2 (2°, respectively. Intramolecular and intermolecular O—H...O hydrogen bonds help to stabilize the structure, the latter interaction leading to inversion dimers..

  8. Electrochemical impedance of poly(9-tosyl-9H-carbazole-co-pyrrole) electrocoated carbon fiber

    Energy Technology Data Exchange (ETDEWEB)

    Ates, Murat; Uludag, Nesimi [Department of Chemistry, Faculty of Arts and Sciences, Namik Kemal University, Degirmenalti Campus, 59030, Tekirdag (Turkey); Sarac, A. Sezai, E-mail: sarac@itu.edu.tr [Department of Chemistry, Polymer Science and Technology, Istanbul Technical University, Maslak, 34469, Istanbul (Turkey)

    2011-05-16

    Research highlights: {yields} Impedance study of poly(9-tosyl-9H-carbazole-co-pyrrole) electrocoated carbon fiber. {yields} Copolymer of 9-tosyl-9H-carbazole and pyrrole were electrocoated on carbon fiber. {yields} Impedance spectroscopy and circuit models of poly(9-tosyl-9H-carbazole-co-pyrrole). - Abstract: In this paper, copolymer of 9-tosyl-9H-carbazole (TCz) and pyrrole (Py) comonomers were electrochemically deposited onto carbon fiber micro electrode (CFME) as an active electrode material. An electrochemical impedance study on the prepared electrodes is reported. Poly(TCz-co-Py)/CFME is characterized by cyclic voltammetry (CV), Fourier transform infrared reflectance-attenuated total reflection spectroscopy (FTIR-ATR), scanning electron microscopy-energy dispersive X-ray analysis (SEM-EDX), and electrochemical impedance spectroscopy (EIS). Capacitive behaviors of modified CFMEs were defined via Nyquist, Bode-magnitude and Bode-phase plots. An examination is made of which equivalent circuits of R(C(R(Q(RW)))) and R(C(R(Q(RW))))(CR) used for modeling the system. The effect of monomer ratio (mole fraction, X{sub TCz} = n{sub TCz}/n{sub TCz} + n{sub Py}) on the formation of copolymer is reported in 0.1 M sodium perchlorate (NaClO{sub 4})/acetonitrile (ACN) solution. The inclusion of TCz in the copolymer structure was also confirmed by FTIR-ATR, SEM, and CV measurements. The highest low frequency capacitance (C{sub LF} = 22.7 for R(C(R(Q(RW)))) and C{sub LF} = 22.6 mF cm{sup -2} for R(C(R(Q(RW))))(CR)) were obtained for X{sub TCz} = 0.91.

  9. Preparation and characterization of new poly-pyrrole having side chain liquid crystalline moieties

    Energy Technology Data Exchange (ETDEWEB)

    Hosseini, S. Hossein, E-mail: hosseini_sh44@yahoo.com [Department of Chemistry, Faculty of Science and Engineering, Imam Hossein University, Babaee Express Way, Tehran (Iran, Islamic Republic of); Mohammadi, M. [Department of Chemistry, Faculty of Science and Engineering, Imam Hossein University, Babaee Express Way, Tehran (Iran, Islamic Republic of)

    2009-06-01

    We have synthesized a novel liquid-crystalline (LC)-conducting polymer by introducing LC group into pyrrole monomer and polymerizing it with FeCl{sub 3}. The N-substituted pyrrole with LC group (Py-RedII) was prepared by direct reaction of potassium pyrrole salt with 2-[N-ethyl-N-[4-[(4-nitrophenyl)azo]-phenyl]amino]ethyl-3-chloropropionate (RedII). The polymerization of this monomer was successful, giving a conjugated polymer system with liquid crystalline moieties in moderate yield. The polymer obtained was soluble in organic solvents and had a thermotropic liquid crystallinity with mosaic texture characterized by polarizing optical microscopy. Phase transitions, thermal analysis and rheological studies were also evaluated by means of differential scanning calorimetry (DSC), thermogravimetry analysis (TGA) and scanning electron microscopy (SEM), respectively. Spectral properties of poly (2-[N-ethyl-N-[4-[(nitrophenyl)azo]phenyl]amino]ethyl-N-pyrrolyl propionate) (PPy-RedII) were characterized by UV, IR, {sup 1}H NMR, and {sup 13}C NMR spectroscopies. The photoluminescence spectrum of the film showed that maximum photoluminescence peak emission is located at 437 nm, corresponding to the photon energy of 2.5 eV. Electrical conductivity of PPy-RedII was studied by the four-probe method and produced a conductivity of 7.5 x 10{sup -4} S cm{sup -1}.

  10. Morphology and electrical properties of electrochemically synthesized pyrrole–formyl pyrrole copolymer

    Energy Technology Data Exchange (ETDEWEB)

    Gholami, Mehrdad, E-mail: mehrdad897@um.edu.my [Department of Chemistry, University of Malaya, Kuala Lumpur 50603 (Malaysia); Department of Chemistry, Marvdasht Branch, Islamic Azad University, P.O. Box 465, Marvdasht (Iran, Islamic Republic of); Nia, Pooria Moozarm, E-mail: pooriamn@yahoo.com [Department of Chemistry, University of Malaya, Kuala Lumpur 50603 (Malaysia); Alias, Yatimah, E-mail: yatimah70@um.edu.my [Department of Chemistry, University of Malaya, Kuala Lumpur 50603 (Malaysia)

    2015-12-01

    Graphical abstract: - Highlights: • The (Py–co-FPy) copolymer was synthesized electrochemically. • This copolymer has 1.6 times higher surface coverage compared to polypyrrole. • This copolymer showed 2.5 times lower resistance compared to polypyrrole. • The conjugated structure between Py and FPy causes enhancement of conductivity. • This conducting copolymer has a strong potential to be used in various applications. - Abstract: A direct electrochemical copolymerization of pyrrole–formyl pyrrole (Py–co-FPy) was carried out by oxidative copolymerization of formyl pyrrole and pyrrole in LiClO{sub 4} aqueous solution through galvanostatic method. The (Py–co-FPy) copolymer was characterized using Fourier-transform infrared spectroscopy (FT-IR), field emission scanning electron microscope (FESEM), energy-filtering transmission electron microscope (EFTEM), thermal gravimetric analysis (TGA), X-ray photoelectron spectroscopy (XPS), cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS). The FESEM images showed that the synthesized copolymer had a hollow whelk-like helixes structure, which justifies the enhancement of charge transportation through the copolymer film. Cyclic voltammetry studies revealed that the electrocatalytic activity of synthesized copolymer has improved and the surface coverage in copolymer enhanced 1.6 times compared to polypyrrole alone. Besides, (Py–co-FPy) copolymer showed 2.5 times lower electrochemical charge transfer resistance (R{sub ct}) value in impedance spectroscopy. Therefore, this copolymer has a strong potential to be used in several applications such as sensor applications.

  11. Electrochemical synthesis of poly(pyrrole-co-o-anisidine)/chitosan composite films

    Science.gov (United States)

    Yalçınkaya, Süleyman; Çakmak, Didem

    2017-05-01

    In this study, poly(pyrrole-co-o-anisidine)/chitosan composite films were electrochemically synthesized in various monomers feed ratio (pyrrole: o-anisidine; 9:1, 7:3, 1:1, 3:7 and 1:9) of pyrrole and o-anisidine on the platinum electrode. Electrochemical synthesis of the composite films was carried out via cyclic voltammetry technique. They were characterized by FT-IR, cyclic voltammetry, SEM micrographs, digital images, TGA and DSC techniques. The SEM results indicated that the particle size of the composite decreased with increasing o-anisidine ratio and the films became more likely to be smooth morphology. The TGA results proved that the film of the composite with 1:1 ratio showed highest final degradation temperature and lowest weight loss (83%) compared to copolymer and 9:1 1:9 composite films. The 1:1 composite film had higher thermal stability than copolymer and the other composite films (9:1 1:9). Meanwhile, electrochemical studies exhibited that the 1/9 composite film had good electrochemical stability as well.

  12. Absolute intensities of NH-stretching transitions in dimethylamine and pyrrole.

    Science.gov (United States)

    Miller, Benjamin J; Du, Lin; Steel, Thomas J; Paul, Allanah J; Södergren, A Helena; Lane, Joseph R; Henry, Bryan R; Kjaergaard, Henrik G

    2012-01-12

    Vibrational spectra of vapor-phase dimethylamine (DMA) and pyrrole have been recorded in the 1000 to 13000 cm(-1) region using long path conventional spectroscopy techniques. We have focused on the absolute intensities of the NH-stretching fundamental and overtone transitions; Δν(NH) = 1-4 regions for DMA and the Δν(NH) = 1-3 regions for pyrrole. In the Δν(NH) = 1-3 regions for DMA, evidence of tunneling splitting associated with the NH-wagging mode is observed. For DMA, the fundamental NH-stretching transition intensity is weaker than the first NH-stretching overtone. Also, the fundamental NH-stretching transition in DMA is much weaker than the fundamental transition in pyrrole. We have used an anharmonic oscillator local mode model with ab initio calculated local mode parameters and dipole moment functions at the CCSD(T)/aug-cc-pVTZ level to calculate the NH-stretching intensities and explain this intensity anomaly in DMA.

  13. Novel pyrrole derivatives bearing sulfonamide groups: Synthesis in vitro cytotoxicity evaluation, molecular docking and DFT study

    Science.gov (United States)

    Bavadi, Masoumeh; Niknam, Khodabakhsh; Shahraki, Omolbanin

    2017-10-01

    The synthesis of new derivatives of pyrrole substituted sulfonamide groups is described. The in vitro anticancer activity of these pyrroles was evaluated against MCF7, MOLT-4 and HL-60 cells using MTT assay. The target compounds showed inhibitory activity against tested cell lines. Among the compounds, compound 1a exhibited good cytotoxic activity. The potential of this analog to induce apoptosis was confirmed in a nuclear morphological assay by Hoechst 33258 staining in the PC-12 cells. Finally, molecular docking was performed to determine the probable binding mode of the designed pyrrole derivatives into the active site of FGFR1 protein. DFT calculations were carried out at the B3LYP levels of theory with 6-31+G (d,p) basis set for compound 1a. The point group (C1) of it was obtained based on the optimized structures; the calculation of the FT-IR vibrational frequencies, 1H NMR and 13C NMR chemical shifts of the compound were carried out and compared with those obtained experimentally.

  14. Evaluation on the inhibition of pyrrol-2-yl ethanone derivatives to lactate dehydrogenase and anticancer activities

    Science.gov (United States)

    Lu, Na-Na; Weng, Zhao-Yue; Chen, Qiu-Yun; Boison, Daniel; Xiao, Xin-Xin; Gao, Jing

    2016-08-01

    Lactate dehydrogenase A (LDH-A) is a potentially important metabolic target for the inhibition of the highly activated glycolysis pathway in cancer cells. In order to develop bifunctional compounds as inhibitor of LDH-A and anticancer agents, two pyrrol-2-yl methanone (or ethanone) derivatives (PM1 and PM2) were synthesized and evaluated as inhibitors of LDH-A based on the enzyme assay and cell assay by spectroscopy analysis. Fluorescence and CD spectra results demonstrated that both the change of second structure of LDH-A and the affinity interaction for compounds to LDH-A gave great effect on the activity of LDH-A. In particular, low concentration of compounds (1 μμ-25 μμ) could change the level of pyruvate in cancer cells. Moreover, the in vitro assay results demonstrated that pyrrol-2-yl ethanone derivatives can inhibit the proliferation of cancer cells. Therefore, pyrrol-2-yl ethanone derivatives (PM2) can be both LDH-A inhibitor and anticancer agents.

  15. Organophosphorus and carbamate insecticide poisoning.

    Science.gov (United States)

    Vale, Allister; Lotti, Marcello

    2015-01-01

    Both organophosphorus (OP) and carbamate insecticides inhibit acetylcholinesterase (AChE), which results in accumulation of acetylcholine (ACh) at autonomic and some central synapses and at autonomic postganglionic and neuromuscular junctions. As a consequence, ACh binds to, and stimulates, muscarinic and nicotinic receptors, thereby producing characteristic features. With OP insecticides (but not carbamates), "aging" may also occur by partial dealkylation of the serine group at the active site of AChE; recovery of AChE activity requires synthesis of new enzyme in the liver. Relapse after apparent resolution of cholinergic symptoms has been reported with OP insecticides and is termed the intermediate syndrome. This involves the onset of muscle paralysis affecting particularly upper-limb muscles, neck flexors, and cranial nerves some 24-96 hours after OP exposure and is often associated with the development of respiratory failure. OP-induced delayed neuropathy results from phosphorylation and subsequent aging of at least 70% of neuropathy target esterase. Cramping muscle pain in the lower limbs, distal numbness, and paresthesiae are followed by progressive weakness, depression of deep tendon reflexes in the lower limbs and, in severe cases, in the upper limbs. The therapeutic combination of oxime, atropine, and diazepam is well established experimentally in the treatment of OP pesticide poisoning. However, there has been controversy as to whether oximes improve morbidity and mortality in human poisoning. The explanation may be that the solvents in many formulations are primarily responsible for the high morbidity and mortality; oximes would not be expected to reduce toxicity in these circumstances. even if given in appropriate dose. © 2015 Elsevier B.V. All rights reserved.

  16. Pharmacophore model for neonicotinoid insecticides

    Institute of Scientific and Technical Information of China (English)

    Jian Li; Xiu Lian Ju; Feng Chao Jiang

    2008-01-01

    An effective prediction pharmacophore model (RMS = 0.634, Correl = 0.893, Weight = 1.463, Config = 11.940) was success-fully obtained by 3D-QSAR based on a series of nAChR (nicotinic acetylcholine receptors) agonists, which consists of a hydrogen-bonding acceptor, a hydrogen-bond donor, a hydrophobic aliphatic and a hydrophobic aromatic centre. This pharmacophore modelmay provide theoretical basis for designation and development of higher active insecticides.2008 Xiu Lian Ju. Published by Elsevier B.V. on behalf of Chinese Chemical Society. All rights reserved.

  17. Insecticide Recommendations for Arkansas. MP 144.

    Science.gov (United States)

    Jones, Bill F.; Barnes, Gordon

    This publication gives, in chart form, insecticides for use on animals, field crops, fruits, flowers, trees and shrubs, household pests, recreation areas, lawn and turf grass, pecans, stored grain, and vegetables. Included in the charts are the insecticides recommended for each insect, formulation to be used, amount, time to apply, and other…

  18. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    2007-01-24

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.  Created: 1/24/2007 by Emerging Infectious Diseases.   Date Released: 3/13/2007.

  19. Insecticide Recommendations for Arkansas. MP 144.

    Science.gov (United States)

    Jones, Bill F.; Barnes, Gordon

    This publication gives, in chart form, insecticides for use on animals, field crops, fruits, flowers, trees and shrubs, household pests, recreation areas, lawn and turf grass, pecans, stored grain, and vegetables. Included in the charts are the insecticides recommended for each insect, formulation to be used, amount, time to apply, and other…

  20. Elastic electron collisions with the aza-derivatives of furan, pyrrole and thiophene

    Energy Technology Data Exchange (ETDEWEB)

    Kossoski, Fabris; Freitas, Thiago Correa de; Bettega, Marcio Henrique Franco [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil)

    2011-07-01

    Full text. Experimental studies of electron collisions with furan, pyrrole, thiophene and their corresponding aza-derivatives show the occurrence of several resonant states at low impact energies (0-10 eV), for all the structures. These resonances are associated with the occupation of an unoccupied molecular orbital by the incident electron, and the consequent formation of a temporary anionic state, or resonance. Theoretical studies of elastic electron collisions with furan and pyrrole also show the presence of shape resonances in good agreement with the experimental positions of the resonance peaks. In this work we present integral cross sections for elastic scattering of low-energy electrons by the aza-derivatives of furan, pyrrole and thiophene, namely, oxazole, isoxazole, imidazole, pyrazole, thiazole and isothiazole. Our studied structures differ from furan, pyrrole and thiophene by the substitution of a C-H by an N atom, in different positions of the ring. The ground state geometry was optimized using second order perturbation theory with the TZV++(2d,1p) basis set. The molecular ground state was described in the Hartree-Fock approximation, and the virtual molecular orbitals obtained were used to represent the scattering orbitals. In order to compute the elastic cross sections we employed the Schwinger multichannel method implemented with pseudopotentials of Bachelet, Hamann and Schlueter, in the static-exchange approximation. The six molecules present shape resonances at low energies, in both A' and A{sup '}' symmetries. Electronic structure calculations were performed in order to characterize the resonant orbitals. Each of the three pairs of isomers presented very similar integral cross sections at high energies. At low energies, on the other hand, the cross sections become more distinct, specially due to the different positions of the resonances. We also discuss the effects on the cross sections caused by aza-substitution, when compared to

  1. Toxicities of chlorfenapyr and thiamethoxam to termites and synergistic effect of their mixture%虫螨腈、噻虫嗪对白蚁的毒力测定及复配剂增效作用研究

    Institute of Scientific and Technical Information of China (English)

    林雁; 何利文; 郭红

    2013-01-01

    Objective To determine the toxicities of chlorfenapyr and thiamethoxam to termites (Coptotermes formosanus) and the synergistic effect of their mixtures at different ratios.Methods In the laboratory,termites were kept in contact with filter papers treated with different concentrations of termiticides (1 ml),and the mortalities of treated termites were recorded periodically.Results The mortality of termites treated with chlorfenapyr was relatively high during hours 48-72 and 72-96,while that of termites treated with thiamethoxam was relatively high during hours 24-48,48-72,and 72-96.The termite's mortality from either termiticide was low (< 10%) within 24 h.After 96 h of treatment for C.formosanus,the LC50 of chlorfenapyr was 1.854 mg/L,and that of thiamethoxam was 386.021 mg/L.When mixed at an effective component ratio of 1 ∶ (40-80),chlorfenapyr and thiamethoxam achieved a maximum synergistic effect,with co-toxicity coefficients of 1411.65 and 1767.79,respectively.Conclusion Chlorfenapyr and thiamethoxam act slowly to kill termites.The toxicity of chlorfenapyr to termites is 208 times that of thiamethoxam.Chlorfenapyr mixed with thiamethoxam at different ratios can achieve a marked synergistic effect.%目的 研究虫螨腈、噻虫嗪及2种药物不同比例的复配剂对白蚁毒力和增效情况.方法 通过室内药膜法,将1ml不同浓度的药液处理滤纸后投入白蚁,持续接触,定期记录白蚁的死亡情况.结果 虫螨腈引起白蚁死亡率较高的时间发生在48~72 h和72~96 h时间段,噻虫嗪引起白蚁死亡的时间主要在24~48 h、48~72 h和72~96 h时间段,在24 h内,2种药物引起白蚁死亡率都不高(<10%).96 h后,白蚁的LC50值虫螨腈为1.854 mg/L,噻虫嗪为386.021 mg/L.虫螨腈和噻虫嗪在复配比例1∶40和1∶80(有效成分比)时,对白蚁的增效作用最显著,共毒系数分别为1411.65和1767.79.结论 虫螨腈和噻虫嗪均为慢性杀白蚁药物,虫螨腈对白蚁的

  2. An Indigenously Developed Insecticidal Aerosol

    Directory of Open Access Journals (Sweden)

    R. N. Varma

    1969-10-01

    Full Text Available A total of 6 "Test" insecticidal aerosols (TA-I to VI indigenously produced were tested during the years 1966-67 as suitable replacements for imported aerosols.TA-I produced deep yellow staining and a yellowish spray mist. Its capacity was only 120 ml fluid. TA-III types II and III containing modified aerosol formulation with "Esso solvent 3245" and mineral turpentine oil (Burmah Shelland Freon 12 11 (all indigenouswere comparable to he "SRA" in insecticidial efficacy. The container was also manufactured in the country and it compared well with the "SRA" in construction, resistance against rough usage and mechanical function. They were both finally approved for introduction in the services as replacement for imported aerosols. TA-IV performed well in inscticidial assessment, but the aerosols formulation. TA-V and VI were similar to TA-III types II and III respectively.

  3. Role of the ribose-specific marker furfuryl-amine in the formation of aroma active 1-(furan-2-ylmethyl)-1H-pyrrole (or furfuryl-pyrrole) derivatives.

    Science.gov (United States)

    Nikolov, Plamen Y; Yaylayan, Varoujan A

    2012-10-10

    Furfuryl-pyrroles possess a diverse range of organoleptic properties described as roasted, chocolaty, green, horseradish-like, and mushroom-like and are detected in various foods such as coffee, chocolate, popcorn, and roasted chicken. Although their origin in food was attributed to furfuryl-amine, the latter has not been detected so far in Maillard model systems or in foods. In this study, furfuryl-amine was shown to be formed specifically from ribose through nitrogen atom transfer from the α-amino group of any amino acid. Such a transfer can be achieved through decarboxylation of the Schiff base adduct and isomerization followed by hydrolysis. Through the use of (15)Nα-lysine it was revealed that only the (15)Nα nitrogen atom was incorporated into its structure, indicating a specific role for the carboxylate moiety in the mechanism of its formation. Furthermore, isotope labeling studies have indicated that furfuryl-pyrrole derivatives can be formed by the interaction of 2 mol of furfuryl-amine with 3-deoxyribosone followed by dehydration and cyclization to form 1-(furan-2-yl)-N-{[1-(furan-2-ylmethyl)-1H-pyrrol-2-yl]methylidene}methanamine. After hydrolysis, this intermediate can generate furfuryl-formyl-pyrrole, furfuryl-pyrrole carboxylic acid, and furfuryl-pyrrole. In this study, the furfuryl-amine derivatives were also detected in different coffee beans after pyrolysis and analysis by GC-MS. The potential of these compounds to form in aqueous model systems at a temperature of 120 °C was also demonstrated.

  4. Pyrrole Derivatives and Diterpene Alkaloids from the South China Sea Sponge Agelas nakamurai.

    Science.gov (United States)

    Chu, Mei-Jun; Tang, Xu-Li; Qin, Guo-Fei; Sun, Yan-Ting; Li, Lei; de Voogd, Nicole J; Li, Ping-Lin; Li, Guo-Qiang

    2017-07-01

    Two pairs of new non-brominated racematic pyrrole derivatives, (±)-nakamurine D (1) and (±)-nakamurine E (2), two new diterpene alkaloids, isoagelasine C (16) and isoagelasidine B (21), together with 13 known pyrrole derivatives ((±)-3 - 15), five known diterpene alkaloids (17 - 20, 22) were isolated from the South China Sea sponge Agelas nakamurai. The racemic mixtures, compounds 1 - 4, were resolved into four pairs of enantiomers, (+)-1 and (-)-1, (+)-2 and (-)-2, (+)-3 and (-)-3, and (+)-4 and (-)-4, by chiral HPLC. The structures and absolute configurations were elucidated on the basis of comprehensive spectroscopic analyses, quantum chemical calculations, quantitative measurements of molar rotations, application of van't Hoff's principle of optical superposition, and comparison with the literature data. The NMR and MS data of compound 3 are reported for the first time, as the structure was listed in SciFinder Scholar with no associated reference. These non-brominated pyrrole derivatives were found in this species for the first time. Compound 18 showed valuable cytotoxicities against HL-60, K562, and HCT-116 cell lines with IC50 values of 12.4, 16.0, and 19.8 μm, respectively. Compounds 16 - 19, 21, and 22 showed potent antifungal activities against Candida albicans with MIC values ranging from 0.59 to 4.69 μg/ml. Compounds 16 - 19 exhibited moderate antibacterial activities against Proteusbacillus vulgaris (MIC values ranging from 9.38 to 18.75 μg/ml). © 2017 Wiley-VHCA AG, Zurich, Switzerland.

  5. The Chemical and Physical Properties of Pyrrole-Based Conducting Polymers: The Characterization of As-Grown Films by X-Ray Photoemission Spectroscopy.

    Science.gov (United States)

    1983-04-07

    by identifying the existence of both, pyrrole rinp and perchlorate anions. It should be mentioned, however, that no significant density of states can...XPS indicates one tetrafluoroborate anion for 4 pyrrole rinp in PP+BF . More precisely, 0.26 boron atoms were found on an average over 4 samples

  6. Copper-catalyzed C(sp(3))-H functionalization of ketones with vinyl azides: synthesis of substituted-1H-pyrroles.

    Science.gov (United States)

    Donthiri, Ramachandra Reddy; Samanta, Supravat; Adimurthy, Subbarayappa

    2015-10-28

    Copper-catalyzed C(sp(3))-H functionalization of ketones with vinyl azides for the synthesis of substituted pyrroles has been developed. The method is a straightforward and efficient way to access a series of 2,3,5-trisubstituted-1H-pyrroles in modest to excellent yields with broad functional group tolerance under mild conditions.

  7. Sustainable Pathways to Pyrroles through Iron-Catalyzed N-Heterocyclization from Unsaturated Diols and Primary Amines.

    Science.gov (United States)

    Yan, Tao; Barta, Katalin

    2016-09-01

    Pyrroles are prominent scaffolds in pharmaceutically active compounds and play an important role in medicinal chemistry. Therefore, the development of new, atom-economic, and sustainable catalytic strategies to obtain these moieties is highly desired. Direct catalytic pathways that utilize readily available alcohol substrates have been recently established; however, these approaches rely on the use of noble metals such as ruthenium or iridium. Here, we report on the direct synthesis of pyrroles using a catalyst based on the earth-abundant and inexpensive iron. The method uses 2-butyne-1,4-diol or 2-butene-1,4-diol that can be directly coupled with anilines, benzyl amines, and aliphatic amines to obtain a variety of N-substituted pyrroles in moderate-to-excellent isolated yields.

  8. A Bis-Calix[4]pyrrole Enzyme Mimic that Constrains Two Oxoanions in Close Proximity

    DEFF Research Database (Denmark)

    He, Qing; Kelliher, Michael; Bähring, Steffen

    2017-01-01

    Herein we describe a large capsule-like bis-calix[4]pyrrole 1 , that is able to host concurrently two dihydrogen phosphate anions within a relatively large internal cavity. Evidence for the concurrent, dual recognition of the encapsulated anions came from 1H NMR and UV-vis spectroscopies and ITC...... by spectroscopic analyses. Finally, receptor 1 was found capable of accommodating two trianionic pyrophosphate anions in the cavity. The present experimental findings are supported by DFT calculations along with 1H NMR and UV-vis spectroscopies, ITC studies, and single crystal X-ray diffraction analyses....

  9. Indium(III)-catalyzed synthesis of N-substituted pyrroles under solvent-free conditions

    OpenAIRE

    Chen,Jiu-Xi; Liu,Miao-Chang; Yang,Xiao-Liang; Ding,Jin-Chang; Wu,Hua-Yue

    2008-01-01

    A variety of N-substituted pyrroles have been synthesized by reacting γ-diketones (R¹C(O)CH2CH2C(O)R²: R¹, R² = Me, Ph) with amines (RNH2: R=Alkyl, Aryl, TsNH) or diamines (1,6-diaminohexane and 1,2-diaminoethane) in the presence of indium tribromide, indium trichloride or indium trifluoromethanesulfonate at room temperature under solvent-free conditions. The experiment protocol features simple operations, and the products are isolated in high to excellent yields (81-98%).

  10. N-Benzyl-2,5-bis(2-thienyl)pyrrole.

    Science.gov (United States)

    Palenzuela Conde, Jesús; Elsegood, Mark R J; Ryder, Karl S

    2004-03-01

    The solid-state structure of the title compound, C19H15NS2, is unusual among substituted thiophene/pyrrole derivatives in that the molecular packing is dominated by pi-pi interactions between the benzyl substituents. This may be due to the large torsion angles observed between adjacent heterocycles. Torsion angles between adjacent rings in polypyrrole and polythiophene conducting polymers are related to conjugation length and the conductivity properties of the polymer materials. The title compound crystallizes in space group P21/c with two molecules in the asymmetric unit, both of which exhibit disorder in one of their thiophene rings.

  11. Copper-diamine-catalyzed N-arylation of pyrroles, pyrazoles, indazoles, imidazoles, and triazoles.

    Science.gov (United States)

    Antilla, Jon C; Baskin, Jeremy M; Barder, Timothy E; Buchwald, Stephen L

    2004-08-20

    This paper details the copper-catalyzed N-arylation of pi-excessive nitrogen heterocycles. The coupling of either aryl iodides or aryl bromides with common nitrogen heterocycles (pyrroles, pyrazoles, indazoles, imidazoles, and triazoles) was successfully performed in good yield with catalysts derived from diamine ligands and CuI. General conditions were found that tolerate functional groups such as aldehydes, ketones, alcohols, primary amines, and nitriles on the aryl halide or heterocycle. Hindered aryl halides or heterocycles were also found to be suitable substrates using the conditions reported herein. Copyright 2004 American Chemical Society

  12. Indium(III)-catalyzed synthesis of N-substituted pyrroles under solvent-free conditions

    OpenAIRE

    Chen,Jiu-Xi; Liu,Miao-Chang; Yang, Xiao-Liang; Ding,Jin-Chang; Wu,Hua-Yue

    2008-01-01

    A variety of N-substituted pyrroles have been synthesized by reacting γ-diketones (R¹C(O)CH2CH2C(O)R²: R¹, R² = Me, Ph) with amines (RNH2: R=Alkyl, Aryl, TsNH) or diamines (1,6-diaminohexane and 1,2-diaminoethane) in the presence of indium tribromide, indium trichloride or indium trifluoromethanesulfonate at room temperature under solvent-free conditions. The experiment protocol features simple operations, and the products are isolated in high to excellent yields (81-98%).

  13. Low frequency ac conduction and dielectric relaxation in poly(N-methyl pyrrole)

    Indian Academy of Sciences (India)

    Amarjeet K Narula; Ramadhar Singh; Subhas Chandra

    2000-06-01

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity. These loss peaks are associated with the hopping of the charge carriers. The frequency and temperature dependence of ac conductivity have been qualitatively explained by considering the contribution from two mechanisms; one giving a linear dependence of conductivity on frequency and other having distribution of relaxation times giving rise to broad dielectric loss peak.

  14. Access to pyrrolo-pyridines by gold-catalyzed hydroarylation of pyrroles tethered to terminal alkynes

    Directory of Open Access Journals (Sweden)

    Elena Borsini

    2011-10-01

    Full Text Available In a simple procedure, the intramolecular hydroarylation of N-propargyl-pyrrole-2-carboxamides was accomplished with the aid of gold(III catalysis. The reaction led to differently substituted pyrrolo[2,3-c]pyridine and pyrrolo[3,2-c]pyridine derivatives arising either from direct cyclization or from a formal rearrangement of the carboxamide group. Terminal alkynes are essential to achieve bicyclic pyrrolo-fused pyridinones by a 6-exo-dig process, while the presence of a phenyl group at the C–C triple bond promotes the 7-endo-dig cyclization giving pyrrolo-azepines.

  15. (AJST) INSECTICIDAL ACTIVITY OF EXTRACTS DERIVED FROM ...

    African Journals Online (AJOL)

    opiyo

    of the brine shrimp Artemia salina (Leach). Antifeedant ... The pool of plants possessing insecticidal substances is enormous ... The most economically important of the natural plant ... processing and application of the product inexpensive. In.

  16. Transformation of the insecticide teflubenzuron by microorganisms

    NARCIS (Netherlands)

    Finkelstein, Z.I.; Baskunov, B.P.; Rietjens, I.M.C.M.; Boersma, M.G.; Vervoort, J.; Golovleva, L.A.

    2001-01-01

    Transformation of teflubenzuron, the active component in the insecticide commercialized as Nomolt, by soil microorganisms was studied. It was shown that microorganisms, belonging to Bacillus, Alcaligenes, Pseudomonas and Acinetobacter genera are capable to perform the hydrolytic cleavage of the phen

  17. Preliminary assessment of insecticidal activity of Moroccan ...

    African Journals Online (AJOL)

    aghomotsegin

    2015-03-11

    Mar 11, 2015 ... capitata, and the most important pupation reduction was obtained for isolates 37 ... Key words: Moroccan actinobacteria, insecticidal activity, biological screening, ..... extracts against culex tritaeniorhynchus and culex gelidus.

  18. Fitness costs associated with insecticide resistance.

    Science.gov (United States)

    Kliot, Adi; Ghanim, Murad

    2012-11-01

    Insects are exposed to a variety of stress factors in their environment, and, in many cases for insect pests to agriculture, those factors include toxic chemical insecticides. Coping with the toxicity of insecticides can be costly and requires energy and resource allocation for adaptation and survival. Several behavioural, physiological and genetic mechanisms are used by insects to handle toxic insecticides, sometimes leading to resistance by constitutive overexpression of detoxification enzymes or inducing mutations in the target sites. Such actions are costly and may affect reproduction, impair dispersal ability and have several other effects on the insect's fitness. Fitness costs resulting from resistance to insecticides has been reported in many insects from different orders, and several examples are given in this mini-review.

  19. DESCRIPTIVE ANALYSIS OF HOUSEHOLD INSECTICIDE IN COMMUNITY

    Directory of Open Access Journals (Sweden)

    Aram Sih Joharina

    2014-06-01

    Full Text Available The most popular and effective vector control is the use of insecticides. Surveywas done in the houses and some supermarket to know many kind of insecticides usedby people. The formulation, active ingredients, and concentration were recorded andanalyzed. Based on the results of the survey, household insecticides formulated invarious formulations such as liquid, mosquito coils, aerosol, mat and liquid vaporizer,chalk and paper burn. In addition to formulation, active ingredients and concentrationalso vary. Almost all household insecticide products on the market using the syntheticpyrethroid. Selection of household insecticides should be adapted to the type of insectpests because each type of active ingredients and formulations have advantages anddisadvantages. Efficacy of various active ingredients in various formulations has beenstudied and the results vary widely. Insecticide efficacy is influenced by the type ofactive ingredient, dosage, concentration, formulation, and the susceptibility of insectspecies, temperature, sunlight, wind, and application method.Key word: household insecticide, insecticides formulation, active ingredientsABSTRAKPengendalian serangga vektor penyakit yang paling efektif dan populer adalahpenggunaan insektisida. Survei dilakukan di masyarakat dan supermarket untuk mengetahuijcnis-jenis insektisida yang digunakan oleh masyarakat. Berdasarkan hasil survei, insektisidarumah tangga terkemas dalam berbagai formulasi antara lain liquid, mosquito coil, aerosol, mat& liquid vaporizer, kapur serangga dan kertas bakar. Disamping formulasi, bahan aktif dankonsentrasi yang digunakan juga bermacam-macam. Hampir semua produk insektisida rumahtangga di pasaran menggunakan bahan aktif golongan piretroid sintetik. Pemilihan insektisidarumah tangga hendaknya disesuaikan dengan jenis serangga sasaran karena tiap jenis bahan aktifdan formulasi memiliki kelcbihan dan kekurangan. Efikasi berbagai bahan aktif dalam berbagaiformulasi telah

  20. (E)-2,4,6-Trimethyl-N-[(1H-pyrrol-2-yl)methyl-idene]aniline.

    Science.gov (United States)

    Imhof, Wolfgang

    2013-01-01

    The title compound, C14H16N2, is a pyrrole-2-carbaldimine ligand that shows an E conformation at the imine double bond. The dihedral angle between the rings is 78.3 (1)°. In the crystal, pairs of mol-ecules form centrosymmetric dimers [graph-set descriptor is presumably R(2)2(10)] via N-H⋯N hydrogen bonds between the pyrrole N-H group and the imine N atom of a neighbouring mol-ecule.

  1. Synthesis and Cytotoxic Evaluation of Pyrrole Hetarylazoles Containing Benzimidazole/Pyrazolone/1,3,4-Oxadiazole Motifs.

    Science.gov (United States)

    Mochona, Bereket; Jackson, Timothy; McCauley, DeCoria; Mazzio, Elizabeth; Redda, Kinfe K

    2016-11-01

    Azomethine linked pyrrole bishetarylazoles containing benzimidazole/pyrazolone/1,3,4-oxadiazole were synthesized in satisfactory yields. Their structures were confirmed by IR, (1)H-NMR, (13)C-NMR and elemental analysis. Evaluation for the cytotoxic activities In vitro against a panel of breast cancer cell lines (MDA-AB-231, BT-474 and Ishikawa cells) revealed that the pyrrole-benzimidazole hybrids are more potent than the pyrazolone and 1,3,4-oxadiazole hybrids in all cell lines. Compound (9) displayed promising cytotoxicity against BT-474 cell line with IC50 values, 7.7 µM.

  2. Pyrrole Alkaloids with Potential Cancer Chemopreventive Activity Isolated from a Goji Berry-Contaminated Commercial Sample of African Mango

    OpenAIRE

    Li, Jie; Pan, Li; Naman, C. Benjamin; Deng, Ye; Chai, Heebyung; Keller, William J.; Kinghorn, A. Douglas

    2014-01-01

    Bioassay-guided fractionation of a commercial sample of African mango (Irvingia gabonensis) that was later shown to be contaminated with goji berry (Lycium sp.) led to the isolation of a new pyrrole alkaloid, methyl 2-[2-formyl-5-(hydroxymethyl)-1H-pyrrol-1-yl]propanoate, 1, along with seven known compounds, 2?8. The structures of the isolated compounds were established by analysis of their spectroscopic data. The new compound 1g showed hydroxyl radical-scavenging activity with an ED50 value ...

  3. Study on the teratogenicity of chlorfenapyr in rats%虫螨腈原药致畸毒性实验研究

    Institute of Scientific and Technical Information of China (English)

    殷霄; 陈晓燕; 刘莉莉; 曾丽海; 谢植伟; 黄建勋; 黄振烈

    2014-01-01

    Objective To study the teratogenicity and embryotoxicity of chlorfenapyr in rats by oral administration during the period of embryonic organ formation .Methods Totally 200 female and 200 male specific pathogen free healthy mature and nulliparous SD rats were selected .A male and a female rat in 1∶1 ratio were selected as the mating pairs for mating in one cage.The pregnant rats were randomly divided into 3 dose groups, a negative-and a positive-control group.On the gestation of day 6-15, rats in low-, median-and high-dose groups were given chlorfenapyr by gavage daily at the doses of 12.2, 61.2 and 306.2 mg/kg body weight (bw).N, N-methylena-bis (2-amino-1,3,4-thiadiazole) was used for the positive control and the vehicle (3% starch paste) was used for the negative control .Pregnant rats were euthanized and executed on day 20 of gestation.Indexes of the weight , length, visceral and skeletal changes of the fetuses were examined . Results After the administration of chlorfenapyr in the sensitive teratogenic period , the net weight gain of the rats in me-dian-and high-dose groups were lower than those of the negative control group [53.79 (39.81,60.65) vs 67.09 (47.27, 73.92) g, 42.34 (31.04, 53.46) vs 67.09 (47.27,73.92) g, P<0.05, P<0.01].The live birth rate in the high-dose group was lower than that in the negative control group (87.78% vs 92.75%, P<0.05).The stillbirth rate in the high-dose group was higher than that in the negative control group (4.18%vs 1.30%, P<0.05).Maternal toxicity, em-bryo toxicity and teratogenicity in fetal rats could be found in the positive group .Maternal toxicity and embryo toxicity occurred in high-dose group , however , teratogenicities in bones and internal organs could not be found in the fetal rats . Maternal toxicity , embryo toxicity and teratogenicity of fetal rats could not be found in low dose group .Conclusion At the dose of 306.2 mg/kg bw, maternal toxicity and embryotoxicity were observed , while teratogenicities of

  4. Bis(pyrrole-benzimidazole) conjugates as novel colorimetric sensor for anions

    Indian Academy of Sciences (India)

    SANJEEV PRAN MAHANTA; PRADEEPTA KUMAR PANDA

    2017-05-01

    Novel bis(pyrrole-benzimidazole) (PYBI) conjugates were investigated as colorimetric anion recognition motif by employing multiple donor sites. In this regard, PYBI derivatives where pyrrole unit is connected to the C2 position of benzimidazole via its α-position were synthesized and their anion recognitionbehavior were evaluated by UV-Vis, fluorescence and 1H NMR spectroscopy. PYBI selectively interacts with fluoride ion, whereas introduction of nitro group on the benzimidazole moiety enhances the binding affinity by at least one order, albeit at the expense of the selectivity. Bridging of two PYBIs led to interesting cooperative effect between the two subunits, which gets enhanced upon changing the spacer between the two from nonconjugatingtype (sp3-C) to conjugating one (quinoxaline). This also affects the way they interact with anions, with the latter moiety displaying very interesting stepwise double deprotonation of benzimidazole protons upon addition of fluoride ions with strong colorimetric as well as fluorometric response. Further, acidity of the H-bond donor sites was found to play pivotal role in the anion complexation mechanism and selectivity.

  5. Synthesis of Conductive PPy/SiO2 Aerogels Nanocomposites by In Situ Polymerization of Pyrrole

    Directory of Open Access Journals (Sweden)

    Daliana Muller

    2015-01-01

    Full Text Available Electrical conductive nanocomposite aerogels were synthesized through in situ oxidative polymerization of pyrrole (Py using ammonium persulfate (APS as an oxidizing agent in SiO2 gels. The effect of Py concentration on the electrical conductivity and physical and morphological properties of aerogels SiO2/PPy was evaluated. B.E.T. analysis indicated that the surface area of the composite SiO2/PPy decreases with increasing concentration of Py. CHN analysis showed an increase in the amount of PPy, from 13 wt.% to 23 wt.%, with increasing concentration of pyrrole synthesis. FTIR-ATR analysis of the composites revealed bands in the region of 1500–1400 cm−1, indicating the presence of the conductive polymer in the silica aerogel as well as the characteristic bands of Si-O-Si and Si-OH covalent bonds. TEM micrographs revealed the presence of particles of PPy with the increased size of the nanoparticles. The composites were successfully applied as passive components, in RC circuits, for low-pass frequency filters. The filters exhibited a cutoff frequency at approximately 435 Hz. The aerogels obtained in this work exhibited suitable electrical conductivity for use in various other applications in electronics.

  6. Assessment of conformational, spectral, antimicrobial activity, chemical reactivity and NLO application of Pyrrole-2,5-dicarboxaldehyde bis(oxaloyldihydrazone)

    Science.gov (United States)

    Rawat, Poonam; Singh, R. N.

    2015-04-01

    An orange colored pyrrole dihydrazone: Pyrrole-2,5-dicarboxaldehyde bis(oxaloyldihydrazone) (PDBO) has been synthesized by reaction of oxalic acid dihydrazide with 2,5 diformyl-1H-pyrrole and has been characterized by spectroscopic analysis (1H, 13C NMR, UV-visible, FT-IR and DART Mass). The properties of the compound has been evaluated using B3LYP functional and 6-31G(d,p)/6-311+G(d,p) basis set. The symmetric (3319, 3320 cm-1) and asymmetric (3389, 3382 cm-1) stretching wave number confirm free NH2 groups in PDBO. NBO analysis shows, inter/intra molecular interactions within the molecule. Topological parameters have been analyzed by QTAIM theory and provide the existence of intramolecular hydrogen bonding (N-H⋯O). The local reactivity descriptors analyses determine the reactive sites within molecule. The calculated first hyperpolarizability value (β0 = 23.83 × 10-30 esu) of pyrrole dihydrazone shows its suitability for non-linear optical (NLO) response. The preliminary bioassay suggested that the PDBO exhibits relatively good antibacterial and fungicidal activity against Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, Candida albicans, Aspergillus niger. The local reactivity descriptors - Fukui functions (fk+, fk-), local softnesses (sk+, sk-) and electrophilicity indices (ωk+, ωk-) analyses have been used to determine the reactive sites within molecule.

  7. Electrochemical Detection of Clenbuterol in Pig Liver at Pyrrole-DNA Modified Boron-doped Diamond Electrode

    Institute of Scientific and Technical Information of China (English)

    WU Jing; LI Xiao-li; WU Xu-mei; HUAN Shuang-yan; SHEN Guo-li; YU Ru-qin

    2005-01-01

    The direct detection of clenbuterol(CL) in pig liver without any extraction separation at a pyrrole-DNA modified boron-doped diamond(BDD) electrode is reported. The pyrrole-DNA modified BDD electrode has a strong electrocatalytic effect on the redox reaction of CL. One oxidization and two reduction peaks of CL appear at 340.2, 299.8 and 166.6 mV(versus SCE), respectively. The pyrrole polymer alone cannot electrocatalyze the above reaction at a BDD electrode; the electrocatalytic effect of a BDD electrode modified with DNA membrane is unsufficient for the analytical detection of CL; the replacement of boron-doped diamond by glass carbon makes the electrocatalytic reaction impossible; the redox process is pH dependent. The influences of various experimental parameters on the pyrrole-DNA modified BDD electrode were investigated. A sensitive cyclic voltammetric response for CL was obtained in a linear range from 3.4×10-6 to 5×10-4 mol/L with a detection limit of 8.5×10-7 mol/L. A mean recovery of 102.7% of CL in the pig liver sample solution and a reproducibility of 3.2% were obtained.

  8. Chemistry of sulfonylmethyl isocyanides. 45. A direct synthesis of 2-(trimethylstannyl)pyrroles from Michael acceptors and stannylated tosylmethyl isocyanide

    NARCIS (Netherlands)

    Dijkstra, HP; ten Have, Ronald; van Leusen, A.M.

    1998-01-01

    A series of 2-(trimethylstannyl)pyrroles 3, with substituents at the 3- and 4-positions, is synthesized efficiently by a base-induced reaction of stannylated TosMIC with Michael accepters. Stills cross-couplings with bromobenzene and double cross-couplings with 1,4-dibromobenzene have been achieved

  9. Sustainable Pathways to Pyrroles through Iron-Catalyzed N-Heterocyclization from Unsaturated Diols and Primary Amines

    NARCIS (Netherlands)

    Yan, Tao; Barta, Katalin

    2016-01-01

    Pyrroles are prominent scaffolds in pharmaceutically active compounds and play an important role in medicinal chemistry. Therefore, the development of new, atom-economic, and sustainable catalytic strategies to obtain these moieties is highly desired. Direct catalytic pathways that utilize readily a

  10. (E-3-(1-Methyl-1H-pyrrol-2-yl-1-phenylprop-2-en-1-one

    Directory of Open Access Journals (Sweden)

    Li Liu

    2011-04-01

    Full Text Available The crystal structure of the title compound, C14H13NO, exhibits an E configuration. The conjugated compound is slightly twisted with a dihedral angle of 29.3° between the benzene and pyrrole rings. Two intermolecular C—H...O interactions lead to a dimer. In the crystal, intermolecular C—H...O interactions generate an inversion dimer.

  11. Pseudocapacitive Electrodes Produced by Oxidant-Free Polymerization of Pyrrole between the Layers of 2D Titanium Carbide (MXene).

    Science.gov (United States)

    Boota, Muhammad; Anasori, Babak; Voigt, Cooper; Zhao, Meng-Qiang; Barsoum, Michel W; Gogotsi, Yury

    2016-02-17

    Heterocyclic pyrrole molecules are in situ aligned and polymerized in the -absence of an oxidant between layers of the 2D Ti3C2Tx (MXene), resulting in high volumetric and gravimetric capacitances with capacitance retention of 92% after 25,000 cycles at a 100 mV s(-1) scan rate.

  12. Assessment of conformational, spectral, antimicrobial activity, chemical reactivity and NLO application of Pyrrole-2,5-dicarboxaldehyde bis(oxaloyldihydrazone).

    Science.gov (United States)

    Rawat, Poonam; Singh, R N

    2015-04-05

    An orange colored pyrrole dihydrazone: Pyrrole-2,5-dicarboxaldehyde bis(oxaloyldihydrazone) (PDBO) has been synthesized by reaction of oxalic acid dihydrazide with 2,5 diformyl-1H-pyrrole and has been characterized by spectroscopic analysis (1H, 13C NMR, UV-visible, FT-IR and DART Mass). The properties of the compound has been evaluated using B3LYP functional and 6-31G(d,p)/6-311+G(d,p) basis set. The symmetric (3319, 3320 cm(-1)) and asymmetric (3389, 3382 cm(-1)) stretching wave number confirm free NH2 groups in PDBO. NBO analysis shows, inter/intra molecular interactions within the molecule. Topological parameters have been analyzed by QTAIM theory and provide the existence of intramolecular hydrogen bonding (N-H⋯O). The local reactivity descriptors analyses determine the reactive sites within molecule. The calculated first hyperpolarizability value (β0=23.83×10(-30) esu) of pyrrole dihydrazone shows its suitability for non-linear optical (NLO) response. The preliminary bioassay suggested that the PDBO exhibits relatively good antibacterial and fungicidal activity against Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Streptococcus pyogenes, Candida albicans, Aspergillus niger. The local reactivity descriptors--Fukui functions (fk+, fk-), local softnesses (sk+, sk-) and electrophilicity indices (ωk+, ωk-) analyses have been used to determine the reactive sites within molecule. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. Photodissociation dynamics of pyrrole: evidence for mode specific dynamics from conical intersections.

    Science.gov (United States)

    Wei, J; Riedel, J; Kuczmann, A; Renth, F; Temps, F

    2004-01-01

    The H and D atom elimination mechanisms in the photodissociation of jet cooled pyrrole and pyrrole-d1 have been studied by photofragment velocity map imaging. The molecules were excited to the 1 1A2 (pi sigma*) state at lambda = 243 nm and to the 1 1B2 (pi pi*) state at lambda = 217 nm. H/D atoms were detected by (2 + 1) resonance enhanced multiphoton ionization (REMPI) at lambda = 243 nm. The analysis of the images and the resulting translational energy distributions from the 1 1A2 state demonstrates the existence of two decay pathways, fast mode-specific cleavage of the NH bond in the excited state (channel A) and internal conversion (IC) to the electronic ground state (S0) followed by unimolecular decomposition of the vibrationally hot S0 molecules (channel B). The angular distributions of the H/D atoms from the direct dissociation in the excited state are strongly anisotropic, whereas the decay of the S0 molecules leads to spatially isotropic distributions. The results at lambda = 217 nm indicate that the 1 1B2 state undergoes an ultrafast radiationless transition to 1 1A2 followed by the abovementioned direct mode-specific NH bond fission on the 1 1A2 potential energy surface (channel A') or conversion to S0 and subsequent unimolecular decomposition (channel B'). The latter pathway may also be initiated by a direct relaxation from 1 1B2 to S0. The anisotropy parameter of beta approximately -1 for the direct NH bond fission at lambda = 217 nm is in accordance with the expectations for a perpendicular electronic excitation and a dissociation lifetime that is short compared to the rotational period of the molecules. The fast decay dynamics of both excited electronic states can be rationalized with reference to the theoretically predicted conical intersections between the pi pi*, pi sigma*, and S0 potential energy surfaces and the antibonding nature of the pi sigma* potential energy surface with respect to the NH bond [A. L. Sobolewski, W. Domcke. C. Dedonder

  14. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Matowo Pc

    al., 1999). The occurrence of insecticide resistant Culex mosquitoes has also been reported in Wete, ... Emerged pupae were sucked from the larval containers .... Key: aWHO criteria for assessing susceptibility to insecticides of mosquitoes; ...

  15. Evaluation of the Repellent and Insecticidal Activities of the Leaf ...

    African Journals Online (AJOL)

    ADOWIE PERE

    high repellent and insecticidal activities demonstrated by the root powder ... generally low as a result of serious insect pest attacks ..... to have clear insecticidal properties (DeGeyter, 2012) ... nematicidal ingredients from neem leaves, siam.

  16. Potency of Traditional Insecticide Materials against Stored Bean ...

    African Journals Online (AJOL)

    Potency of Traditional Insecticide Materials against Stored Bean Weevil, ... AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search · USING AJOL ... apply traditional insecticide materials in the protection of bean from insect pests.

  17. Electronic structure of pesticides: 1. Organochlorine insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Novak, Igor, E-mail: inovak@csu.edu.au [Charles Sturt University, POB 883, Orange, NSW 2800 (Australia); Kovac, Branka [Physical Chemistry Division, ' R. Boskovic' Institute, HR-10000 Zagreb (Croatia)

    2011-11-15

    Highlights: {yields} Electronic structure of several organochlorine insecticides has been determined by UV photoelectron spectroscopy and high-level ab initio calculations. {yields} The electronic structure obtained from spectra has been related to their biological activity. {yields} The molecular modes of binding to appropriate receptors are rationalized in view of the molecule's electronic structure and conformational flexibility. - Abstract: The electronic structures of six organochlorine insecticides: {gamma}-lindane (I), aldrin (II), dieldrin (III), DDD (IV), DDE (V) and DDT (VI) have been investigated by UV photoelectron spectroscopy (UPS), quantum chemical calculations and comparison with molecular modelling studies. Their electronic and molecular structures are discussed in order to rationalize their biological activity. In this work we relate the biological activity of these insecticides to their experimentally observed electronic and molecular structures.

  18. Cytochromes P450 and insecticide resistance.

    Science.gov (United States)

    Scott, J G

    1999-09-01

    The cytochrome P450-dependent monooxygenases (monooxygenases) are an extremely important metabolic system involved in the catabolism and anabolism of xenobiotics and endogenous compounds. Monooxygenase-mediated metabolism is a common mechanism by which insects become resistant to insecticides as evidenced by the numerous insect species and insecticides affected. This review begins by presenting background information about P450s, the role of monooxygenases in insects, and the different techniques that have been used to isolate individual insect P450s. Next, insecticide resistance is briefly described, and then historical information about monooxygenase-mediated insecticide resistance is reviewed. For any case of monooxygenase-mediated resistance, identification of the P450(s) involved, out of the dozens that are present in an insect, has proven very challenging. Therefore, the next section of the review focuses on the minimal criteria for establishing that a P450 is involved in resistance. This is followed by a comprehensive examination of the literature concerning the individual P450s that have been isolated from insecticide resistant strains. In each case, the history of the strain and the evidence for monooxygenase-mediated resistance are reviewed. The isolation and characterization of the P450(s) from the strain are then described, and the evidence of whether or not the isolated P450(s) is involved in resistance is summarized. The remainder of the review summarizes our current knowledge of the molecular basis of monooxygenase-mediated resistance and the implications for the future. The importance of these studies for development of effective insecticide resistance management strategies is discussed.

  19. Substituent effect in the photochromism of two isomeric asymmetric diarylethenes having pyrrole and thiophene units

    Science.gov (United States)

    Wang, Renjie; Zhang, Xiaoxia; Pu, Shouzhi; Liu, Gang; Dai, Yanfeng

    2017-02-01

    Two new asymmetric isomeric diarylethenes having pyrrole and thiophene units have been synthesized by one-pot reaction and characterized by single crystal X-ray diffraction analysis. The two prepared diarylethenes had disparate crystal structures, and they exhibited distinctly different photochromic behavior, both in solution and in the solid state. Their photochromism, fatigue resistance, and fluorescence were investigated systematically. The methyl group at the reactive carbon atom could significantly enhance the quantum yield of cyclization step and decrease the quantum yield of cycloreversion step, whereas a cyano group at the same position could notably suppress the photocyclization reaction and promote the photocycloreversion reaction. The results indicated that the substituent at the reactive carbon atom could readily modulate the optoelectronic and physical properties for these diarylethenes.

  20. Bis{2-[(2,4,6-trimethylphenyliminomethyl]pyrrol-1-ido}palladium(II

    Directory of Open Access Journals (Sweden)

    Wolfgang Imhof

    2013-02-01

    Full Text Available The title compound, [Pd(C14H15N22], is a square-planar palladium complex composed of two deprotonated pyrrole-2-carbaldimine ligands coordinating a central PdII atom. In the crystal, three crystallographically independent complex molecules are observed, one of which is located in a general position, whereas the PdII atoms of the other molecules are situated on crystallographic inversion centers. The aromatic substituents at the imine N atoms in the three molecules show dihedral angles of 87.6 (7/83.64 (7, 74.3 (7 and 88.3 (7° with respect to the corresponding PdN4 plane.

  1. A poly(pyrrole-Cobalt(IIdeuteroporphyrin electrode for the potentiometric determination of nitrite

    Directory of Open Access Journals (Sweden)

    Michael Wedel

    2003-07-01

    Full Text Available The electrochemical properties of a new Co(II deuteroporphyrin substituted by two electropolymerizable pyrrole groups has been investigated in organic solvent. This functionalization has allowed the preparation of the first example of a cobalt deuteroporphyrin film by oxidative electropolymerization. The resulting conducting polypyrrole film exhibits the regular electroactivity of cobalt deuteroporphyrin. Compared to conventional cobalt porphyrin electrochemistry, the replacement of porphyrin macrocycle by deuteroporphyrin ring results in markedly more negative potential values for the metalcentered oxidation and reduction processes. The influence of NO2- as axial ligand on the reductive behavior of the electropolymerized cobalt (II deuteroporphyrin is examined. The recognition properties of the film illustrated by the potentiometric shift of the Co(II/(I reduction were exploited for the determination of NO2- in the concentration range 2 10-6- 2.5 10-4 M.

  2. Outer-Sphere Mechanism in the Oxidation of Pyrrole-2- Carboxaldehyde by Hexacyanoferrate (III Complex.

    Directory of Open Access Journals (Sweden)

    Abd-Alhakeem H. Abu-Nawwas

    2014-01-01

    Full Text Available The kinetics and mechanism of base-catalyzed oxidation of pyrrole-2-carboxaldehyde with hexacyanoferrate (III is reported. The reaction showed first order with respect to aldahyde , alkali and hexaeyanoferrate(III. The kinetic data suggest that the oxidation involves the formation of an anion of the substrate undergoes oxidation with hexaeyanoferrate(III via outer sphere mechanism process. The free radical thus produced is further oxidized to form the final products. A suitable mechanism was proposed and rate law was derived as − d[Fe CN 6 ] 3− = 2k1k2 RC(OH2 [Fe CN 6 ] 3−[OH−] k−1 H2O

  3. ELECTRICALLY CONDUCTIVE COMPOSITE PREPARED BY ELECTROCHEMICAL POLYMERIZATION OF PYRROLE IN POLY- (p- PHENYLENE TEREPHTHALAMIDE ) MATRIX

    Institute of Scientific and Technical Information of China (English)

    BI Xiantong; PEI Qibing; HAN Baozhen; BAO Jingshen

    1991-01-01

    The preparation of PPy/PPTA conductive composite films by electrochemical method is presented.The first step is to cast a thin layer of poly (p-phenylene-terephthalamide)(PPTA)on a slice of Pt working electrode. The second step is to electrochemically polymerize pyrrole on the PPTA/Pt working electrode. Both of the electrical conductivity and the mechanical properties of the PPy/PPTA composite film are better than those of the pure PPy film, and the film has excellent flexibility at low temperature, even in liquid nitrogen.The SEM picture of the cross-section of PPy/PPTA composite film showed that the two components were well mixed.Cyclic voltammograms of PPy/PPTA film in aqueous solution showed that the conductive films could be reduced and reoxidized.

  4. -pyrrole substituted porphyrin-pyrene dyads using vinylene spacer: Synthesis, characterization and photophysical properties

    Indian Academy of Sciences (India)

    P Silviya Reeta; Ravi Kumar Kanaparthi; L Giribabu

    2013-03-01

    We have designed and synthesized donor-acceptor conjugates having donor pyrene at the pyrrole- position of either free-base porphyrin or Zn(II) porphyrin using vinylene spacer. Both the dyads have been completely characterized by elemental analysis,MALDI-MS, UV-Vis., and fluorescence (steady state and timeresolved) spectroscopies as well as cyclic voltammetry. The absorption maxima of both dyads are red-shifted by 8-12 nm. The ground state properties showed that there exist minimum - interaction between the aromatic subunits of these D-A systems. Quenched emission was observed in both the dyads when excited at 290 nm. The quenched emission explained in terms of intramolecular excitation energy transfer competes with the photo-induced electron transfer reaction in these D-A system.

  5. Colorimetric chemosensor for multi-signaling detection of metal ions using pyrrole based Schiff bases.

    Science.gov (United States)

    Udhayakumari, Duraisamy; Velmathi, Sivan

    2014-03-25

    Pyrrole based Schiff bases act as a highly sensitive probe for metal ions in aqueous medium. Both receptors R1 and R2 are sensitive towards Fe(3+), Cu(2+), Hg(2+) and Cr(3+) among the other metal ions. The sensing ability of the receptors are investigated via colorimetric, optical and emission spectroscopic studies. The binding stoichiometries of R1 and R2 with metal ions have been determined as 2:1 by using Job's plot. The colorimetric receptors exhibited high sensitivity with a low detection limit of μM levels. In the presence of metal ions both receptors shows fluorescence quenching. This might be due to the photo induced electron transfer mechanism. The quenching constant was further determined using Stern-Volmer plot.

  6. State-specific tunneling lifetimes from classical trajectories: H-atom dissociation in electronically excited pyrrole

    Science.gov (United States)

    Xie, Weiwei; Domcke, Wolfgang; Farantos, Stavros C.; Grebenshchikov, Sergy Yu.

    2016-03-01

    A trajectory method of calculating tunneling probabilities from phase integrals along straight line tunneling paths, originally suggested by Makri and Miller [J. Chem. Phys. 91, 4026 (1989)] and recently implemented by Truhlar and co-workers [Chem. Sci. 5, 2091 (2014)], is tested for one- and two-dimensional ab initio based potentials describing hydrogen dissociation in the 1B1 excited electronic state of pyrrole. The primary observables are the tunneling rates in a progression of bending vibrational states lying below the dissociation barrier and their isotope dependences. Several initial ensembles of classical trajectories have been considered, corresponding to the quasiclassical and the quantum mechanical samplings of the initial conditions. It is found that the sampling based on the fixed energy Wigner density gives the best agreement with the quantum mechanical dissociation rates.

  7. A novel quinoxaline bearing electroactive monomer: Pyrrole as the donor moiety

    Energy Technology Data Exchange (ETDEWEB)

    Taskin, Asli Tuba; Balan, Abidin; Epik, Bugra; Yildiz, Ersin [Middle East Technical University, Department of Chemistry, 06531, Ankara (Turkey); Udum, Yasemin Arslan [Gazi University, Institute of Science and Technology, Department of Advanced Technologies, 06570, Ankara (Turkey); Toppare, Levent [Middle East Technical University, Department of Chemistry, 06531, Ankara (Turkey)], E-mail: toppare@metu.edu.tr

    2009-09-30

    A novel electroactive monomer 5,8-di(1H-pyrrol-2-yl)-2,3-di(thiophen-2-yl)quinoxaline (PTQ) was successfully synthesized and its electrochromic properties were reported. Nuclear magnetic resonance ({sup 1}H NMR-{sup 13}C NMR) and mass spectroscopy were used to characterize the monomer. The monomer was electrochemically polymerized in the presence of tetrabutylammonium perchlorate (TBAP) as supporting electrolyte in dichloromethane. Monomer reveals relatively low oxidation potential at +0.70 V. Spectroelectrochemical behaviors and switching ability of homopolymer were investigated by UV-vis spectroscopy and cyclic voltammetry. Two {pi}-{pi}* transitions were observed at 400 and 815 nm with a low band gap, 1.0 eV. Polymer possesses 66% optical contrast in the Near IR region, which may be promising in NIR electrochromic device applications.

  8. Caveats in the interpretation of time-resolved photoionization measurements: A photoelectron imaging study of pyrrole

    Science.gov (United States)

    Crane, Stuart W.; Zawadzki, Magdalena M.; Thompson, James O. F.; Kotsina, Nikoleta; Ghafur, Omair; Townsend, Dave

    2016-12-01

    We report time-resolved photoelectron imaging studies of gas-phase pyrrole over the 267-240 nm excitation region, recorded in conjunction with a 300 nm probe. Of specific interest is the lowest-lying (3 s /π σ* ) state, which exhibits very weak oscillator strength but is thought to be excited directly at wavelengths ≤254 nm. We conclude, however, that the only significant contribution to our photoelectron data at all wavelengths investigated is from non-resonant ionization. Our findings do not rule out (3 s /π σ* ) state excitation (as appears to be confirmed by supporting time-resolved ion-yield measurements) but do potentially highlight important caveats regarding the use and interpretation of photoreactant ionization measurements to interrogate dynamical processes in systems exhibiting significant topological differences between the potential energy surfaces of the neutral and cation states.

  9. Theoretical Study on Measure of Hydrogen Bonding Strength: R-C≡N…pyrrole Complexes

    Institute of Scientific and Technical Information of China (English)

    史福强; 安静仪; 俞稼镛

    2005-01-01

    The R-C≡N…pyrrole (R=H, CH3, CH2F, CHF2, CF3, NH2, BH2, OH, F, CH2Cl, CHCl2, CCl3, Li, Na) complexes were considered as the simple sample for measure of hydrogen bonding strength. Density functional theory B3LYP/6-311 + + G** level was applied to the optimization of geometries of complexes and monomers. Measure of hydrogen bonding strength based on geometrical and topological parameters, which were derived from the AIM theory, was analyzed. Additionally, natural bond orbital (NBO) analysis and frequency calculations were performed.From the computation results it was found that the electronic density at N-H bond critical points was also strictly correlated with the hydrogen bonding strength.

  10. Insecticide Resistance: Challenge to Pest Management and Basic Research

    Science.gov (United States)

    Brattsten, L. B.; Holyoke, C. W.; Leeper, J. R.; Raffa, K. F.

    1986-03-01

    The agricultural use of synthetic insecticides usually protects crops but imposes strong selection pressures that can result in the development of resistance. The most important resistance mechanisms are enhancement of the capacity to metabolically detoxify insecticides and alterations in target sites that prevent insecticides from binding to them. Insect control methods must incorporate strategies to minimize resistance development and preserve the utility of the insecticides. The most promising approach, integrated pest management, includes the use of chemical insecticides in combination with improved cultural and biologically based techniques.

  11. Insecticide resistance selection in rice planthoppers

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ Brown planthopper (BPH, Nilaparvata lugens Stal) and white backed planthopper (WBPH, Sogatella furcifera Horvath) are the main insects on rice in China. The insecticide resistance of the two planthoppers have often been reported. Availability of the resistant population is a prerequisite for studying the resistance mechanism. In this paper, one method to select methamidophos resistance of the two planthoppers was recommended.

  12. Fungicide and insecticide residues in rice grains

    Directory of Open Access Journals (Sweden)

    Gustavo Mack Teló

    2017-01-01

    Full Text Available The objective of this study was to analyse residues of fungicides and insecticides in rice grains that were subjected to different forms of processing. Field work was conducted during three crop seasons, and fungicides and insecticides were applied at different crop growth stages on the aerial portion of the rice plants. Azoxystrobin, difenoconazole, propiconazole, tebuconazole, and trifloxystrobin fungicides were sprayed only once at the R2 growth stage or twice at the R2 and R4 growth stages; cypermethrin, lambda-cyhalothrin, permethrin, and thiamethoxam insecticides were sprayed at the R2 growth stage; and permethrin was sprayed at 5-day intervals from the R4 growth stage up to one day prior to harvest. Pesticide residues were analysed in uncooked, cooked, parboiled, polished and brown rice grains as well as rice hulls during the three crop seasons, for a total of 1458 samples. The samples were analysed by gas chromatography with electron capture detection (GC-ECD using modified QuEChERS as the extraction method. No fungicide or insecticide residues were detected in rice grain samples; however, azoxystrobin and cypermethrin residues were detected in rice hull samples.

  13. The 1975 Insecticide, Herbicide, Fungicide Quick Guide.

    Science.gov (United States)

    Page, Bill G.; Thomson, W. T.

    This is a quick guide for choosing a chemical to use to control a certain pest on a specific crop. Information in the book was obtained from manufacturers' labels and from the USDA and FDA pesticide summary. The book is divided into four parts: (1) insecticides, (2) herbicides, (3) fungicides, and (4) conversion tables. Each of the first three…

  14. Insecticides for Suppression of Nylanderia fulva

    Directory of Open Access Journals (Sweden)

    Dawn Calibeo

    2017-08-01

    Full Text Available Nylanderia fulva (Mayr is an invasive ant that is a serious pest in the southern United States. Pest control operators and homeowners are challenged to manage pest populations below acceptable thresholds. Contact and bait insecticides are key components of an Integrated Pest Management (IPM strategy, however, little is known about their efficacy. In repellency and efficacy bioassays, N. fulva were not completely repelled by any insecticide tested, although fewer ants crossed a surface treated with Temprid®. Few insecticides provided rapid control. Termidor® and Temprid® were the best performing with mean mortality of 100% in 13.4 and 19.0 days, respectively. In no-choice bait acceptance studies, it was shown that N. fulva generally had greater acceptance of carbohydrate-based ant baits (Advion®, InTiceTM (gel, and InTiceTM (granular. However, mortality was low for the InTiceTM baits in a 7-day bioassay. Maxforce® Ant Killer Bait Gel and Advance® 375A in the spring and Maxforce® Complete in the summer and fall required the fewest days to reach 100% mortality. Bait active ingredients that resulted in the highest mortality were hydramethylnon and fipronil. These data on the efficacy of commercially available contact and bait insecticides provide valuable information to manage this invasive pest.

  15. Comparison of Susceptibility of Plutella xylostella to Nine Insecticides in Different Areas of Jiangxi Province%江西不同地区小菜蛾对9种杀虫剂的敏感性比较

    Institute of Scientific and Technical Information of China (English)

    陈洁琼; 黄水金; 邱高辉; 管德泳; 秦文婧; 陈琼; 秦厚国

    2014-01-01

    2013年采取浸叶法测定了江西省5个地区田间小菜蛾对9种杀虫剂的敏感性。结果表明:小菜蛾5个地理种群对BT、溴虫腈和丁醚脲表现为敏感至低水平抗性;对啶虫隆、氯虫苯甲酰胺和茚虫威均表现为中等及其以下水平抗性;对阿维菌素和高效氯氰菊酯已产生了高水平的抗性。除了吉水种群对多杀菌素表现出高抗外,其余4个种群均表现出中等或中等以下水平抗性。%The susceptibility of field populations of Plutella xylostella from five areas of Jiangxi province to nine insecticides was tested by using leaf-dipping method in 2013.It was found that 5 field populations of Plutella xylostella showed sensitive or low re-sistance to BT, Chlorfenapyr and Diafenthiuron , moderate or middle-low resistance to Chlorfluazuron , Chlorantraniliprole and In-doxacarb, and high resistance to Abamectin and beta -Cypermethrin.Among the tested five populations , the field population in Jishui revealed a high resistance to Spinosad , while the others showed a moderate or middle -low resistance to this insecticide .

  16. Zn(OTf)2 promoted rearrangement of 1,2-cyclopropanated sugars with amines: a convenient method for the synthesis of 3-polyhydroxyalkyl-substituted pyrrole derivatives.

    Science.gov (United States)

    Shen, Xudong; Xia, Jianhui; Liang, Peng; Ma, Xiaofeng; Jiao, Wei; Shao, Huawu

    2015-11-28

    A rearrangement reaction of 1,2-cyclopropanated sugars with alkylamines or arylamines promoted by Zn(OTf)2 is described. The method offers a series of 3-polyhydroxyalkyl-substituted pyrrole derivatives with multiple chiral centers in moderate to excellent yields. The epimerization is achieved by inverting the stereochemistry at the free hydroxyl group of the resulting pyrrole, which would give access to many more possible stereoisomers.

  17. Vinyl azides derived from allenes: thermolysis leading to multisubstituted 1,4-pyrazines and Mn(III)-catalyzed photochemical reaction leading to pyrroles.

    Science.gov (United States)

    Sajna, K V; Kumara Swamy, K C

    2012-10-05

    Thermolysis of phosphorus-based vinyl azides under solvent- and catalyst-free conditions furnished a new route for 1,4-pyrazines. A simple one-pot, Mn(III)-catalyzed photochemical route has been developed for multisubstituted pyrroles starting from allenes and 1,3-dicarbonyls via in situ-generated vinyl azides. The utility of new phosphorus-based pyrroles is also demonstrated in the Horner reaction. The structures of key products are unequivocally confirmed by X-ray crystallography.

  18. Oviposition and olfaction responses of Aedes aegypti mosquitoes to insecticides.

    Science.gov (United States)

    Canyon, D V; Muller, R

    2013-12-01

    Insecticide applications are not particularly effective on Aedes aegypti mosquitoes which has been attributed to their 'closet' behaviour, or ability to rest in places that remain unexposed to insecticides. Some researchers have suggested that insecticides repel mosquitoes, which would result in less exposure and increased dispersal. If repellence due to insecticides is a fact, acquiring a vector-borne disease, such as dengue, could legitimately be attributed to local vector control efforts and this would lead to restitution claims. This study thus investigated the effect of insecticide presence on mosquito behaviour indirectly via oviposition and directly via olfactory response. In all experiments, oviposition in each insecticide compared to its water and ethanol controls was not significantly different. This indicates that Ae. aegypti mosquitoes are not affected by insecticide presence and that increased dispersal is unlikely to be caused by vector control spraying.

  19. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas.

  20. Comparative Analysis of the Antineoplastic Activity of C60 Fullerene with 5-Fluorouracil and Pyrrole Derivative In Vivo

    Science.gov (United States)

    Lynchak, O. V.; Prylutskyy, Yu I.; Rybalchenko, V. K.; Kyzyma, O. A.; Soloviov, D.; Kostjukov, V. V.; Evstigneev, M. P.; Ritter, U.; Scharff, P.

    2017-01-01

    The antitumor activity of pristine C60 fullerene aqueous solution (C60FAS) compared to 5-fluorouracil (5-FU) and pyrrole derivative 1-(4-Cl-benzyl)-3-Cl-4-(CF3-fenylamino)-1H-pyrrol-2.5-dione (MI-1) cytostatic drugs was investigated and analyzed in detail using the model of colorectal cancer induced by 1.2-dimethylhydrazine (DMH) in rats. The number, size, and location of the tumors were measured, and the pathology was examined. It was found that the number of tumors and total lesion area decreased significantly under the action of C60FAS and MI-1. Because these drugs have different mechanisms of action, their simultaneous administration can potentially increase the effectiveness and significantly reduce the side effects of antitumor therapy.

  1. Ethyl 5-cyano-4-[2-(2,4-dichlorophenoxyacetamido]-1-phenyl-1H-pyrrole-3-carboxylate

    Directory of Open Access Journals (Sweden)

    Jing Xu

    2009-08-01

    Full Text Available In the title compound, C22H17Cl2N3O4, the pyrrole ring and the 2,4-dichlorophenyl group form a dihedral angle of 8.14 (13°; the phenyl ring is twisted with respect to the pyrrole ring, forming a dihedral angle of 60.77 (14°. The C=O bond length is 1.213 (3 Å, indicating that the molecule is in the keto form, associated with a –CONH– group, and the amide group adopts the usual trans conformation. The molecule is stabilized by an intramolecular N—H...O hydrogen-bonding interaction. In the crystal, the stacked molecules exhibit intermolecular C—H...O and C—H...N hydrogen-bonding interactions.

  2. Preparation and enhanced electrochemical properties of nano-sulfur/poly(pyrrole-co-aniline) cathode material for lithium/sulfur batteries

    Energy Technology Data Exchange (ETDEWEB)

    Qiu Linlin [School of Materials Science and Engineering, Beihang University, Xueyuan Road, Haidian District, Beijing 100083 (China); Zhang Shichao, E-mail: csc@buaa.edu.c [School of Materials Science and Engineering, Beihang University, Xueyuan Road, Haidian District, Beijing 100083 (China); Zhang Lan; Sun, Mingming [School of Materials Science and Engineering, Beihang University, Xueyuan Road, Haidian District, Beijing 100083 (China); Wang Weikun [Military Power Sources Research and Development Center, Chemical Defense Institute, Beijing 100083 (China)

    2010-06-01

    Poly(pyrrole-co-aniline) (PPyA) copolymer nanofibers were prepared by chemical oxidation method with cetyltrimethyl ammonium chloride (CTAC) as template, and the nano-sulfur/poly(pyrrole-co-aniline) (S/PPyA) composite material in lithium batteries was achieved via co-heating the mixture of PPyA and sublimed sulfur at 160 deg. C for 24 h. The component and structure of the materials were characterized by FTIR, Raman, XRD, and SEM. PPyA with nanofiber network structure was employed as a conductive matrix, adsorbing agent and firm reaction chamber for the sulfur cathode materials. The nano-dispersed composite exhibited a specific capacity up to 1285 mAh g{sup -1} in the initial cycle and remained 866 mAh g{sup -1} after 40 cycles.

  3. CHANGES OF STRUCTURE AND PROPERTIES OF POLY (ETHYLENE TEREPHTHALATE)CAUSED BY IN-SITU POLYMERIZATION OF PYRROLE

    Institute of Scientific and Technical Information of China (English)

    HE Jiasong; FENG Zhihai

    1991-01-01

    Conductive polymer composites based on crystalline polymer matrix have been prepared by using an in-situ polymerization process of pyrrole in amorphous poly (ethylene terephthalate) (PET) film.The DSC and WAXD measurement and SEM observation show that liquid-induced crystallization of PET matrix has occurred during the preparation of composite films. Depending upon the equilibrium degree of swelling and crystallinity, the limited depth of penetration of pyrrole molecules results in a skin-core structure of the composite film. The skin layer containing charge transfer intercalated polypyrrole has a surface resistance of 3.5 × 104 Ω. Rigid and heat-resistant polypyrrole molecules formed in PET film increase the tensile modulus and, especially, the rigidity of PET at elevated temperatures. However, they decrease the tensile strength and elongation at break, and impair the thermal ductility of PET.

  4. Bandgap Engineering in π-Extended Pyrroles. A Modular Approach to Electron-Deficient Chromophores with Multi-Redox Activity.

    Science.gov (United States)

    Zhylitskaya, Halina; Cybińska, Joanna; Chmielewski, Piotr; Lis, Tadeusz; Stępień, Marcin

    2016-09-07

    A family of bandgap-tunable pyrroles structurally related to rylene dyes was computationally designed and prepared using robust, easily scalable chemistry. These pyrroles show highly variable fluorescence properties and can be used as building blocks for the synthesis of electron-deficient oligopyrroles. The latter application is demonstrated through the development of π-extended porphyrins containing naphthalenediamide or naphthalenediimide units. These new macrocycles exhibit simultaneously tunable visible and near-IR absorptions, an ability to accept up to 8 electrons via electrochemical reduction, and high internal molecular free volumes. When chemically reduced under inert conditions, the most electron-deficient of these macrocycles revealed reversible formation of eight charged states, characterized by remarkably red-shifted optical absorptions, extending beyond 2200 nm. Such features make these oligopyrroles of interest as functional chromophores, charge-storage materials, and tectons for crystal engineering.

  5. SPECTROSCOPIC STUDY OF EFFECTS OF TETRAALKYLAMMONIUM CATIONS ON F--SENSING PROPERTIES OF CALIX[4]PYRROLE BORADIAZAINDACENE DYE

    Directory of Open Access Journals (Sweden)

    Yongjun Lv

    Full Text Available A novel meso-tetracyclohexylcalix[4]pyrrole-based boradiazaindacene dye 3 was synthesized and characterized. F--binding properties of the dye in the presence of tetrabutylammonium (TBA+, tetraethylammonium (TEA+, and tetramethylammonium (TMA+ counter ions were investigated by UV-Vis, fluorescence, and NMR spectroscopies. Dye 3 displayed various degrees of absorption red shift, fluorescence quenching, and downfield shifts of NH signals for the three fluoride salts. The association constants of these salts mainly depend on cation size effects and ion-pairing effects and were in the order KTMA+ > KTEA+ > KTBA+. Thus, we speculate that both F- and tetraalkylammonium cations are concomitantly located above and below a bowl-shaped calix[4]pyrrole cup in an ion-paired complex, respectively.

  6. Direct detection of pyridine formation by the reaction of CH (CD) with pyrrole: a ring expansion reaction

    Energy Technology Data Exchange (ETDEWEB)

    Soorkia, Satchin; Taatjes, Craig A.; Osborn, David L.; Selby, Talitha M.; Trevitt, Adam J.; Wilson, Kevin R.; Leone, Stephen R.

    2010-03-16

    The reaction of the ground state methylidyne radical CH (X2Pi) with pyrrole (C4H5N) has been studied in a slow flow tube reactor using Multiplexed Photoionization Mass Spectrometry coupled to quasi-continuous tunable VUV synchrotron radiation at room temperature (295 K) and 90 oC (363 K), at 4 Torr (533 Pa). Laser photolysis of bromoform (CHBr3) at 248 nm (KrF excimer laser) is used to produce CH radicals that are free to react with pyrrole molecules in the gaseous mixture. A signal at m/z = 79 (C5H5N) is identified as the product of the reaction and resolved from 79Br atoms, and the result is consistent with CH addition to pyrrole followed by Helimination. The Photoionization Efficiency curve unambiguously identifies m/z = 79 as pyridine. With deuterated methylidyne radicals (CD), the product mass peak is shifted by +1 mass unit, consistent with the formation of C5H4DN and identified as deuterated pyridine (dpyridine). Within detection limits, there is no evidence that the addition intermediate complex undergoes hydrogen scrambling. The results are consistent with a reaction mechanism that proceeds via the direct CH (CD) cycloaddition or insertion into the five-member pyrrole ring, giving rise to ring expansion, followed by H atom elimination from the nitrogen atom in the intermediate to form the resonance stabilized pyridine (d-pyridine) molecule. Implications to interstellar chemistry and planetary atmospheres, in particular Titan, as well as in gas-phase combustion processes, are discussed.

  7. Synthesis and spectroscopic characterization of pyrrole-2,3-diones and their following reactions with 1,2-aromatic diamines

    Directory of Open Access Journals (Sweden)

    İrfan Koca

    2012-01-01

    Full Text Available 4-aroyl-5-aryl-2,3-furandiones and N,N-dialkyl urea combine with loss of water yielding the pyrrole-2,3-dione derivatives in moderate yields (47-68%. Then, these compounds were converted into 2(1H-quinoxalinones with various 1,2-phenylenediamines. The structures and characterizations of the synthesized compounds were established by the 1H- and 13C-NMR, IR and elemental analysis.

  8. Cation-π interaction of the univalent silver cation with meso-octamethylcalix[4]pyrrole: Experimental and theoretical study

    Science.gov (United States)

    Polášek, Miroslav; Kvíčala, Jaroslav; Makrlík, Emanuel; Křížová, Věra; Vaňura, Petr

    2017-02-01

    By using electrospray ionization mass spectrometry (ESI-MS), it was proven experimentally that the univalent silver cation Ag+ forms with meso-octamethylcalix[4]pyrrole (abbrev. 1) the cationic complex species 1·Ag+. Further, applying quantum chemical DFT calculations, four different conformations of the resulting complex 1·Ag+ were derived. It means that under the present experimental conditions, this ligand 1 can be considered as a macrocyclic receptor for the silver cation.

  9. Tetraaryl-, Pentaaryl-, and Hexaaryl-1,4-dihydropyrrolo 3,2-b pyrroles: Synthesis and Optical Properties

    DEFF Research Database (Denmark)

    Krzeszewski, M.; Thorsted, B.; Brewer, J.

    2014-01-01

    examination of various reaction parameters (solvent, acid, temperature) p-toluenesulfonic acid was identified as the crucial catalyst. As a result, 1,4-dihydropyrrolo[3,2-b]pyrroles were obtained in the highest yields reported to date. The scope and limitation studies showed that this new method...... in the near-IR region were surprisingly high (hundreds of GM), given the limited conjugation in these propeller-shaped dyes....

  10. Visible-light-induced formal [3+2] cycloaddition for pyrrole synthesis under metal-free conditions.

    Science.gov (United States)

    Xuan, Jun; Xia, Xu-Dong; Zeng, Ting-Ting; Feng, Zhu-Jia; Chen, Jia-Rong; Lu, Liang-Qiu; Xiao, Wen-Jing

    2014-05-26

    A photocatalytic formal [3+2] cycloaddition of 2H-azirines with alkynes has been achieved under irradiation by visible light in the presence of organic dye photocatalysts. This transformation provides efficient access to highly functionalized pyrroles in good yields and has been applied to the synthesis of drug analogues. A primary trial of photocascade catalysis merging energy transfer and redox neutral reactions was shown to be successful. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Pyrrole PMOs, incorporating new N-heterocyclic compounds on an ethene-PMO through Diels–Alder reactions

    Energy Technology Data Exchange (ETDEWEB)

    Esquivel, Dolores; De Canck, Els [Center for Ordered Materials, Organometallics and Catalysis, Department of Inorganic and Physical Chemistry, Ghent University, Krijgslaan 281-S3, 9000 Ghent (Belgium); Jiménez-Sanchidrián, César [Department of Organic Chemistry, Nanochemistry and Fine Chemistry Research Institute (IUIQFN), Faculty of Sciences, University of Córdoba, Campus de Rabanales, Marie Curie Building, Ctra. Nnal. IV, km 396, 14071 Córdoba (Spain); Romero-Salguero, Francisco J., E-mail: qo2rosaf@uco.es [Department of Organic Chemistry, Nanochemistry and Fine Chemistry Research Institute (IUIQFN), Faculty of Sciences, University of Córdoba, Campus de Rabanales, Marie Curie Building, Ctra. Nnal. IV, km 396, 14071 Córdoba (Spain); Van Der Voort, Pascal, E-mail: pascal.vandervoort@ugent.be [Center for Ordered Materials, Organometallics and Catalysis, Department of Inorganic and Physical Chemistry, Ghent University, Krijgslaan 281-S3, 9000 Ghent (Belgium)

    2014-11-14

    The ethenylene bridges on the walls of an ethenylene-bridged periodic mesoporous organosilica were successfully modified with a variety of pyrrole derivatives – pyrrole, methylpyrrole, dimethylpyrrole, trimethylpyrrole and 1-phenylpyrrole – through Diels–Alder reactions. X-ray diffraction measurements and N{sub 2} adsorption–desorption analysis confirmed the preservation of the ordering and mesoporosity of the parent material as well as the decoration of the pores with the surface Diels–Alder adducts. Moreover, other techniques such as DRIFT, {sup 13}C and {sup 29}Si nuclear magnetic resonances revealed the formation of the surface N-heterocyclic compounds at the parent ethenylene sites. - Highlights: • Chemical modification of the double bonds on an ethene-PMO through the Diels–Alder reaction. • A family of pyrrole derivatives act as dienes in the Diels–Alder reaction. • Well-ordering and mesoporosity are retained after the post-functionalization. • N-containing compounds on the surface of ethene-PMO are present after the Diels–Alder reaction.

  12. Synthetic, structural and biological studies of organosilicon(IV complexes of Schiff bases derived from pyrrole-2-carboxaldehyde

    Directory of Open Access Journals (Sweden)

    KIRAN SING

    2010-07-01

    Full Text Available Selected new organosilicon(IV complexes having the general formula R2SiCl[L] and R2Si[L] 2 were synthesized by the reactions of Me2SiCl2 with Schiff bases (5-mercapto-4-[(1H-pyrrol-2ylmethyleneamino]-s-triazole, 5-mercapto-3-methyl-4-[(1H-pyrrol-2ylmethyleneamino]-s-triazole and 3-ethyl-5-mercapto-4-[(1H-pyrrol-2ylmethyleneamino]-s-triazole in 1:1 and 1:2 molar ratios. All of the compounds were characterized by elemental analysis, molar conductance, and IR, UV, 1H-, 13C- and 29Si-NMR spectral studies. All the spectral data suggest an involvement with an azomethine nitrogen in coordination to the central silicon atom. With the help of above-mentioned spectral studies, penta and hexacoordinated environments around the central silicon atoms in the 1:1 and 1:2 complexes, respectively, are proposed. Finally, the free ligands and their metal complexes were tested in vitro against some pathogenic bacteria and fungi to assess their antimicrobial properties.

  13. Synthesis and Crystal Structure of 3-(Pyrrole-2'-carboxamido)propanoic Acid·(1/2)H2O

    Institute of Scientific and Technical Information of China (English)

    ZENG Xiang-Chao; XU Shi-Hai; GU Jian; LIU Po-Run

    2005-01-01

    3-(Pyrrole-2'-carboxamido)propanoic acid I has been synthesized from the reaction of β-alanine methyl ester with 2-trichloroacetylpyrrole followed by saponifying and acidating in 85.4% yield, and the crystal structure of 3-(pyrrole-2'-carboxamido)propanoic acid· (1/2)H2O (C8H11N2O3.5, Mr = 191.19) was obtained and determined by X-ray diffraction method. The crystal is of monoclinic, space group C2/c with a = 19.010(4), b = 8.3515(17), c = 13.788(3) (A), β = 125.88(3)°, V = 1773.6(6) (A)3, Z = 8, Dc = 1.432 g/cm3, λ = 0.71073 (A), μ-MoKα) = 0.114 mm-1 and F(000) = 768. The structure was refined to R = 0.0354 and wR = 0.0942 for 1642 observed reflections with I > 2σ(I). It is revealed that the title compound has one pyrrole ring and one propionic acid subchain linked by an amido bond at C(4), and there are 8 molecules of com- pound I and 4 crystal water molecules in each unit cell. The supramolecular layers are stabilized by the hydrogen bonds of N(2) H…O(2), N(1) H…O(4), O(4) H(1W)…O(2) and O(3) H…O(1).

  14. Characterization of electrogenerated polypyrrole-benzophenone films coated on poly(pyrrole-methyl metacrylate) optic-conductive fibers.

    Science.gov (United States)

    Abu-Rabeah, Khalil; Atias, Danit; Herrmann, Sebastien; Frenkel, Julia; Tavor, Dorith; Cosnier, Serge; Marks, Robert S

    2009-09-01

    A conductive surface was created for the development of a biosensing platform via chemical polymerization of pyrrole onto the surface of poly(methyl methacrylate) (PMMA) fibers, with a subsequent electrogeneration of a photoactive linker pyrrole-benzophenone (PyBz) monomer on the fiber surface. Irradiation of the benzophenone groups embedded in the polypyrrole (Ppy) films by UV (350 nm) formed active radicals, allowing covalent attachment of the desired biomaterials. Characterization and optimization of this platform were carried out, with the platform showing conductive, stable, thin, controllable, and light-transmissible film features. Various parameters such as time deposition, process temperature, and activator plus pyrrole monomer concentrations were examined in the study. The morphology and permeability of the optic-fiber PMMA fibers were investigated to examine mass transfer ability. Cyclic voltammetry and amperometry techniques were applied to characterize the electrical features of the surface and charge transfer. The platform potential was then demonstrated by the construction of both amperometric and optical biosensors.

  15. Calix[4]pyrrole derivative: recognition of fluoride and mercury ions and extracting properties of the receptor-based new material.

    Science.gov (United States)

    de Namor, Angela F Danil; Khalife, Rasha

    2008-12-11

    A calix[4]pyrrole derivative, namely, meso-tetramethyl tetrakis (4-phenoxy methyl ketone) calix[4]pyrrole, 1, was synthesized and structurally (1H NMR) and thermodynamically characterized. The complexing properties of this receptor with a wide variety of anions and cations in dipolar aprotic media (acetonitrile, propylene carbonate, and dimethyl sulfoxide) were investigated through 1H NMR and conductance studies. The former technique was used to assess whether or not complexation occurs and if so to identify the active sites of interaction of 1 with ions. The composition of the complexes was established by conductance measurements. It was found that in dipolar aprotic solvents, 1 interacts only with two polluting ions (fluoride and mercury). The complexation thermodynamics of 1 and these ions in these solvents is reported. The medium effect on the binding process involving the fluoride ion is discussed taking into account the solvation properties of reactants and the product. Complexes of moderate stability are found. Given that this is an important factor to consider for the recycling of the loaded material in extraction processes, 1 was treated with formaldehyde in basic medium leading to the production of a calix[4]pyrrole based material able to extract fluoride and mercury (II) ions from water. Thus the optimum conditions for the extraction of these ions from aqueous solutions were established. The material is easily recyclable using an organic acid. Final conclusions are given.

  16. Evaluation of molecular assembly, spectroscopic interpretation, intra-/inter molecular hydrogen bonding and chemical reactivity of two pyrrole precursors

    Science.gov (United States)

    Rawat, Poonam; Singh, R. N.

    2014-10-01

    This paper describes the evaluation of conformational, spectroscopic, hydrogen bonding and chemical reactivity of pyrrole precursor: ethyl 3,5 dimethyl-1H-pyrrole-2-carboxylate (EDPC) and ethyl 3,4-dimethyl-4-acetyl-1H-pyrrole-2-carboxylate (EDAPC) for the convenient characterization, synthetic usefulness and comparative evaluations. All experimental spectral values of 1H NMR, UV-Vis and FT-IR spectra coincide well with calculated values by DFT. The orbital interactions in EDPC and EDAPC are found to lengthen their Nsbnd H and Cdbnd O bonds and lowers their vibrational frequencies (red shift) resulting to dimer formation. The QTAIM and NBO analyses provide the strength of interactions and charge transfer in the hydrogen bonding unit and stability of dimers. The binding energy of EDPC and EDPAC dimer are found to be 9.92, 10.22 kcal/mol, respectively. In EDPAC and EDPC dimer, hyperconjugative interactions between monomer units is due to n1(O) → σ*(Nsbnd H) that stabilize the molecule up to 9.7 and 9.3 kcal/mol, respectively. On evaluation of molecular electrostatic potential (MEP) and electronic descriptors for EDPC it has been found that it is a good precursor for synthesis of formyl and acetyl derivatives whereas EDAPC has been found to be a good precursor for synthesis of schiff base, hydrazones, hydrazide-hydrazones and chalcones.

  17. Spiroheterocyclization of Methyl 1-Aryl-3-cinnamoyl-4,5-dioxo-4,5-dihydro-1H-pyrrole-2-carboxylates by the Action of 3-(Arylamino-1H-inden-1-ones

    Directory of Open Access Journals (Sweden)

    Аndrey N. Maslivets

    2012-11-01

    Full Text Available Methyl 1-aryl-3-cinnamoyl-4,5-dioxo-4,5-dihydro-1H-pyrrole-2-carboxylates interact with 3-(arylamino-1H-inden-1-ones to give the corresponding 1,1'-diaryl-3'-cinnamoyl-4'-hydroxy-1H-spiro[indeno[1,2-b]pyrrole-3,2'-pyrrole]-2,4,5'(1'H-triones in good yields.

  18. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  19. Resmethrin, the first modern pyrethroid insecticide.

    Science.gov (United States)

    Soderlund, David M

    2015-06-01

    The discovery of resmethrin almost five decades ago was the seminal event in the development of pyrethroid insecticides as important pest management tools, the value of which endures to this day. This brief review considers the development of pyrethroids from the perspective of the discovery of resmethrin. I describe the pathway to the discovery of resmethrin and the unique properties that differentiated it from the pyrethrins and earlier synthetic pyrethroids is described. I also summarize information on metabolic fate and mechanisms of selective toxicity, first elucidated with resmethrin, that have shaped our understanding of pyrethroid toxicology since that time. Finally, I review the discovery pathway that led from resmethrin to the development of the first photostable, agriculturally useful pyrethroids that established the importance of this insecticide class.

  20. Neem (Azadirachta indica): towards the ideal insecticide?

    Science.gov (United States)

    Benelli, Giovanni; Canale, Angelo; Toniolo, Chiara; Higuchi, Akon; Murugan, Kadarkarai; Pavela, Roman; Nicoletti, Marcello

    2017-02-01

    Pesticide resistance is going to change rapidly our antibiotics and insecticides arsenal. In this scenario, plant-derived natural products are considered valuable candidates to reverse this negative trend. Growing research attention is focused on neem (Azadirachta indica, Meliaceae), exploring the utility of its products as insecticides and antibiotics. In this review, we summarised the knowledge on neem oil and neem cake by-products in arthropod pest control, with special reference to mosquito vectors of public health importance. To the best of our knowledge, neem-borne products currently showed effective and eco-friendly features, including little non-target effects, multiple mechanisms of action, low cost, easy production in countries with limited industrial facilities. In particular, the potentiality of neem cake as ideal and affordable source of mosquitocidal compounds in anopheline and aedine control programmes is outlined. Overall, we propose the employ of neem-based products as an advantageous alternative to build newer and safer arthropod control tools.

  1. Ion channels: molecular targets of neuroactive insecticides.

    Science.gov (United States)

    Raymond-Delpech, Valérie; Matsuda, Kazuhiko; Sattelle, Benedict M; Rauh, James J; Sattelle, David B

    2005-11-01

    Many of the insecticides in current use act on molecular targets in the insect nervous system. Recently, our understanding of these targets has improved as a result of the complete sequencing of an insect genome, i.e., Drosophila melanogaster. Here we examine the recent work, drawing on genetics, genomics and physiology, which has provided evidence that specific receptors and ion channels are targeted by distinct chemical classes of insect control agents. The examples discussed include, sodium channels (pyrethroids, p,p'-dichlorodiphenyl-trichloroethane (DDT), dihydropyrazoles and oxadiazines); nicotinic acetylcholine receptors (cartap, spinosad, imidacloprid and related nitromethylenes/nitroguanidines); gamma-aminobutyric acid (GABA) receptors (cyclodienes, gamma-BHC and fipronil) and L-glutamate receptors (avermectins). Finally, we have examined the molecular basis of resistance to these molecules, which in some cases involves mutations in the molecular target, and we also consider the future impact of molecular genetic technologies in our understanding of the actions of neuroactive insecticides.

  2. BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY

    OpenAIRE

    E. V. Matseliukh; N. A. Nidialkova; V. V. Krout'; L. D. Varbanets; A. V. Kalinichenko; V. F. Patyka

    2015-01-01

    The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kh...

  3. Insecticide control in a Dengue epidemics model

    CERN Document Server

    Rodrigues, Helena Sofia; Torres, Delfim F M

    2010-01-01

    A model for the transmission of dengue disease is presented. It consists of eight mutually-exclusive compartments representing the human and vector dynamics. It also includes a control parameter (insecticide) in order to fight the mosquitoes. The main goal of this work is to investigate the best way to apply the control in order to effectively reduce the number of infected humans and mosquitoes. A case study, using data of the outbreak that occurred in 2009 in Cape Verde, is presented.

  4. Effects of Different Surfaces and Insecticide Carriers on Residual Insecticide Bioassays Against Bed Bugs, Cimex spp. (Hemiptera: Cimicidae).

    Science.gov (United States)

    Dang, Kai; Singham, G Veera; Doggett, Stephen L; Lilly, David G; Lee, Chow-Yang

    2017-04-01

    The performance of five insecticides (bendiocarb, deltamethrin, DDT, malathion, and imidacloprid) using three application methods (oil-based insecticide films on filter paper, and acetone-based insecticide deposits on two substrates: filter paper and glass) was assessed against a susceptible strain of Cimex lectularius (L.) and two resistant strains of Cimex hemipterus (F.). Substrate type significantly affected (P < 0.05) the insecticide knockdown response of the susceptible strain in acetone-based insecticide bioassays, with longer survival time on filter paper than on the glass surface. With the exception of deltamethrin, the different diluents (oil and acetone) also significantly affected (P < 0.05) the insecticide knockdown response of the susceptible strain in the filter paper-based insecticide bioassays, with longer survival time with acetone as the diluent. For both strains of C. hemipterus, there were no significant effects with the different surfaces and diluents for all insecticides except for malathion and imidacloprid, which was largely due to high levels of resistance. The lower effectiveness for the insecticide acetone-based treatment on filter paper may be due to crystal bloom. This occurs when an insecticide, dissolved in a volatile solvent, is applied onto absorptive surfaces. The effect is reduced on nonabsorptive surfaces and slowed down with oil-based insecticides, whereby the oil forms a film on absorptive surfaces. These findings suggest that nonabsorptive surfaces should be used in bioassays to monitor insecticide resistance. If absorptive surfaces are used in bioassays for testing active ingredients, then oil-based insecticides should be preferably used. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Palladium complexes of pyrrole-2-aldehyde thiosemicarbazone: Synthesis, structure and spectral properties

    Indian Academy of Sciences (India)

    Piyali Paul; Samaresh Bhattacharya

    2014-09-01

    Reaction of pyrrole-2-aldehyde thiosemicarbazone (abbreviated as H2L, where H2 stands for the two potentially dissociable protons) with [Pd(PPh3)2Cl2] in ethanol in the presence of NEt3 afforded two complexes, [Pd(PPh3)(HLNS)Cl] and [Pd(PPh3)(LNNS)], where the thiosemicarbazone ligand is coordinated to the metal centre respectively as monoanionic N,S-donor (depicted by HLNS) and dianionic N,N,S-donor (depicted by LNNS). Similar reaction with Na2[PdCl4] afforded a bis-complex, [Pd(HLNS)2]. Crystal structures of all the three complexes have been determined.With reference to the structure of the uncoordinated thiosemicarbazone (H2L), the N,S-coordinationmode observed in [Pd(PPh3)(HLNS)Cl] and [Pd(HLNS)2] is associated with a geometrical change around the imine bond.While the N,N,S-mode of binding observed in [Pd(PPh3)(LNNS)] takes place without any such geometrical change. All three complexes display intense absorptions in the visible and ultraviolet regions, which have been analyzed by TDDFT method.

  6. Efficient Synthesis of Peptide and Protein Functionalized Pyrrole-Imidazole Polyamides Using Native Chemical Ligation

    Directory of Open Access Journals (Sweden)

    Brian M. G. Janssen

    2015-06-01

    Full Text Available The advancement of DNA-based bionanotechnology requires efficient strategies to functionalize DNA nanostructures in a specific manner with other biomolecules, most importantly peptides and proteins. Common DNA-functionalization methods rely on laborious and covalent conjugation between DNA and proteins or peptides. Pyrrole-imidazole (Py–Im polyamides, based on natural minor groove DNA-binding small molecules, can bind to DNA in a sequence specific fashion. In this study, we explore the use of Py–Im polyamides for addressing proteins and peptides to DNA in a sequence specific and non-covalent manner. A generic synthetic approach based on native chemical ligation was established that allows efficient conjugation of both peptides and recombinant proteins to Py–Im polyamides. The effect of Py–Im polyamide conjugation on DNA binding was investigated by Surface Plasmon Resonance (SPR. Although the synthesis of different protein-Py–Im-polyamide conjugates was successful, attenuation of DNA affinity was observed, in particular for the protein-Py–Im-polyamide conjugates. The practical use of protein-Py–Im-polyamide conjugates for addressing DNA structures in an orthogonal but non-covalent manner, therefore, remains to be established.

  7. Crystal structures of unsymmetrically mixed β-pyrrole substituted nickel(II)-meso-tetraphenylporphyrins

    Indian Academy of Sciences (India)

    BHYRAPPA PUTTAIAH; VELKANNAN VEERAPANDIAN; SARANGI UJWAL KUMAR

    2016-07-01

    Crystal structures of solvated unsymmetrically substituted meso-tetraphenylporphyrins, 2,3,12,13, 17-pentachloro-5,7,8,10,15,18,20-hepta-phenylporphyrin, H₂TPP(Ph)₃(Cl)₅, 1 and its nickel(II), NiTPP(Ph)₃(Cl)₅, 2 were determined by single crystal XRD analysis. In addition, a new unsymmetricallysubstituted porphyrin, 2,3,12,13,17-pentacyano-5,7,8,10,15,18,20-heptaphenyl-porphinato nickel(II) complex, NiTPP(Ph)₃(CN)₅, 3 complex was synthesized and its solvated structure was examined by crystallography. These porphyrins exhibited dramatic nonplanar conformation of the macrocycle as evidenced from the averagedisplacement of the β-pyrrole carbon (±ΔCβ ) from the mean plane of the porphyrin ring and the trend in nonplanarity varies in the order: 2 (1.189(5) Å) > 1 (1.036(6) Å) > 3 (0.895(6) Å). The normal-coordinate structural decomposition analysis of these structures revealed mainly saddle distortion of the macrocycle combined with small degree of ruffled or domed distortions. The Hirshfeld surface analysis of structures 1-3 revealed solvate dependent intermolecular contacts with varying degree of H. . .H (43–49%), C. . .H (17–19%), H. . .Cl (25–30%) and N. . .H (~19%) contact contributions.

  8. Efficient Synthesis of Peptide and Protein Functionalized Pyrrole-Imidazole Polyamides Using Native Chemical Ligation.

    Science.gov (United States)

    Janssen, Brian M G; van Ommeren, Sven P F I; Merkx, Maarten

    2015-06-04

    The advancement of DNA-based bionanotechnology requires efficient strategies to functionalize DNA nanostructures in a specific manner with other biomolecules, most importantly peptides and proteins. Common DNA-functionalization methods rely on laborious and covalent conjugation between DNA and proteins or peptides. Pyrrole-imidazole (Py-Im) polyamides, based on natural minor groove DNA-binding small molecules, can bind to DNA in a sequence specific fashion. In this study, we explore the use of Py-Im polyamides for addressing proteins and peptides to DNA in a sequence specific and non-covalent manner. A generic synthetic approach based on native chemical ligation was established that allows efficient conjugation of both peptides and recombinant proteins to Py-Im polyamides. The effect of Py-Im polyamide conjugation on DNA binding was investigated by Surface Plasmon Resonance (SPR). Although the synthesis of different protein-Py-Im-polyamide conjugates was successful, attenuation of DNA affinity was observed, in particular for the protein-Py-Im-polyamide conjugates. The practical use of protein-Py-Im-polyamide conjugates for addressing DNA structures in an orthogonal but non-covalent manner, therefore, remains to be established.

  9. Flexible electrochemical capacitors based on polypyrrole/carbon fibers via chemical polymerization of pyrrole vapor

    Science.gov (United States)

    Yuan, Wei; Han, Gaoyi; Xiao, Yaoming; Chang, Yunzhen; Liu, Cuixian; Li, Miaoyu; Li, Yanping; Zhang, Ying

    2016-07-01

    Polypyrrole (PPy) has been deposited on the carbon fibers (CFs) via chemical oxidation of monomer vapor strategy, during which FeCl3·6H2O in acetonitrile adsorbed on CFs acts as oxidant to polymerize the pyrrole vapor. The morphologies and capacitive properties of the PPy deposited on CFs (PPy/CFs) are strongly influenced by the concentration of oxidant used in the process. The assembled flexible capacitors by using PPy/CFs as electrodes and LiCl/polyvinyl alcohol as gel electrolyte have been evaluated by cyclic voltammetry, galvanostatic charge/discharge and electrochemical impedance spectroscopy. The results show that the composites of PPy/CFs prepared by using 350 mg mL-1 FeCl3·6H2O as oxidant (PPy/CFs-350) exhibit relatively higher specific capacitance and good rate capability. Compared with PPy/CFs prepared by electrochemical deposition (retaining 5% of the initial capacitance), the PPy/CFs prepared by chemically polymerizing monomer vapor shows excellent stability (retaining 85% of initial capacitance after 5000 cycles). Furthermore, cells fabricated by PPy/CFs show a fairly good performance under various bending states, three cells of PPy/CFs-350 connected in series can light up a light emitting diode with a voltage threshold of about 2.5 V for approximate 10 min after being charged for about 3 min, revealing the potential of the cells' practical applications.

  10. Molecular design and performance prediction of poly-dinitroamino pyrrole compounds as energetic materials

    Indian Academy of Sciences (India)

    MEI LI; FENG-MIN WU; HANG XU

    2017-01-01

    To identify superior and safe energetic materials, eighteen poly-dinitroamino pyrrole derivatives were studied at the B3LYP/6-311G** level of density functional theory (DFT). The isodesmic reactions were employed to calculate the heats of formation (HOFs) for these compounds. The detonation velocity (D) and pressure (P) were evaluated using the Kamlet-Jacobs equations. Results indicate that –N(NO₂)₂ group is an effective substituent for enhancing the detonation performance since most of the molecules have larger energy density than RDX (1,3,5-trinitro-1,3,5-triazinane), and a few molecules, C1(N-R) - D3(N-R), with D ranging from 8.55 to 9.04 km s−1 and P ranging from 35.53 to 40.36 GPa outperform RDX (D = 8.75 km s⁻¹ and P = 34.00 GPa). The calculated bond dissociation energy (BDE) revealed that the new compounds exhibit good thermal stability and meet the requirements of energetic materials. Besides, the N-NO₂ bond on the side chain was found to be the trigger bond during decomposition. The characteristic height (h₅₀) of the compound was calculated, and thirteen compounds exhibited lower sensitivity than CL-20 (2,4,6,8,10,12-hexanitro-2,4,6,8,10,12-hexaazaisowurtzitane).

  11. Insecticide resistance in Bemisia tabaci from Cyprus

    Institute of Scientific and Technical Information of China (English)

    Vassilis Vassiliou; Maria Emmanouilidou; Andreas Perrakis; Evangelia Morou; John Vontas; Anastasia Tsagkarakou; Emmanouil Roditakis

    2011-01-01

    A comprehensive study on the Bemisia tabaci(biotype B)resistance to neonicotinoid insecticides imidacloprid,acetamiprid and thiamethoxam,and pyrethroid bifenthrin was conducted in Cyprus.The resistance level to eight field-collected B.tabaci populations was investigated.The activities of enzymes involved in metabolic detoxification and the frequencies of pyrethroid and organophosphates target site resistance mutations were determined.Moderate to high levels of resistance were detected for imidacloprid(resistance factor[RF]77-392)and thiamethoxam(RF 50-164)while low resistance levels were observed for acetamiprid(RF 7-12).Uniform responses by the Cypriot whiteflies could be observed against all neonicotinoid insecticides.No cross-resistance between the neonicotinoids was detected as well as no association with the activity of the P450 microsomal oxidases.Only imidacloprid resistance correlated with carboxylesterase activity.Low to extremely high resistance was observed for insecticide bifenthrin(RF 49-1 243)which was associated with the frequency of the resistant allele in the sodium channel gene but not with the activity of the detoxification enzymes.Finally,the F331W mutation in the acetylcholinesterase enzyme ace1 gene was fixed in all B.tabaci populations from Cyprus.

  12. Insecticide Resistance and Management Strategies in Urban Ecosystems

    Directory of Open Access Journals (Sweden)

    Fang Zhu

    2016-01-01

    Full Text Available The increased urbanization of a growing global population makes imperative the development of sustainable integrated pest management (IPM strategies for urban pest control. This emphasizes pests that are closely associated with the health and wellbeing of humans and domesticated animals. Concurrently there are regulatory requirements enforced to minimize inadvertent exposures to insecticides in the urban environment. Development of insecticide resistance management (IRM strategies in urban ecosystems involves understanding the status and mechanisms of insecticide resistance and reducing insecticide selection pressure by combining multiple chemical and non-chemical approaches. In this review, we will focus on the commonly used insecticides and molecular and physiological mechanisms underlying insecticide resistance in six major urban insect pests: house fly, German cockroach, mosquitoes, red flour beetle, bed bugs and head louse. We will also discuss several strategies that may prove promising for future urban IPM programs.

  13. Multiple insecticide resistance: an impediment to insecticide-based malaria vector control program.

    Directory of Open Access Journals (Sweden)

    Delenasaw Yewhalaw

    Full Text Available BACKGROUND: Indoor Residual Spraying (IRS, insecticide-treated nets (ITNs and long-lasting insecticidal nets (LLINs are key components in malaria prevention and control strategy. However, the development of resistance by mosquitoes to insecticides recommended for IRS and/or ITNs/LLINs would affect insecticide-based malaria vector control. We assessed the susceptibility levels of Anopheles arabiensis to insecticides used in malaria control, characterized basic mechanisms underlying resistance, and evaluated the role of public health use of insecticides in resistance selection. METHODOLOGY/PRINCIPAL FINDINGS: Susceptibility status of An. arabiensis was assessed using WHO bioassay tests to DDT, permethrin, deltamethrin, malathion and propoxur in Ethiopia from August to September 2009. Mosquito specimens were screened for knockdown resistance (kdr and insensitive acetylcholinesterase (ace-1(R mutations using AS-PCR and PCR-RFLP, respectively. DDT residues level in soil from human dwellings and the surrounding environment were determined by Gas Chromatography with Electron Capture Detector. An. arabiensis was resistant to DDT, permethrin, deltamethrin and malathion, but susceptible to propoxur. The West African kdr allele was found in 280 specimens out of 284 with a frequency ranged from 95% to 100%. Ace-1(R mutation was not detected in all specimens scored for the allele. Moreover, DDT residues were found in soil samples from human dwellings but not in the surrounding environment. CONCLUSION: The observed multiple-resistance coupled with the occurrence of high kdr frequency in populations of An. arabiensis could profoundly affect the malaria vector control programme in Ethiopia. This needs an urgent call for implementing rational resistance management strategies and integrated vector control intervention.

  14. The use of insecticides to control insect pests

    Directory of Open Access Journals (Sweden)

    M Wojciechowska

    2016-07-01

    Full Text Available Pesticides are used as plants protection products. Among those, insecticides serve as agents to control insects. When incorrectly applied, however these substances may negatively affect people's health and natural environment. Administration routes of insecticides depend on many factors and vary from spraying to fertilizers. These different methods influence how insects prey and how pests develop. Additionally, too frequent use of the same chemicals can lead to development of resistance of insects to these insecticides. In order to prevent occurrence of negative effects of insecticides on surroundings, the effects of these compounds should be studied

  15. Comparative toxicity of insecticides to Choristoneura species (Lepidoptera: Tortricidae)

    Science.gov (United States)

    Jacqueline L. Robertson; Nancy L. Gillette; Barbara A. Lucas; Robert M. Russell; N.E. Savin

    1978-01-01

    Selected carbamate, chlorinated hydrocarbon, organophosphorous, and pyrethroid insecticides were tested on six Choristoneura species: conflictana (Walker), fumiferana (Clemens), lambertiana ponderosana Obraztsov, occidentalis Freeman, pinus Freeman, and...

  16. Podophyllotoxin-derived insecticidal agents: part XIII--evaluation of insecticidal activity of podophyllotoxin derivatives against Brontispa longissima.

    Science.gov (United States)

    Liu, Ying-Qian; Feng, Gang; Yang, Liu; Jing-Zhang; Li, Hong-Yu

    2011-09-01

    In an attempt to find the biorational insecticides for Brontispa longissima control, 12 podophyllotoxin (PPT) analogues were tested for their insecticidal activity against the fifth-instar larvae of B. longissima in vivo for the first time. Among all the tested compounds, especially compounds 6 and 8 showed more promising and pronounced insecticidal activity than toosendanin, a commercial insecticide derived from Melia azedarach. The different insecticidal activity range of compounds 1-12 indicated that the variation of chemical structures in the PPT skeleton markedly affected the activity profiles of this compound class, and some important structure-activity relationship information has been revealed. Together, these preliminary results may be useful in guiding further modification of PPTs in the development of potential new insecticides.

  17. One-pot Green Synthesis of Pyrrole Derivatives Catalyzed by Nano Sulfated Zirconia as a Solid Acid Catalyst%One-pot Green Synthesis of Pyrrole Derivatives Catalyzed by Nano Sulfated Zirconia as a Solid Acid Catalyst

    Institute of Scientific and Technical Information of China (English)

    Teimouri, Abbas; Chermahini, Alireza Najafi

    2012-01-01

    A new and efficient method for the preparation of N-substituted pyrroles from one-pot Paal-Knorr condensation has been accomplished using nano-crystalline sulfated zirconia (SZ) as the catalyst in ethanol at moderate temperature. This new protocol has the advantages of easy availability, stability, reusability and eco-friendliness of the catalyst, high to excellent yields, simple experimental and work-up procedure. The synthesized compounds were confirmed through spectral characterization using IR, 1H NMR, 13C NMR and mass spectra.

  18. 2-(ω-Carboxyethyl)pyrrole Antibody as a New Inhibitor of Tumor Angiogenesis and Growth.

    Science.gov (United States)

    Wu, Chunying; Wang, Xizhen; Tomko, Nicholas; Zhu, Junqing; Wang, William R; Zhu, Jinle; Wang, Yanming; Salomon, Robert G

    2016-09-22

    Angiogenesis is a fundamental process in the progression, invasion, and metastasis of tumors. Therapeutic drugs such as bevacizumab and ranibuzumab have thus been developed to inhibit vascular endothelial growth factor (VEFG)-promoted angiogenesis. While these anti-angiogenic drugs have been commonly used in the treatment of cancer, patients often develop significant resistance that limits the efficacy of anti-VEGF therapies to a short period of time. This is in part due to the fact that an independent pathway of angiogenesis exists, which is mediated by 2-(ω-carboxyethyl)pyrrole (CEP) in a TLR2 receptor-dependent manner that can compensate for inhibition of the VEGF-mediated pathway. In this work, we evaluated a CEP antibody as a new tumor growth inhibitor that blocks CEP-induced angiogenesis. We first evaluated the effectiveness of a CEP antibody as a monotherapy to impede tumor growth in two human tumor xenograft models. We then determined the synergistic effects of bevacizumab and CEP antibody in a combination therapy, which demonstrated that blocking of the CEP-mediated pathway significantly enhanced the anti-angiogenic efficacy of bevacizumab in tumor growth inhibition indicating that CEP antibody is a promising chemotherapeutic drug. To facilitate potential translational studies of CEP-antibody, we also conducted longitudinal imaging studies and identified that FMISO-PET is a non-invasive imaging tool that can be used to quantitatively monitor the anti-angiogenic effects of CEP-antibody in the clinical setting. That treatment with CEP antibody induces hypoxia in tumor tissue was indicated by 43% higher uptake of [18F]FMISO in CEP antibody-treated tumor xenografs than in the control PBS-treated littermates.

  19. 7-glutathione pyrrole adduct: a potential DNA reactive metabolite of pyrrolizidine alkaloids.

    Science.gov (United States)

    Xia, Qingsu; Ma, Liang; He, Xiaobo; Cai, Lining; Fu, Peter P

    2015-04-20

    Pyrrolizidine alkaloid (PA)-containing plants are the most common poisonous plants affecting livestock, wildlife, and humans. PAs require metabolic activation to form pyrrolic metabolites to exert cytotoxicity and tumorigenicity. We previously determined that metabolism of tumorigenic PAs produced four DNA adducts, designated as DHP-dG-3, DHP-dG-4, DHP-dA-3, and DHP-dA-4, that are responsible for liver tumor initiation. 7-Glutathione-(±)-6,7-dihydro-1-hydroxymethyl-5H-pyrrolizine (7-GS-DHP), formed in vivo and in vitro, and 7,9-di-GS-DHP, formed in vitro, are both considered detoxified metabolites. However, in this study we determined that incubation of 7-GS-DHP with 2'-deoxyguanosine (dG) and 2'-deoxyadenosine (dA) yields DHP-dG-3, DHP-dG-4, DHP-dA-3, and DHP-dA-4 adducts as well as the reactive metabolite DHP. Furthermore, reaction of 7-GS-DHP with calf thymus DNA in aqueous solution at 37 °C for 4, 8, 16, 24, 48, or 72 h, followed by enzymatic hydrolysis yielded DHP-dG-3, DHP-dG-4, DHP-dA-3, and DHP-dA-4 adducts. Under our current experimental conditions, DHP-dA-3 and DHP-dA-4 adducts were formed in a trace amount from the reaction of 7,9-di-GS-DHP with dA. No DHP-dG-3 or DHP-dG-4 adducts were detected from the reaction of 7,9-di-GS-DHP with dG. This study represents the first report that the 7-GS-DHP adduct can be a potential reactive metabolite of PAs leading to DNA adduct formation.

  20. Mesoionic insecticides: a novel class of insecticides that modulate nicotinic acetylcholine receptors.

    Science.gov (United States)

    Holyoke, Caleb W; Cordova, Daniel; Zhang, Wenming; Barry, James D; Leighty, Robert M; Dietrich, Robert F; Rauh, James J; Pahutski, Thomas F; Lahm, George P; Tong, My-Hanh Thi; Benner, Eric A; Andreassi, John L; Smith, Rejane M; Vincent, Daniel R; Christianson, Laurie A; Teixeira, Luis A; Singh, Vineet; Hughes, Kenneth A

    2017-04-01

    As the world population grows towards 9 billion by 2050, it is projected that food production will need to increase by 60%. A critical part of this growth includes the safe and effective use of insecticides to reduce the estimated 20-49% loss of global crop yields owing to pests. The development of new insecticides will help to sustain this protection and overcome insecticide resistance. A novel class of mesoionic compounds has been discovered, with exceptional insecticidal activity on a range of Hemiptera and Lepidoptera. These compounds bind to the orthosteric site of the nicotinic acetylcholine receptor and result in a highly potent inhibitory action at the receptor with minimal agonism. The synthesis, biological activity, optimization and mode of action will be discussed. Triflumezopyrim insect control will provide a powerful tool for control of hopper species in rice throughout Asia. Dicloromezotiaz can provide a useful control tool for lepidopteran pests, with an underexploited mode of action among these pests. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  1. The insecticide resistance in two planthoppers from three areas to three insecticides

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    @@ Migrating insects brown planthopper (BPH), Nilaparata lugens Stal and white-backed planthopper (WBPH), Sogatellafurcifera Horvath are both most harmful insects on rice in China. Chemical control is thought to be the best way to manage them, but it may cause insecticide resistance.

  2. Insecticide-Treated Nets and Protection against Insecticide-Resistant Malaria Vectors in Western Kenya.

    Science.gov (United States)

    Ochomo, Eric; Chahilu, Mercy; Cook, Jackie; Kinyari, Teresa; Bayoh, Nabie M; West, Philippa; Kamau, Luna; Osangale, Aggrey; Ombok, Maurice; Njagi, Kiambo; Mathenge, Evan; Muthami, Lawrence; Subramaniam, Krishanthi; Knox, Tessa; Mnavaza, Abraham; Donnelly, Martin James; Kleinschmidt, Immo; Mbogo, Charles

    2017-05-01

    Insecticide resistance might reduce the efficacy of malaria vector control. In 2013 and 2014, malaria vectors from 50 villages, of varying pyrethroid resistance, in western Kenya were assayed for resistance to deltamethrin. Long-lasting insecticide-treated nets (LLIN) were distributed to households at universal coverage. Children were recruited into 2 cohorts, cleared of malaria-causing parasites, and tested every 2 weeks for reinfection. Infection incidence rates for the 2 cohorts were 2.2 (95% CI 1.9-2.5) infections/person-year and 2.8 (95% CI 2.5-3.0) infections/person-year. LLIN users had lower infection rates than non-LLIN users in both low-resistance (rate ratio 0.61, 95% CI 0.42-0.88) and high-resistance (rate ratio 0.55, 95% CI 0.35-0.87) villages (p = 0.63). The association between insecticide resistance and infection incidence was not significant (p = 0.99). Although the incidence of infection was high among net users, LLINs provided significant protection (p = 0.01) against infection with malaria parasite regardless of vector insecticide resistance.

  3. Carbamate Insecticides Target Human Melatonin Receptors.

    Science.gov (United States)

    Popovska-Gorevski, Marina; Dubocovich, Margarita L; Rajnarayanan, Rajendram V

    2017-02-20

    Carbaryl (1-naphthyl methylcarbamate) and carbofuran (2,3-dihydro-2,2-dimethyl-7-benzofuranyl methylcarbamate) are among the most toxic insecticides, implicated in a variety of diseases including diabetes and cancer among others. Using an integrated pharmacoinformatics based screening approach, we have identified these insecticides to be structural mimics of the neurohormone melatonin and were able to bind to the putative melatonin binding sites in MT1 and MT2 melatonin receptors in silico. Carbaryl and carbofuran then were tested for competition with 2-[(125)I]-iodomelatonin (300 pM) binding to hMT1 or hMT2 receptors stably expressed in CHO cells. Carbaryl and carbofuran showed higher affinity for competition with 2-[(125)I]-iodomelatonin binding to the hMT2 compared to the hMT1 melatonin receptor (33 and 35-fold difference, respectively) as predicted by the molecular modeling. In the presence of GTP (100 μM), which decouples the G-protein linked receptors to modulate signaling, the apparent efficacy of carbaryl and carbofuran for 2-[(125)I]-iodomelatonin binding for the hMT1 melatonin receptor was not affected but significantly decreased for the hMT2 melatonin receptor compatible with receptor antagonist/inverse agonist and agonist efficacy, respectively. Altogether, our data points to a potentially new mechanism through which carbamate insecticides carbaryl and carbofuran could impact human health by altering the homeostatic balance of key regulatory processes by directly binding to melatonin receptors.

  4. Wash resistance of insecticide-treated materials.

    Science.gov (United States)

    Ordóñez González, José; Kroeger, Axel; Aviña, Ana Isabel; Pabón, Eulides

    2002-01-01

    The effectiveness of insecticide-treated materials (ITMs) for malaria control is reduced by washing them. This research in Colombia and Bolivia investigated the resistance of different insecticide formulations and, in particular, a commercially available impregnated bednet (PermaNet) which provides chemical protection for the insecticide. The fabrics studied were all polyester; the pyrethroids used for impregnation were deltamethrin (tablet and suspension concentrate both at 25 mg/m2 target dose), lambdacyhalothrin (capsule suspension at 15 mg/m2; laboratory study only), alphacypermethrin (suspension concentrate at 40 mg/m2) and, in the case of PermaNet, deltamethrin (55 mg/m2). The indicator of wash resistance was Anopheles spp. mortality (using the bioassay cone method) before and after different numbers and intensities of washing. When the fabrics were washed under controlled conditions, gently with water and a bar of soap, the wash resistance of all formulations was good (100% Anopheles mortality after 3 washes). However, when the impregnated nets were soaked for 30-60 min and washed with soap powder and tap water by local women in the usual way, the mortality after 4 washes declined considerably (43.5% and 41.3% for deltamethrin tablets and liquid respectively when washing every second day). Alphacypermethrin showed slightly better results after 3 washes every 7th day compared to deltamethrin tablets (63.8% and 43.3% mortality, respectively). The wash resistance offered by PermaNet was much better and longer lasting: Anopheles mortality after 4 washes was 92.6%, after 10 washes 83.7% and after 20 washes 87.1%. The limitations of commercially available wash-resistant nets are, however, their limited accessibility and the difficulty of replacing all existing bednets with a new product.

  5. BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY

    Directory of Open Access Journals (Sweden)

    E. V. Matseliukh

    2015-10-01

    Full Text Available The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kherson, Odesa, Mykolaiv and Zaporizhiia regions of Ukraine. Purification of enzymes with elastase activity isolated from above mentioned strains was performed by gel-chromatography and insecticide activity was studied on the 3–4 larvae instar of Colorado beetle. The ability of a number of B. thuringiensis strains to synthesize the proteases with elastase activity has been established. The most active were enzymes obtained from strains IMV B-7465, IMV B-7324 isolated from sea water, and strains 9, 902, Bt-H and 0-239 isolated from Colorado beetles. The study of the physicochemical properties of the partially purified proteases of these strains showed that they belonged to enzymes of the serine type. Peptidases of a number of B. thuringiensis strains (IMV B-7324, IMV B-7465, 902, 0-239, 9 are metal-dependent enzymes. Optimal conditions of action of all tested enzymes are the neutral and alkaline рН values and the temperatures of 30–40 °С. The studies of influence of the complex enzyme preparations and partially purified ones of B. thuringiensis strains on the larvae instar of Colorado beetles indicated that enzymes with elastase activity could be responsible for insecticide action of the tested strains.

  6. Eco-friendly synthesis, spectral and computational study of pyrrole-2-carboxaldehyde salicylhydrazone (PCSH) for its application

    Science.gov (United States)

    Rawat, Poonam; Singh, R. N.

    2015-11-01

    In this paper we present eco-friendly synthesis of Pyrrole-2-carboxaldehyde salicylhydrazone (PCSH) and its molecular structural elucidation, spectral analysis and reactivity evaluation. Pyrrole-2-carboxaldehyde and salicyl hydrazide in water undergo condensation reaction to produce PCSH in good yield (88%). All results of quantum chemical calculation corroborate well with the experimental findings. The PCSH has been characterized by elemental analysis, FT-IR, 1H NMR, UV-Visible, and ESI-Mass spectroscopy. Density functional theory (DFT) calculations have been carried out for PCSH by performing B3LYP functional using the standard basis set 6-31 + g (d, p), and additional basis sets 6D and 10F. Two most stable conformers for PCSH have been observed around the dihedral angle N1C5C6N7. The red shift observed in O-H stretching vibration in the FT-IR spectrum indicates the presence of intramolecular hydrogen bonding. The rotational barrier between syn-syn (closed) syn-syn (open) found to be 2966.9 kcal/mol. The presence of hydroxyl proton at 10.45 ppm downfield in experimental 1H NMR spectrum confirms the existence of intramolecular hydrogen bonding in PCSH. Further, topological parameters analysis at the bond critical points using 'Atoms in molecules' theory reveals intramolecular hydrogen bonding. The energy of homonuclear intramolecular hydrogen bond (O17-H28⋯O10) is calculated to be 14.03 kcal/mol. The ellipticity results confirm the resonance assisted nature of this intramolecular hydrogen bond. In addition to this work, the reactive sites in PCSH have been explored using DFT descriptors, predicting nucleophilic reactions at carbonyl carbon and electrophilic reactions are possible at pyrrolic NH, amidic NH and double bond Cdbnd N leading to several heterocyclic products and metal complexes.

  7. Transition metal doped poly(aniline-co-pyrrole)/multi-walled carbon nanotubes nanocomposite for high performance supercapacitor electrode materials

    Energy Technology Data Exchange (ETDEWEB)

    Dhibar, Saptarshi; Bhattacharya, Pallab; Hatui, Goutam; Das, C.K., E-mail: chapal12@yahoo.co.in

    2015-03-15

    Highlights: • The CuCl{sub 2} doped copolymer (PANI and PPy)/MWCNTs nanocomposite was prepared. • The nanocomposite achieved highest specific capacitance of 383 F/g at a 0.5 A/g. • Nanocomposite exhibits better energy density as well as power density. • The nanocomposite also showed better electrical conductivity at room temperature. • The nanocomposite can be used as promising electrode materials for supercapacitor. - Abstract: In this present communication, copolymer of polyaniline (PANI) and polypyrrole (PPy) that is poly(aniline-co-pyrrole) [poly(An-co-Py)], copper chloride (CuCl{sub 2}) doped poly(aniline-co-pyrrole) [poly(An-co-Py) Cu], and CuCl{sub 2} doped poly(aniline-co-pyrrole)/multi walled carbon nanotubes (MWCNTs) [poly(An-co-Py) Cu CNT] nanocomposite have been prepared by a simple and inexpensive in-situ chemical oxidative polymerization method, using ammonium persulfate (APS) as oxidant and hydrochloric acid (HCl) as dopant and investigated as high performance supercapacitor electrode materials. The possible interaction between CuCl{sub 2} with copolymers and MWCNTs was investigated by Fourier transform infrared spectroscopy (FTIR) and UV–visible spectroscopy analysis. The morphological characteristic of all the electrode materials were analyzed by Field emission scanning electron microscopy (FESEM) and Transmission electron microscopy (TEM) study. The electrochemical characterizations of all the electrode materials were carried out by three electrode probe method where, standard calomel electrode and platinum were used as reference and counter electrodes, respectively. Among all the electrode materials, poly(An-co-Py) Cu CNT nanocomposite achieved highest specific capacitance value of 383 F/g at 0.5 A/g scan rate. The nanocomposite showed better electrical conductivity at room temperature and also attained nonlinear current–voltage characteristic. Based on the superior electrochemical as well as other properties the as prepared

  8. Cytotoxic and Insecticidal Activities of Derivatives of Harmine, a Natural Insecticidal Component Isolated from Peganum harmala

    Directory of Open Access Journals (Sweden)

    Guohua Zhong

    2010-11-01

    Full Text Available In a continuing effort to develop novel β-carbolines endowed with better insecticidal activity, a simple high-yielding method for the synthesis of harmine compounds starting from L-tryptophan has been developed and a series of 1,3-substituted β-carboline derivatives have been synthesized and evaluated for their cytotoxicity against insect cultured Sf9 cell line in vitro and insecticidal activities against 4th instar larvae of mosquitos, Culex pipiens quinquefasciatus and mustard aphid, Lipaphis erysimi. The results demonstrated that 1-phenyl-1,2,3,4-tetrahydro-β-carboline-3-carboxylic acid (compound 2 and methyl 1-phenyl-β-carboline-3-carboxylate (compound 13 represented the best potential compounds, with Sf9 cells inhibition rates of 71.55% and 60.21% after 24 h treatment at concentrations of 50–200 mg/L, respectively. Both compounds 2 and 13 also showed strong insecticidal activity towards 4th instar larvae of mosquitos with LC50 values of 20.82 mg/L and 23.98 mg/L, and their LC90 values were 88.29 mg/L and 295.13 mg/L, respectively. Furthermore, the LC50 values of compounds 2 and 13 against mustard aphids were 53.16 mg/L and 68.05 mg/L, and their LC90 values were 240.10 mg/L and 418.63 mg/L after 48 h treatment. The in vitro cytotoxicity of these compounds was consistent with the insecticidal activity in vivo. The results indicated that the 1- and 3-positions of the β-carboline ring deserve further investigation to develop biorational insecticides based on the natural compound harmine as a lead compound.

  9. Synthesis and antiproliferative activity of 2,5-bis(3'-indolyl)pyrroles, analogues of the marine alkaloid nortopsentin.

    Science.gov (United States)

    Carbone, Anna; Parrino, Barbara; Barraja, Paola; Spanò, Virginia; Cirrincione, Girolamo; Diana, Patrizia; Maier, Armin; Kelter, Gerhard; Fiebig, Heinz-Herbert

    2013-03-01

    2,5-bis(3'-Indolyl)pyrroles, analogues of the marine alkaloid nortopsentin, were conveniently prepared through a three step procedure in good overall yields. Derivatives 1a and 1b exhibited concentration-dependent antitumor activity towards a panel of 42 human tumor cell lines with mean IC50 values of 1.54 μM and 0.67 μM, respectively. Investigating human tumor xenografts in an ex-vivo clonogenic assay revealed selective antitumor activity, whereas sensitive tumor models were scattered among various tumor histotypes.

  10. Synthesis and Antiproliferative Activity of 2,5-bis(3′-Indolyl)pyrroles, Analogues of the Marine Alkaloid Nortopsentin

    Science.gov (United States)

    Carbone, Anna; Parrino, Barbara; Barraja, Paola; Spanò, Virginia; Cirrincione, Girolamo; Diana, Patrizia; Maier, Armin; Kelter, Gerhard; Fiebig, Heinz-Herbert

    2013-01-01

    2,5-bis(3′-Indolyl)pyrroles, analogues of the marine alkaloid nortopsentin, were conveniently prepared through a three step procedure in good overall yields. Derivatives 1a and 1b exhibited concentration-dependent antitumor activity towards a panel of 42 human tumor cell lines with mean IC50 values of 1.54 μM and 0.67 μM, respectively. Investigating human tumor xenografts in an ex-vivo clonogenic assay revealed selective antitumor activity, whereas sensitive tumor models were scattered among various tumor histotypes. PMID:23455514

  11. A Hydrogen Peroxide Sensor Prepared by Electropolymerization of Pyrrole Based on Screen-Printed Carbon Paste Electrodes

    OpenAIRE

    Hui Xu; You Wang; Guang Li

    2007-01-01

    A disposable amperometric biosensor for commercial use to detect hydrogen peroxide has been developed. The sensor is based on screen-printed carbon paste electrodes modified by electropolymerization of pyrrole with horseradish peroxidase (HRP) entrapped. The facture techniques of fabricating the enzyme electrodes are suitable for mass production and quality control. The biosensor shows a linear amperometric response to H2O2 from 0.1 to 2.0 mM, with a sensitivity of 33.24 µA mM-1 cm-2. Differe...

  12. A Hydrogen Peroxide Sensor Prepared by Electropolymerization of Pyrrole Based on Screen-Printed Carbon Paste Electrodes

    Directory of Open Access Journals (Sweden)

    Hui Xu

    2007-03-01

    Full Text Available A disposable amperometric biosensor for commercial use to detect hydrogenperoxide has been developed. The sensor is based on screen-printed carbon paste electrodesmodified by electropolymerization of pyrrole with horseradish peroxidase (HRP entrapped.The facture techniques of fabricating the enzyme electrodes are suitable for mass productionand quality control. The biosensor shows a linear amperometric response to H2O2 from 0.1to 2.0 mM, with a sensitivity of 33.24 μA mM-1 cm-2. Different operational parameters ofelectropolymerization are evaluated and optimized.

  13. Electropolymerization of pyrrole: effects of pH and anions on the conductivity and growth kinetics of polypyrrole

    Energy Technology Data Exchange (ETDEWEB)

    Kupila, E.L. (Dept. of Chemistry, Univ. of Turku (Finland)); Kankare, J. (Dept. of Chemistry, Univ. of Turku (Finland))

    1993-03-22

    Polypyrrole is one of the most studied conducting polymers. In situ AC conductimetry during electropolymerization is a method which allows the specific conductivity to be estimated for the polymer in statu nascendi. We have applied this method to the electropolymerization of pyrrole in aqueous solutions at various conditions. Polymers synthesized at lower pH range are of better quality than those synthesized at higher pH values. The use of small anions in the supporting electrolyte results in a layer of low conductivity at pH 7. The use of long-chain organic anions like sodium dodecylsulfate gives a high quality polymer even in neutral unbuffered solutions. (orig.)

  14. Design, Synthesis and Insecticidal Activities of Novel Phenyl Substituted Isoxazolecarboxamides

    Institute of Scientific and Technical Information of China (English)

    LIU Peng-fei; ZHANG Ji-feng; YAN Tao; XIONG Li-xia; LI Zheng-ming

    2012-01-01

    Thirteen novel phenyl substituted isoxazolecarboxamides were synthesized,and their structures were characterized by 1H NMR,elementary analysis and high-resolution mass spectrometry(HRMS) techniques.Their evaluated insecticidal activities against oriental armyworm(Mythimna separata) indicate that the phcnyl substituted isoxazolecarboxamides exhibited moderate insecticidal activities,among which compounds 9c and 9k showed comparatively higher activities.

  15. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  16. Interactions of transgenic Bacillus thuringiensis insecticidal crops with spiders (Araneae)

    Science.gov (United States)

    Genetically modified crops expressing insecticidal proteins from Bacillus thuringiensis (Bt) have dramatically increased in acreage since their introduction in the mid-1990’s. Although the insecticidal mechanisms of Bt target specific pests, concerns persist regarding direct and indirect effects on...

  17. Selective Toxicities of 12 Insecticides to Plutella Xylostella and Diadegma Semiclausum%12种杀虫剂对小菜蛾及半闭弯尾姬蜂的选择毒力

    Institute of Scientific and Technical Information of China (English)

    洪珊珊; 贾变桃; 张雨超; 曹永伟

    2015-01-01

    The toxicity of 12 insecticides to Plutella xylostella and its parasitoidDiadegma semiclausum was determined with leaf‐dip method and vial residual film method ,respectively ,and the selective toxicity between P. xylostella andD.semiclausum was compared. The results showed that the order of toxicity of 12 insecticides to the larvae of dia‐mondback moth was emamectin benzoate > sophocarpidine > pinetoram > abamectin > spinosad > chlorantraniliprole >lufenuron > ndoxacarb > chlorfenapyr > diafenthiuron > chlorpyrifos > beta‐cypermethrin ;the order of toxicity of 12 in‐secticides to the adults of D.semiclausum was beta‐cypermethrin > emamectin benzoate > sophocarpidine > spinetoram >chlorpyrifos > abamectin > spinosad > chlorfenapyr > indoxacarb > chlorantraniliprole > diafenthiuron > lufenu‐ron. Lufenuron showed highest positive selectivity to D.semiclausum and P. xylostella with the selective toxicity ratio (STR) > 1 141.6 ,chlorantraniliprole showed higher positive selectivity with STR 169.2. The four insecticides (sopho‐carpidine ,abamectin ,emamectin benzoate ,spinetoram ) showed moderately positive selectivity ,and their STR was 19.8 ~ 57.0.Diafenthiuron ,oxacarb ,spinosad and chlorfenapyr showed low positive selectivity ,and their STR was 1.9 ~ 6.6.Chlorpyrifos and beta‐cypermethrin showed negative selective toxicity to D.semiclausum and P. xylostella , their STR were lowest with 9.0 × 10 - 3 and 0.9 × 10 - 3 ,respectively. The data presented in this paper provided guideline for reasonable use of insecticides and coordinating chemical and biological control of P. xylostella.%采用浸叶法和试管药膜法分别测定了12种杀虫剂对小菜蛾3龄幼虫及其天敌半闭弯尾姬蜂的毒力,比较不同药剂在害虫和天敌之间的选择毒力。结果表明,杀虫剂对小菜蛾幼虫毒力大小顺序为甲维盐>苦参碱>乙基多杀菌素>阿维菌素>氯虫苯甲酰胺>多杀菌素>虱螨脲>茚虫威>溴

  18. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  19. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides.

  20. Averting a malaria disaster: will insecticide resistance derail malaria control?

    Science.gov (United States)

    Hemingway, Janet; Ranson, Hilary; Magill, Alan; Kolaczinski, Jan; Fornadel, Christen; Gimnig, John; Coetzee, Maureen; Simard, Frederic; Roch, Dabiré K; Hinzoumbe, Clément Kerah; Pickett, John; Schellenberg, David; Gething, Peter; Hoppé, Mark; Hamon, Nicholas

    2016-04-23

    World Malaria Day 2015 highlighted the progress made in the development of new methods of prevention (vaccines and insecticides) and treatment (single dose drugs) of the disease. However, increasing drug and insecticide resistance threatens the successes made with existing methods. Insecticide resistance has decreased the efficacy of the most commonly used insecticide class of pyrethroids. This decreased efficacy has increased mosquito survival, which is a prelude to rising incidence of malaria and fatalities. Despite intensive research efforts, new insecticides will not reach the market for at least 5 years. Elimination of malaria is not possible without effective mosquito control. Therefore, to combat the threat of resistance, key stakeholders need to rapidly embrace a multifaceted approach including a reduction in the cost of bringing new resistance management methods to market and the streamlining of associated development, policy, and implementation pathways to counter this looming public health catastrophe.

  1. Theoretical Study on Structure and Electronic Properties of 2, 5-Bis [4-N, N-Diethylaminostyryl] Thiophene and Its Furan and Pyrrole Derivatives Using Density Functional Theory (Dft

    Directory of Open Access Journals (Sweden)

    *B. Semire

    2012-12-01

    Full Text Available Theoretical calculations using Density Functional Theory (DFT were performed on 2,5-bis[4-N,N-diethylaminostyryl]thiophene and its furan and pyrrole derivatives The energy band gaps calculated at B3LYP/6-31G(d level for thiophene derivatives are lower than that of furan and pyrrole analogues. The absorption λmax calculated using DFT was shifted to longer wavelength by replacement of R = CH3 by C2H5 for all studied molecules. The geometries and electronic properties of the compounds were also studied.

  2. 2-(5-Bromo-1H-indol-3-yl-4-(4-bromophenyl-5-(4-chlorobenzoyl-1H-pyrrole-3-carbonitrile dimethyl sulfoxide monosolvate

    Directory of Open Access Journals (Sweden)

    Y. AaminaNaaz

    2016-07-01

    Full Text Available In the title solvated compound, C26H14Br2ClN3O·C2H6OS, the indole ring is inclined to the central pyrrole ring by 25.7 (2°. The chlorobenzene ring and the bromobenzene rings subtend dihedral angles of 56.5 (2 and 53.4 (2°, respectively, with the central pyrrole ring. In the crystal, molecules are bridged by N—H...O hydrogen bonds, involving the dimethyl sulfoxide solvent molecule, forming chains along [010]. There are no other significant intermolecular interactions present.

  3. Fipronil insecticide toxicology: oxidative stress and metabolism.

    Science.gov (United States)

    Wang, Xu; Martínez, María Aránzazu; Wu, Qinghua; Ares, Irma; Martínez-Larrañaga, María Rosa; Anadón, Arturo; Yuan, Zonghui

    2016-11-01

    Fipronil (FIP) is widely used across the world as a broad-spectrum phenylpyrazole insecticide and veterinary drug. FIP was the insecticide to act by targeting the γ-aminobutyric acid (GABA) receptor and has favorable selective toxicity towards insects rather than mammals. However, because of accidental exposure, incorrect use of FIP or widespread FIP use leading to the contamination of water and soil, there is increasing evidence that FIP could cause a variety of toxic effects on animals and humans, such as neurotoxic, hepatotoxic, nephrotoxic, reproductive, and cytotoxic effects on vertebrate and invertebrates. In the last decade, oxidative stress has been suggested to be involved in the various toxicities induced by FIP. To date, few reviews have addressed the toxicity of FIP in relation to oxidative stress. The focus of this article is primarily intended to summarize the progress in research associated with oxidative stress as a possible mechanism for FIP-induced toxicity as well as metabolism. The present review reports that studies have been conducted to reveal the generation of reactive oxygen species (ROS) and oxidative stress as a result of FIP treatment and have correlated them with various types of toxicity. Furthermore, the metabolism of FIP was also reviewed, and during this process, various CYP450 enzymes were involved and oxidative stress might occur. The roles of various compounds in protecting against FIP-induced toxicity based on their anti-oxidative effects were also summarized to further understand the role of oxidative stress in FIP-induced toxicity.

  4. Risks of neonicotinoid insecticides to honeybees.

    Science.gov (United States)

    Fairbrother, Anne; Purdy, John; Anderson, Troy; Fell, Richard

    2014-04-01

    The European honeybee, Apis mellifera, is an important pollinator of agricultural crops. Since 2006, when unexpectedly high colony losses were first reported, articles have proliferated in the popular press suggesting a range of possible causes and raising alarm over the general decline of bees. Suggested causes include pesticides, genetically modified crops, habitat fragmentation, and introduced diseases and parasites. Scientists have concluded that multiple factors in various combinations-including mites, fungi, viruses, and pesticides, as well as other factors such as reduction in forage, poor nutrition, and queen failure-are the most probable cause of elevated colony loss rates. Investigators and regulators continue to focus on the possible role that insecticides, particularly the neonicotinoids, may play in honeybee health. Neonicotinoid insecticides are insect neurotoxicants with desirable features such as broad-spectrum activity, low application rates, low mammalian toxicity, upward systemic movement in plants, and versatile application methods. Their distribution throughout the plant, including pollen, nectar, and guttation fluids, poses particular concern for exposure to pollinators. The authors describe how neonicotinoids interact with the nervous system of honeybees and affect individual honeybees in laboratory situations. Because honeybees are social insects, colony effects in semifield and field studies are discussed. The authors conclude with a review of current and proposed guidance in the United States and Europe for assessing the risks of pesticides to honeybees.

  5. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  6. Rhodium and iridium complexes of N-(2'-hydroxyphenyl)pyrrole-2-aldimine: Synthesis, structure, and spectral and electrochemical properties

    Indian Academy of Sciences (India)

    Semanti Basu; Indrani Pal; Ray J Butcher; Georgina Rosair; Samaresh Bhattacharya

    2005-03-01

    Reaction of N-(2'-hydroxyphenyl)pyrrole-2-aldimine (H2L) with [M(PPh3)3Cl] (M = Rh, Ir) affords complexes of type [M(PPh3)2(L)Cl]. Structures of both complexes have been determined by X-ray crystallography. In both complexes, the N-(2'-hydroxyphenyl)pyrrole-2-aldimine ligand is coordinated to the metal centre, via dissociation of the acidic protons, as a dianionic tridentate N,N,O-donor. The M(L)Cl fragment constitutes an equatorial plane with the metal at the centre and the two PPh3 ligands occupying axial positions. The complexes are diamagnetic (low-spin 6, = 0) and show intense MLCT transitions in the visible region. Cyclic voltammetry of the [M(PPh3)2(L)Cl] complexes shows reversible M(III)-M(IV) oxidation near 0.5 V vs SCE and quasi-reversible ligand-centred oxidative response near 1.0 V vs SCE.

  7. Photodissociation of pyrrole-ammonia clusters by velocity map imaging: mechanism for the H-atom transfer reaction.

    Science.gov (United States)

    Rubio-Lago, L; Amaral, G A; Oldani, A N; Rodríguez, J D; González, M G; Pino, G A; Bañares, L

    2011-01-21

    The photodissociation dynamics of pyrrole-ammonia clusters (PyH·(NH(3))(n), n = 2-6) has been studied using a combination of velocity map imaging and non-resonant detection of the NH(4)(NH(3))(n-1) products. The excited state hydrogen-atom transfer mechanism (ESHT) is evidenced through delayed ionization and presents a threshold around 236.6 nm, in agreement with previous reports. A high resolution determination of the kinetic energy distributions (KEDs) of the products reveals slow (∼0.15 eV) and structured distributions for all the ammonia cluster masses studied. The low values of the measured kinetic energy rule out the existence of a long-lived intermediate state, as it has been proposed previously. Instead, a direct N-H bond rupture, in the fashion of the photodissociation of bare pyrrole, is proposed. This assumption is supported by a careful analysis of the structure of the measured KEDs in terms of a discrete vibrational activity of the pyrrolyl co-fragment.

  8. A role of nanotube dangling pyrrole and oxygen functions in the electrochemical synthesis of polypyrrole/MWCNTs hybrid materials

    Energy Technology Data Exchange (ETDEWEB)

    Krukiewicz, Katarzyna, E-mail: katarzyna.krukiewicz@polsl.pl [Department of Physical Chemistry and Technology of Polymers, Silesian University of Technology, Strzody 9, 44-100 Gliwice (Poland); Herman, Artur P., E-mail: artur.herman@polsl.pl [Department of Organic Chemistry, Bioorganic Chemistry and Biotechnology, Silesian University of Technology, Krzywoustego 4, Gliwice 44-100 (Poland); Turczyn, Roman, E-mail: roman.turczyn@polsl.pl [Department of Physical Chemistry and Technology of Polymers, Silesian University of Technology, Strzody 9, 44-100 Gliwice (Poland); Szymańska, Katarzyna, E-mail: katarzyna.szymanska@polsl.pl [Department of Chemical and Process Engineering, Silesian University of Technology, Strzody 7, 44-100 Gliwice (Poland); Koziol, Krzysztof K.K., E-mail: kk292@cam.ac.uk [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Boncel, Sławomir, E-mail: slawomir.boncel@polsl.pl [Department of Organic Chemistry, Bioorganic Chemistry and Biotechnology, Silesian University of Technology, Krzywoustego 4, Gliwice 44-100 (Poland); Zak, Jerzy K., E-mail: jerzy.zak@polsl.pl [Department of Physical Chemistry and Technology of Polymers, Silesian University of Technology, Strzody 9, 44-100 Gliwice (Poland)

    2014-10-30

    Highlights: • The effect of MWCNT functionalization on properties of PPy composites was explained. • The behavior of pristine, pyrrole-modified and oxidized MWCNT was explained. • Functionalization of MWCNT improved their dispersibility and processability. • Different mechanisms of (f-)MWCNT incorporation into PPy composites were explained. • Orientation of growing PPy chains was tailored through the addition of (f-)MWCNT. - Abstract: The effect of the functionalization of multi-walled carbon nanotubes (MWCNTs) on the process of electrochemical co-deposition of MWCNTs and polypyrrole (PPy), as well as the morphology of obtained composites have been demonstrated. As the nanotube components of the hybrids, three types of MWCNT were used, namely c-CVD derived (pristine) MWCNTs, their oxidized counterparts MWCNT-Ox and pyrrole-modified MWCNT-Py. The stability of pristine and functionalized MWCNTs (f-MWCNT) dispersions in tetrahydrofuran and water was studied together with the description of the process of formation PPy/(f-)MWCNT hybrid materials via electrochemical co-deposition. The structural and morphological properties of the hybrids were characterized by Raman spectroscopy, scanning electron microscopy and atomic force microscopy revealing substantial differences among hybrid materials in their surface morphology and the influence of MWCNT functionalization on the orientation of growing PPy chains.

  9. Insecticides induced biochemical changes in freshwater microalga Chlamydomonas mexicana.

    Science.gov (United States)

    Kumar, Muthukannan Satheesh; Kabra, Akhil N; Min, Booki; El-Dalatony, Marwa M; Xiong, Jiuqiang; Thajuddin, Nooruddin; Lee, Dae Sung; Jeon, Byong-Hun

    2016-01-01

    The effect of insecticides (acephate and imidacloprid) on a freshwater microalga Chlamydomonas mexicana was investigated with respect to photosynthetic pigments, carbohydrate and protein contents, fatty acids composition and induction of stress indicators including proline, superoxide dismutase (SOD) and catalase (CAT). C. mexicana was cultivated with 1, 5, 10, 15, 20 and 25 mg L(-1) of acephate and imidacloprid. The microalga growth increased with increasing concentrations of both insecticides up to 15 mg L(-1), beyond which the growth declined compared to control condition (without insecticides). C. mexicana cultivated with 15 mg L(-1) of both insecticides for 12 days was used for further analysis. The accumulation of photosynthetic pigments (chlorophyll and carotenoids), carbohydrates and protein was decreased in the presence of both insecticides. Acephate and imidacloprid induced the activities of superoxide dismutase (SOD) and catalase (CAT) and increased the concentration of proline in the microalga, which play a defensive role against various environmental stresses. Fatty acid analysis revealed that the fraction of polyunsaturated fatty acids decreased on exposure to both insecticides. C. mexicana also promoted 25 and 21% removal of acephate and imidacloprid, respectively. The biochemical changes in C. mexicana on exposure to acephate and imidacloprid indicate that the microalga undergoes an adaptive change in response to the insecticide-induced oxidative stress.

  10. Virus and calcium: an unexpected tandem to optimize insecticide efficacy.

    Science.gov (United States)

    Apaire-Marchais, Véronique; Ogliastro, Mylène; Chandre, Fabrice; Pennetier, Cédric; Raymond, Valérie; Lapied, Bruno

    2016-04-01

    The effective control of insect pests is based on the rational use of the most efficient and safe insecticide treatments. To increase the effects of classical insecticides and to avoid the ability of certain pest insects to develop resistance, it is essential to propose novel strategies. Previous studies have shown that calcium-dependent phosphorylation/dephosphorylation is now considered as a new cellular mechanism for increasing the target sensitivity to insecticides. Because it is known that virus entry is correlated with intracellular calcium concentration rise, this report attempts to present the most important data relevant to the feasibility of combining an insect virus such as baculovirus or densovirus with an insecticide. In this case, the insect virus is not used as a bioinsecticide but acts as a synergistic agent able to trigger calcium rise and to activate calcium-dependent intracellular signalling pathways involved in the increase of the membrane receptors and/or ion channels sensitivity to insecticides. This virus-insecticide mixture represents a promising alternative to optimize the efficacy of insecticides against insect pests while reducing the doses. © 2016 Society for Applied Microbiology and John Wiley & Sons Ltd.

  11. Energetic cost of insecticide resistance in Culex pipiens mosquitoes.

    Science.gov (United States)

    Rivero, A; Magaud, A; Nicot, A; Vézilier, J

    2011-05-01

    The extensive use of insecticides to control vector populations has lead to the widespread development of different mechanisms of insecticide resistance. Mutations that confer insecticide resistance are often associated to fitness costs that prevent them from spreading to fixation. In vectors, such fitness costs include reductions in preimaginal survival, adult size, longevity, and fecundity. The most commonly invoked explanation for the nature of such pleiotropic effects of insecticide resistance is the existence of resource-based trade-offs. According to this hypothesis, insecticide resistance would deplete the energetic stores of vectors, reducing the energy available for other biological functions and generating trade-offs between insecticide resistance and key life history traits. Here we test this hypothesis by quantifying the energetic resources (lipids, glycogen, and glucose) of larvae and adult females of the mosquito Culex pipiens L. resistant to insecticides through two different mechanisms: esterase overproduction and acetylcholinesterase modification. We find that, as expected from trade-off theory, insecticide resistant mosquitoes through the overproduction of esterases contain on average 30% less energetic reserves than their susceptible counterparts. Acetylcholinesterase-modified mosquitoes, however, also showed a significant reduction in energetic resources (20% less). We suggest that, in acetylcholinesterase-modified mosquitoes, resource depletion may not be the result of resource-based trade-offs but a consequence of the hyperactivation of the nervous system. We argue that these results not only provide a mechanistic explanation for the negative pleiotropic effects of insecticide resistance on mosquito life history traits but also can have a direct effect on the development of parasites that depend on the vector's energetic reserves to fulfil their own metabolic needs.

  12. Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.

    Science.gov (United States)

    Hua, Jessica; Jones, Devin K; Relyea, Rick A

    2014-04-01

    As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.

  13. The insecticide resistance in stripped stem borer, Chilo suppressalis (Walker)

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ The stripped stem borer (SSB), Chilo suppressalis (Walker) is one of the major insect pests of rice in China. Chemical control has been a common practice in SSB management since 1950s. Insecticides used included BHC before 1983;organophosphorus insecticides (methyl-parathion, trichophon, methamidophos, and monocrotophos), and chlordimeform in mid-1970s-1980s; Shachongshuang (dimehypo) and Shachongdan (monousltap) since early 1980s. In recent years, SSB population and its damage to rice increased rapidly and failures on control has been reported. To find out the cause of failure and to put forward the suitable control methods, we studied the resistance of SSB to major insecticides used in China.

  14. Synthetic and structure-activity relationship of insecticidal bufadienolides.

    Science.gov (United States)

    Hidayat, Ace Tatang; Zainuddin, Achmad; Dono, Danar; Hermawan, Wawan; Hayashi, Hideo; Supratman, Unang

    2014-07-01

    A new synthetic analog of bufadienolide, methyl isobryophyllinate A (1), and a known synthetic analog, methyl isobersaldegenate-1,3,5-orthoacetate (2), were obtained by methanolysis of bryophyllin A (3) and bersaldegenin-1,3,5-orthoacetate (5) in basic solution. Structure-insecticidal activity relationship studies revealed both orthoacetate and alpha-pyrone moieties seemed to be essential structural elements for exhibiting insecticidal activity, whereas oxygenated substituents in the C ring enhanced the insecticidal activity against the third instar larvae of silkworm (Bombyx mori).

  15. Insecticidal Activity of Cyanohydrin and Monoterpenoid Compounds

    Directory of Open Access Journals (Sweden)

    Joel R. Coats

    2000-04-01

    Full Text Available The insecticidal activities of several cyanohydrins, cyanohydrin esters and monoterpenoid esters (including three monoterpenoid esters of a cyanohydrin were evaluated. Topical toxicity to Musca domestica L. adults was examined, and testing of many compounds at 100 mg/fly resulted in 100% mortality. Topical LD50 values of four compounds for M. domestica were calculated. Testing of many of the reported compounds to brine shrimp (Artemia franciscana Kellog resulted in 100% mortality at 10 ppm, and two compounds caused 100% mortality at 1 ppm. Aquatic LC50 values were calculated for five compounds for larvae of the yellow fever mosquito (Aedes aegypti (L.. Monoterpenoid esters were among the most toxic compounds tested in topical and aquatic bioassays.

  16. Insecticidal defenses of Piperaceae from the neotropics.

    Science.gov (United States)

    Bernard, C B; Krishanmurty, H G; Chauret, D; Durst, T; Philogène, B J; Sánchez-Vindas, P; Hasbun, C; Poveda, L; San Román, L; Arnason, J T

    1995-06-01

    Insecticidal and growth-reducing properties of extracts of 14 species of American neotropical Piperaceae were investigated by inclusion in diets of a polyphagous lepidopteran, the European corn borer,Ostrinia nubilalis. Nutritional indices suggested most extracts acted by postdigestive toxicity.Piper aduncum, P. tuberculatum, andP. decurrens were among the most active species and were subjected to bioassay-guided isolation of the active components. Dillapiol was isolated from the active fraction ofP. aduncum, piperlonguminine was isolated fromP. tuberculatum, and a novel neolignan fromP. decurrens. The results support other studies on Asian and AfricanPiper species, which suggest that lignans and isobutyl amides are the active defence compounds in this family.

  17. Toxicological Properties of the Organophosphorus Insecticide Dimethoate

    Science.gov (United States)

    Sanderson, D. M.; Edson, E. F.

    1964-01-01

    The results are presented of extensive toxicological studies on the systemic organophosphate insecticide dimethoate, and compared with published results from other laboratories. It behaves as a typical indirect anticholinesterase, by conversion in the liver to at least four short-lived active metabolites, whose hydrolysis products are rapidly excreted, mainly in the urine. The acute oral toxicity of dimethoate is low in mammals but higher in avians. Dermal absorption is notably slow and dermal toxicity correspondingly low. Cumulative dosing of rats and guinea-pigs gave no cholinesterase inhibition at 0·7 and 4 mg./kg./day respectively. Dietary feeding to growing rats caused no cholinesterase inhibition at 0·5 mg./kg./day and no other effect at 10 times this dose. The main plant metabolite is identical with one formed in the liver, and comparative feeding tests with normal dimethoate and that partly metabolized in vegetation showed that residue analysis determined total hazard. Tests on humans, some with 32P-labelled material, confirmed that metabolism and urinary excretion are very rapid, that skin absorption is very slow, and that at least 2·5 mg., and probably up to 18 mg., could be ingested daily for at least three weeks without cholinesterase inhibition or other effects. Vapour hazards proved negligible. Oral toxicity was not potentiated by any of 17 other insecticides. The earliest detectable effect of dimethoate poisoning was always erythrocyte cholinesterase inhibition. Symptoms of poisoning could be effectively treated by atropine but not by oxime therapy. No known cases of occupational poisoning have occurred during five years' commercial usage of dimethoate. PMID:14106136

  18. Flow synthesis using gaseous ammonia in a Teflon AF-2400 tube-in-tube reactor: Paal-Knorr pyrrole formation and gas concentration measurement by inline flow titration.

    Science.gov (United States)

    Cranwell, Philippa B; O'Brien, Matthew; Browne, Duncan L; Koos, Peter; Polyzos, Anastasios; Peña-López, Miguel; Ley, Steven V

    2012-08-14

    Using a simple and accessible Teflon AF-2400 based tube-in-tube reactor, a series of pyrroles were synthesised in flow using the Paal-Knorr reaction of 1,4-diketones with gaseous ammonia. An inline flow titration technique allowed measurement of the ammonia concentration and its relationship to residence time and temperature.

  19. The Synthesis of Novel 3-Substituted Poly(pyrroles) Bearing Crown-ether Moieties and a Study of their Electrochemical Properties

    DEFF Research Database (Denmark)

    Guernion, Nicolas J.L.; Blencowe, A.; Hayes, Wayne;

    2006-01-01

    A series of fourteen novel pyrrole monomers substituted at the 3-position with aliphatic and aromatic crown-ether moieties have been synthesised in good yield and characterised extensively. Several of those compounds were electropolymerised successfully in acetonitrile, using both potentiostatic ...

  20. Thieno[3,4-c]pyrrole-4,6-dione-3,4-difluorothiophene Polymer Acceptors for Efficient All-Polymer Bulk Heterojunction Solar Cells

    KAUST Repository

    Liu, Shengjian

    2016-09-16

    Branched-alkyl-substituted poly(thieno[3,4-c]pyrrole-4,6-dione-alt-3,4-difluorothiophene) (PTPD[2F]T) can be used as a polymer acceptor in bulk heterojunction (BHJ) solar cells with a low-band-gap polymer donor (PCE10) commonly used with fullerenes. The

  1. Reconciling Experiment and Theory in the Use of Aryl-Extended Calix[4]pyrrole Receptors for the Experimental Quantification of Chloride–π Interactions in Solution

    Directory of Open Access Journals (Sweden)

    Antonio Bauzá

    2015-04-01

    Full Text Available In this manuscript we consider from a theoretical point of view the recently reported experimental quantification of anion–π interactions (the attractive force between electron deficient aromatic rings and anions in solution using aryl extended calix[4]pyrrole receptors as model systems. Experimentally, two series of calix[4]pyrrole receptors functionalized, respectively, with two and four aryl rings at the meso positions, were used to assess the strength of chloride–π interactions in acetonitrile solution. As a result of these studies the contribution of each individual chloride–π interaction was quantified to be very small (<1 kcal/mol. This result is in contrast with the values derived from most theoretical calculations. Herein we report a theoretical study using high-level density functional theory (DFT calculations that provides a plausible explanation for the observed disagreement between theory and experiment. The study reveals the existence of molecular interactions between solvent molecules and the aromatic walls of the receptors that strongly modulate the chloride–π interaction. In addition, the obtained theoretical results also suggest that the chloride-calix[4]pyrrole complex used as reference to dissect experimentally the contribution of the chloride–π interactions to the total binding energy for both the two and four-wall aryl-extended calix[4]pyrrole model systems is probably not ideal.

  2. Determination of Plutella xylostella(L.)Resistance to Nine Insecticides in Central China%华中地区小菜蛾对9种杀虫剂的抗药性测定

    Institute of Scientific and Technical Information of China (English)

    夏耀民; 鲁艳辉; 朱勋; 申君; 游红; 李建洪

    2013-01-01

    采用室内浸叶法,测定了华中地区5个蔬菜产区(河南洛阳白马寺镇、湖南岳阳广兴洲镇、湖北武穴梅川镇、湖北宜昌当阳市、湖北云梦隔蒲镇)田间小菜蛾种群对2%阿维菌素乳油(EC)、16000 IU·mg-1 Bt工程菌WG-001可湿性粉剂(WP)、20%高效氯氰菊酯EC、5%氯虫苯甲酰胺EC、2.5%多杀菌素悬浮剂(SC)、10%溴虫腈EC、5%氟啶脲EC、20%丁醚脲EC、5%茚虫威EC等9种常用杀虫剂的抗药性。结果表明:5个小菜蛾种群对阿维菌素(抗药性倍数为44.5~92.0倍)、Bt(抗药性倍数为66.5~202.1倍)、高效氯氰菊酯(抗药性倍数为76.2~146.4倍)已产生了高水平至极高水平抗性,对氟啶脲(抗药性倍数为32.5~82.5倍)的抗药性达到中等至高水平抗性,对多杀菌素(抗药性倍数为6.5~19.4倍)、氯虫苯甲酰胺(抗药性倍数为3.1~23.1倍)、溴虫腈(抗药性倍数为2.6~22.3倍)和茚虫威(抗药性倍数为7.1~26.3倍)表现为中等及以下水平抗性,对丁醚脲(抗药性倍数为2.3~7.7倍)表现为敏感至低水平抗性。因此,华中地区的小菜蛾防治应注重氯虫苯甲酰胺、溴虫腈、丁醚脲与多杀菌素、茚虫威、氟啶脲交替、轮换使用,以便延缓抗药性的产生与发展,取得更好的防效。%Five field populations of diamondback moth,Plutella xylostella,including Luoyang in Henan Province,Yueyang in Hunan Province,and Wuxue,Yunmeng and Yichang in Hubei Province, were collected from the central China.P. xylostella populations had resistance to 9 insecticides as 2%abamectin EC,16 000 IU·mg-1 Bt WG-001 WP,20%beta-cypermethrin EC,5%chlorantraniliprole EC,2.5% spinosad SC,10% chlorfenapyr EC,5% chlorfluazuron EC,20% diafenthiuron EC,5%indoxacarb EC.The bioassay results indicated that 5 populations exhibited high to extreme high level of resistance to abamectin,Bt,beta-cypermethrin,with the resistance ratio 44

  3. PRN 73-4: Residual Insecticides in Food Handling Establishments

    Science.gov (United States)

    This notice provides a copy of a Federal Register notice published July 6, 1973, regarding certain insecticides used in food-handling establishments. It establishes certain definitions and requirements related to approval for crack and crevice treatment.

  4. Expression of melanin and insecticidal protein from Rhodotorula ...

    African Journals Online (AJOL)

    SERVER

    2006-02-16

    Feb 16, 2006 ... Key words: Rhodotorula glutinis, Escherichia coli, Melanin, Insecticidal Protein. INTRODUCTION ... proteinaceous crystals toxic to different insect larvae (Bulla ..... Gulex univitattus, Aedes aegypti and Culex pipens. Mosq.

  5. Insect P450 inhibitors and insecticides: challenges and opportunities.

    Science.gov (United States)

    Feyereisen, René

    2015-06-01

    P450 enzymes are encoded by a large number of genes in insects, often over a hundred. They play important roles in insecticide metabolism and resistance, and growing numbers of P450 enzymes are now known to catalyse important physiological reactions, such as hormone metabolism or cuticular hydrocarbon synthesis. Ways to inhibit P450 enzymes specifically or less specifically are well understood, as P450 inhibitors are found as drugs, as fungicides, as plant growth regulators and as insecticide synergists. Yet there are no P450 inhibitors as insecticides on the market. As new modes of action are constantly needed to support insecticide resistance management, P450 inhibitors should be considered because of their high potential for insect selectivity, their well-known mechanisms of action and the increasing ease of rational design and testing.

  6. Federal Insecticide, Fungicide, and Rodenticide Act Section 18 Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — Section 18 of Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) authorizes EPA to allow an unregistered use of a pesticide for a limited time if EPA...

  7. Effectiveness and profitability of insecticide formulations used for ...

    African Journals Online (AJOL)

    ACSS

    Chemicals and rates used on snap beans in Mwea, Kenya. Trade name ... Source: Product labels ..... 1,400.6. *The cost of sprays includes cost of purchasing insecticide and labour for spraying ... chemistries and other consumer preferred.

  8. High insecticidal activity of Leclercia adecarboxylata isolated from ...

    African Journals Online (AJOL)

    PRECIOUS

    2009-12-15

    Dec 15, 2009 ... bacterial flora of CPB, and tested them for insecticidal effects on it. The highest ... Genetically engineered resistant varieties containing toxin genes from ... certain proteins for interfering with the evolution of taxa through billions ...

  9. Fungal infection counters insecticide resistance in African malaria mosquitoes

    NARCIS (Netherlands)

    Farenhorst, M.; Mouatcho, J.C.; Kikankie, C.K.; Brooke, B.D.; Hunt, R.H.; Thomas, M.B.; Koekemoer, L.L.; Knols, B.G.J.; Coetzee, M.

    2009-01-01

    The evolution of insecticide resistance in mosquitoes is threatening the effectiveness and sustainability of malaria control programs in various parts of the world. Through their unique mode of action, entomopathogenic fungi provide promising alternatives to chemical control. However, potential

  10. Bio-evaluation of South African plants for insecticidal properties

    CSIR Research Space (South Africa)

    Maharaj, R

    2006-02-01

    Full Text Available Malaria is a serious health problem in South Africa affecting the lives of approximately 4 million people. Resistance to the principal vector, Anopheles arabiensis, has initiated a search for new plant-derived insecticides. Plants were selected...

  11. Fungal infection counters insecticide resistance in African malaria mosquitoes

    NARCIS (Netherlands)

    Farenhorst, M.; Mouatcho, J.C.; Kikankie, C.K.; Brooke, B.D.; Hunt, R.H.; Thomas, M.B.; Koekemoer, L.L.; Knols, B.G.J.; Coetzee, M.

    2009-01-01

    The evolution of insecticide resistance in mosquitoes is threatening the effectiveness and sustainability of malaria control programs in various parts of the world. Through their unique mode of action, entomopathogenic fungi provide promising alternatives to chemical control. However, potential inte

  12. Effect of insecticide application on pests of late maturing pigeonpea ...

    African Journals Online (AJOL)

    Effect of insecticide application on pests of late maturing pigeonpea cultivar ... University of Nigeria, Nsukka agro-ecological zone in 2000/2001 cropping season. ... control of pigoenpea pests under the integrated management concept.

  13. Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives

    Directory of Open Access Journals (Sweden)

    Jialong Sun

    2015-03-01

    Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  14. Design, synthesis and insecticidal activity of novel phenylurea derivatives.

    Science.gov (United States)

    Sun, Jialong; Zhou, Yuanming

    2015-03-19

    A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  15. Sensitivity to several types of insecticides in field populations of Spodoptera litura in Zhejiang Province%浙江菜区斜纹夜蛾对几类杀虫剂的敏感性

    Institute of Scientific and Technical Information of China (English)

    章金明; 张蓬军; 黄芳; 宋亮; 刘敏; 吕要斌; 林小勇; 叶鑫业

    2014-01-01

    To characterize the developmental trend of resistance to insecticides of oriental leafworm moth ( OLM ) , Spodoptera litura, in Zhejiang province , the sensitivities to 11 insecticides of OLMs collected from Sanmen and Xi-aoshan were studied and compared .Significant differences were shown between the data of OLMs from the two cities , i.e.the acquired sensitivities to 11 insecticides of OLMs from Sanmen were higher than those of OLMs from Xiaos-han.Refering to the survival rate of OLMs after treating at discriminating doses , together with the ratio of insecticidal LC99 to field recommended concentration , it could be deduced that OLMs in Sanmen was still sensitive to chlorantra-niliprole, chlorfenapyr; sensitivities to indoxacarb, emamectin benzoate, chlorfluazuron, diafenthiuron, spinosad have declined;and resistances to tebufenozide , spinetoram and beta-cypermethrin have developed .While the OLMs in Xiaoshan were sensitive to chlorantraniliprole , chlorfenapyr and spinosad; sensitivity to emamectin benzoate , diafenthiuron , chlorfluazuron , spinetoram , indoxacarb , abamection had declined , and resistances to beta-cyper-methrin have developed .Therefore, resistance levels of OLMs to most of the insecticides monitored were increasing in Zhejiang province , and beta-cypermethrin , abamection , tebufenozide that OLMs had developed resistance should be stopped using for one or two years , and the rest still can be applied to control OLMs by the methods of limiting the frequency of spraying , rotation or mixture of different kinds insecticides in order to delay the development of resist -ance.%为明确浙江菜区斜纹夜蛾对主要杀虫剂的抗药性发展趋势,采集了浙江三门和萧山地区田间斜纹夜蛾,监测其对11种杀虫剂的敏感性水平。结果表明,三门种群和萧山种群对这些杀虫剂的敏感性存在明显差异,且萧山种群对测试药剂的敏感性高于三门种群。参考抗性诊断剂量(田间推

  16. Comparative toxicities of organophosphate and pyrethroid insecticides to aquatic macroarthropods.

    Science.gov (United States)

    Halstead, Neal T; Civitello, David J; Rohr, Jason R

    2015-09-01

    As agricultural expansion and intensification increase to meet the growing global food demand, so too will insecticide use and thus the risk of non-target effects. Insecticide pollution poses a particular threat to aquatic macroarthropods, which play important functional roles in freshwater ecosystems. Thus, understanding the relative toxicities of insecticides to non-target functional groups is critical for predicting effects on ecosystem functions. We exposed two common macroarthropod predators, the crayfish Procambarus alleni and the water bug Belostoma flumineum, to three insecticides in each of two insecticide classes (three organophosphates: chlorpyrifos, malathion, and terbufos; and three pyrethroids: esfenvalerate, λ-cyhalothrin, and permethrin) to assess their toxicities. We generated 150 simulated environmental exposures using the US EPA Surface Water Contamination Calculator to determine the proportion of estimated peak environmental concentrations (EECs) that exceeded the US EPA level of concern (0.5×LC50) for non-endangered aquatic invertebrates. Organophosphate insecticides generated consistently low-risk exposure scenarios (EECs0.5×LC50) to P. alleni, but not to B. flumineum, where only λ-cyhalothrin produced consistently high-risk exposures. Survival analyses demonstrated that insecticide class accounted for 55.7% and 91.1% of explained variance in P. alleni and B. flumineum survival, respectively. Thus, risk to non-target organisms is well predicted by pesticide class. Identifying insecticides that pose low risk to aquatic macroarthropods might help meet increased demands for food while mitigating against potential negative effects on ecosystem functions. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Effects of Diamide Insecticides on Predators in Soybean.

    Science.gov (United States)

    Whalen, R A; Herbert, D A; Malone, S; Kuhar, T P; Brewster, C C; Reisig, D D

    2016-10-01

    Predatory arthropods can be important for preventing insect pests from reaching damaging levels in soybean. However, the predator community can be compromised when pest control strategies include the application of broad-spectrum insecticides. The use of selective insecticides such as diamides could conserve predators while still providing necessary pest control. We evaluated two selective diamide insecticides, chlorantraniliprole and flubendiamide, and a broad-spectrum insecticide, lambda-cyhalothrin in combination with chlorantraniliprole, for impact on predators in soybean. We applied insecticides to field plots and documented predator abundance prior to and up to 3 wk postapplication using sticky card, beat sheet, and sweep net sampling methods. In sweep net samples, total predator abundance in plots treated with the selective insecticides was not significantly different from untreated control plots. For beat sheet samples, there were no significant differences in the abundance of total predators on any day postapplication between the selective diamide insecticides or the untreated control, but abundance decreased after application of lambda-cyhalothrin + chlorantraniliprole and did not recover. For sticky cards, there were no differences in predator abundance among treatments on any day postapplication. Over all, results showed that there were no significant differences in the abundance of total predators, Anthocoridae, Araneae, or Geocoridae after application of flubendiamide or chlorantraniliprole compared with the untreated control for up to 3 wk after application. All insecticides significantly decreased populations of lepidopteran pests compared with the untreated control, but only lambda-cyhalothrin + chlorantraniliprole reduced predatory arthropod abundance. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  18. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    Directory of Open Access Journals (Sweden)

    D.C. Pathak

    2011-07-01

    Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.

  19. Impact of triazophos insecticide on paddy soil environment

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A laboratory incubation study was carried out to elucidate the dynamic response of insecticide (triazophos) on a paddy field soil health under controlled moisture (flooded soil) and temperature (25℃).The insecticide was applied at five levels that were 0.0 (control),0.5 field rate (FR),1.0 FR,5.0 FR,and 10.0 FR,where FR was 1500 ml/hm2,and the parameters were studied at 1,4,7,14,and 21days after treatments' addition.The electron transport system (ETS)/dehydrogenase activity exhibited a negative correlation with insecticide concentrations,and the activity affected adversely as the concentration increased.The higher doses of 5 and 10 field rates significantly reduced the ETS activity,while lower rates failed to produce any significant inhibiting effect against the control.The toxicity of insecticide decreased towards decreasing the ETS activity with the advancement of incubation period.The insecticide caused an improvement in the soil phenol content and it increased with increasing concentration of insecticide.The insecticide incorporation applied at various concentrations did not produce any significant change in soil protein content and it remained stable throughout the incubation period of 21 - days.The response of biomass phospholipid content was nearly similar to ETS activity.The phospholipid content was decreased with the addition of insecticide and the toxicity was in the order:10 FR (field rate) > 5 FR > 1.0 FR > 0.5 FR > control and it also decreased with incubation period.

  20. Profile of the population use of household insecticides against mosquitoes

    Directory of Open Access Journals (Sweden)

    Luzilene Barbosa Oliveira

    2015-11-01

    Full Text Available This study described the use of household insecticides in Picos (Piauí, Brazil, identify which are the most used types of insecticides and describes the incidence of poisoning and environmental awareness of the population. After home visits (n = 700, it was seen that the majority of respondents was represented by women (75%, with 31-55 years-old (49%, incomplete primary education (38.1% and income between 1-2 earnings (64%. Most homes have between 1-3 residents (48%, 85% of the persons use insecticides mainly chosen in TV and radio and only 54% of them read the label before employing the product. The most used form of presentation is the aerosol (70.7%. Majority (79% recognizes that insecticides are harmful to health, but 74% do not use any Personal Protective Equipment (PPE. Symptoms of toxicity were reported by 27% of people interviewed. Two women reported irritation, dizziness and respiratory problems and need for medical intervention and hospitalization. All interviewed discard the package as regular trash, since Picos does not has selective collection. In conclusion, most people use insecticides, know about the individual and collective risks to which they are exposed but do not use PPE, though they believe insecticides are toxic. It was noted that acquisition of knowledge does not necessarily result in behavioral changes, since learning does not translate into appropriate preventive attitudes and practices, emphasizing the requirement for awareness campaigns about toxicity and environmental risks, preparation of professionals and surveillance policy against indiscriminate sale.

  1. Using Luseweilei insecticide to control Dendrolimus superans T.

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Luseweilei is an easily-bursted microcapsule insecticide. A test of effectiveness of the insecticide to control the larvae of Dendrolimus superans T. was carried out in larch forest in Baoan Forest Farm of Nehe City, Heilongjiang Province, in April 2001. The solutions of different concentrations (1:150, 1:250, 1:350, and 1:450 Luseweilei : water) were sprayed on the larch trunk before the overwintering larvae climbing on trees and the spraying lengths (height) designed were 1.0, 2.5, and 3.5 m high from ground. The control result showed that spraying 150-, 250-, and 350-fold solutions of the insecticide all produced a good control result, with a mortality rate of 97%, but the 450-fold solution only produced 70% mortality. It is concluded that this insecticide can be used as a kind of good insecticide to control the overwintering larvae of D. superans in spring. Spraying 350-fold solution of easy-burst microcapsule insecticide and one meter spraying length are recommended for the future application..

  2. Impact of some selected insecticides application on soil microbial respiration.

    Science.gov (United States)

    Latif, M A; Razzaque, M A; Rahman, M M

    2008-08-15

    The aim of present study was to investigate the impact of selected insecticides used for controlling brinjal shoot and fruit borer on soil microorganisms and to find out the insecticides or nontoxic to soil microorganism the impact of nine selected insecticides on soil microbial respiration was studied in the laboratory. After injection of different insecticides solutions, the soil was incubated in the laboratory at room temperature for 32 days. The amount of CO2 evolved due to soil microbial respiration was determined at 2, 4, 8, 16, 24 and 32 days of incubation. Flubendiamide, nimbicidine, lambda-cyhalothrin, abamectin and thiodicarb had stimulatory effect on microbial respiration during the initial period of incubation. Chlorpyriphos, cartap and carbosulfan had inhibitory effect on microbial respiration and cypermethrin had no remarkable effect during the early stage of incubation. The negative effect of chlorpyriphos, cartap and carbosulfan was temporary, which was disappeared after 4 days of insecticides application. No effect of the selected insecticides on soil microorganisms was observed after 24 or 32 days of incubation.

  3. Design, synthesis and insecticidal evaluation of aryloxy dihalopropene derivatives.

    Science.gov (United States)

    Yang, Ji-Chun; Li, Miao; Wu, Qiao; Liu, Chang-Ling; Chang, Xiu-Hui

    2016-02-01

    Plutella xylostella (P. xylostella) is a highly migratory, cosmopolitan species and one of the most important pest of cruciferous crops worldwide. Pyridalyl as a novel class of insecticides has good efficacy against P. xylostella. On the basis of the commercial insecticide pyridalyl, a series of new aryloxy dihalopropene derivatives were designed and synthesized by using Intermediate Derivatization Methods. Their chemical structures were confirmed by (1)H NMR, high-resolution mass spectrum (HRMS), and single-crystal X-ray diffraction analysis. The insecticidal activities of the new compounds against P. xylostella were evaluated. The results of bioassays indicated that most of the compounds showed moderate to high activities at the tested concentration, especially compounds 10e and 10g displayed more than 75% insecticidal activity against P. xylostella at 6.25mg/L, while pyridalyl showed 50% insecticidal activity at the same concentration. The field trials result of the insecticidal activities showed that compound 10e as a 10% emulsifiable concentrate (EC) was effective in the control of P. xylostella at 75-150g a.i./ha, and the mortality of P. xylostella for treatment with compound 10e at 75g a.i./ha was equivalent to pyridalyl at 105g a.i./ha.

  4. Bis{2-[(2,4,6-trimethyl-phen-yl)imino-methyl]pyrrol-1-ido}palladium(II).

    Science.gov (United States)

    Imhof, Wolfgang

    2013-02-01

    The title compound, [Pd(C(14)H(15)N(2))(2)], is a square-planar palladium complex composed of two deprotonated pyrrole-2-carbaldimine ligands coordinating a central Pd(II) atom. In the crystal, three crystallographically independent complex mol-ecules are observed, one of which is located in a general position, whereas the Pd(II) atoms of the other mol-ecules are situated on crystallographic inversion centers. The aromatic substituents at the imine N atoms in the three mol-ecules show dihedral angles of 87.6 (7)/83.64 (7), 74.3 (7) and 88.3 (7)° with respect to the corresponding PdN(4) plane.

  5. Synthesis and Crystal Structure of 1-H-Pyrrole-2-carboxylic Acid [2-(Naphthalen-1-ylamino)-ethyl]-amide

    Institute of Scientific and Technical Information of China (English)

    YIN Zhen-Ming; WANG Jian-Ying

    2006-01-01

    1-H-Pyrrole-2-carboxylic acid [2-(naphthalen-1-ylamino)-ethyl]-amide has been synthesized and characterized. Its crystal is of monoclinic, space group P21/n with a = 5.930(6), b =12.144(13), c = 20.10(2) (A),β = 95.709(17)°, V= 1441(3) (A), Z= 4, C17H17N3O, Mr= 279.34, Dc=1.288 g/cm3, F(000) = 592, μ(MoKα) = 0.083 mm-1, S = 1.019, R = 0.0473 and wR = 0.1181 for 1713 observed reflections with 1 > 2σ(Ⅰ). X-ray diffraction reveals that two molecules of the title compound form a dimer through a pair of N-H…O hydrogen bonds.

  6. Acylguanidine inhibitors of beta-secretase: optimization of the pyrrole ring substituents extending into the S1' substrate binding pocket.

    Science.gov (United States)

    Jennings, Lee D; Cole, Derek C; Stock, Joseph R; Sukhdeo, Mohani N; Ellingboe, John W; Cowling, Rebecca; Jin, Guixian; Manas, Eric S; Fan, Kristi Y; Malamas, Michael S; Harrison, Boyd L; Jacobsen, Steve; Chopra, Rajiv; Lohse, Peter A; Moore, William J; O'Donnell, Mary-Margaret; Hu, Yun; Robichaud, Albert J; Turner, M James; Wagner, Erik; Bard, Jonathan

    2008-01-15

    The proteolytic enzyme beta-secretase (BACE-1) produces amyloid beta (Abeta) peptide, the primary constituent of neurofibrillary plaques, implicated in Alzheimer's disease, by cleavage of the amyloid precursor protein. A small molecule inhibitor of BACE-1, (diaminomethylene)-2,5-diphenyl-1H-pyrrole-1-acetamide (1, BACE-1 IC(50)=3.7 microM), was recently described, representing a new small molecule lead. Initial SAR investigation demonstrated the potential of accessing the nearby S(3) and S(1)(') substrate binding pockets of the BACE-1 enzyme by building substituents off one of the phenyl substituents and guanidinyl functional group. We report here the optimization of guanidinyl functional group substituents on 1, leading to potent submicromolar BACE-1 inhibitors.

  7. Non-radiative relaxation dynamics of pyrrole following excitation in the range 249.5-200 nm

    Science.gov (United States)

    Kirkby, Oliver M.; Parkes, Michael A.; Neville, Simon P.; Worth, Graham A.; Fielding, Helen H.

    2017-09-01

    The non-radiative relaxation dynamics of pyrrole have been investigated using time-resolved photoelectron spectroscopy and quantum dynamics simulations. Following excitation of the A2 (11 πσ∗) state, we observe population flow out of the Franck-Condon region on a ≲ 50 fs timescale. Following excitation of the B2 (21 ππ∗) state, we observe population being transferred to the A2 (11 πσ∗) state on a <50 fs timescale and subsequently out of the Franck-Condon region, also on a <50 fs timescale. Quantum dynamics calculations suggest that population is transferred from the B2 (21 ππ∗) state through the A2 (1 π 3pz) state to the B1 (21 πσ∗) state before being transferred to the A2 (11 πσ∗) state.

  8. Large area in situ fabrication of poly(pyrrole)-nanowires on flexible thermoplastic films using nanocontact printing

    Science.gov (United States)

    Garcia-Cruz, Alvaro; Lee, Michael; Marote, Pedro; Zine, Nadia; Sigaud, Monique; Bonhomme, Anne; Pruna, Raquel; Lopez, Manuel; Bausells, Joan; Jaffrezic, Nicole; Errachid, Abdelhamid

    2016-08-01

    Highly efficient nano-engineering tools will certainly revolutionize the biomedical and sensing devices research and development in the years to come. Here, we present a novel high performance conducting poly(pyrrole) nanowires (PPy-NW) patterning technology on thermoplastic surfaces (poly(ethylene terephthalate (PETE), poly(ethylene 2,6-naphthalate (PEN), polyimide (PI), and cyclic olefin copolymer) using nanocontact printing and controlled chemical polymerization (nCP-CCP) technique. The technique uses a commercial compact disk as a template to produce nanopatterned polydimethylsiloxane (PDMS) stamps. The PDMS nanopatterned stamp was applied to print the PPy-NWs and the developed technology of nCP-CCP produced 3D conducting nanostructures. This new and very promising nanopatterning technology was achieved in a single step and with a low cost of fabrication over large areas.

  9. Multichromic conducting copolymer of 1-benzyl-2,5-di(thiophen-2-yl)-1H-pyrrole with EDOT

    Energy Technology Data Exchange (ETDEWEB)

    Camurlu, Pinar [Department of Chemistry, Akdeniz University, 07058 Antalya (Turkey); Tarkuc, Simge; Akhmedov, idris Mecidoglu; Tanyeli, Cihangir; Toppare, Levent [Department of Chemistry, Middle East Technical University, 06531 Ankara (Turkey); Sahmetlioglu, Ertugrul [Department of Chemistry, Nigde University, 51100 Nigde (Turkey)

    2008-02-15

    Despite the significant progress made in the field of electrochromic polymers, the multichromic facility of current knowledge is restricted. Therefore, as previously proven, electrochemical copolymerization of 1-benzyl-2,5-di(thiophen-2-yl)-1H-pyrrole (SNBS) and 3,4-ethylenedioxythiophene (EDOT) was used as a strategy to achieve desired multichromic properties, where the resultant copolymer displayed distinct color changes between claret red, yellow, green, and blue colors with short switching times and high optical contrast. As an application, absorption/transmission type electrochromic device with indium tin oxide (ITO)/copolymer/gel electrolyte PEDOT/ITO configuration was constructed, where copolymer and PEDOT functioned as the anodically and the cathodically coloring layers, respectively. Results implied the successive use of this copolymer in electrochromic device applications, since the device exhibited short switching times with a wide color variation upon applied potential. (author)

  10. From indole to pyrrole, furan, thiophene and pyridine: Search for novel small molecule inhibitors of bacterial transcription initiation complex formation.

    Science.gov (United States)

    Thach, Oscar; Mielczarek, Marcin; Ma, Cong; Kutty, Samuel K; Yang, Xiao; Black, David StC; Griffith, Renate; Lewis, Peter J; Kumar, Naresh

    2016-03-15

    The search for small molecules capable of inhibiting transcription initiation in bacteria has resulted in the synthesis of N,N'-disubstituted hydrazines and imine-carbohydrazides comprised of indole, pyridine, pyrrole, furan and thiophene using the respective trichloroacetyl derivatives, carbohydrazides and aldehydes. Replacement of the indole moiety by smaller heterocycles linked by CONHNC linkers afforded a broad variety of compounds efficiently targeting the RNA polymerase-σ(70)/σ(A) interaction as determined by ELISA and exhibiting increased inhibition of the growth of Escherichia coli compared to Bacillus subtilis in culture. The structural features of the synthesized transcription initiation inhibitors needed for antibacterial activity were identified employing molecular modelling and structure-activity relationship (SAR) studies.

  11. Susceptibility of Cimex lectularius (Hemiptera: Cimicidae) to pyrethroid insecticides and to insecticidal dusts with or without pyrethroid insecticides.

    Science.gov (United States)

    Anderson, John F; Cowles, Richard S

    2012-10-01

    Relative increases of bed bug, Cimex lectularius L., populations are probably due in large measure to their resistance to pyrethroids, which have been used extensively against urban pests. A Connecticut population of bed bugs was assessed for sensitivity to pyrethroids and exposed to commonly-used commercial insecticides applied to various substrates on which the residues were allowed to age for 0-24 wk. Type I and type II pyrethroids differed in toxicity when applied at a high dosage (1 microg) per bed bug. Some type II pyrethroids (cyfluthrin, lambda-cyhalothrin, cis-cypermethrin, and deltamethrin) caused > 80% mortality, whereas exposure to type I pyrethroids caused 0.95) an exponential rise to a maximum model from which the survival half-life (S1/2) was calculated directly. Tempo Dust (Bayer Environmental Science, Montvale, NJ) killed bed bugs relatively quickly, as did Syloid 244 (Grace Davison, Columbia, MD) and Drione (Bayer Environmental Science, Montvale, NJ) on hardboard and mattress fabric substrates (S1/2 Companies, Waterbury, CT), displayed reduced residual toxicity as they aged; the mortality was < 50% on some substrates after 4 d. Desiccant dusts, with their physical mode of action and long residual activity, appear to be superior to sprayable pyrethroid products for killing bed bugs.

  12. Excited state non-adiabatic dynamics of pyrrole: A time-resolved photoelectron spectroscopy and quantum dynamics study

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Guorong [National Research Council of Canada, 100 Sussex Drive, Ottawa, Ontario K1A 0R6 (Canada); State Key Laboratory of Molecular Reaction Dynamics, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian, Liaoning 116023 (China); Synergetic Innovation Center of Quantum Information and Quantum Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Neville, Simon P.; Worth, Graham A., E-mail: g.a.worth@bham.ac.uk [School of Chemistry, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom); Schalk, Oliver [National Research Council of Canada, 100 Sussex Drive, Ottawa, Ontario K1A 0R6 (Canada); Department of Physics, AlbaNova University Center, Stockholm University, Roslagstullsbacken 21, 109 61 Stockholm (Sweden); Sekikawa, Taro [National Research Council of Canada, 100 Sussex Drive, Ottawa, Ontario K1A 0R6 (Canada); Department of Applied Physics, Hokkaido University, Kita-13 Nishi-8, Kita-ku, Sapporo 060-8628 (Japan); Ashfold, Michael N. R. [School of Chemistry, University of Bristol, Bristol BS8 1TS (United Kingdom); Stolow, Albert, E-mail: astolow@uottawa.ca [National Research Council of Canada, 100 Sussex Drive, Ottawa, Ontario K1A 0R6 (Canada); Departments of Chemistry and Physics, University of Ottawa, 10 Marie Curie, Ottawa, Ontario K1N 6N5 (Canada)

    2015-02-21

    The dynamics of pyrrole excited at wavelengths in the range 242-217 nm are studied using a combination of time-resolved photoelectron spectroscopy and wavepacket propagations performed using the multi-configurational time-dependent Hartree method. Excitation close to the origin of pyrrole’s electronic spectrum, at 242 and 236 nm, is found to result in an ultrafast decay of the system from the ionization window on a single timescale of less than 20 fs. This behaviour is explained fully by assuming the system to be excited to the A{sub 2}(πσ{sup ∗}) state, in accord with previous experimental and theoretical studies. Excitation at shorter wavelengths has previously been assumed to result predominantly in population of the bright A{sub 1}(ππ{sup ∗}) and B{sub 2}(ππ{sup ∗}) states. We here present time-resolved photoelectron spectra at a pump wavelength of 217 nm alongside detailed quantum dynamics calculations that, together with a recent reinterpretation of pyrrole’s electronic spectrum [S. P. Neville and G. A. Worth, J. Chem. Phys. 140, 034317 (2014)], suggest that population of the B{sub 1}(πσ{sup ∗}) state (hitherto assumed to be optically dark) may occur directly when pyrrole is excited at energies in the near UV part of its electronic spectrum. The B{sub 1}(πσ{sup ∗}) state is found to decay on a timescale of less than 20 fs by both N-H dissociation and internal conversion to the A{sub 2}(πσ{sup ∗}) state.

  13. Porphodilactones as synthetic chlorophylls: relative orientation of β-substituents on a pyrrolic ring tunes NIR absorption.

    Science.gov (United States)

    Ke, Xian-Sheng; Chang, Yi; Chen, Jia-Zhen; Tian, Jiangwei; Mack, John; Cheng, Xin; Shen, Zhen; Zhang, Jun-Long

    2014-07-09

    Porphodilactones represent the porphyrin analogues, in which the peripheral bonds of two pyrrole rings are replaced by lactone moieties. They provide an opportunity to investigate how β-substituent orientation of porphyrinoids modulates the electronic structures and optical properties, in a manner similar to what is observed with naturally occurring chlorophylls. In this work, a comprehensive description of the synthesis, characterization, and optical properties of meso-tetrakispentafluorophenylporphodilactone isomers is first reported. The β-dilactone moieties are found to lie at opposite pyrrole positions (trans- and cis-configurations are defined by the relative orientations of the carbonyl group when one lactone moiety is fixed), in accordance with earlier computational predictions (Gouterman, M. J. Am. Chem. Soc. 1989, 111, 3702). The relative orientation of the β-dilactone moieties has a significant influence on the electronic structures and photophysical properties. For example, the Qy band of trans-porphodilactone is red-shifted by 19 nm relative to that of the cis-isomer, and there is a 2-fold increase in the absorption intensity, which resembles the similar trends that have been reported for natural chlorophyll f and d. An in depth analysis of magnetic circular dichroism spectral data and TD-DFT calculations at the B3LYP/6-31G(d) level of theory demonstrates that the trans- and cis-orientations of the dilactone moieties have a significant effect on the relative energies of the frontier π-molecular orbitals. Importantly, the biological behaviors of the isomers reveal their different photocytotoxicity in NIR region (>650 nm). The influence of the relative orientation of the β-substituents on the optical properties in this context provides new insights into the electronic structures of porphyrinoids which could prove useful during the development of near-infrared absorbing photosensitizers.

  14. Sublethal and transgenerational effects of insecticides in developing Trichogramma galloi (Hymenoptera: Trichogrammatidae) : toxicity of insecticides to Trichogramma galloi.

    Science.gov (United States)

    Costa, Mariana Abreu; Moscardini, Valéria Fonseca; da Costa Gontijo, Pablo; Carvalho, Geraldo Andrade; de Oliveira, Rodrigo Lopes; de Oliveira, Harley Nonato

    2014-10-01

    This study assessed the transgenerational effects of insecticides in developing Trichogramma galloi (Hymenoptera: Trichogrammatidae). Laboratory bioassays were performed in which five insecticides were sprayed on egg-larval, pre-pupal and pupal stages of the parasitoid. The interaction between insecticides and development stages of the parasitoid was not significant for the rate of F0 emergence. All insecticides significantly reduced the emergence of wasps, with the lowest emergence observed when they were applied to the pupal stage. For the sex ratio, only spinosad applied to the pre-pupal stage and triflumuron applied on the egg-larval and pre-pupal stages did not differ from the controls. Triflumuron applied to pre-pupae did not lead to any difference in the parasitism rate of the treated generation (F0) when compared to the control. There were no significant differences among survival curves for females of F0 when all insecticides were sprayed on the egg-larval stage. Both concentrations of lambda-cyhalothrin + thiamethoxam reduced female pre-pupal survival, and all treatments reduced female pupal survival. In addition, we observed a transgenerational effect of the insecticides on emergence and sex ratio of next generation (F1). Lambda-cyhalothrin + thiamethoxam (Min) applied to the pre-pupae and pupae, the maximum rate of the same insecticides applied to the egg-larvae and pre-pupae, and spinosad applied to pre-pupae all significantly reduced the adults emergence of T. galloi F1 generation. Only triflumuron did not alter the F1 sex ratio. These bioassays provide a basis for better understanding the effects of insecticide use on beneficial parasitoids.

  15. Usage pattern, physical integrity & insecticidal efficacy of long-lasting insecticidal nets in Odisha State, India

    Directory of Open Access Journals (Sweden)

    S S Anuse

    2015-01-01

    Full Text Available Background & objectives: One of the major strategies being pursued for malaria control by the National Vector Borne Disease Control Programme is the distribution of long lasting insecticidal nets (LLINs in endemic areas since 2009. Information on durability of insecticidal efficacy and physical integrity of LLINs and community usage at different time intervals of their use is essential to plan net replacements to maintain universal coverage for an effective and sustainable malaria control strategy. Therefore, a study was undertaken to assess these parameters in two malaria endemic districts of the Odisha State. Methods: A total of 309 households were selected in 15 villages of two community health centres (CHCs (Borigumma and Laxmipur from Koraput district and one (Khairput from Malkangiri district. Data on net usage were collected during March to July 2014 using semi-structured questionnaires. PermaNet 2.0 were sampled from all households, replaced with new ones, and bioassays were carried out to determine the insecticidal efficacy of LLINs after four and half, four and two years of field use following the standard procedure of World Health Organization. Results: LLIN use rate varied from 57.9 to 90.2 per cent in the study CHCs. The annual washing rate per net in Borigumma, Khairput and Laxmipur was 6.6, 3.2 and 4.8, respectively. The LLINs used two years in the field caused 100 per cent mortality and four to four and half years caused below 80 per cent mortality, except one net. Interpretation & conclusions: Nearly 20 per cent of the people were out of net coverage and hence the Programme to ensure 100 per cent coverage. The community should adequately be educated so as to increase the net use rate and avoid incorrect washing practices.

  16. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  17. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  18. Tolerance to the carbamate insecticide propoxur.

    Science.gov (United States)

    Costa, L G; Hand, H; Schwab, B W; Murphy, S D

    1981-01-01

    Male mice were given the carbamate insecticide propoxur (2-isopropoxy phenyl methylcarbamate; Baygon) in the drinking water at weekly increasing concentrations (from 50 to 2000 ppm), for a period of 6 weeks. At the end of the treatment the LD50 for propoxur was significantly higher in the treated animals as compared with controls. Propoxur-treated animals were also resistant to the hypothermic effect of an acute administration of the same compound. Groups of mice were challenged with the cholinergic agonist carbachol at intervals during the drinking water dosing and at its end. No differences in sensitivity to carbachol acute toxicity were found between control and treated animals. Propoxur-tolerant animals were also not resistant to the hypothermic effect of oxotremorine, another cholinergic agonist. [3H]Quinuclidinyl benzilate ([3H]QNB) binding (a measure of muscarinic receptor density and affinity) in forebrain, hindbrain and ileum never differed in control and treated mice. The possibility that repeated administrations of propoxur induced increased metabolic inactivation was tested by measuring hexobarbital sleeping time and carboxylesterase activity in treated and control mice. No changes in tissue carboxylesterase activities occurred but hexobarbital sleeping time was significantly reduced in propoxur treated animals suggesting an induction of hepatic microsomal enzymes. These results suggest that tolerance to propoxur is not mediated by a decrease of cholinergic receptors, as reported for other acetylcholinesterase inhibitors, but possibly by an enhancement of its metabolism.

  19. Mutagenic and cytotoxic activities of benfuracarb insecticide.

    Science.gov (United States)

    Eren, Yasin; Erdoğmuş, Sevim Feyza; Akyıl, Dilek; Özkara, Arzu

    2016-08-01

    Benfuracarb is a carbamate insecticide used to control insect pests in vegetables and it has anti-acetylcholinesterase activity lower than other carbamates. Cytotoxic effects of benfuracarb were evaluated by using root growth inhibition (EC50), mitotic index (MI), and mitotic phase determinations on the root meristem cells of Allium cepa and mutagenic effects were determined in Salmonella typhymurium Ames test by TA98 and TA100 strains with and without metabolic activation. In Allium test, 1 % DMSO was used as negative control group and 10 ppm MMS was used as positive control group. 75 ppm concentration of benfuracarb was found as EC50. In MI and mitotic phases determination study, 37.5, 75 and 150 ppm doses of benfuracarb were used. Dose-dependent cytotoxic activity was found by root growth inhibition and MI studies. It was identified that mitotic inhibition activity of benfuracarb was higher than 10 ppm MMS. In Ames test, mutagenic activity was not observed and over 200 µg/plate of benfuracarb was determined as cytotoxic to S. typhymurium strains. Benfuracarb can be called as "mitotic inhibitor" but not called as mutagen.

  20. Anaerobic microbial degradation of organochlorine insecticides Aldrin

    Energy Technology Data Exchange (ETDEWEB)

    Chiu, T.C.; Yen, J.H.; Wang, Y.S. [National Taiwan Univ. (Taiwan)

    2004-09-15

    Aldrin (1,2,3,4,10,10-hexachloro-1,4,4a,5,8,8a-hexahydro-1,4-endo-exo-5,8-dimethanonnaphthalene), a cyclodiene organochlorine insecticide, was banned by nations and classified as B2 carcinogen by United States Environmental Protection Agency (EPA). Because of its chemical stability and lipophilicity, aldrin is regarded as a persistent and recalcitrant compound. Aldrin is easily adsorbed to soil and sediment after spreading to the environments, furthermore, it may be accumulated in animal's tissue or milk and then cause adverse effects by food-chain. The dissipation process of aldrin in environments has continuously been paid much attention by researchers. In general, the dissipation of aldrin has been thought as relating to three mechanisms: photo-degradation, chemical hydrolysis, and microbial degradation. And it has been well known that microbial degradation is the most important agent for breakdown of organochlorine pesticides. There has been shown that aldrin could be transformed to its metabolites, such as dieldrin or photo-dieldrin, by microorganisms under aerobic conditions, however, limited information has been shown under anaerobic conditions. For this reason, the degradation potential of aldrin by anaerobic microorganisms obtained from indigenous river sediment was evaluated, and the effect of environmental factors such as temperatures and nutrients on the aldrin degradation was also investigated in this study.

  1. Azobenzene Modified Imidacloprid Derivatives as Photoswitchable Insecticides: Steering Molecular Activity in a Controllable Manner

    Science.gov (United States)

    Xu, Zhiping; Shi, Lina; Jiang, Danping; Cheng, Jiagao; Shao, Xusheng; Li, Zhong

    2015-10-01

    Incorporating the photoisomerizable azobenzene into imidacloprid produced a photoswitchable insecticidal molecule as the first neonicotinoid example of remote control insecticide performance with spatiotemporal resolution. The designed photoswitchable insecticides showed distinguishable activity against Musca both in vivo and in vitro upon irradiation. Molecular docking study further suggested the binding difference of the two photoisomers. The generation of these photomediated insecticides provides novel insight into the insecticidal activity facilitating further investigation on the functions of insect nicotinic acetylcholine receptors and opens a novel way to control and study insect behavior on insecticide poisoning using light.

  2. Toxicity of some insecticides used in maize crop on Trichogramma pretiosum (Hymenoptera, Trichogrammatidae immature stages

    Directory of Open Access Journals (Sweden)

    Jander R Souza

    2014-04-01

    Full Text Available Fall armyworm Spodoptera frugiperda (J.E. Smith, 1797 (Lepidoptera: Noctuidae is an important pest of maize (Zea mays L. crops in Brazil. The effects of beta-cypermethrin, chlorfenapyr, chlorpyrifos, spinosad, etofenprox, triflumuron, alpha-cypermethrin/teflubenzuron, and lambda-cyhalothrin/thiamethoxam on Trichogramma pretiosum Riley, 1879 (Hymenoptera: Trichogrammatidae immature stages were evaluated. Eggs of Anagasta kuehniella (Zeller, 1879 (Lepidoptera: Pyralidae, containing immature stages of the parasitoid were dipped in water solution pesticides, to evaluate their effects on emergence and sex ratio of F1 parasitoids. For F2 parasitoids, emergence, parasitism capacity, and sex ratio were evaluated. Beta-cypermethrin, chlorfenapyr, chlorpyrifos, and spinosad affected the emergence success of F1 T. pretiosum. Insects exposed to etofenprox and alpha-cypermethrin/teflubenzuron during the egg-larval period and to lambda-cyhalothrin/thiamethoxam during the pupal stage also suffered reduction in the emergence. Beta-cypermethrin affected the sex ratio of F1 T. pretiosum from host eggs treated during the egg-larval period; spinosad affected it during the egg-larval period and the pupal stage, whereas chlorpyrifos did the same when applied during the pupal stage. Chlorpyrifos also affected the sex ratio of F2 parasitoids, but only when applied during the egg-larval period, whereas chlorfenapyr reduced this trait when applied during the pre-pupal phase. Chlorpyrifos and alpha-cypermethrin/teflubenzuron affected the parasitism capacity of F1 females from eggs treated during the egg-larval period. Considering the overall effects, only etofenprox and triflumuron were selective on T. pretiosum when applied on parasitized A. kuehniella eggs. Further studies need to be carried out to verify the toxicity of the other pesticides under semi-field and field conditions.

  3. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  4. The global status of insect resistance to neonicotinoid insecticides.

    Science.gov (United States)

    Bass, Chris; Denholm, Ian; Williamson, Martin S; Nauen, Ralf

    2015-06-01

    The first neonicotinoid insecticide, imidacloprid, was launched in 1991. Today this class of insecticides comprises at least seven major compounds with a market share of more than 25% of total global insecticide sales. Neonicotinoid insecticides are highly selective agonists of insect nicotinic acetylcholine receptors and provide farmers with invaluable, highly effective tools against some of the world's most destructive crop pests. These include sucking pests such as aphids, whiteflies, and planthoppers, and also some coleopteran, dipteran and lepidopteran species. Although many insect species are still successfully controlled by neonicotinoids, their popularity has imposed a mounting selection pressure for resistance, and in several species resistance has now reached levels that compromise the efficacy of these insecticides. Research to understand the molecular basis of neonicotinoid resistance has revealed both target-site and metabolic mechanisms conferring resistance. For target-site resistance, field-evolved mutations have only been characterized in two aphid species. Metabolic resistance appears much more common, with the enhanced expression of one or more cytochrome P450s frequently reported in resistant strains. Despite the current scale of resistance, neonicotinoids remain a major component of many pest control programmes, and resistance management strategies, based on mode of action rotation, are of crucial importance in preventing resistance becoming more widespread. In this review we summarize the current status of neonicotinoid resistance, the biochemical and molecular mechanisms involved, and the implications for resistance management.

  5. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on NaV and KV channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  6. Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives.

    Science.gov (United States)

    Nguyen, Binh Cao Quan; Chompoo, Jamnian; Tawata, Shinkichi

    2015-09-14

    Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol) from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively). Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b) showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively) with 50%-60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C₅-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.

  7. Post Hartree–Fock and DFT Studies on Pyrrole···Nitrogen and Pyrrole···Carbon Monoxide Molecules

    Directory of Open Access Journals (Sweden)

    P. Kolandaivel

    2002-07-01

    Full Text Available Abstract: The hydrogen bonded and van der Waals isomers of pyrrole···nitrogen and pyrrole···carbon monoxide have been studied using ab initio and density functional theory methods. Complex geometries and total energies of the isomers have been determined at HF, MP2, B3LYP and B3PW91 levels of theory employing 6-31G* basis set. For pyrrole···nitrogen complex, only two isomers have stable structure and the more stable one is found to be the hydrogen bonded isomer. Among the five isomers of pyrrole···carbon monoxide complex, the hydrogen bonded isomer is found to be the most stable form. The interaction energy for all these isomers have been calculated after eliminating the basis set superposition errors by using the full counterpoise correction method. Chemical hardness, chemical potential have been calculated and are used to study the stability of the molecules.

  8. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2015. Scientific Opinion on Flavouring Group Evaluation 77, Revision 2 (FGE.77Rev2): Consideration of Pyridine, Pyrrole and Quinoline Derivatives evaluated by JECFA (63rd meeting) structurally related, to Pyridine, Pyrrole, Indole and Quinoline Derivatives evaluated by EFSA in FGE.24Rev2 (2013)

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Nørby, Karin Kristiane

    evaluation is necessary, as laid down in Commission Regulation (EC) No 1565/2000. The present consideration concerns a group of 22 pyridine, pyrrole and quinoline derivatives evaluated by JECFA (63rd meeting). The revision of this consideration is made since additional toxicity data have become available...

  9. Deproto-metallation of N-arylated pyrroles and indoles using a mixed lithium–zinc base and regioselectivity-computed CH acidity relationship

    Directory of Open Access Journals (Sweden)

    Mohamed Yacine Ameur Messaoud

    2015-08-01

    Full Text Available The synthesis of N-arylated pyrroles and indoles is documented, as well as their functionalization by deprotonative metallation using the base in situ prepared from LiTMP and ZnCl2·TMEDA (1/3 equiv. With N-phenylpyrrole and -indole, the reactions were carried out in hexane containing TMEDA which regioselectively afforded the 2-iodo derivatives after subsequent iodolysis. With pyrroles and indoles bearing N-substituents such as 2-thienyl, 3-pyridyl, 4-methoxyphenyl and 4-bromophenyl, the reactions all took place on the substituent, at the position either adjacent to the heteroatom (S, N or ortho to the heteroatom-containing substituent (OMe, Br. The CH acidities of the substrates were determined in THF solution using the DFT B3LYP method in order to rationalize the experimental results.

  10. Silica sulfuric acid: a reusable solid catalyst for one pot synthesis of densely substituted pyrrole-fused isocoumarins under solvent-free conditions

    Directory of Open Access Journals (Sweden)

    Sudipta Pathak

    2013-11-01

    Full Text Available A convenient and efficient methodology for the synthesis of densely substituted pyrrole-fused isocoumarins, which employs solid-supported silica sulfuric acid (SSA as catalyst, has been developed. When the mixture of ninhydrin adducts of acetylacetone/ethyl acetoacetate and primary amines was heated on the solid surface of SSA under solvent-free conditions, the pyrrole-fused isocoumarins were formed in good yields. This synthetic method has several advantages such as the employment of solvent-free reaction conditions without the use of any toxic reagents and metal catalysts, the ease of product isolation, the use of a recyclable catalyst, the low cost, the easy availability of the starting materials, and the excellent yields of products.

  11. Electrochemical dechlorination of chloroform in neutral aqueous solution on palladium/foam-nickel and palladium/polymeric pyrrole film/foam-nickel electrodes

    Institute of Scientific and Technical Information of China (English)

    SUN Zhirong; LI Baohua; HU Xiang; SHI Min; HOU Qingnan; PENG Yongzhen

    2008-01-01

    Electrochemical dechlonnafion of chloroform in neutral aqueous solution was investigated using palladium-loaded electrodes at ambient temperature.Palladium/foam-nickel (Pd/foam-Ni) and palladium/polymeric pyrrole film/foam-nickel (Pd/PPy/foam-Ni)composite electrodes which provided catalytic surface for reductive dechiorination of chloroform in aqueous solution were prepared using an electrodepositing method.Scanning electron microscope (SEM) micrographs showed that polymeric pyrrole film modified the electrode-surface characteristics and resulted in the uniform dispersion of needle-shaped palladium particles on foam-Ni supporting electrode.The experimental results of dechlorination indicated that the removal efficiency of chloroform and current efficiency in neutral aqueous solution on Pd/PPy/foam-Ni electrode could be up to 36.8% and 33.0% at dechlorination current of 0.1 mA and dechlorination time of 180 rain,which is much higher than that of Pd/foam-Ni electrode.

  12. RESISTANCE OF THE TOXAPHENE INSECTICIDE IN SOIL

    Directory of Open Access Journals (Sweden)

    G MIRSATTARI

    2001-06-01

    Full Text Available Introduction. Toxaphene is resistant to degration and has been known as persistent bioaccumulator. In oder to understand the persistence and degradation phenomena of toxaphene in soil a series of tests were run. Methods. All experiments for dry and moist soil were conducted with 10 to 20 kg soil samples, contained in plastic tubs. The experiment was carried out in two parts. The five samples studied in each part are described below. Part I: "Dry samples". Soil control I soil amended with 10 percent gin trash/soil amended with 25 percent gin trash/soil amended with 10 percent gin trash and treated with 500 ppm toxaphene and soil treated with 500 ppm toxaphene. These samples were kept dry during the entire experimental period. Part II: "Moist samples". The samples were the same as described in part I, but they were kept moist by addition of water weekly during the experimental period. Periodically twenty grams of soil were analyzed using a gas chromatograph. Results. Chromatograms of dry and moist samples from soil containers (Part I and II analyzed up to 12 months after initiation of the experiments showed that no toxaphene degradation or dissipation had occurred. GLC profiles of extracts of 12 months soil samples were identical to those of 0 dry samples and almost 100 percent of toxaphene was recovered in all samples after one year regardless of whether samples were dry or moist I amended or not. Discussion. The results suggest that toxaphene dose not undergo degradation in soil" under aerobic condition, so it can be a persistent insecticide in soil under environmental condition.

  13. Influence of Pyrethroid Insecticides on Sodium and Calcium Influx in Neocortical Neurons

    Science.gov (United States)

    Pyrethroid insecticides bind to voltage-gated sodium channels and modify their gating kinetics, thereby disrupting neuronal function. Using murine neocortical neurons in primary culture, we have compared the ability of 11 structurally diverse pyrethroid insecticides to evoke Na+ ...

  14. Mechanistic modeling of insecticide risks to breeding birds in North American agroecosystems

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of ...

  15. Resistance to bio-insecticides or how to enhance their sustainability: a review

    Directory of Open Access Journals (Sweden)

    Myriam eSIEGWART

    2015-06-01

    Full Text Available After more than 70 years of chemical pesticide use, modern agriculture is increasingly using biological control products. Resistances to conventional insecticides are wide spread, while those to bio-insecticides have raised less attention, and resistance management is frequently neglected. However, a good knowledge of the limitations of a new technique often provides greater sustainability. In this review, we compile cases of resistance to widely used bio-insecticides and describe the associated resistance mechanisms. This overview shows that all widely used bio-insecticides ultimately select resistant individuals. For example, at least 27 species of insects have been described as resistant to Bacillus thuringiensis toxins. The resistance mechanisms are at least as diverse as those that are involved in resistance to chemical insecticides, some of them being common to bio-insecticides and chemical insecticides. This analysis highlights the specific properties of bio-insecticides that the scientific community should use to provide a better sustainability of these products.

  16. Resistance to bio-insecticides or how to enhance their sustainability: a review.

    Science.gov (United States)

    Siegwart, Myriam; Graillot, Benoit; Blachere Lopez, Christine; Besse, Samantha; Bardin, Marc; Nicot, Philippe C; Lopez-Ferber, Miguel

    2015-01-01

    After more than 70 years of chemical pesticide use, modern agriculture is increasingly using biological control products. Resistances to conventional insecticides are wide spread, while those to bio-insecticides have raised less attention, and resistance management is frequently neglected. However, a good knowledge of the limitations of a new technique often provides greater sustainability. In this review, we compile cases of resistance to widely used bio-insecticides and describe the associated resistance mechanisms. This overview shows that all widely used bio-insecticides ultimately select resistant individuals. For example, at least 27 species of insects have been described as resistant to Bacillus thuringiensis toxins. The resistance mechanisms are at least as diverse as those that are involved in resistance to chemical insecticides, some of them being common to bio-insecticides and chemical insecticides. This analysis highlights the specific properties of bio-insecticides that the scientific community should use to provide a better sustainability of these products.

  17. Trimethoxybenzene- and trimethylbenzene-based compounds bearing imidazole, indole and pyrrole groups as recognition units: synthesis and evaluation of the binding properties towards carbohydrates.

    Science.gov (United States)

    Rosien, Jan-Ruven; Seichter, Wilhelm; Mazik, Monika

    2013-10-14

    The aim of the study was to evaluate the potential of trimethoxybenzene- and trimethylbenzene-based compounds bearing imidazole or indole groups as recognition sites in the complexation of carbohydrates. Representatives of these compounds were prepared and their binding properties toward selected carbohydrates evaluated. The results of the binding studies were compared with those obtained for the prepared pyrrole bearing analogues and for the previously described triethylbenzene-based receptors.

  18. A Convenient Method for the Preparation of 1,5-Diaryl-3-(arylamino)-I H-pyrrol-2(5 H)-ones

    Institute of Scientific and Technical Information of China (English)

    Ghashang, Majid; Shaterian, Hamid Reza~

    2011-01-01

    A simple and eco-friendly method for the preparation of 1,5-diaryl-3-(arylamino)-lH-pyrrol-2(5H)-ones via the cyclo-condensation reaction of aldehydes, amines and ethyl pyruvate in the presence of silica supported ferric chlo- ride (SiO2-FeCl3) as reusable heterogeneous catalyst is described. The present methodology offers several advantages such as excellent yields, simple procedure and short reaction times.

  19. Synthesis and Charge Transport Properties of Polymers Derived from Oxidation of 1-H-1’(6-pyrrol-1-yl)-hexyl-4,4’-bipyridinium

    Science.gov (United States)

    1988-08-15

    platinized poly(3- methylthiophene),7b a viologen /quinone polymer, 9 ferrocyanide-loaded protonated poly(4-vinylpyridine),l 0 and electroactive metal oxides...article describes the synthesis and electrochemical properties of redox polymers, having a poly- pyrrole backbone and viologen subunits, derived from...study aspects of the charge transport behavior of the viologen redox system. Poly(P-V-Me2 ) and poly(P-V-H2+ ) have been used to investigate the

  20. Synthese des ABCD-Ringsystems und absolute Stereochemie des Pyrrol-Imidazol-Alkaloids Palau'amin aus dem Meeresschwamm Stylotella aurantium

    OpenAIRE

    Jacquot, Delphine

    2003-01-01

    Die Pyrrol-Imidazol-Alkaloide bilden eine Familie von etwa 90 Naturstoffen, die ausschliesslich aus Meeresschwämmen isoliert worden sind. Eine wichtige Untergruppe bilden die cyclischen Monomeren des Oroidins (14). Zu diesen gehört das in Phakellia mauritiana gefundene, cytotoxische Dibromphakellstatin (20), welches eine grosse Herausforderung an den Synthetiker repräsentiert. Die Struktur weist ein gespanntes tetracyclisches System mit benachbarten tertiären und quaternären stereogenen Zentr...

  1. 2,2′,5,5′-Tetramethyl-1,1′-(hexane-1,6-diyldi-1H-pyrrole

    Directory of Open Access Journals (Sweden)

    Ana C. Santos

    2009-07-01

    Full Text Available The molecule of the title compound, C18H28N2, composed of two 2,5-dimethylpyrrole groups linked by a hexane chain, lies across a crystallographic inversion centre. The mean plane of the pyrrole ring is almost perpendicular to the mean plane of the central chain, making a dihedral angle of 89.09 (8°. The crystal structure is stabilized by intermolecular C—H...π interactions.

  2. Interaction of derived polymers from pyrrole with biocompatible solutions; Interaccion de polimeros derivados de pirrol con soluciones biocompatibles

    Energy Technology Data Exchange (ETDEWEB)

    Lopez G, O. G.

    2010-07-01

    This work presents a study about the synthesis by plasma, the electric properties and superficial interaction of polymers derived from pyrrole doped with Iodine with potential use as bio material. Poly-pyrrole is a semiconductor and biocompatible polymer with potential application in the development of artificial muscles and implants where the electric interaction between cells and material is an important variable. The syntheses were made at 13.5 MHz in a glass tubular reactor of 1500 cm{sup 3} with electrodes of 6.5 cm diameter and stainless steel flanges. An electrode was connected to the RF terminal of the power supply that is combined with a matching coupling resistance. The monomer and dopant used in this work were pyrrole and Iodine respectively, in closed containers. They were vaporized and injected separately into the reactor at room temperature and 0.1 mbar. The vapors of the reagents mixed freely in the reactor. The synthesis time was 240 min at 40, 60, 80 and 100 W. The polymers were obtained as thin films adhered to the reactor walls. The films were washed and swollen with distilled water and removed from the reactor walls with a small spatula. The polymers were irradiated with gamma rays at 18 and 22 KGy. Due to the fact that the doses are cumulative, the final dose applied was 40 KGy. The polymers characterization was carried out by Fourier Transform Infrared Spectroscopy, thermogravimetric analysis (TGA), scanning electron microscopy, contact angle, electrical conductivity and X-ray diffraction. The analyses indicates that the polymers have very similar structure in almost the entire power range, showing C-O, C=C, C-H, O-H, N-H bonds with a predominantly amorphous structure. The TGA analyses showed that the material has 4 or 5 loses of material. The first one starts after that 115 C except for the material irradiated at 40 KGy, this one begins in 87 C, the second one is in the interval of 196 and 295 C, the third one between 311 and 500 C, and the

  3. Efficacy of an insecticide paint against insecticide-susceptible and resistant mosquitoes - Part 1: Laboratory evaluation

    Directory of Open Access Journals (Sweden)

    Carnevale Pierre

    2010-11-01

    Full Text Available Abstract Background The main malaria vector Anopheles gambiae and the urban pest nuisance Culex quinquefasciatus are increasingly resistant to pyrethroids in many African countries. There is a need for new products and strategies. Insecticide paint Inesfly 5A IGR™, containing two organophosphates (OPs, chlorpyrifos and diazinon, and insect growth regulator (IGR, pyriproxyfen, was tested under laboratory conditions for 12 months following WHOPES Phase I procedures. Methods Mosquitoes used were laboratory strains of Cx. quinquefasciatus susceptible and resistant to OPs. The paint was applied at two different doses (1 kg/6 m2 and 1 kg/12 m2 on different commonly used surfaces: porous (cement and stucco and non-porous (softwood and hard plastic. Insecticide efficacy was studied in terms of delayed mortality using 30-minute WHO bioassay cones. IGR efficacy on fecundity, fertility and larval development was studied on OP-resistant females exposed for 30 minutes to cement treated and control surfaces. Results After treatment, delayed mortality was high (87-100% even against OP-resistant females on all surfaces except cement treated at 1 kg/12 m2. Remarkably, one year after treatment delayed mortality was 93-100% against OP-resistant females on non-porous surfaces at both doses. On cement, death rates were low 12 months after treatment regardless of the dose and the resistance status. Fecundity, fertility and adult emergence were reduced after treatment even at the lower dose (p -3. A reduction in fecundity was still observed nine months after treatment at both doses (p -3 and adult emergence was reduced at the higher dose (p -3. Conclusions High mortality rates were observed against laboratory strains of the pest mosquito Cx. quinquefasciatus susceptible and resistant to insecticides. Long-term killing remained equally important on non-porous surfaces regardless the resistance status for over 12 months. The paint's effect on fecundity, fertility and

  4. Toxicity, synergism, and neurological effects of novel volatile insecticides in insecticide-susceptible and -resistant Drosophila strains.

    Science.gov (United States)

    Nguyen, Sam N; Song, Cheol; Scharf, Michael E

    2007-04-01

    Naturally derived volatile insecticides from the heterobicyclic and formate ester classes were investigated using a combination of volatility and synergist bioassays. In these studies, Drosophila melanogaster (Meigen) was used as a model for other medically important dipterans. In addition to a susceptible strain (Canton-S), three mutant strains were tested that included a strain resistant by P450-based metabolism (Hikone-R) and two resistant neurological mutant strains; one voltage-gated sodium channel mutant (para(ts-1)) and one GABA-gated chloride channel mutant (Rdl). In general, the 11 tested insecticides displayed a diversity of toxicity, metabolism, and resistance characteristics that correlate with their structural diversity. Several important trends were revealed by these studies, including hydrolase- and cytochrome P450 (P450)-based activation, P450-based resistance, distinct patterns of neurological activity, and negative cross-resistance with established insecticides. These findings provide important insight into the metabolism and modes of action for the volatile insecticides. These findings also suggest potential approaches for insecticide deployment in integrated vector management and resistance management programs.

  5. Modeling the integration of parasitoid, insecticide, and transgenic insecticidal crop for the long-term control of an insect pest.

    Science.gov (United States)

    Onstad, David W; Liu, Xiaoxia; Chen, Mao; Roush, Rick; Shelton, Anthony M

    2013-06-01

    The tools of insect pest management include host plant resistance, biological control, and insecticides and how they are integrated will influence the durability of each. We created a detailed model of the population dynamics and population genetics of the diamondback moth, Plutella xylostella L., and its parasitoid, Diadegma insulare (Cresson), to study long-term pest management in broccoli Brassica oleracea L. Given this pest's history of evolving resistance to various toxins, we also evaluated the evolution of resistance to transgenic insecticidal Bt broccoli (expressing Cry1Ac) and two types of insecticides. Simulations demonstrated that parasitism provided the most reliable, long-term control of P. xylostella populations. Use of Bt broccoli with a 10% insecticide-free refuge did not reduce the long-term contribution of parasitism to pest control. Small refuges within Bt broccoli fields can delay evolution of resistance > 30 generations if resistance alleles are rare in the pest population. However, the effectiveness of these refuges can be compromised by insecticide use. Rainfall mortality during the pest's egg and neonate stages significantly influences pest control but especially resistance management. Our model results support the idea that Bt crops and biological control can be integrated in integrated pest management and actually synergistically support each other. However, the planting and maintenance of toxin-free refuges are critical to this integration.

  6. Insecticide Resistance in the Western Flower Thrips, Frankliniella occidentalis

    DEFF Research Database (Denmark)

    Jensen, Sten Erik

    The western flower thrips, Frankliniella occidentalis (Pergande) is a serious pest on a wide range of crops throughout the world. In Denmark F. occidentalis is a pest in greenhouses. F. occidentalis is difficult to control with insecticides because of its thigmokinetic behaviour and resistance...... to insecticides. Since F. occidentulis spread to become a worldwide pest in 1980’es, resistance to a number of different insecticides has been shown in many populations of F. occidentalis. This flower thrips has the potential of fast development of resistance owing to the short generation time, high fecundity......, and a haplodiploid breeding system. Although resistance in F. occidentalis is a common problem, the underlying mechanisms conferring resistance have only been studied on a few populations. A purpose of this study was to gain more knowledge about possible resistance mechanisms in F. occidentulis and, furthermore...

  7. Insecticide Usage and Chemical Contamination Assessment in Asiatic Pennywort

    Science.gov (United States)

    Bumroongsook, S.

    2017-07-01

    The insecticide usage in commercially grown asiatic pennywort plantations in Nakhonpatum and Nonthaburi province, Thailand was surveyed during January-June, 2016. The results showed that asiatic pennywort cuttworms was leaf destructive and caused the most damge to the production. The growers used organophosphate insecticides to control the caterpillars the most, followed by pyrethoid, abamectin, carbamate and organochlorine, respectively. The chemical contaminants of pennywort from 9 fresh markets in Bangkok was monitored, the result indicated that lead was not detected in the samples. The amount of arsenic was less than 0.075 mg / kg. The insecticide residue measurement of dicofol, chlorpyrifos and methidathion was 0.98, 2.84 and 0.46 mg / kg, respectively.

  8. Antitumor Activity of a 5-Hydroxy-1H-Pyrrol-2-(5H-One-Based Synthetic Small Molecule In Vitro and In Vivo.

    Directory of Open Access Journals (Sweden)

    Yunyun Geng

    Full Text Available Alternative chemo-reagents are in great demand because chemotherapy resistance is one of the major challenges in current cancer treatment. 5-hydoxy-1H-pyrrol-2-(5H-one is an important N-heterocyclic scaffold that is present in natural products and medicinal chemistry. However, its antitumor activity has not been systematically explored. In this study, we screened a panel of 5-hydoxy-1H-pyrrol-2-(5H-one derivatives and identified compound 1d as possessing strong anti-proliferative activity in multiple cancer cell lines. Cell cycle analysis revealed that 1d can induce S-phase cell cycle arrest and that HCT116 was sensitive to 1d-induced apoptosis. Further analysis indicated that 1d preferentially induced DNA damage and p53 activation in HCT116 cells and that 1d-induced apoptosis is partly dependent on p53. Furthermore, we showed that 1d significantly suppressed tumor growth in xenograft tumor models in vivo. Taken together, our results suggest that 5-hydoxy-1H-pyrrol-2-(5H-one derivatives bear potential antitumor activity and that 1d is an effective agent for cancer treatment.

  9. Synthesis and antitumor activity of duocarmycin derivatives: modification at C-8 position of A-ring pyrrole compounds bearing the simplified DNA-binding groups.

    Science.gov (United States)

    Amishiro, N; Nagamura, S; Murakata, C; Okamoto, A; Kobayashi, E; Asada, M; Gomi, K; Tamaoki, T; Okabe, M; Yamaguchi, N; Yamaguchi, K; Saito, H

    2000-02-01

    A series of the 8-O-substituted A-ring pyrrole derivatives of duocarmycin bearing the simplified DNA-binding moieties such as cinnamoyl or heteroarylacryloyl groups were synthesized, and evaluated for in vitro anticellular activity against HeLa S3 cells and in vivo antitumor activity against murine sarcoma 180 in mice. In addition, the stability of the 8-O-substituted analogues in aqueous solution and the conversion to their active form (cyclopropane compound) from the 8-O-substituted analogues in mice or human serum were examined. The 8-O-substituted A-ring pyrrole derivatives bearing the simplified DNA-binding moieties showed remarkably potent in vivo antitumor activity and low peripheral blood toxicity compared with the 8-O-substituted A-ring pyrrole derivatives having the trimethoxyindole skeleton in segment-B (Seg-B), which were equal to 8-O-[(N-methylpiperazinyl)carbonyl] derivatives of 4'-methoxycinnamates and 4'-methoxy-beta-heteroarylacrylates. Moreover, among 8-O-substituted analogues, several compounds can be chemically or enzymatically converted to their active form in human serum. This result indicated that new 8-O-substituted derivatives were different prodrugs from KW-2189 and 8-O-substituted analogues being the same type of prodrug as KW-2189.

  10. 5-Benzoyl-2-(5-bromo-1H-indol-3-yl-4-(4-methoxyphenyl-1H-pyrrole-3-carbonitrile

    Directory of Open Access Journals (Sweden)

    G. Vimala

    2016-05-01

    Full Text Available In the title compound, C27H18BrN3O, the indole and central pyrrole ring systems are inclined to one another by 13.15 (15°. The carbonitrile group is almost coplanar with its attached pyrrole ring, the C[triple-bond]N bond making a dihedral angle of 1.9 (2° with the ring plane. The 4-methoxybenzene ring and the benzoyl ring are inclined to the central pyrrole ring by 55.1 (2 and 51.5 (2°, respectively. The dihedral angle between these two benzene rings is 37.68 (17°. In the crystal, molecules are linked by pairs of N—H...N hydrogen bonds, forming inversion dimers with an R22(16 ring motif. The dimers are linked by offset π–π interactions [intercentroid distance = 3.614 (2 Å], which leads to the formation of chains propagating in the [010] direction.

  11. A mixed experimental and DFT study on ethyl 4-[3-(4-dimethylamino-phenyl)-acryloyl]-3,5-dimethyl-1H-pyrrole-2-carboxylate

    Science.gov (United States)

    Singh, R. N.; Rawat, Poonam; Sahu, Sangeeta

    2014-05-01

    A new pyrrole containing chalcone, ethyl 4-[3-(4-dimethylamino-phenyl)-acryloyl]-3,5-dimethyl-1H-pyrrole-2-carboxylate (EDPADPC) derived from ethyl 4-acetyl-3,5-dimethyl-1H-pyrrole-2-carboxylate and 4-dimethylamino-benzaldehyde has been characterized by spectroscopic techniques (1H NMR, UV-Visible, FT-IR) and results have been compared by means of theoretical findings. A combined experimental and theoretical vibrational analysis identified red shifts in vNH and vCO indicating the formation of dimer in the solid state. The binding energy of dimer has been evaluated as 9.89 kcal/mol and the strength and nature of hydrogen bonding have also been analyzed in detail. The DFT derived reactivity descriptors indicate that EDPADPC is suitable for the formation of new heterocyclic compounds. The first hyperpolarizability (β0) of EDPADPC has been computed and found to be 62.0226 × 10-30 indicating its use as non-linear optical (NLO) material.

  12. REVIEW ON THE EFFICACY OF INSECTICIDES AND BIO-INSECTICIDES (PATHOGEN AND IGR AGAINST VECTOR DISEASES EVALUATIONS CONDUCTED BY VRCRU (2001-2002

    Directory of Open Access Journals (Sweden)

    Damar Tri Boewono

    2012-11-01

    Full Text Available Vector and Reservoir Control Research Unit (VRCRU Salatiga, as WHO Collaborating Center for Pesticide Evaluation, has evaluate the efficacy of several new insecticides for various purposes especially for the registration in Indonesia Pesticide Commission. This unit has evaluated insecticides inc ollaboration with pesticide companies and WHO. The aim of the studies were to provide the efficacy and residual effect of insecticides against vector disease. Such as malaria, dengue haemorrhagic fever (DHF, filariasis, plague, diarrhea, etc. The studied insecticides in the unit were belong to Organophosphate, Carbamate and Synthetic Phyrethroid compounds and also bio-insecticides (pathogen & Insect Grow Regulator/IGR. Various insecticide applications were performed against the adult, e.g. residual spraying (IRS, thermal fogging, Ultra Low Volume (ULV, bed nets impregnation. The study was also conducted to evaluate the efficacy of insecticides, bio-insecticides (pathogen and IGR against mosquito larvae as well as insecticides against fleas and cockroaches. This paper is an overall review of the related studies which were conducted on 2001-2002. Keywords: efficacy, bio-insecticides, vector disease

  13. Optimal Cotton Insecticide Application Termination Timing: A Meta-Analysis.

    Science.gov (United States)

    Griffin, T W; Zapata, S D

    2016-08-01

    The concept of insecticide termination timing is generally accepted among cotton (Gossypium hirsutum) researchers; however, exact timings are often disputed. Specifically, there is uncertainty regarding the last economic insecticide application to control fruit-feeding pests including tarnished plant bug (Lygus lineolaris (Palisot de Beauvois)), boll weevil (Anthonomus grandis), bollworm (Helicoverpa zea), tobacco budworm (Heliothis virescens), and cotton fleahopper (Pseudatomoscelis seriatus). A systematic review of prior studies was conducted within a meta-analytic framework. Nine publicly available articles were amalgamated to develop an optimal timing principle. These prior studies reported 53 independent multiple means comparison field experiments for a total of 247 trial observations. Stochastic plateau theory integrated with econometric meta-analysis methodology was applied to the meta-database to determine the shape of the functional form of both the agronomic optimal insecticide termination timing and corresponding yield potential. Results indicated that current university insecticide termination timing recommendations are later than overall estimated timing suggested. The estimated 159 heat units (HU) after the fifth position above white flower (NAWF5) was found to be statistically different than the 194 HU termination used as the status quo recommended termination timing. Insecticides applied after 159 HU may have been applied in excess, resulting in unnecessary economic and environmental costs. Empirical results also suggested that extending the insecticide termination time by one unit resulted in a cotton lint yield increase of 0.27 kilograms per hectare up to the timing where the plateau began. Based on economic analyses, profit-maximizing producers may cease application as soon as 124 HU after NAWF5. These results provided insights useful to improve production systems by applying inputs only when benefits were expected to be in excess of the

  14. Insecticide resistance in vector Chagas disease: evolution, mechanisms and management.

    Science.gov (United States)

    Mougabure-Cueto, Gastón; Picollo, María Inés

    2015-09-01

    Chagas disease is a chronic parasitic infection restricted to America. The disease is caused by the protozoa Trypanosoma cruzi, which is transmitted to human through the feces of infected triatomine insects. Because no treatment is available for the chronic forms of the disease, vector chemical control represents the best way to reduce the incidence of the disease. Chemical control has been based principally on spraying dwellings with insecticide formulations and led to the reduction of triatomine distribution and consequent interruption of disease transmission in several areas from endemic region. However, in the last decade it has been repeatedly reported the presence triatomnes, mainly Triatoma infestans, after spraying with pyrethroid insecticides, which was associated to evolution to insecticide resistance. In this paper the evolution of insecticide resistance in triatomines is reviewed. The insecticide resistance was detected in 1970s in Rhodnius prolixus and 1990s in R. prolixus and T. infestans, but not until the 2000s resistance to pyrthroids in T. infestans associated to control failures was described in Argentina and Bolivia. The main resistance mechanisms (i.e. enhanced metabolism, altered site of action and reduced penetration) were described in the T. infestans resistant to pyrethrods. Different resistant profiles were demonstrated suggesting independent origin of the different resistant foci of Argentina and Bolivia. The deltamethrin resistance in T. infestans was showed to be controlled by semi-dominant, autosomally inherited factors. Reproductive and developmental costs were also demonstrated for the resistant T. infestans. A discussion about resistance and tolerance concepts and the persistence of T. infestans in Gran Chaco region are presented. In addition, theoretical concepts related to toxicological, evolutionary and ecological aspects of insecticide resistance are discussed in order to understand the particular scenario of pyrethroid

  15. Insecticide resistance status in Anopheles gambiae in southern Benin

    Directory of Open Access Journals (Sweden)

    Corbel Vincent

    2010-03-01

    Full Text Available Abstract Background The emergence of pyrethroid resistance in Anopheles gambiae has become a serious concern to the future success of malaria control. In Benin, the National Malaria Control Programme has recently planned to scaling up long-lasting insecticidal nets (LLINs and indoor residual spraying (IRS for malaria prevention. It is, therefore, crucial to monitor the level and type of insecticide resistance in An. gambiae, particularly in southern Benin where reduced efficacy of insecticide-treated nets (ITNs and IRS has previously been reported. Methods The protocol was based on mosquito collection during both dry and rainy seasons across forty districts selected in southern Benin. Bioassay were performed on adults collected from the field to assess the susceptibility of malaria vectors to insecticide-impregnated papers (permethrin 0.75%, delthamethrin 0.05%, DDT 4%, and bendiocarb 0.1% following WHOPES guidelines. The species within An. gambiae complex, molecular form and presence of kdr and ace-1 mutations were determined by PCR. Results Strong resistance to permethrin and DDT was found in An. gambiae populations from southern Benin, except in Aglangandan where mosquitoes were fully susceptible (mortality 100% to all insecticides tested. PCR showed the presence of two sub-species of An. gambiae, namely An. gambiae s.s, and Anopheles melas, with a predominance for An. gambiae s.s (98%. The molecular M form of An. gambiae was predominant in southern Benin (97%. The kdr mutation was detected in all districts at various frequency (1% to 95% whereas the Ace-1 mutation was found at a very low frequency (≤ 5%. Conclusion This study showed a widespread resistance to permethrin in An. gambiae populations from southern Benin, with a significant increase of kdr frequency compared to what was observed previously in Benin. The low frequency of Ace-1 recorded in all populations is encouraging for the use of bendiocarb as an alternative insecticide to

  16. Novel AChE inhibitors for sustainable insecticide resistance management.

    Directory of Open Access Journals (Sweden)

    Haoues Alout

    Full Text Available Resistance to insecticides has become a critical issue in pest management and it is particularly chronic in the control of human disease vectors. The gravity of this situation is being exacerbated since there has not been a new insecticide class produced for over twenty years. Reasoned strategies have been developed to limit resistance spread but have proven difficult to implement in the field. Here we propose a new conceptual strategy based on inhibitors that preferentially target mosquitoes already resistant to a currently used insecticide. Application of such inhibitors in rotation with the insecticide against which resistance has been selected initially is expected to restore vector control efficacy and reduce the odds of neo-resistance. We validated this strategy by screening for inhibitors of the G119S mutated acetylcholinesterase-1 (AChE1, which mediates insensitivity to the widely used organophosphates (OP and carbamates (CX insecticides. PyrimidineTrione Furan-substituted (PTF compounds came out as best hits, acting biochemically as reversible and competitive inhibitors of mosquito AChE1 and preferentially inhibiting the mutated form, insensitive to OP and CX. PTF application in bioassays preferentially killed OP-resistant Culex pipiens and Anopheles gambiae larvae as a consequence of AChE1 inhibition. Modeling the evolution of frequencies of wild type and OP-insensitive AChE1 alleles in PTF-treated populations using the selectivity parameters estimated from bioassays predicts a rapid rise in the wild type allele frequency. This study identifies the first compound class that preferentially targets OP-resistant mosquitoes, thus restoring OP-susceptibility, which validates a new prospect of sustainable insecticide resistance management.

  17. Do insecticide-treated bednets have an effect on malaria vectors?

    NARCIS (Netherlands)

    Takken, W.

    2002-01-01

    The use of insecticide-treated bednets (ITNs) has been widely adopted as an important method for malaria control. Few data exist on effects of ITNs on mosquito biology and ecology, other than the development of insecticide resistance against the insecticides used. There is no hard evidence that the

  18. New Insecticides and Repellents For Use on Mosquitoes and Sand Flies

    Science.gov (United States)

    The major emphasis of our research is on the discovery and development of new insecticides for personal protection. The insecticide discovery effort involves structure-activity modeling to correlate molecular structure and electronic properties with repellent and/or insecticidal activity. Models a...

  19. Toxaphene, a complex mixture of polychloroterpenes and a major insecticide, is mutagenic

    Energy Technology Data Exchange (ETDEWEB)

    Hooper, N.K.; Ames, B.N.; Saleh, M.A.; Casida, J.E.

    1979-08-10

    Toxaphene, the most widely used chlorinated insecticide, is mutagenic in the Salmonella test without requiring liver homogenate for activity. This insecticide is a complex mixture (more than 177 polychloroterpenes) with carcinogenic activity in rodents. Some but not all of the mutagenic components are easily separated from the insecticidal ingredients.

  20. Haematological parameters as bioindicators of insecticide exposure in teleosts.

    Science.gov (United States)

    Singh, Narendra Nath; Srivastava, Anil Kumar

    2010-06-01

    Haematological parameters, such as erythrocyte and leucocyte count, erythrocyte indices and thrombocyte number vis-a-vis coagulation of blood has been considered bioindicators of toxicosis in fish following exposure to organochlorine, organophosphate, carbamate and pyrethroid insecticides. This review deals with the effects of insecticides on the morphology of red blood cells, total erythrocyte count, haemoglobin content, haematocrit, mean corpuscular volume, mean corpuscular haemoglobin, mean corpuscular haemoglobin concentration, erythrocyte sedimentation rate, total and differential leucocyte counts, thrombocyte count and clotting time in the peripheral blood of a number of teleosts. The review also takes stock of knowledge of the subject and explores prospects of additional research in the related area.

  1. Insecticide applications to soil contribute to the development of Burkholderia mediating insecticide resistance in stinkbugs.

    Science.gov (United States)

    Tago, Kanako; Kikuchi, Yoshitomo; Nakaoka, Sinji; Katsuyama, Chie; Hayatsu, Masahito

    2015-07-01

    Some soil Burkholderia strains are capable of degrading the organophosphorus insecticide, fenitrothion, and establish symbiosis with stinkbugs, making the host insects fenitrothion-resistant. However, the ecology of the symbiotic degrading Burkholderia adapting to fenitrothion in the free-living environment is unknown. We hypothesized that fenitrothion applications affect the dynamics of fenitrothion-degrading Burkholderia, thereby controlling the transmission of symbiotic degrading Burkholderia from the soil to stinkbugs. We investigated changes in the density and diversity of culturable Burkholderia (i.e. symbiotic and nonsymbiotic fenitrothion degraders and nondegraders) in fenitrothion-treated soil using microcosms. During the incubation with five applications of pesticide, the density of the degraders increased from less than the detection limit to around 10(6)/g of soil. The number of dominant species among the degraders declined with the increasing density of degraders; eventually, one species predominated. This process can be explained according to the competitive exclusion principle using V(max) and K(m) values for fenitrothion metabolism by the degraders. We performed a phylogenetic analysis of representative strains isolated from the microcosms and evaluated their ability to establish symbiosis with the stinkbug Riptortus pedestris. The strains that established symbiosis with R. pedestris were assigned to a cluster including symbionts commonly isolated from stinkbugs. The strains outside the cluster could not necessarily associate with the host. The degraders in the cluster predominated during the initial phase of degrader dynamics in the soil. Therefore, only a few applications of fenitrothion could allow symbiotic degraders to associate with their hosts and may cause the emergence of symbiont-mediated insecticide resistance.

  2. Electrodeposition of (pyrrole-co-phenol) on steel surfaces in mixed electrolytes of oxalic acid and DBSA

    Energy Technology Data Exchange (ETDEWEB)

    Mahmoudian, M.R., E-mail: M_R_mahmoudian@yahoo.com [Department of Chemistry, University of Malaya, Kuala Lumpur 50603 (Malaysia); Alias, Y.; Basirun, W.J. [Department of Chemistry, University of Malaya, Kuala Lumpur 50603 (Malaysia)

    2010-12-01

    Poly (pyrrole-co-phenol) (co-PyPh) was synthesised using cyclic voltammetry in the mixture of dodecyl benzene sulphonic acid (DBSA) with oxalic acid solution on steel electrodes. The morphology and compositions were characterized by Field Emission Scanning Electron Microscopy (FESEM), Fourier Transform Infrared Spectroscopy (FTIR) techniques and Energy-dispersive X-ray spectroscopy (EDX). Electrode/co-PyPh/electrolyte system was studied in 0.1 M NaCl solutions by Electrochemical Impedance Spectroscopy (EIS). The Warburg impedance observed in mid frequency region is an evidence of the effective barrier behaviour of coating. The results of EDX indicate that the content of doped sulphur can influence the morphology of co-PyPh. Three dissimilar morphologies of co-PyPh and different amount of doped sulphur in co-PyPh are observed. The existence of phenol monomer leads to a decrease in the amount of doped sulphur in co-PyPh compared with synthesised polypyrrole (PPy) in the same environment.

  3. Electrochemical characteristics of coated steel with poly(N-methyl pyrrole) synthesized in presence of ZnO nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Mahmoudian, M.R., E-mail: M_R_mahmoudian@yahoo.com [Department of Chemistry, University of Malaya, Kuala Lumpur 50603 (Malaysia); Department of Chemistry, Masjed-Soleiman Branch, Islamic Azad University, Masjed-Soleiman (Iran, Islamic Republic of); Basirun, W.J.; Alias, Y. [Department of Chemistry, University of Malaya, Kuala Lumpur 50603 (Malaysia); Khorsand Zak, A. [Low Dimensional Materials Research Center, Department of Physics, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2011-10-31

    Poly(N-methyl pyrrole) (PMPy) coating was electrodeposited on steel substrates in mixed electrolytes of dodecyl benzene sulphonic acid with oxalic acid in the absence and the presence of ZnO nanoparticles (NPs). The morphology and compositions were characterized by Field Emission Scanning Electron Microscopy (FESEM), Fourier Transform Infrared Spectroscopy and Energy-dispersive X-ray spectroscopy. Electrode/coating/electrolyte system was studied by Electrochemical Impedance Spectroscopy. The comparison between the pore resistance (R{sub po}) of synthesized PMPy in the absence and presence of ZnO NPs indicated that the existence of ZnO increased the R{sub po} of the coating. The FESEM micrographs indicated that the size of micro-spherical grains in the morphology of PMPy is significantly reduced and the surface area of PMPy is increased with the presence of ZnO NPs. The increase of the ability to interact with the ions liberated during the corrosion reaction of steel and the increase of the rate probability for the occurrence of cathodic reduction of oxygen on the PMPy with the increase of the surface area can be considered as reasons for improvement of protective properties of synthesized PMPy in the presence of ZnO NPs.

  4. Quantitation of Pyrrole-Imidazole Polyamide in Rat Plasma by High-Performance Liquid Chromatography Coupled with UV Detection

    Directory of Open Access Journals (Sweden)

    Tomonori Kamei

    2012-01-01

    Full Text Available A simple and robust method using high-performance liquid chromatography with UV detection was developed and validated for the determination of six pyrrole-imidazole (PI polyamides (HN.49, TGF-β1f, TGF-β1t, HN.50f, HN.50t, and LOX-1 in rat plasma. After the plasma proteins were precipitated with methanol containing phenacetin as an internal standard, the analytes were separated on a Luna C18 (2 (5 μm, 4.6×150 mm. Calibration curves were linear over the range of 0.5 to 200 μg/mL for HN.49, 0.25 to 200 μg/mL for TGF-β1f, TGF-β1t, HN.50t, and LOX-1, 1 to 200 μg/mL for HN.50f in rat plasma. The inter- and intraday precision were below 15%, and the accuracy was within 15% at the quality controls. The validated method was successfully applied to sample analysis for the pharmacokinetic study.

  5. Characterization of poly pyrrole/montmorillonite electro polymerised onto Pt; Caracterizacao de filmes PPy/montmorilonita eletropolimerizados sobre Pt

    Energy Technology Data Exchange (ETDEWEB)

    Castagno, K.R.L., E-mail: katiarlc@pelotas.ifsul.edu.b [Instituto Federal Sul-rio-grandense (IFSul), RS (Brazil). Dept. de Quimica; Azambuja, D.S.; Dalmoro, V.; Mauller, R.S. [Universidade Federal do Rio Grande do Sul (UFRGS), Pelotas, RS (Brazil). Inst. de Quimica

    2010-07-01

    In this study films of polypyrrole/montmorillonite (PPy/MT) were electropolymerized on platinum in order to evaluate the performance of this technique in the preparation of nanocomposite materials and to determine the thermal properties and conductivity of the composites. The films were synthesized from a solution containing pyrrole, dodecylbenzene sulfonate, acid and two types of clays: montmorillonite-Na + (MT-Na) and montmorillonite-30B (MT-M). The characterization of the films we have used FT-IR, TEM, XRD, TGA, DSC and resistivity measurement by the four-point van der Pauw method. The study showed that the adopted method of exfoliation and the electropolymerization method used, allows obtaining nanocomposite materials. Analyses of FT-IR, TEM and XRD show that the clays are exfoliated in the polymer matrix. Thermal analysis of the films indicates that the addition of clay reflects an enhancement in the thermal properties of the matrix of PPy, but decreases the conductivity of the same. (author)

  6. Effect of non-electroactive additives on the early stage pyrrole electropolymerization on indium tin oxide electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Castro-Beltran, A. [Facultad de Ingeniería Mecánica y Eléctrica, Universidad Autónoma de Nuevo León, Ave. Pedro de Alba s/n, Ciudad Universitaria, C.P. 66451 San Nicolás de los Garza, N.L. (Mexico); Centro de Innovación Investigación y Desarrollo en Ingeniería y Tecnología (CIIDIT), Universidad Autónoma de Nuevo León, PIIT-Monterrey C.P. 66600 Apodaca, N.L. (Mexico); Dominguez, C.; Bahena-Uribe, D. [Centro Investigación en Ingeniería y Ciencias Aplicadas (CIICAp), Universidad Autónoma del Estado de Morelos, Av. Universidad 1001, Col. Chamilpa, C.P. 62209 Cuernavaca, Mor. (Mexico); Sepulveda-Guzman, S., E-mail: selene.sepulvedagz@uanl.edu.mx [Facultad de Ingeniería Mecánica y Eléctrica, Universidad Autónoma de Nuevo León, Ave. Pedro de Alba s/n, Ciudad Universitaria, C.P. 66451 San Nicolás de los Garza, N.L. (Mexico); Centro de Innovación Investigación y Desarrollo en Ingeniería y Tecnología (CIIDIT), Universidad Autónoma de Nuevo León, PIIT-Monterrey C.P. 66600 Apodaca, N.L. (Mexico); Cruz-Silva, R. [Research Center for Exotic NanoCarbon, Shinshu University, 4-17-1 Wakasato, Nagano 380-8553 (Japan)

    2014-09-01

    The use of non-electroactive additives during electrodeposition of conducting polymers has long been used to modify the properties of deposited films. These additives can improve the adhesion, and not only change the morphology and deposition rate but also modify the chemical composition of the electrodeposited polymer. Several compounds have been used to modify deposition of polypyrrole; however, there is no systematic study of these compounds. In this work, we comparatively studied several water soluble chemical compounds, a cationic polymer, an anionic polymer, a cationic surfactant, and an anionic surfactant during potentiostatic electrodeposition of polypyrrole. In order to study the effect of these compounds on the interface, where the electrochemical polymerization takes place, we used electrochemical impedance spectroscopy. The morphology during the initial stage of growth was studied by atomic force microscopy, whereas the resulting polypyrrole films were observed by scanning electron microscopy. - Highlights: • Early-stage polymerization polypyrrole particles on indium tin oxide (ITO). • Anionic additives promote pyrrole oxidation and polypyrrole film growth on ITO. • Cationic polyelectrolyte promotes adhesion between ITO and polypyrrole film. • Non-electroactive additives strongly influence polypyrrole nucleation on ITO.

  7. Electropolymerization of pyrrole and immobilization of glucose oxidase in a flow system: influence of the operating conditions on analytical performance.

    Science.gov (United States)

    Vidal, J C; Garcia, E; Castillo, J R

    1998-03-01

    The in situ potentiostatic electropolymerization of pyrrole (Py) on a Pt electrode in a thin-layer amperometric cell and the entrapment of the enzyme glucose oxidase (GOx) for the determination of glucose are reported. Polypyrrole (PPy) is directly formed by continuous passage of a buffered solution of the monomer (0.4 M) and enzyme (250 U mL-1) at pH 7 at a flow rate of 0.05-0.1 mL min-1 under a constant applied potential of +0.85 V vs Ag/AgCl decreases. The electrosynthesis of PPy by injection of 500 microL of a Py + GOx solution in a carrier electrolyte consisting of 0.05 M phosphate buffer and 0.1 M KCl at pH 7.0 was also assayed. The influence of the electropolymerization conditions on the analytical response of the sensor to glucose was investigated. The analytical performance of the PPy/GOx sensor was also studied in terms of durability and storage life, as well as selectivity against electroactive species such as ascorbic acid and uric acid as a function of the thickness of the polymer film formed.

  8. Biofabrication Using Pyrrole Electropolymerization for the Immobilization of Glucose Oxidase and Lactate Oxidase on Implanted Microfabricated Biotransducers

    Directory of Open Access Journals (Sweden)

    Christian N. Kotanen

    2014-03-01

    Full Text Available The dual responsive Electrochemical Cell-on-a-Chip Microdisc Electrode Array (ECC MDEA 5037 is a recently developed electrochemical transducer for use in a wireless, implantable biosensor system for the continuous measurement of interstitial glucose and lactate. Fabrication of the biorecognition membrane via pyrrole electropolymerization and both in vitro and in vivo characterization of the resulting biotransducer is described. The influence of EDC-NHS covalent conjugation of glucose oxidase with 4-(3-pyrrolyl butyric acid (monomerization and with 4-sulfobenzoic acid (sulfonization on biosensor performance was examined. As the extent of enzyme conjugation was increased sensitivity decreased for monomerized enzymes but increased for sulfonized enzymes. Implanted biotransducers were examined in a Sprague-Dawley rat hemorrhage model. Resection after 4 h and subsequent in vitro re-characterization showed a decreased sensitivity from 0.68 (±0.40 to 0.22 (±0.17 µA·cm−2·mM−1, an increase in the limit of detection from 0.05 (±0.03 to 0.27 (±0.27 mM and a six-fold increase in the response time from 41 (±18 to 244 (±193 s. This evidence reconfirms the importance of biofouling at the bio-abio interface and the need for mitigation strategies to address the foreign body response.

  9. Electrochemical synthesis of Poly[3, 4-Propylenedioxythiophene-co-N-Phenylsulfonyl Pyrrole]: Morphological, electrochemical and spectroscopic characterization

    Directory of Open Access Journals (Sweden)

    2011-06-01

    Full Text Available Electroactive random copolymers of 3,4-Propylenedioxythiophene (ProDOT and N-Phenylsulfonyl Pyrrole (PSP were electrochemically synthesized on single carbon fiber microelectrode (SCFME by cyclic voltammetry (CV. Fourier Transform Infrared-Attenuated Total Reflectance (FTIR-ATR measurements indicate the inclusion of PSP into the copolymer structure. The influence of feed ratios on the copolymers was studied by CV and electrochemical impedance spectroscopy (EIS and equivalent circuit modelling (ECM. The morphologies and film thicknesses of copolymers were characterized by scanning electron microscopy (SEM and atomic force microscopy (AFM. The results have shown that the principal changes in morphology, conductivity, porous nature and thickness of Poly(ProDOT-co-PSP film depend on the concentration of PSP. The strong electron-withdrawing sulfonyl group substitution on PSP significantly inhibited electrochemical copolymerization. Semicircular characteristics at Nyquist plots reflected an increasing trend with the increase of PSP concentration in the feed at high frequency. The semicircular characteristic of the copolymer film is useful for the bioelectrochemical sensor applications.

  10. Sub-10 nm Platinum Nanocrystals with Size and Shape Control: Catalytic Study for Ethylene and Pyrrole Hydrogenation

    Energy Technology Data Exchange (ETDEWEB)

    Tsung, Chia-Kuang; Kuhn, John N.; Huang, Wenyu; Aliaga, Cesar; Hung, Ling-I; Somorjai, Gabor A.; Yang, Peidong

    2009-03-02

    Platinum nanocubes and nanopolyhedra with tunable size from 5 to 9 nm were synthesized by controlling the reducing rate of metal precursor ions in a one-pot polyol synthesis. A two-stage process is proposed for the simultaneous control of size and shape. In the first stage, the oxidation state of the metal ion precursors determined the nucleation rate and consequently the number of nuclei. The reaction temperature controlled the shape in the second stage by regulation of the growth kinetics. These well-defined nanocrystals were loaded into MCF-17 mesoporous silica for examination of catalytic properties. Pt loadings and dispersions of the supported catalysts were determined by elemental analysis (ICP-MS) and H2 chemisorption isotherms, respectively. Ethylene hydrogenation rates over the Pt nanocrystals were independent of both size and shape and comparable to Pt single crystals. For pyrrole hydrogenation, the nanocubes enhanced ring-opening ability and thus showed a higher selectivity to n-butylamine as compared to nanopolyhedra.

  11. Maleimides (1 H-pyrrole-2,5-diones) as molecular indicators of anoxygenic photosynthesis in ancient water columns

    Science.gov (United States)

    Grice, Kliti; Gibbison, Robert; Atkinson, Jane E.; Schwark, Lorenz; Eckardt, Christian B.; Maxwell, James R.

    1996-10-01

    Maleimides (1 H-pyrrole-2,5-diones), degradation products of photosynthetic tetrapyrrole pigments, have been found for the first time in the polar fraction of the solvent extracts of two marine sediments deposited in restricted basins: Kupferschiefer (Permian) and Serpiano shale (Mid-Triassic). GC and GC—MS analyses of the TBDMS ( tertiary-butyldimethylsilyl) derivatives show a simple component distribution, dominated by Me Et maleimide, mainly of planktonic origin; Me n-Pr and Me i-Bu maleimides, present in low abundance, are thought on structural grounds to be derived from the bacteriochlorophylls c, d, or e of Chlorobiaceae (anoxygenic green sulfur bacteria). This is confirmed for Kupferschiefer by isotope ratio monitoring (irm) GCMS which shows them to be enriched in 13C as a result of their photosynthetic carbon assimilation, which takes place by the reversed tricarboxylic acid (TCA) cycle. The structurally more specific Me i-Bu maleimide is, however, slightly more enriched in 13C than Me n-Pr maleimide, suggesting that the latter is derived in part from reduction of the C 3-acid substituent at C-17 of phytoplanktonic chlorophyll. These results provide evidence for the existence in both depositional settings of microbial communities containing Chlorobiaceae. In turn, this indicates that there must have been periods when the water column was highly stratified and anoxia extended into the zone of light penetration.

  12. Synthesis of 1-((4-methoxyphenyl-3-alkynes-1H-pyrrole-2,5-diones and functionalization to tria

    Directory of Open Access Journals (Sweden)

    Bakhat Ali

    2017-05-01

    Full Text Available A series of alkynyl maleimides were prepared via one-step cross-coupling reaction using bromomaleimide and acetylenes under the Sonogashira conditions, affording 1-((4-methoxyphenyl-3-alkynes-1H-pyrrole-2,5-diones in good to high yields. These products were subsequently converted in the corresponding 1,2,3-triazole using conventional click chemistry approach. The alkynyl maleimide compound (8g crystallized in the triclinic space group P1 with unit cell parameters a = 5.3692(6, b = 9.2513(10, c = 10.3070(11 Å, α = 85.349(4, β = 86.892(4, γ = 86.892(4°, V = 507.31(10 Å3, and Z = 1. In the crystal the molecules are stacked parallel to the c axis and held together through a C–H⋯π and a C–H⋯O interaction.

  13. Seleções para resistência e suscetibilidade, detecção e monitoramento da resistência de Tetranychus urticae ao acaricida clorfenapir Selections for resistance and susceptibility, detection and monitoring of resistance to the acaricide chlorfenapyr in Tetranychus urticae koch (Acari: Tetranychidae

    Directory of Open Access Journals (Sweden)

    Mário Eidi Sato

    2007-01-01

    Full Text Available Problemas com resistência de ácaro-rajado, Tetranychus urticae Koch (Acari: Tetranychidae, a acaricidas têm sido registrados em diversos países, inclusive no Brasil. O estudo teve como objetivo caracterizar a resistência de T. urticae ao acaricida clorfenapir e avaliar a freqüência de resistência a esse composto em áreas comerciais de seis culturas no Estado de São Paulo. Seleções para resistência e suscetibilidade a clorfenapir foram realizadas em laboratório, utilizando-se uma população de T. urticae coletada em 2002 de um cultivo comercial de crisântemo em Holambra (SP. Após seis seleções para resistência e cinco seleções para suscetibilidade, foram obtidas as linhagens suscetível (S e resistente (R de T. urticae a clorfenapir. A razão de resistência (CL50 R/ CL50 S obtida alcançou valores de 571 vezes. Estabeleceu-se uma concentração discriminatória de 37,4 mg L-1 de ingrediente ativo (i.a. para o monitoramento da resistência de T. urticae a clorfenapir. O monitoramento foi realizado coletando-se 21 populações de ácaros em áreas comerciais de diferentes culturas (mamão, morango, feijão, tomate, crisântemo, rosa, em vários municípios do Estado de São Paulo. Arenas confeccionadas com folha de feijão foram infestadas com ácaros T. urticae e pulverizadas com clorfenapir, na sua concentração discriminatória, em torre de Potter. Os resultados indicaram grande variabilidade entre as populações com relação à suscetibilidade a clorfenapir. Foram observadas populações com freqüências de resistência entre 0,0 e 65,4%. As maiores freqüências de resistência foram observadas para populações coletadas de crisântemo em Holambra (SP.Problems associated with acaricide resistance in Tetranychus urticae Koch have been recorded in several countries including Brazil. The objective of this study was to characterize the resistance of T. urticae to the acaricide chlorfenapyr and to evaluate the resistance

  14. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-01-01

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments. PMID:23297352

  15. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-02-19

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

  16. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    Energy Technology Data Exchange (ETDEWEB)

    Weston, D.P., E-mail: dweston@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Asbell, A.M., E-mail: aasbell@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Hecht, S.A., E-mail: scott.hecht@noaa.gov [NOAA Fisheries, Office of Protected Resources, 510 Desmond Drive S.E., Lacey, WA 98503 (United States); Scholz, N.L., E-mail: nathaniel.scholz@noaa.gov [NOAA Fisheries, Northwest Fisheries Science Center, 2725 Montlake Blvd. E., Seattle, WA 98112 (United States); Lydy, M.J., E-mail: mlydy@siu.edu [Fisheries and Illinois Aquaculture Center and Department of Zoology, Southern Illinois University, 171 Life Sciences II, Carbondale, IL 62901 (United States)

    2011-10-15

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: > Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. > Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. > Two creeks contained concentrations acutely lethal to sensitive invertebrates. > Bifenthrin was of greatest concern, though less than in prior studies. > Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  17. GABA receptor subunit composition relative to insecticide potency and selectivity.

    Science.gov (United States)

    Ratra, G S; Casida, J E

    2001-07-01

    Three observations on the 4-[(3)H]propyl-4'-ethynylbicycloorthobenzoate ([(3)H]EBOB) binding site in the gamma-aminobutyric acid (GABA) receptor indicate the specific target for insecticide action in human brain and a possible mechanism for selectivity. First, from published data, alpha-endosulfan, lindane and fipronil compete for the [(3)H]EBOB binding site with affinities of 0.3--7 nM in both human recombinant homooligomeric beta 3 receptors and housefly head membranes. Second, from structure-activity studies, including new data, GABAergic insecticide binding potency on the pentameric receptor formed from the beta 3 subunit correlates well with that on the housefly receptor (r=0.88, n=20). This conserved inhibitor specificity is consistent with known sequence homologies in the housefly GABA receptor and the human GABA(A) receptor beta 3 subunit. Third, as mostly new findings, various combinations of alpha 1, alpha 6, and gamma 2 subunits coexpressed with a beta 1 or beta 3 subunit confer differential insecticide binding sensitivity, particularly to fipronil, indicating that subunit composition is a major factor in insecticide selectivity.

  18. Control of Scirtothrips dorsalis with foliar insecticides, 2011

    Science.gov (United States)

    The objective of this study was to evaluate the efficacy of several conventional and novel insecticides against a new invasive thrips pest, Scirtothrips dorsalis Hood, in pepper under greenhouse condition. The trial was conducted at Tropical Research and Education Center in Homestead, Florida in hop...

  19. Soil applied insecticidal control of Scirtothrips dorsalis, 2011

    Science.gov (United States)

    The objective of this study was to evaluate the efficacy of several conventional and novel soil applied insecticides against a new invasive thrips pest, Scirtothrips dorsalis Hood, in pepper under greenhouse condition. The trial was conducted at Tropical Research and Education Center in Homestead, F...

  20. Investigation of the Insecticide Seed Dressing on the Sugar Beet

    Directory of Open Access Journals (Sweden)

    Jasminka Igrc Barčić

    2000-06-01

    Full Text Available The results of three year trials with various sugar beet seed treatments on the most important sugar beet pests, wireworms, flea beetles, sugar beet weevil and aphids are presented. The task of the investigation was to establish whether or not the sugar beet seed should be treated with insecticides and when granulars should be applied. In threeyear investigations 6 trials on different localities were carried out. Gaucho 70WS, Montur 190 FS, Geocid ST 35, Carbofuran 500 FS and a combination of Geocid ST 35 and Geocid G-5 were applied. The results showed that the imidacloprid seed treatment was satisfactory efficient on wireworms ensuring 20-42% more plants than on untreated plots. The efficacy of all treatments on the flea beetles was sufficient: Gaucho 70 WS 63-70%, the combined carbofuran treatment 65-67%, Geocid ST 35 54-55% and Montur 190 FS 52-55%. Therefore on imidacloprid and carbofuran treated crops the foliar treatment against flea beetles is mostly unnecassary. Insecticides based on imidacloprid showed a very good efficacy on aphids until 64 days after the sowing time with a somewhat longer residual action than the standard carbofuran treatments. All investigated insecticides were not satisfactorily efficient against sugar beet weevil. The seed dressing with a systemic insecticide is a justified measure. But, if the attack of wirevorms is strong or if a positive sugar beet weevil forecast is present, granulars shoud be applied additionaly.