Energy Technology Data Exchange (ETDEWEB)
Okita, T.W.
1990-12-31
The long term aim of this project is to assess the feasibility of increasing the conversion of photosynthate into starch via manipulation of the gene that encodes for ADPglucose pyrophosphorylase, a key regulatory enzyme of starch biosynthesis. In developing storage tissues such as cereal seeds and tubers, starch biosynthesis is regulated by the gene activation and expression of ADPglucose pyrophosphorylase, starch synthase, branching enzyme and other ancillary starch modifying enzymes, as well as the allosteric-controlled behavior of ADPglucose pyrophosphorylase activity. During the last two years we have obtained information on the structure of this enzyme from both potato tuber and rice endosperm, using a combination of biochemical and molecular biological approaches. Moreover, we present evidence that this enzyme may be localized at discrete regions of the starch grain within the amyloplast, and plays a role in controlling overall starch biosynthesis in potato tubers.
Substrate Specificity and Inhibitor Sensitivity of Plant UDP-Sugar Producing Pyrophosphorylases
Directory of Open Access Journals (Sweden)
Daniel Decker
2017-09-01
Full Text Available UDP-sugars are essential precursors for glycosylation reactions producing cell wall polysaccharides, sucrose, glycoproteins, glycolipids, etc. Primary mechanisms of UDP sugar formation involve the action of at least three distinct pyrophosphorylases using UTP and sugar-1-P as substrates. Here, substrate specificities of barley and Arabidopsis (two isozymes UDP-glucose pyrophosphorylases (UGPase, Arabidopsis UDP-sugar pyrophosphorylase (USPase and Arabidopsis UDP-N-acetyl glucosamine pyrophosphorylase2 (UAGPase2 were investigated using a range of sugar-1-phosphates and nucleoside-triphosphates as substrates. Whereas all the enzymes preferentially used UTP as nucleotide donor, they differed in their specificity for sugar-1-P. UGPases had high activity with D-Glc-1-P, but could also react with Fru-1-P and Fru-2-P (Km values over 10 mM. Contrary to an earlier report, their activity with Gal-1-P was extremely low. USPase reacted with a range of sugar-1-phosphates, including D-Glc-1-P, D-Gal-1-P, D-GalA-1-P (Km of 1.3 mM, β-L-Ara-1-P and α-D-Fuc-1-P (Km of 3.4 mM, but not β-L-Fuc-1-P. In contrast, UAGPase2 reacted only with D-GlcNAc-1-P, D-GalNAc-1-P (Km of 1 mM and, to some extent, D-Glc-1-P (Km of 3.2 mM. Generally, different conformations/substituents at C2, C4, and C5 of the pyranose ring of a sugar were crucial determinants of substrate specificity of a given pyrophosphorylase. Homology models of UDP-sugar binding to UGPase, USPase and UAGPase2 revealed more common amino acids for UDP binding than for sugar binding, reflecting differences in substrate specificity of these proteins. UAGPase2 was inhibited by a salicylate derivative that was earlier shown to affect UGPase and USPase activities, consistent with a common structural architecture of the three pyrophosphorylases. The results are discussed with respect to the role of the pyrophosphorylases in sugar activation for glycosylated end-products.
International Nuclear Information System (INIS)
Seng, Shanshan; Wu, Jian; Sui, Juanjuan; Wu, Chenyu; Zhong, Xionghui; Liu, Chen; Liu, Chao; Gong, Benhe; Zhang, Fengqin; He, Junna; Yi, Mingfang
2016-01-01
Starch is the main storage compound in underground organs like corms. ADP-glucose pyrophosphorylase (AGPase) plays a key role in regulating starch biosynthesis in storage organs and is likely one of the most important determinant of sink strength. Here, we identify an AGPase gene (GhAGPS1) from gladiolus. The highest transcriptional levels of GhAGPS1 were observed in cormels and corms. Transformation of GhAGPS1 into Arabidopsis rescued the phenotype of aps1 mutant. Silencing GhAGPS1 in gladiolus corms by virus-induced gene silencing (VIGS) decreased the transcriptional levels of two genes and starch content. Transmission electron microscopy analyses of leaf and corm sections confirmed that starch biosynthesis was inhibited. Corm weight and cormel number reduced significantly in the silenced plants. Taken together, these results indicate that inhibiting the expression of AGPase gene could impair starch synthesis, which results in the lowered corm quality and cormel yield in gladiolus. -- Highlights: •Cormel quantity was reduced significantly in silenced Gladiolus plants. •Corm quality was declined significantly in silenced Gladiolus plants. •Starch synthesis was inhibited in silenced Gladiolus plants.
Energy Technology Data Exchange (ETDEWEB)
Seng, Shanshan, E-mail: seshsh108@126.com [Beijing Key Laboratory of Development and Quality Control of Ornamental Crops, Department of Ornamental Horticulture and Landscape Architecture, China Agricultural University, Yuan Mingyuan Western Road 2#, Beijing 100193 (China); Wu, Jian [Beijing Key Laboratory of Development and Quality Control of Ornamental Crops, Department of Ornamental Horticulture and Landscape Architecture, China Agricultural University, Yuan Mingyuan Western Road 2#, Beijing 100193 (China); Sui, Juanjuan [Beijing Key Laboratory of Development and Quality Control of Ornamental Crops, Department of Ornamental Horticulture and Landscape Architecture, China Agricultural University, Yuan Mingyuan Western Road 2#, Beijing 100193 (China); College of Biology, Fuyang Normal College, Qinghe Western Road 100#, Fuyang 236037, Anhui (China); Wu, Chenyu; Zhong, Xionghui; Liu, Chen; Liu, Chao; Gong, Benhe; Zhang, Fengqin; He, Junna [Beijing Key Laboratory of Development and Quality Control of Ornamental Crops, Department of Ornamental Horticulture and Landscape Architecture, China Agricultural University, Yuan Mingyuan Western Road 2#, Beijing 100193 (China); Yi, Mingfang, E-mail: ymfang@cau.edu.cn [Beijing Key Laboratory of Development and Quality Control of Ornamental Crops, Department of Ornamental Horticulture and Landscape Architecture, China Agricultural University, Yuan Mingyuan Western Road 2#, Beijing 100193 (China)
2016-05-20
Starch is the main storage compound in underground organs like corms. ADP-glucose pyrophosphorylase (AGPase) plays a key role in regulating starch biosynthesis in storage organs and is likely one of the most important determinant of sink strength. Here, we identify an AGPase gene (GhAGPS1) from gladiolus. The highest transcriptional levels of GhAGPS1 were observed in cormels and corms. Transformation of GhAGPS1 into Arabidopsis rescued the phenotype of aps1 mutant. Silencing GhAGPS1 in gladiolus corms by virus-induced gene silencing (VIGS) decreased the transcriptional levels of two genes and starch content. Transmission electron microscopy analyses of leaf and corm sections confirmed that starch biosynthesis was inhibited. Corm weight and cormel number reduced significantly in the silenced plants. Taken together, these results indicate that inhibiting the expression of AGPase gene could impair starch synthesis, which results in the lowered corm quality and cormel yield in gladiolus. -- Highlights: •Cormel quantity was reduced significantly in silenced Gladiolus plants. •Corm quality was declined significantly in silenced Gladiolus plants. •Starch synthesis was inhibited in silenced Gladiolus plants.
Directory of Open Access Journals (Sweden)
Roman Gangl
Full Text Available In animals, the main precursor for glycosaminoglycan and furthermore proteoglycan biosynthesis, like hyaluronic acid, is UDP-glucuronic acid, which is synthesized via the nucleotide sugar oxidation pathway. Mutations in this pathway cause severe developmental defects (deficiency in the initiation of heart valve formation. In plants, UDP-glucuronic acid is synthesized via two independent pathways. Beside the nucleotide sugar oxidation pathway, a second minor route to UDP-glucuronic acid exist termed the myo-inositol oxygenation pathway. Within this myo-inositol is ring cleaved into glucuronic acid, which is subsequently converted to UDP-glucuronic acid by glucuronokinase and UDP-sugar pyrophosphorylase. Here we report on a similar, but bifunctional enzyme from zebrafish (Danio rerio which has glucuronokinase/putative pyrophosphorylase activity. The enzyme can convert glucuronic acid into UDP-glucuronic acid, required for completion of the alternative pathway to UDP-glucuronic acid via myo-inositol and thus establishes a so far unknown second route to UDP-glucuronic acid in animals. Glucuronokinase from zebrafish is a member of the GHMP-kinase superfamily having unique substrate specificity for glucuronic acid with a Km of 31 ± 8 µM and accepting ATP as the only phosphate donor (Km: 59 ± 9 µM. UDP-glucuronic acid pyrophosphorylase from zebrafish has homology to bacterial nucleotidyltransferases and requires UTP as nucleosid diphosphate donor. Genes for bifunctional glucuronokinase and putative UDP-glucuronic acid pyrophosphorylase are conserved among some groups of lower animals, including fishes, frogs, tunicates, and polychaeta, but are absent from mammals. The existence of a second pathway for UDP-glucuronic acid biosynthesis in zebrafish likely explains some previous contradictory finding in jekyll/ugdh zebrafish developmental mutants, which showed residual glycosaminoglycans and proteoglycans in knockout mutants of UDP
International Nuclear Information System (INIS)
Cupp-Vickery, Jill R.; Igarashi, Robert Y.; Meyer, Christopher R.
2005-01-01
Crystallization and X-ray diffraction methods for native A. tumefaciens ADP-glucose pyrophosphorylase and its selenomethionyl derivative are described. Two crystal forms are identified, both of which diffract to 2 Å
UDP-glucose pyrophosphorylase from tubers of Jerusalem artichoke (Helianthus tuberosus L.)
International Nuclear Information System (INIS)
Otozai, Kiyotaka; Taniguchi, Hajime; Nakamura, Michinori
1973-01-01
UDP-glucose pyrophosphorylase of Jerusalem artichoke tubers was purified 90-fold over the crude extract. The purified enzyme preparation absolutely required magnesium ions for activity. Cobalt ions were 60% as effective as magnesium ions; other divalent cations including manganese showed little or no effect. This enzyme had a pH optimum of 8.5 and a temperature optimum of 40 deg C. ATP and UDP inhibited the activity of this enzyme in both forward and backward directions. Km values for UDP-glucose, inorganic pyrophosphate, glucose-1-phosphate - 14 C and UTP were determined to be 4.45 x 10 -4 , 2.33 x 10 -4 , 9.38 x 10 -4 and 2.98 x 10 -4 M, respectively. These results are discussed in comparison with those of UDP-glucose pyrophosphorylases isolated from other plants. (author)
Guo, Jian; Huang, Siyao; Chen, Yefu; Guo, Xuewu; Xiao, Dongguang
2017-12-18
Pullulan produced by Aureobasidium pullulans presents various applications in food manufacturing and pharmaceutical industry. However, the pullulan biosynthesis mechanism remains unclear. This work proposed a pathway suggesting that heavy oil and melanin may correlate with pullulan production. The effects of overexpression or deletion of genes encoding apolipoprotein, UDPG-pyrophosphorylase, glucosyltransferase, and α-phosphoglucose mutase on the production of pullulan, heavy oil, and melanin were examined. Pullulan production increased by 16.93 and 8.52% with the overexpression of UDPG-pyrophosphorylase and apolipoprotein genes, respectively. Nevertheless, the overexpression or deletion of other genes exerted little effect on pullulan biosynthesis. Heavy oil production increased by 146.30, 64.81, and 33.33% with the overexpression of UDPG-pyrophosphorylase, α-phosphoglucose mutase, and apolipoprotein genes, respectively. Furthermore, the syntheses of pullulan, heavy oil, and melanin can compete with one another. This work may provide new guidance to improve the production of pullulan, heavy oil, and melanin through genetic approach.
Energy Technology Data Exchange (ETDEWEB)
Maruyama, Daisuke; Nishitani, Yuichi; Nonaka, Tsuyoshi; Kita, Akiko [Department of Chemistry, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502 (Japan); Fukami, Takaaki A.; Mio, Toshiyuki; Yamada-Okabe, Hisafumi [Kamakura Research Laboratory, Chugai Pharmaceutical Co. Ltd, 200 Kajiwara, Kamakura, Kanagawa 247-8530 (Japan); Yamada-Okabe, Toshiko [Department of Hygiene, School of Medicine, Yokohama City University, 3-9 Fukuura, Kanazawa, Yokohama 236-0004 (Japan); Miki, Kunio, E-mail: miki@kuchem.kyoto-u.ac.jp [Department of Chemistry, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502 (Japan); RIKEN SPring-8 Center at Harima Institute, Koto 1-1-1, Sayocho, Sayo-gun, Hyogo 679-5148 (Japan)
2006-12-01
UDP-N-acetylglucosamine pyrophosphorylase was purified and crystallized and X-ray diffraction data were collected to 2.3 Å resolution. UDP-N-acetylglucosamine pyrophosphorylase (UAP) is an essential enzyme in the synthesis of UDP-N-acetylglucosamine. UAP from Candida albicans was purified and crystallized by the sitting-drop vapour-diffusion method. The crystals of the substrate and product complexes both diffract X-rays to beyond 2.3 Å resolution using synchrotron radiation. The crystals of the substrate complex belong to the triclinic space group P1, with unit-cell parameters a = 47.77, b = 62.89, c = 90.60 Å, α = 90.01, β = 97.72, γ = 92.88°, whereas those of the product complex belong to the orthorhombic space group P2{sub 1}2{sub 1}2{sub 1}, with unit-cell parameters a = 61.95, b = 90.87, c = 94.88 Å.
Choix, Francisco J; Bashan, Yoav; Mendoza, Alberto; de-Bashan, Luz E
2014-05-10
ADP-glucose pyrophosphorylase (AGPase) regulates starch biosynthesis in higher plants and microalgae. This study measured the effect of the bacterium Azospirillum brasilense on AGPase activity in the freshwater microalga Chlorella vulgaris and formation of starch. This was done by immobilizing both microorganisms in alginate beads, either replete with or deprived of nitrogen or phosphorus and all under heterotrophic conditions, using d-glucose or Na-acetate as the carbon source. AGPase activity during the first 72h of incubation was higher in C. vulgaris when immobilized with A. brasilense. This happened simultaneously with higher starch accumulation and higher carbon uptake by the microalgae. Either carbon source had similar effects on enzyme activity and starch accumulation. Starvation either by N or P had the same pattern on AGPase activity and starch accumulation. Under replete conditions, the population of C. vulgaris immobilized alone was higher than when immobilized together, but under starvation conditions A. brasilense induced a larger population of C. vulgaris. In summary, adding A. brasilense enhanced AGPase activity, starch formation, and mitigation of stress in C. vulgaris. Copyright © 2014 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Ayalew Ligaba-Osena
2018-02-01
Full Text Available To address national and global low-carbon fuel targets, there is great interest in alternative plant species such as cassava (Manihot esculenta, which are high-yielding, resilient, and are easily converted to fuels using the existing technology. In this study the genes encoding hyperthermophilic archaeal starch-hydrolyzing enzymes, α-amylase and amylopullulanase from Pyrococcus furiosus and glucoamylase from Sulfolobus solfataricus, together with the gene encoding a modified ADP-glucose pyrophosphorylase (glgC from Escherichia coli, were simultaneously expressed in cassava roots to enhance starch accumulation and its subsequent hydrolysis to sugar. A total of 13 multigene expressing transgenic lines were generated and characterized phenotypically and genotypically. Gene expression analysis using quantitative RT-PCR showed that the microbial genes are expressed in the transgenic roots. Multigene-expressing transgenic lines produced up to 60% more storage root yield than the non-transgenic control, likely due to glgC expression. Total protein extracted from the transgenic roots showed up to 10-fold higher starch-degrading activity in vitro than the protein extracted from the non-transgenic control. Interestingly, transgenic tubers released threefold more glucose than the non-transgenic control when incubated at 85°C for 21-h without exogenous application of thermostable enzymes, suggesting that the archaeal enzymes produced in planta maintain their activity and thermostability.
Chen, Zhen; Liu, Peize; Li, Zhipeng; Yu, Wencheng; Wang, Zhi; Yao, Haosheng; Wang, Yuanpeng; Li, Qingbiao; Deng, Xu; He, Ning
2017-03-01
The present study reports the sequenced genome of Bacillus licheniformis CGMCC 2876, which is composed of a 4,284,461 bp chromosome that contains 4,188 protein-coding genes, 72 tRNA genes, and 21 rRNA genes. Additional analysis revealed an eps gene cluster with 16 open reading frames. Conserved Domains Database analysis combined with qPCR experiments indicated that all genes in this cluster were involved in polysaccharide bioflocculant synthesis. Phosphoglucomutase and UDP-glucose pyrophosphorylase were supposed to be key enzymes in polysaccharide secretion in B. licheniformis. A biosynthesis pathway for the production of polysaccharide bioflocculant involving the integration of individual genes was proposed based on functional analysis. Overexpression of epsDEF from the eps gene cluster in B. licheniformis CGMCC 2876 increased the flocculating activity of the recombinant strain by 90% compared to the original strain. Similarly, the crude yield of polysaccharide bioflocculant was enhanced by 27.8%. Overexpression of the UDP-glucose pyrophosphorylase gene not only increased the flocculating activity by 71% but also increased bioflocculant yield by 13.3%. Independent of UDP-N-acetyl-D-mannosamine dehydrogenase gene, flocculating activity, and polysaccharide yield were negatively impacted by overexpression of the UDP-N-acetylglucosamine 2-epimerase gene. Overall, epsDEF and gtaB2 were identified as key genes for polysaccharide bioflocculant synthesis in B. licheniformis. These results will be useful for further engineering of B. licheniformis for industrial bioflocculant production. Biotechnol. Bioeng. 2017;114: 645-655. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Villand, P; Aalen, R; Olsen, O A; Lüthi, E; Lönneborg, A; Kleczkowski, L A
1992-06-01
Several cDNAs encoding the small and large subunit of ADP-glucose pyrophosphorylase (AGP) were isolated from total RNA of the starchy endosperm, roots and leaves of barley by polymerase chain reaction (PCR). Sets of degenerate oligonucleotide primers, based on previously published conserved amino acid sequences of plant AGP, were used for synthesis and amplification of the cDNAs. For either the endosperm, roots and leaves, the restriction analysis of PCR products (ca. 550 nucleotides each) has revealed heterogeneity, suggesting presence of three transcripts for AGP in the endosperm and roots, and up to two AGP transcripts in the leaf tissue. Based on the derived amino acid sequences, two clones from the endosperm, beps and bepl, were identified as coding for the small and large subunit of AGP, respectively, while a leaf transcript (blpl) encoded the putative large subunit of AGP. There was about 50% identity between the endosperm clones, and both of them were about 60% identical to the leaf cDNA. Northern blot analysis has indicated that beps and bepl are expressed in both the endosperm and roots, while blpl is detectable only in leaves. Application of the PCR technique in studies on gene structure and gene expression of plant AGP is discussed.
Daligaux, Pierre; Bernadat, Guillaume; Tran, Linh; Cavé, Christian; Loiseau, Philippe M; Pomel, Sébastien; Ha-Duong, Tâp
2016-01-01
Leishmania is the parasite responsible for the neglected disease leishmaniasis. Its virulence and survival require biosynthesis of glycoconjugates, whose guanosine diphospho-d-mannose pyrophosphorylase (GDP-MP) is a key player. However, experimentally resolved structures of this enzyme are still lacking. We herein propose structural models of the GDP-MP from human and Leishmania donovani. Based on a multiple sequences alignment, the models were built with MODELLER and then carefully refined with all atom molecular dynamics simulations in explicit solvent. Their quality was evaluated against several standard criteria, including their ability to bind GDP-mannose assessed by redocking calculations. Special attention was given in this study to interactions of the catalytic site residues with the enzyme substrate and competitive inhibitors, opening the perspective of medicinal chemistry developments. Copyright © 2015 Elsevier Masson SAS. All rights reserved.
Boels, I.C.; Ramos, A.; Kleerebezem, M.; Vos, de W.M.
2001-01-01
We studied the UDP-glucose pyrophosphorylase (galU) and UDP-galactose epimerase (galE) genes of Lactococcus lactis MG1363 to investigate their involvement in biosynthesis of UDP-glucose and UDP-galactose, which are precursors of glucose- and galactose-containing exopolysaccharides (EPS) in L.
Positional isotope exchange analysis of the uridine-diphosphoglucose pyrophosphorylase reaction
International Nuclear Information System (INIS)
Hester, L.; Hilscher, L.; Raushel, F.M.
1986-01-01
The enzyme uridine-diphosphoglucose pyrophosphorylase catalyzes the reversible formation of pyrophosphate and UDP-glucose from UTP and glc-1P. The positional isotope exchange reaction was measured using oxygen-18 labelled UTP. The synthesis of [β- 18 O 2 , βγ- 18 O, γ- 18 O 3 ]UTP was accomplished by the coupled activities of carbamate kinase, nucleoside diphosphate kinase, and nucleoside monophosphate kinase. The exchange of an oxygen-18 from a β-nonbridge position of the labelled UTP to the αβ-bridge position was measured with 31 P NMR. The ratio of the rate of net substrate turnover and the positional isotope exchange rate was measured as a function of the initial glc-1P concentration. This ratio was found to increase with an increasing concentration of glc-1P. The intercept at low glc-1P was found to be 1.2 and the slope was 4.5 mM -1 . These results have been interpreted to mean that this enzyme has an ordered addition of substrates. The lower limit for the release of pyrophosphate from E-UDPG-PP/sub i/ relative to V 2 is 1.2. The rate constant for the release of UTP from E-UTP relative to V 1 is 9
Zhao, Shun; Liu, Lin
2016-10-01
GDP-D-mannose pyrophosphorylase catalyzes the production of GDP-D-mannose, an intermediate product in the plant ascorbic acid (AsA) biosynthetic pathway. This enzyme is a key regulatory target in AsA biosynthesis and is encoded by VITAMIN C DEFECTIVE 1 (VTC1) in the Arabidopsis thaliana genome. Here, recombinant VTC1 was expressed, purified and crystallized. Diffraction data were obtained from VTC1 crystals grown in the absence and presence of substrate using X-rays. The ligand-free VTC1 crystal diffracted X-rays to 3.3 Å resolution and belonged to space group R32, with unit-cell parameters a = b = 183.6, c = 368.5 Å, α = β = 90, γ = 120°; the crystal of VTC1 in the presence of substrate diffracted X-rays to 1.75 Å resolution and belonged to space group P2 1 , with unit-cell parameters a = 70.8, b = 83.9, c = 74.5 Å, α = γ = 90.0, β = 114.9°.
Mao, Wei; Daligaux, Pierre; Lazar, Noureddine; Ha-Duong, Tâp; Cavé, Christian; van Tilbeurgh, Herman; Loiseau, Philippe M; Pomel, Sébastien
2017-04-07
Leishmaniases are an ensemble of diseases caused by the protozoan parasite of the genus Leishmania. Current antileishmanial treatments are limited and present main issues of toxicity and drug resistance emergence. Therefore, the generation of new inhibitors specifically directed against a leishmanial target is an attractive strategy to expand the chemotherapeutic arsenal. GDP-Mannose Pyrophosphorylase (GDP-MP) is a prominent therapeutic target involved in host-parasite recognition which has been described to be essential for parasite survival. In this work, we produced and purified GDP-MPs from L. mexicana (LmGDP-MP), L. donovani (LdGDP-MP), and human (hGDP-MP), and compared their enzymatic properties. From a rationale design of 100 potential inhibitors, four compounds were identified having a promising and specific inhibitory effect on parasite GDP-MP and antileishmanial activities, one of them exhibits a competitive inhibition on LdGDP-MP and belongs to the 2-substituted quinoline series.
Directory of Open Access Journals (Sweden)
Bhagath Kumar Palaka
2014-12-01
Full Text Available Aedes aegypti is a vector that transmits diseases like dengue fever, chikungunya, and yellow fever. It is distributed in all tropical and subtropical regions of the world. According to WHO reports, 40% of the world’s population is currently at risk for dengue fever. As vaccines are not available for such diseases, controlling mosquito population becomes necessary. Hence, this study aims at UDP-N-acetyl glucosamine pyrophosphorylase of Aedes aegypti (AaUAP, an essential enzyme for chitin metabolim in insects, as a drug target. Structure of AaUAP was predicted and validated using in-silico approach. Further, docking studies were performed using a set of 10 inhibitors out of which NAG9 was found to have good docking score, which was further supported by simulation studies. Hence, we propose that NAG9 can be considered as a potential hit in designing new inhibitors to control Aedes aegypti.
Swanson, David M; Blacker, Deborah; Alchawa, Taofik; Ludwig, Kerstin U; Mangold, Elisabeth; Lange, Christoph
2013-11-07
The advent of genome-wide association studies has led to many novel disease-SNP associations, opening the door to focused study on their biological underpinnings. Because of the importance of analyzing these associations, numerous statistical methods have been devoted to them. However, fewer methods have attempted to associate entire genes or genomic regions with outcomes, which is potentially more useful knowledge from a biological perspective and those methods currently implemented are often permutation-based. One property of some permutation-based tests is that their power varies as a function of whether significant markers are in regions of linkage disequilibrium (LD) or not, which we show from a theoretical perspective. We therefore develop two methods for quantifying the degree of association between a genomic region and outcome, both of whose power does not vary as a function of LD structure. One method uses dimension reduction to "filter" redundant information when significant LD exists in the region, while the other, called the summary-statistic test, controls for LD by scaling marker Z-statistics using knowledge of the correlation matrix of markers. An advantage of this latter test is that it does not require the original data, but only their Z-statistics from univariate regressions and an estimate of the correlation structure of markers, and we show how to modify the test to protect the type 1 error rate when the correlation structure of markers is misspecified. We apply these methods to sequence data of oral cleft and compare our results to previously proposed gene tests, in particular permutation-based ones. We evaluate the versatility of the modification of the summary-statistic test since the specification of correlation structure between markers can be inaccurate. We find a significant association in the sequence data between the 8q24 region and oral cleft using our dimension reduction approach and a borderline significant association using the
International Nuclear Information System (INIS)
Hester, L.S.; Raushel, F.M.
1987-01-01
A method has been developed for obtaining qualitative information about enzyme-catalyzed reactions by measuring the inhibitory effects of added substrates on positional isotope exchange rates. It has been demonstrated for ordered kinetic mechanisms that an increase in the concentration of the second substrate to add to the enzyme will result in a linear increase in the ratio of the chemical and positional isotope exchange rates. The slopes and intercepts from these plots can be used to determine the partitioning ratios of binary and ternary enzyme complexes. The method has been applied to the reaction catalyzed by UDP-glucose pyrophosphorylase. A positional isotope exchange reaction was measured within oxygen-18-labeled UTP as a function of variable glucose 1-phosphate concentration in the forward reaction. In the reverse reaction, a positional isotope exchange reaction was measured within oxygen-18-labeled UDP-glucose as a function of increasing pyrophosphate concentration. The results have been interpreted to indicate that the interconversion of the ternary central complexes is fast relative to product dissociation in either direction. In the forward direction, the release of UDP-glucose is slower than the release of pyrophosphate. The release of glucose 1-phosphate is slower than the release of UTP in the reverse reaction
Structural Analysis of ADP-Glucose Pyrophosphorylase From the Bacterium Agrobacterium Tumefaciens
Energy Technology Data Exchange (ETDEWEB)
Cupp-Vickery, J.R.; Igarashi, R.Y.; Perez, M.; Poland, M.; Meyer, C.R.
2009-05-14
ADP-glucose pyrophosphorylase (ADPGlc PPase) catalyzes the conversion of glucose 1-phosphate and ATP to ADP-glucose and pyrophosphate. As a key step in glucan synthesis, the ADPGlc PPases are highly regulated by allosteric activators and inhibitors in accord with the carbon metabolism pathways of the organism. Crystals of Agrobacterium tumefaciens ADPGlc PPase were obtained using lithium sulfate as a precipitant. A complete anomalous selenomethionyl derivative X-ray diffraction data set was collected with unit cell dimensions a = 85.38 {angstrom}, b = 93.79 {angstrom}, and c = 140.29 {angstrom} ({alpha} = {beta} = {gamma} = 90{sup o}) and space group I{sub 222}. The A. tumefaciens ADPGlc PPase model was refined to 2.1 {angstrom} with an R{sub factor} = 22% and R{sub free} = 26.6%. The model consists of two domains: an N-terminal {alpha}{beta}{alpha} sandwich and a C-terminal parallel {beta}-helix. ATP and glucose 1-phosphate were successfully modeled in the proposed active site, and site-directed mutagenesis of conserved glycines in this region (G20, G21, and G23) resulted in substantial loss of activity. The interface between the N- and the C-terminal domains harbors a strong sulfate-binding site, and kinetic studies revealed that sulfate is a competitive inhibitor for the allosteric activator fructose 6-phosphate. These results suggest that the interface between the N- and C-terminal domains binds the allosteric regulator, and fructose 6-phosphate was modeled into this region. The A. tumefaciens ADPGlc PPase/fructose 6-phosphate structural model along with sequence alignment analysis was used to design mutagenesis experiments to expand the activator specificity to include fructose 1,6-bisphosphate. The H379R and H379K enzymes were found to be activated by fructose 1,6-bisphosphate.
Nebauer, Sergio G; Renau-Morata, Begoña; Lluch, Yolanda; Baroja-Fernández, Edurne; Pozueta-Romero, Javier; Molina, Rosa-Victoria
2014-07-01
The fruit is the main sink organ in Citrus and captures almost all available photoassimilates during its development. Consequently, carbohydrate partitioning and starch content depend on the crop load of Citrus trees. Nevertheless, little is known about the mechanisms controlling the starch metabolism at the tree level in relation to presence of fruit. The aim of this study was to find the relation between the seasonal variation of expression and activity of the genes involved in carbon metabolism and the partition and allocation of carbohydrates in 'Salustiana' sweet orange trees with different crop loads. Metabolisable carbohydrates, and the expression and activity of the enzymes involved in sucrose and starch metabolism, including sucrose transport, were determined during the year in the roots and leaves of 40-year-old trees bearing heavy crop loads ('on' trees) and trees with almost no fruits ('off' trees). Fruit altered photoassimilate partitioning in trees. Sucrose content tended to be constant in roots and leaves, and surplus fixed carbon is channeled to starch production. Differences between 'on' and 'off' trees in starch content can be explained by differences in ADP-glucose pyrophosphorylase (AGPP) expression/activity and α-amylase activity which varies depending on crop load. The observed relation of AGPP and UGPP (UDP-glucose pyrophosphorylase) is noteworthy and indicates a direct link between sucrose and starch synthesis. Furthermore, different roles for sucrose transporter SUT1 and SUT2 have been proposed. Variation in soluble sugars content cannot explain the differences in gene expression between the 'on' and 'off' trees. A still unknown signal from fruit should be responsible for this control. Copyright © 2014 Elsevier Masson SAS. All rights reserved.
Enami, Kazuhiko; Ozawa, Tomoki; Motohashi, Noriko; Nakamura, Masayuki; Tanaka, Kan; Hanaoka, Mitsumasa
2011-01-01
Amyloplasts, a subtype of plastid, are found in nonphotosynthetic tissues responsible for starch synthesis and storage. When tobacco (Nicotiana tabacum) Bright Yellow-2 cells are cultured in the presence of cytokinin instead of auxin, their plastids differentiate from proplastids to amyloplasts. In this program, it is well known that the expression of nucleus-encoded starch biosynthesis genes, such as ADP-Glucose Pyrophosphorylase (AgpS) and Granule-Bound Starch Synthase (GBSS), is specifically induced. In this study, we investigated the roles of plastid gene expression in amyloplast differentiation. Microarray analysis of plastid genes revealed that no specific transcripts were induced in amyloplasts. Nevertheless, amyloplast development accompanied with starch biosynthesis was drastically inhibited in the presence of plastid transcription/translation inhibitors. Surprisingly, the expression of nuclear AgpS and GBSS was significantly repressed by the addition of these inhibitors, suggesting that a plastid-derived signal(s) that reflects normal plastid gene expression was essential for nuclear gene expression. A series of experiments was performed to examine the effects of intermediates and inhibitors of tetrapyrrole biosynthesis, since some of the intermediates have been characterized as candidates for plastid-to-nucleus retrograde signals. Addition of levulinic acid, an inhibitor of tetrapyrrole biosynthesis, resulted in the up-regulation of nuclear AgpS and GBSS gene expression as well as starch accumulation, while the addition of heme showed opposite effects. Thus, these results indicate that plastid transcription and/or translation are required for normal amyloplast differentiation, regulating the expression of specific nuclear genes by unknown signaling mechanisms that can be partly mediated by tetrapyrrole intermediates. PMID:21771917
DEFF Research Database (Denmark)
Agarwal, Pankaj K.; Graham, Graham; Huang, Zengfeng
2013-01-01
We study the mergeability of data summaries. Informally speaking, mergeability requires that, given two summaries on two datasets, there is a way to merge the two summaries into a single summary on the two datasets combined together, while preserving the error and size guarantees. This property m...
Delimiting Coalescence Genes (C-Genes) in Phylogenomic Data Sets.
Springer, Mark S; Gatesy, John
2018-02-26
coalescence methods have emerged as a popular alternative for inferring species trees with large genomic datasets, because these methods explicitly account for incomplete lineage sorting. However, statistical consistency of summary coalescence methods is not guaranteed unless several model assumptions are true, including the critical assumption that recombination occurs freely among but not within coalescence genes (c-genes), which are the fundamental units of analysis for these methods. Each c-gene has a single branching history, and large sets of these independent gene histories should be the input for genome-scale coalescence estimates of phylogeny. By contrast, numerous studies have reported the results of coalescence analyses in which complete protein-coding sequences are treated as c-genes even though exons for these loci can span more than a megabase of DNA. Empirical estimates of recombination breakpoints suggest that c-genes may be much shorter, especially when large clades with many species are the focus of analysis. Although this idea has been challenged recently in the literature, the inverse relationship between c-gene size and increased taxon sampling in a dataset-the 'recombination ratchet'-is a fundamental property of c-genes. For taxonomic groups characterized by genes with long intron sequences, complete protein-coding sequences are likely not valid c-genes and are inappropriate units of analysis for summary coalescence methods unless they occur in recombination deserts that are devoid of incomplete lineage sorting (ILS). Finally, it has been argued that coalescence methods are robust when the no-recombination within loci assumption is violated, but recombination must matter at some scale because ILS, a by-product of recombination, is the raison d'etre for coalescence methods. That is, extensive recombination is required to yield the large number of independently segregating c-genes used to infer a species tree. If coalescent methods are powerful
Directory of Open Access Journals (Sweden)
Tomotaka eShinya
2016-04-01
Full Text Available Eucalyptus species constitutes the most widely planted hardwood trees in temperate and subtropical regions. In this study, we compared the transcript levels of genes involved in lignocellulose formation such as cellulose, hemicellulose and lignin biosynthesis in two selected three-year old hybrid Eucalyptus (Eucalyptus urophylla x E. grandis genotypes (AM063 and AM380 that have different lignin content. AM063 and AM380 had 20.2 and 35.5% of Klason lignin content and 59.0% and 48.2%, -cellulose contents, respectively. We investigated the correlation between wood properties and transcript levels of wood formation-related genes using RNA-seq with total RNAs extracted from developing xylem tissues at a breast height. Transcript levels of cell wall construction genes such as cellulose synthase (CesA and sucrose synthase (SUSY were almost the same in both genotypes. However, AM063 exhibited higher transcript levels of UDP-glucose pyrophosphorylase (UGP and xyloglucan endotransglucoxylase (XTH than those in AM380. Most monolignol biosynthesis- related isozyme genes showed higher transcript levels in AM380. These results indicate monolignol biosynthesis-related genes may regulate wood composition in Eucalyptus. Flavonoids contents were also observed at much higher levels in AM380 as a result of the elevated transcript levels of common phenylpropanoid pathway genes, phenylalanine ammonium lyase (PAL, cinnamate-4-hydroxylase (C4H and 4-coumarate-CoA ligase (4CL. Secondary plant cell wall formation is regulated by many transcription factors. We analyzed genes encoding NAC, WRKY, AP2/ERF and KNOX transcription factors and found higher transcript levels of these genes in AM380. We also observed increased transcription of some MYB and LIM domain transcription factors in AM380 compared to AM063. All these results show that genes related to monolignol biosynthesis may regulate the wood composition and help maintain the ratio of cellulose and lignin contents
Mehinto, Alvine C; Prucha, Melinda S; Colli-Dula, Reyna C; Kroll, Kevin J; Lavelle, Candice M; Barber, David S; Vulpe, Christopher D; Denslow, Nancy D
2014-07-01
Cadmium is a heavy metal that can accumulate to toxic levels in the environment leading to detrimental effects in animals and humans including kidney, liver and lung injuries. Using a transcriptomics approach, genes and cellular pathways affected by a low dose of cadmium were investigated. Adult largemouth bass were intraperitoneally injected with 20μg/kg of cadmium chloride (mean exposure level - 2.6μg of cadmium per fish) and microarray analyses were conducted in the liver and testis 48h after injection. Transcriptomic profiles identified in response to cadmium exposure were tissue-specific with the most differential expression changes found in the liver tissues, which also contained much higher levels of cadmium than the testis. Acute exposure to a low dose of cadmium induced oxidative stress response and oxidative damage pathways in the liver. The mRNA levels of antioxidants such as catalase increased and numerous transcripts related to DNA damage and DNA repair were significantly altered. Hepatic mRNA levels of metallothionein, a molecular marker of metal exposure, did not increase significantly after 48h exposure. Carbohydrate metabolic pathways were also disrupted with hepatic transcripts such as UDP-glucose, pyrophosphorylase 2, and sorbitol dehydrogenase highly induced. Both tissues exhibited a disruption of steroid signaling pathways. In the testis, estrogen receptor beta and transcripts linked to cholesterol metabolism were suppressed. On the contrary, genes involved in cholesterol metabolism were highly increased in the liver including genes encoding for the rate limiting steroidogenic acute regulatory protein and the catalytic enzyme 7-dehydrocholesterol reductase. Integration of the transcriptomic data using functional enrichment analyses revealed a number of enriched gene networks associated with previously reported adverse outcomes of cadmium exposure such as liver toxicity and impaired reproduction. Copyright © 2014 Elsevier B.V. All rights
UniGene Tabulator: a full parser for the UniGene format.
Lenzi, Luca; Frabetti, Flavia; Facchin, Federica; Casadei, Raffaella; Vitale, Lorenza; Canaider, Silvia; Carinci, Paolo; Zannotti, Maria; Strippoli, Pierluigi
2006-10-15
UniGene Tabulator 1.0 provides a solution for full parsing of UniGene flat file format; it implements a structured graphical representation of each data field present in UniGene following import into a common database managing system usable in a personal computer. This database includes related tables for sequence, protein similarity, sequence-tagged site (STS) and transcript map interval (TXMAP) data, plus a summary table where each record represents a UniGene cluster. UniGene Tabulator enables full local management of UniGene data, allowing parsing, querying, indexing, retrieving, exporting and analysis of UniGene data in a relational database form, usable on Macintosh (OS X 10.3.9 or later) and Windows (2000, with service pack 4, XP, with service pack 2 or later) operating systems-based computers. The current release, including both the FileMaker runtime applications, is freely available at http://apollo11.isto.unibo.it/software/
Cloning arbuscule-related genes from mycorrhizas
DEFF Research Database (Denmark)
Burleigh, Stephen
2000-01-01
Until recently little was known about the identity of the genes expressed in the arbuscules of mycorrhizas, due in part to problems associated with cloning genes from the tissues of an obligate symbiont. However, the combination of advanced molecular techniques, innovative use of the materials...... available and fortuitous cloning has resulted in the recent identification of a number of arbuscule-related genes. This article provides a brief summary of the genes involved in arbuscule development, function and regulation, and the techniques used to study them. Molecular techniques include differential...
A combination test for detection of gene-environment interaction in cohort studies.
Coombes, Brandon; Basu, Saonli; McGue, Matt
2017-07-01
Identifying gene-environment (G-E) interactions can contribute to a better understanding of disease etiology, which may help researchers develop disease prevention strategies and interventions. One big criticism of studying G-E interaction is the lack of power due to sample size. Studies often restrict the interaction search to the top few hundred hits from a genome-wide association study or focus on potential candidate genes. In this paper, we test interactions between a candidate gene and an environmental factor to improve power by analyzing multiple variants within a gene. We extend recently developed score statistic based genetic association testing approaches to the G-E interaction testing problem. We also propose tests for interaction using gene-based summary measures that pool variants together. Although it has recently been shown that these summary measures can be biased and may lead to inflated type I error, we show that under several realistic scenarios, we can still provide valid tests of interaction. These tests use significantly less degrees of freedom and thus can have much higher power to detect interaction. Additionally, we demonstrate that the iSeq-aSum-min test, which combines a gene-based summary measure test, iSeq-aSum-G, and an interaction-based summary measure test, iSeq-aSum-I, provides a powerful alternative to test G-E interaction. We demonstrate the performance of these approaches using simulation studies and illustrate their performance to study interaction between the SNPs in several candidate genes and family climate environment on alcohol consumption using the Minnesota Center for Twin and Family Research dataset. © 2017 WILEY PERIODICALS, INC.
COGNATE: comparative gene annotation characterizer.
Wilbrandt, Jeanne; Misof, Bernhard; Niehuis, Oliver
2017-07-17
The comparison of gene and genome structures across species has the potential to reveal major trends of genome evolution. However, such a comparative approach is currently hampered by a lack of standardization (e.g., Elliott TA, Gregory TR, Philos Trans Royal Soc B: Biol Sci 370:20140331, 2015). For example, testing the hypothesis that the total amount of coding sequences is a reliable measure of potential proteome diversity (Wang M, Kurland CG, Caetano-Anollés G, PNAS 108:11954, 2011) requires the application of standardized definitions of coding sequence and genes to create both comparable and comprehensive data sets and corresponding summary statistics. However, such standard definitions either do not exist or are not consistently applied. These circumstances call for a standard at the descriptive level using a minimum of parameters as well as an undeviating use of standardized terms, and for software that infers the required data under these strict definitions. The acquisition of a comprehensive, descriptive, and standardized set of parameters and summary statistics for genome publications and further analyses can thus greatly benefit from the availability of an easy to use standard tool. We developed a new open-source command-line tool, COGNATE (Comparative Gene Annotation Characterizer), which uses a given genome assembly and its annotation of protein-coding genes for a detailed description of the respective gene and genome structure parameters. Additionally, we revised the standard definitions of gene and genome structures and provide the definitions used by COGNATE as a working draft suggestion for further reference. Complete parameter lists and summary statistics are inferred using this set of definitions to allow down-stream analyses and to provide an overview of the genome and gene repertoire characteristics. COGNATE is written in Perl and freely available at the ZFMK homepage ( https://www.zfmk.de/en/COGNATE ) and on github ( https
Wilbik, A.M.; Kaymak, U.; Laurent, A.; Strauss, O.; Bouchon-Meunier, xx
2014-01-01
In this paper we propose a new type of protoform-based linguistic summary – the gradual summary. This new type of summaries aims in capturing the change over some time span. Such summaries can be useful in many domains, for instance in economics, e.g., "prices of X are getting smaller" in eldercare,
Pan, Yufang; Li, Qiaofeng; Wang, Zhizheng; Wang, Yang; Ma, Rui; Zhu, Lili; He, Guangcun; Chen, Rongzhi
2014-12-16
Thermosensitive genic male sterile (TGMS) lines and photoperiod-sensitive genic male sterile (PGMS) lines have been successfully used in hybridization to improve rice yields. However, the molecular mechanisms underlying male sterility transitions in most PGMS/TGMS rice lines are unclear. In the recently developed TGMS-Co27 line, the male sterility is based on co-suppression of a UDP-glucose pyrophosphorylase gene (Ugp1), but further study is needed to fully elucidate the molecular mechanisms involved. Microarray-based transcriptome profiling of TGMS-Co27 and wild-type Hejiang 19 (H1493) plants grown at high and low temperatures revealed that 15462 probe sets representing 8303 genes were differentially expressed in the two lines, under the two conditions, or both. Environmental factors strongly affected global gene expression. Some genes important for pollen development were strongly repressed in TGMS-Co27 at high temperature. More significantly, series-cluster analysis of differentially expressed genes (DEGs) between TGMS-Co27 plants grown under the two conditions showed that low temperature induced the expression of a gene cluster. This cluster was found to be essential for sterility transition. It includes many meiosis stage-related genes that are probably important for thermosensitive male sterility in TGMS-Co27, inter alia: Arg/Ser-rich domain (RS)-containing zinc finger proteins, polypyrimidine tract-binding proteins (PTBs), DEAD/DEAH box RNA helicases, ZOS (C2H2 zinc finger proteins of Oryza sativa), at least one polyadenylate-binding protein and some other RNA recognition motif (RRM) domain-containing proteins involved in post-transcriptional processes, eukaryotic initiation factor 5B (eIF5B), ribosomal proteins (L37, L1p/L10e, L27 and L24), aminoacyl-tRNA synthetases (ARSs), eukaryotic elongation factor Tu (eEF-Tu) and a peptide chain release factor protein involved in translation. The differential expression of 12 DEGs that are important for pollen
Fan, Qianrui; Wang, Wenyu; Hao, Jingcan; He, Awen; Wen, Yan; Guo, Xiong; Wu, Cuiyan; Ning, Yujie; Wang, Xi; Wang, Sen; Zhang, Feng
2017-08-01
Neuroticism is a fundamental personality trait with significant genetic determinant. To identify novel susceptibility genes for neuroticism, we conducted an integrative analysis of genomic and transcriptomic data of genome wide association study (GWAS) and expression quantitative trait locus (eQTL) study. GWAS summary data was driven from published studies of neuroticism, totally involving 170,906 subjects. eQTL dataset containing 927,753 eQTLs were obtained from an eQTL meta-analysis of 5311 samples. Integrative analysis of GWAS and eQTL data was conducted by summary data-based Mendelian randomization (SMR) analysis software. To identify neuroticism associated gene sets, the SMR analysis results were further subjected to gene set enrichment analysis (GSEA). The gene set annotation dataset (containing 13,311 annotated gene sets) of GSEA Molecular Signatures Database was used. SMR single gene analysis identified 6 significant genes for neuroticism, including MSRA (p value=2.27×10 -10 ), MGC57346 (p value=6.92×10 -7 ), BLK (p value=1.01×10 -6 ), XKR6 (p value=1.11×10 -6 ), C17ORF69 (p value=1.12×10 -6 ) and KIAA1267 (p value=4.00×10 -6 ). Gene set enrichment analysis observed significant association for Chr8p23 gene set (false discovery rate=0.033). Our results provide novel clues for the genetic mechanism studies of neuroticism. Copyright © 2017. Published by Elsevier Inc.
Decoding Gene Patents in Australia
Denley, Adam; Cherry, James
2015-01-01
Patents directed to naturally occurring genetic material, such as DNA, RNA, chromosomes, and genes, in an isolated or purified form have been granted in Australia for many years. This review provides scientists with a summary of the gene patent debate from an Australian perspective and specifically reviews how the various levels of the legal system as they apply to patents—the Australian Patent Office, Australian courts, and Australian government—have dealt with the issue of whether genetic m...
Wu, Chong; Pan, Wei
2018-04-01
Many genetic variants affect complex traits through gene expression, which can be exploited to boost statistical power and enhance interpretation in genome-wide association studies (GWASs) as demonstrated by the transcriptome-wide association study (TWAS) approach. Furthermore, due to polygenic inheritance, a complex trait is often affected by multiple genes with similar functions as annotated in gene pathways. Here, we extend TWAS from gene-based analysis to pathway-based analysis: we integrate public pathway collections, expression quantitative trait locus (eQTL) data and GWAS summary association statistics (or GWAS individual-level data) to identify gene pathways associated with complex traits. The basic idea is to weight the SNPs of the genes in a pathway based on their estimated cis-effects on gene expression, then adaptively test for association of the pathway with a GWAS trait by effectively aggregating possibly weak association signals across the genes in the pathway. The P values can be calculated analytically and thus fast. We applied our proposed test with the KEGG and GO pathways to two schizophrenia (SCZ) GWAS summary association data sets, denoted by SCZ1 and SCZ2 with about 20,000 and 150,000 subjects, respectively. Most of the significant pathways identified by analyzing the SCZ1 data were reproduced by the SCZ2 data. Importantly, we identified 15 novel pathways associated with SCZ, such as GABA receptor complex (GO:1902710), which could not be uncovered by the standard single SNP-based analysis or gene-based TWAS. The newly identified pathways may help us gain insights into the biological mechanism underlying SCZ. Our results showcase the power of incorporating gene expression information and gene functional annotations into pathway-based association testing for GWAS. © 2018 WILEY PERIODICALS, INC.
[Dopamine and excessive alcohol consumption: how genes interact with their environment
Schellekens, A.F.A.; Scholte, R.H.J.; Engels, R.C.M.E.; Verkes, R.J.
2013-01-01
SUMMARY BACKGROUND: Hereditary factors account for approximately 50% of the risk of developing alcohol dependence. Genes that affect the dopamine function in the brain have been extensively studied as candidate genes. AIM: To present the results of recent Dutch studies on the interaction between
Brock, Stephen E., Ed.
2011-01-01
This article presents summaries of three articles relevant to school crisis response: (1) "Factors Contributing to Posttraumatic Growth," summarized by Steve DeBlois; (2) "Psychological Debriefing in Cross-Cultural Contexts" (Stacey Rice); and (3) "Brain Abnormalities in PTSD" (Sunny Windingstad). The first summary reports the findings of a…
Veturi, Yogasudha; Ritchie, Marylyn D
2018-01-01
Transcriptome-wide association studies (TWAS) have recently been employed as an approach that can draw upon the advantages of genome-wide association studies (GWAS) and gene expression studies to identify genes associated with complex traits. Unlike standard GWAS, summary level data suffices for TWAS and offers improved statistical power. Two popular TWAS methods include either (a) imputing the cis genetic component of gene expression from smaller sized studies (using multi-SNP prediction or MP) into much larger effective sample sizes afforded by GWAS - TWAS-MP or (b) using summary-based Mendelian randomization - TWAS-SMR. Although these methods have been effective at detecting functional variants, it remains unclear how extensive variability in the genetic architecture of complex traits and diseases impacts TWAS results. Our goal was to investigate the different scenarios under which these methods yielded enough power to detect significant expression-trait associations. In this study, we conducted extensive simulations based on 6000 randomly chosen, unrelated Caucasian males from Geisinger's MyCode population to compare the power to detect cis expression-trait associations (within 500 kb of a gene) using the above-described approaches. To test TWAS across varying genetic backgrounds we simulated gene expression and phenotype using different quantitative trait loci per gene and cis-expression /trait heritability under genetic models that differentiate the effect of causality from that of pleiotropy. For each gene, on a training set ranging from 100 to 1000 individuals, we either (a) estimated regression coefficients with gene expression as the response using five different methods: LASSO, elastic net, Bayesian LASSO, Bayesian spike-slab, and Bayesian ridge regression or (b) performed eQTL analysis. We then sampled with replacement 50,000, 150,000, and 300,000 individuals respectively from the testing set of the remaining 5000 individuals and conducted GWAS on each
DEFF Research Database (Denmark)
Christoffersen, Mette; Tybjærg-Hansen, Anne
2015-01-01
PURPOSE OF REVIEW: To summarize recent findings from genome-wide association studies (GWAS), whole-exome sequencing of patients with familial hypercholesterolemia and 'exome chip' studies pointing to novel genes in LDL metabolism. RECENT FINDINGS: The genetic loci for ATP-binding cassette......-exome sequencing and 'exome chip' studies have additionally suggested several novel genes in LDL metabolism including insulin-induced gene 2, signal transducing adaptor family member 1, lysosomal acid lipase A, patatin-like phospholipase domain-containing protein 5 and transmembrane 6 superfamily member 2. Most...... of these findings still require independent replications and/or functional studies to confirm the exact role in LDL metabolism and the clinical implications for human health. SUMMARY: GWAS, exome sequencing studies, and recently 'exome chip' studies have suggested several novel genes with effects on LDL cholesterol...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Availability of Environmental Impact Assessment Summaries (EIA Summaries) and Environmental Impact Assessments (EIAs). 26.3 Section 26.3 Money and... DEVELOPMENT BANDS (MDBs) § 26.3 Availability of Environmental Impact Assessment Summaries (EIA Summaries) and...
Estimating Effect Sizes and Expected Replication Probabilities from GWAS Summary Statistics
DEFF Research Database (Denmark)
Holland, Dominic; Wang, Yunpeng; Thompson, Wesley K
2016-01-01
Genome-wide Association Studies (GWAS) result in millions of summary statistics ("z-scores") for single nucleotide polymorphism (SNP) associations with phenotypes. These rich datasets afford deep insights into the nature and extent of genetic contributions to complex phenotypes such as psychiatric......-scores, as such knowledge would enhance causal SNP and gene discovery, help elucidate mechanistic pathways, and inform future study design. Here we present a parsimonious methodology for modeling effect sizes and replication probabilities, relying only on summary statistics from GWAS substudies, and a scheme allowing...... for estimating the degree of polygenicity of the phenotype and predicting the proportion of chip heritability explainable by genome-wide significant SNPs in future studies with larger sample sizes. We apply the model to recent GWAS of schizophrenia (N = 82,315) and putamen volume (N = 12,596), with approximately...
International Nuclear Information System (INIS)
Mehinto, Alvine C.; Prucha, Melinda S.; Colli-Dula, Reyna C.; Kroll, Kevin J.; Lavelle, Candice M.; Barber, David S.; Vulpe, Christopher D.; Denslow, Nancy D.
2014-01-01
Highlights: • Low-level acute cadmium exposure elicited tissue-specific gene expression changes. • Molecular initiating events included oxidative stress and disruption of DNA repair. • Metallothionein, a marker of metal exposure, was not significantly affected. • We report effects of cadmium on cholesterol metabolism and steroid synthesis. • Diabetic complications and impaired reproduction are potential adverse outcomes. - Abstract: Cadmium is a heavy metal that can accumulate to toxic levels in the environment leading to detrimental effects in animals and humans including kidney, liver and lung injuries. Using a transcriptomics approach, genes and cellular pathways affected by a low dose of cadmium were investigated. Adult largemouth bass were intraperitoneally injected with 20 μg/kg of cadmium chloride (mean exposure level – 2.6 μg of cadmium per fish) and microarray analyses were conducted in the liver and testis 48 h after injection. Transcriptomic profiles identified in response to cadmium exposure were tissue-specific with the most differential expression changes found in the liver tissues, which also contained much higher levels of cadmium than the testis. Acute exposure to a low dose of cadmium induced oxidative stress response and oxidative damage pathways in the liver. The mRNA levels of antioxidants such as catalase increased and numerous transcripts related to DNA damage and DNA repair were significantly altered. Hepatic mRNA levels of metallothionein, a molecular marker of metal exposure, did not increase significantly after 48 h exposure. Carbohydrate metabolic pathways were also disrupted with hepatic transcripts such as UDP-glucose, pyrophosphorylase 2, and sorbitol dehydrogenase highly induced. Both tissues exhibited a disruption of steroid signaling pathways. In the testis, estrogen receptor beta and transcripts linked to cholesterol metabolism were suppressed. On the contrary, genes involved in cholesterol metabolism were highly
Energy Technology Data Exchange (ETDEWEB)
Mehinto, Alvine C., E-mail: alvinam@sccwrp.org [Southern California Coastal Water Research Project, Costa Mesa, CA 92626 (United States); Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Prucha, Melinda S. [Department of Human Genetics, Yerkes National Primate Research Center, Emory University, Atlanta, GA 30322 (United States); Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Colli-Dula, Reyna C.; Kroll, Kevin J.; Lavelle, Candice M.; Barber, David S. [Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States); Vulpe, Christopher D. [Department of Nutritional Sciences and Toxicology, University of California, Berkeley, CA 94720 (United States); Denslow, Nancy D. [Department of Physiological Sciences and Center for Environmental and Human Toxicology, University of Florida, Gainesville, FL 32611 (United States)
2014-07-01
Highlights: • Low-level acute cadmium exposure elicited tissue-specific gene expression changes. • Molecular initiating events included oxidative stress and disruption of DNA repair. • Metallothionein, a marker of metal exposure, was not significantly affected. • We report effects of cadmium on cholesterol metabolism and steroid synthesis. • Diabetic complications and impaired reproduction are potential adverse outcomes. - Abstract: Cadmium is a heavy metal that can accumulate to toxic levels in the environment leading to detrimental effects in animals and humans including kidney, liver and lung injuries. Using a transcriptomics approach, genes and cellular pathways affected by a low dose of cadmium were investigated. Adult largemouth bass were intraperitoneally injected with 20 μg/kg of cadmium chloride (mean exposure level – 2.6 μg of cadmium per fish) and microarray analyses were conducted in the liver and testis 48 h after injection. Transcriptomic profiles identified in response to cadmium exposure were tissue-specific with the most differential expression changes found in the liver tissues, which also contained much higher levels of cadmium than the testis. Acute exposure to a low dose of cadmium induced oxidative stress response and oxidative damage pathways in the liver. The mRNA levels of antioxidants such as catalase increased and numerous transcripts related to DNA damage and DNA repair were significantly altered. Hepatic mRNA levels of metallothionein, a molecular marker of metal exposure, did not increase significantly after 48 h exposure. Carbohydrate metabolic pathways were also disrupted with hepatic transcripts such as UDP-glucose, pyrophosphorylase 2, and sorbitol dehydrogenase highly induced. Both tissues exhibited a disruption of steroid signaling pathways. In the testis, estrogen receptor beta and transcripts linked to cholesterol metabolism were suppressed. On the contrary, genes involved in cholesterol metabolism were highly
Decoding gene patents in Australia.
Denley, Adam; Cherry, James
2014-10-03
Patents directed to naturally occurring genetic material, such as DNA, RNA, chromosomes, and genes, in an isolated or purified form have been granted in Australia for many years. This review provides scientists with a summary of the gene patent debate from an Australian perspective and specifically reviews how the various levels of the legal system as they apply to patents-the Australian Patent Office, Australian courts, and Australian government-have dealt with the issue of whether genetic material is proper subject matter for a patent. Copyright © 2015 Cold Spring Harbor Laboratory Press; all rights reserved.
Energy Technology Data Exchange (ETDEWEB)
1994-07-01
The US DOE, through the Biofuels Systems Division (BSD) is addressing the issues surrounding US vulnerability to petroleum supply. The BSD goal is to develop technologies that are competitive with fossil fuels, in both cost and environmental performance, by the end of the decade. This document contains summaries of ongoing research sponsored by the DOE BSD. A summary sheet is presented for each project funded or in existence during FY 1993. Each summary sheet contains and account of project funding, objectives, accomplishments and current status, and significant publications.
ACE-it: a tool for genome-wide integration of gene dosage and RNA expression data
van Wieringen, W.N.; Belien, J.A.M.; Vosse, S.; Achame, E.M.; Ylstra, B.
2006-01-01
Summary: We describe a tool, called ACE-it (Array CGH Expression integration tool). ACE-it links the chromosomal position of the gene dosage measured by array CGH to the genes measured by the expression array. ACE-it uses this link to statistically test whether gene dosage affects RNA expression. ©
RNA interference: learning gene knock-down from cell physiology
Directory of Open Access Journals (Sweden)
Provenzano Maurizio
2004-11-01
Full Text Available Summary Over the past decade RNA interference (RNAi has emerged as a natural mechanism for silencing gene expression. This ancient cellular antiviral response can be exploited to allow specific inhibition of the function of any chosen target gene. RNAi is proving to be an invaluable research tool, allowing much more rapid characterization of the function of known genes. More importantly, RNAi technology considerably bolsters functional genomics to aid in the identification of novel genes involved in disease processes. This review briefly describes the molecular principles underlying the biology of RNAi phenomenon and discuss the main technical issues regarding optimization of RNAi experimental design.
Li, Li; Tacke, Eckhard; Hofferbert, Hans-Reinhardt; Lübeck, Jens; Strahwald, Josef; Draffehn, Astrid M; Walkemeier, Birgit; Gebhardt, Christiane
2013-04-01
Tuber yield, starch content, starch yield and chip color are complex traits that are important for industrial uses and food processing of potato. Chip color depends on the quantity of reducing sugars glucose and fructose in the tubers, which are generated by starch degradation. Reducing sugars accumulate when tubers are stored at low temperatures. Early and efficient selection of cultivars with superior yield, starch yield and chip color is hampered by the fact that reliable phenotypic selection requires multiple year and location trials. Application of DNA-based markers early in the breeding cycle, which are diagnostic for superior alleles of genes that control natural variation of tuber quality, will reduce the number of clones to be evaluated in field trials. Association mapping using genes functional in carbohydrate metabolism as markers has discovered alleles of invertases and starch phosphorylases that are associated with tuber quality traits. Here, we report on new DNA variants at loci encoding ADP-glucose pyrophosphorylase and the invertase Pain-1, which are associated with positive or negative effect with chip color, tuber starch content and starch yield. Marker-assisted selection (MAS) and marker validation were performed in tetraploid breeding populations, using various combinations of 11 allele-specific markers associated with tuber quality traits. To facilitate MAS, user-friendly PCR assays were developed for specific candidate gene alleles. In a multi-parental population of advanced breeding clones, genotypes were selected for having different combinations of five positive and the corresponding negative marker alleles. Genotypes combining five positive marker alleles performed on average better than genotypes with four negative alleles and one positive allele. When tested individually, seven of eight markers showed an effect on at least one quality trait. The direction of effect was as expected. Combinations of two to three marker alleles were
2014-01-01
This work offers a summary of Cukier the book: "Big Data: A Revolution That Will Transform How we Live, Work, and Think" by Viktor Mayer-Schonberg and Kenneth. Summary of the ideas in Viktor Mayer-Schonberg's and Kenneth Cukier's book: " Big Data " explains that big data is where we use huge quantities of data to make better predictions based on the fact we identify patters in the data rather than trying to understand the underlying causes in more detail. This summary highlights that big data will be a source of new economic value and innovation in the future. Moreover, it shows that it will
International Nuclear Information System (INIS)
1982-07-01
The Summary Information Report (SIR) provides summary data concerning NRC and its licensees for general use by the Chairman, other Commissioners and Commission staff offices, the Executive Director for Operations, and the Office Directors. SIR is published quarterly by the Management Information Branch (49-27834) of the Office of Resource Management
Guidelines for the naming of genes, gene products, and mutants in the opportunistic protists.
Limper, Andrew H; Weiss, Louis M
2011-01-01
The opportunistic protists encompass a wide diversity of organisms including Pneumocystis, Toxoplasma, cryptosporidia, microsporidia, and related genera. Recent advances in the molecular biology and cellular biochemistry of these organisms have led to the identification of an ever growing numbers of key genes and their cognate proteins. Until now, these molecules have not been designated using any consistent nomenclature system, leading to considerable confusion. The participants of the 11th International Workshop on Opportunistic Protists met on August 3, 2010 to reach consensus of a nomenclature system for genes, gene products, and mutants in the opportunistic protists. The following summary reports the consensus agreement to move toward a unified nomenclature system for these organisms. The system is adapted from that used for Saccharomyces cerevisiae. © 2011 The Author(s). Journal of Eukaryotic Microbiology © 2011 International Society of Protistologists.
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Summary. 1502.12 Section 1502.12 Protection of Environment COUNCIL ON ENVIRONMENTAL QUALITY ENVIRONMENTAL IMPACT STATEMENT § 1502.12 Summary. Each environmental impact statement shall contain a summary which adequately and accurately summarizes...
7 CFR 3402.12 - Project summary.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Project summary. 3402.12 Section 3402.12 Agriculture... FELLOWSHIP GRANTS PROGRAM Preparation of an Application § 3402.12 Project summary. Using the Project Summary.... The summary should not include any reference to the specific number of fellowships requested. The...
49 CFR 194.113 - Information summary.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...
A Bayesian Framework for Multiple Trait Colo-calization from Summary Association Statistics.
Giambartolomei, Claudia; Zhenli Liu, Jimmy; Zhang, Wen; Hauberg, Mads; Shi, Huwenbo; Boocock, James; Pickrell, Joe; Jaffe, Andrew E; Pasaniuc, Bogdan; Roussos, Panos
2018-03-19
Most genetic variants implicated in complex diseases by genome-wide association studies (GWAS) are non-coding, making it challenging to understand the causative genes involved in disease. Integrating external information such as quantitative trait locus (QTL) mapping of molecular traits (e.g., expression, methylation) is a powerful approach to identify the subset of GWAS signals explained by regulatory effects. In particular, expression QTLs (eQTLs) help pinpoint the responsible gene among the GWAS regions that harbor many genes, while methylation QTLs (mQTLs) help identify the epigenetic mechanisms that impact gene expression which in turn affect disease risk. In this work we propose multiple-trait-coloc (moloc), a Bayesian statistical framework that integrates GWAS summary data with multiple molecular QTL data to identify regulatory effects at GWAS risk loci. We applied moloc to schizophrenia (SCZ) and eQTL/mQTL data derived from human brain tissue and identified 52 candidate genes that influence SCZ through methylation. Our method can be applied to any GWAS and relevant functional data to help prioritize disease associated genes. moloc is available for download as an R package (https://github.com/clagiamba/moloc). We also developed a web site to visualize the biological findings (icahn.mssm.edu/moloc). The browser allows searches by gene, methylation probe, and scenario of interest. claudia.giambartolomei@gmail.com. Supplementary data are available at Bioinformatics online.
DNMT1-interacting RNAs block gene specific DNA methylation
Di Ruscio, Annalisa; Ebralidze, Alexander K.; Benoukraf, Touati; Amabile, Giovanni; Goff, Loyal A.; Terragni, Joylon; Figueroa, Maria Eugenia; De Figureido Pontes, Lorena Lobo; Alberich-Jorda, Meritxell; Zhang, Pu; Wu, Mengchu; D’Alò, Francesco; Melnick, Ari; Leone, Giuseppe; Ebralidze, Konstantin K.; Pradhan, Sriharsa; Rinn, John L.; Tenen, Daniel G.
2013-01-01
Summary DNA methylation was described almost a century ago. However, the rules governing its establishment and maintenance remain elusive. Here, we present data demonstrating that active transcription regulates levels of genomic methylation. We identified a novel RNA arising from the CEBPA gene locus critical in regulating the local DNA methylation profile. This RNA binds to DNMT1 and prevents CEBPA gene locus methylation. Deep sequencing of transcripts associated with DNMT1 combined with genome-scale methylation and expression profiling extended the generality of this finding to numerous gene loci. Collectively, these results delineate the nature of DNMT1-RNA interactions and suggest strategies for gene selective demethylation of therapeutic targets in disease. PMID:24107992
Mirror Confinement Systems: project summaries
International Nuclear Information System (INIS)
1980-07-01
This report contains descriptions of the projects supported by the Mirror Confinement Systems (MCS) Division of the Office of Fusion Energy. The individual project summaries were prepared by the principal investigators, in collaboration with MCS staff office, and include objectives and milestones for each project. In addition to project summaries, statements of Division objectives and budget summaries are also provided
International Nuclear Information System (INIS)
2004-01-01
The fourth workshop of the OECD/NEA Forum on Stakeholder Confidence (FSC) was hosted by ONDRAF/NIRAS, the Belgian Agency for Radioactive Waste Management and enriched fissile materials. The central theme of the workshop was ''Dealing with interests, values and knowledge in managing risk''within the Belgian context of local partnerships for the long term management of low-level, short-lived radioactive waste. The four-day workshop started with a half-day session in Brussels giving a general introduction on the Belgian context and the local partnership methodology. This was followed by community visits to three local partnerships, PaLoFF in Fleurus-Farciennes, MONA in Mol, and STOLA in Dessel. After the visits, the workshop continued with two full-day sessions in Brussels. One hundred and nineteen registered participants, representing 13 countries, attended the workshop or participated in the community visits. About two thirds were Belgian stakeholders; the remainder came from FSC member organisations. The participants included representatives of municipal governments, civil society organisations, government agencies, industrial companies, the media, and international organisations as well as private citizens, consultants and academics. This Executive Summary gives an overview of the presentations and discussions that took place at the workshop and the community visits. The structure of the Executive Summary follows the structure of the workshop itself. Complementary to this Executive Summary and also provided with this document, is a NEA Secretariat's reflection aiming to place the main lessons of the workshop into an international perspective. (author)
Gene Regulation in Primates Evolves under Tissue-Specific Selection Pressures
Blekhman, Ran; Oshlack, Alicia; Chabot, Adrien E.; Smyth, Gordon K.; Gilad, Yoav
2008-01-01
Author Summary It has long been hypothesized that in addition to structural changes to proteins, changes in gene regulation might underlie many of the anatomic and behavioral differences between humans and other primates. However, to date, there are only a handful of examples of regulatory adaptations in humans. In this work, we present a genome-wide study of gene expression levels in livers, kidneys, and hearts from three species: humans, chimpanzees, and rhesus macaques. These data allowed ...
77 FR 12865 - Enforcement Actions Summary
2012-03-02
...] Enforcement Actions Summary AGENCY: Transportation Security Administration, DHS. ACTION: Notice of availability. SUMMARY: The Transportation Security Administration (TSA) is providing notice that it has issued an annual summary of all enforcement actions taken by TSA under the authority granted in the...
78 FR 11216 - Enforcement Actions Summary
2013-02-15
...] Enforcement Actions Summary AGENCY: Transportation Security Administration, DHS. ACTION: Notice of availability. SUMMARY: The Transportation Security Administration (TSA) is providing notice that it has issued an annual summary of all enforcement actions taken by TSA under the authority granted in the...
76 FR 9357 - Enforcement Actions Summary
2011-02-17
...] Enforcement Actions Summary AGENCY: Transportation Security Administration, DHS. ACTION: Notice of Availability. SUMMARY: The Transportation Security Administration (TSA) is providing notice that it has issued an annual summary of all enforcement actions taken by TSA under the authority granted in the...
Face facts: Genes, environment, and clefts
Energy Technology Data Exchange (ETDEWEB)
Murray, J.C. [Univ. of Iowa, Iowa City IA (United States)
1995-08-01
Cleft lip and/or palate provides an ideal, albeit complex, model for the study of human developmental anomalies. Clefting disorders show a mix of well-defined syndromic causes (many with single-gene or environmental etiologies) coupled with their more common presentation in the nonsyndromic form. This summary presents some insight into the genetic causes of, etiology of and animal models for cleft lip and/or palate. 79 refs.
19 CFR 210.18 - Summary determinations.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Summary determinations. 210.18 Section 210.18 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE ADJUDICATION AND ENFORCEMENT Motions § 210.18 Summary determinations. (a) Motions for summary...
Reader, Capitol
2013-01-01
This ebook consists of a summary of the ideas, viewpoints and facts presented by Hugh Hewitt in his book "Blog: Understanding the Information Reformation that's Changing Your World". This summary offers a concise overview of the entire book in less than 30 minutes reading time. However this work does not replace in any case Hugh Hewitt's book.Hewitt argues that blogs have an important potential and he believes that it would be a dreadful mistake to avoid their power.
PROP1 gene mutations in a 36-year-old female presenting with psychosis
Rijal, Tshristi; Jha, Kunal Kishor; Saluja, Harpreet
2017-01-01
Summary Combined pituitary hormonal deficiency (CPHD) is a rare disease that results from mutations in genes coding for transcription factors that regulate the differentiation of pituitary cells. PROP1 gene mutations are one of the etiological diagnoses of congenital panhypopituitarism, however symptoms vary depending on phenotypic expression. We present a case of psychosis in a 36-year-old female with congenital panhypopituitarism who presented with paranoia, flat affect and ideas of reference without a delirious mental state, which resolved with hormone replacement and antipsychotics. Further evaluation revealed that she had a homozygous mutation of PROP1 gene. In summary, compliance with hormonal therapy for patients with hypopituitarism appears to be effective for the prevention and treatment of acute psychosis symptoms. Learning points: Patients with PROP1 gene mutation may present with psychosis with no impairment in orientation and memory. There is currently inadequate literature on this topic, and further study on the possible mechanisms of psychosis as a result of endocrine disturbance is required. Compliance with hormonal therapy for patients with hypopituitarism appears to be effective for prevention and treatment of acute psychosis symptoms. PMID:28458894
Positive-negative-selection-mediated gene targeting in rice
Directory of Open Access Journals (Sweden)
Zenpei eShimatani
2015-01-01
Full Text Available Gene targeting (GT refers to the designed modification of genomic sequence(s through homologous recombination (HR. GT is a powerful tool both for the study of gene function and for molecular breeding. However, in transformation of higher plants, non-homologous end joining (NHEJ occurs overwhelmingly in somatic cells, masking HR-mediated GT. Positive-negative selection (PNS is an approach for finding HR-mediated GT events because it can eliminate NHEJ effectively by expression of a negative-selection marker gene. In rice—a major crop worldwide—reproducible PNS-mediated GT of endogenous genes has now been successfully achieved. The procedure is based on strong PNS using diphtheria toxin A-fragment as a negative marker, and has succeeded in the directed modification of several endogenous rice genes in various ways. In addition to gene knock-outs and knock-ins, a nucleotide substitution in a target gene was also achieved recently. This review presents a summary of the development of the rice PNS system, highlighting its advantages. Different types of gene modification and gene editing aimed at developing new plant breeding technology (NPBT based on PNS are discussed.
29 CFR 1905.41 - Summary decision.
2010-07-01
... OCCUPATIONAL SAFETY AND HEALTH ACT OF 1970 Summary Decisions § 1905.41 Summary decision. (a) No genuine issue... 29 Labor 5 2010-07-01 2010-07-01 false Summary decision. 1905.41 Section 1905.41 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR RULES OF...
40 CFR 68.155 - Executive summary.
2010-07-01
... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Executive summary. 68.155 Section 68...) CHEMICAL ACCIDENT PREVENTION PROVISIONS Risk Management Plan § 68.155 Executive summary. The owner or operator shall provide in the RMP an executive summary that includes a brief description of the following...
Computerized summary scoring: crowdsourcing-based latent semantic analysis.
Li, Haiying; Cai, Zhiqiang; Graesser, Arthur C
2017-11-03
In this study we developed and evaluated a crowdsourcing-based latent semantic analysis (LSA) approach to computerized summary scoring (CSS). LSA is a frequently used mathematical component in CSS, where LSA similarity represents the extent to which the to-be-graded target summary is similar to a model summary or a set of exemplar summaries. Researchers have proposed different formulations of the model summary in previous studies, such as pregraded summaries, expert-generated summaries, or source texts. The former two methods, however, require substantial human time, effort, and costs in order to either grade or generate summaries. Using source texts does not require human effort, but it also does not predict human summary scores well. With human summary scores as the gold standard, in this study we evaluated the crowdsourcing LSA method by comparing it with seven other LSA methods that used sets of summaries from different sources (either experts or crowdsourced) of differing quality, along with source texts. Results showed that crowdsourcing LSA predicted human summary scores as well as expert-good and crowdsourcing-good summaries, and better than the other methods. A series of analyses with different numbers of crowdsourcing summaries demonstrated that the number (from 10 to 100) did not significantly affect performance. These findings imply that crowdsourcing LSA is a promising approach to CSS, because it saves human effort in generating the model summary while still yielding comparable performance. This approach to small-scale CSS provides a practical solution for instructors in courses, and also advances research on automated assessments in which student responses are expected to semantically converge on subject matter content.
ORF Alignment: NC_000918 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... pyrophosphorylase) ... Length = 154 ... Query: 4 ... RVVYPGTFDPPHYGHLDIVKRSARIFDEVVVAVAKKPRKFLLFDA...EERVKMFEKMVEDIP 63 ... RVVYPGTFDPPHYGHLDIVKRSARIFDEVVVAVAKKPRKFLLFDAEERVKM...FEKMVEDIP Sbjct: 1 ... RVVYPGTFDPPHYGHLDIVKRSARIFDEVVVAVAKKPRKFLLFDAEERVKMFEKMVEDIP 60 ... Query: 124 IHISSTIVRDV
International Nuclear Information System (INIS)
1987-01-01
This volume contains summaries of 28 papers presented at the 27. conference of the Canadian Nuclear Association. These papers discuss the general situation of the Canadian nuclear industry and the CANDU reactor; dialogue with the public; the International Atomic Energy Agency; and economic goals and operating lessons. It also contains summaries of 70 papers presented at the 8. conference of the Canadian Nuclear Society, which discuss plant life extension; safety and the environment; reactor physics; thermalhydraulics; risk assessment; the CANDU spacer location and repositioning project; CANDU operations; safety research after Chernobyl; fuel channels; and nuclear technology developments. The individual papers are also available in INIS-mf--13673 (CNA), and INIS-mf--12909 (CNS). (L.L.)
U.S. Annual Climatological Summaries
National Oceanic and Atmospheric Administration, Department of Commerce — Annual Climatological Summary contains historical monthly and annual summaries for over 8000 U.S. locations. Observing stations are located in the United States of...
49 CFR 1150.44 - Caption summary.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Caption summary. 1150.44 Section 1150.44... Exempt Transactions Under 49 U.S.C. 10902 for Class III Rail Carriers § 1150.44 Caption summary. The caption summary must be in the following form. The information symbolized by numbers is identified in the...
A gene expression signature for RSV: clinical implications and limitations.
Directory of Open Access Journals (Sweden)
Peter J M Openshaw
2013-11-01
Full Text Available Peter Openshaw discusses the challenges in advancing respiratory syncytial virus (RSV treatments and the implications of a study by Mejias and colleagues using a newly identified gene signature for diagnosis and prediction of RSV severity. Please see later in the article for the Editors' Summary.
29 CFR 1904.32 - Annual summary.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Annual summary. 1904.32 Section 1904.32 Labor Regulations... Requirements § 1904.32 Annual summary. (a) Basic requirement. At the end of each calendar year, you must: (1... deficiencies identified; (2) Create an annual summary of injuries and illnesses recorded on the OSHA 300 Log...
Factors affecting the gene expression of in vitro cultured human preimplantation embryos
Mantikou, E.; Jonker, M.J.; Wong, K.M.; van Montfoort, A.P.A.; de Jong, M.; Breit, T.M.; Repping, S.; Mastenbroek, S.
2016-01-01
STUDY QUESTION: What is the relative effect of common environmental and biological factors on transcriptome changes during human preimplantation development? SUMMARY ANSWER: Developmental stage and maternal age had a larger effect on the global gene expression profile of human preimplantation
International Nuclear Information System (INIS)
1991-01-01
The information contained in this statistical summary leaflet summarizes in bar charts or pie charts Nuclear Electric's performance in 1990-91 in the areas of finance, plant and plant operations, safety, commercial operations and manpower. It is intended that the information will provide a basis for comparison in future years. The leaflet also includes a summary of Nuclear Electric's environmental policy statement. (UK)
DEFF Research Database (Denmark)
Yi, Ke; Wang, Lu; Wei, Zhewei
2014-01-01
), of a particular attribute of these records. Aggregation queries are especially useful in business intelligence and data analysis applications where users are interested not in the actual records, but some statistics of them. They can also be executed much more efficiently than reporting queries, by embedding...... returned by reporting queries. In this article, we design indexing techniques that allow for extracting a statistical summary of all the records in the query. The summaries we support include frequent items, quantiles, and various sketches, all of which are of central importance in massive data analysis....... Our indexes require linear space and extract a summary with the optimal or near-optimal query cost. We illustrate the efficiency and usefulness of our designs through extensive experiments and a system demonstration....
International Nuclear Information System (INIS)
Henley, E.M.
1998-01-01
One never quite knows what to say in a summary. If you were at the sessions, you heard the same talks I did. Perhaps the purpose is to summarize the parallel sessions, but like you, I can only attend one of these sessions. In addition, the time is short, so that this cannot be a real summary. What I will present are impressions of the past two days, and these will certainly be colored by my own views. Thus at the outset, let me apologize for any and all omissions and distortions. I will cover primarily the plenary session talks, but will organize this summary along the following lines: 1. vector (V) mesons; 2. pseudoscalar mesons, and 3. other subjects, notably with electrons. This afternoon's talks are so close in time to this summary that I shall omit them. (author)
U.S. Department of Health & Human Services — Nursing home summary information for the Health and Fire Safety Inspections currently listed on Nursing Home Compare, including dates of the three most recent...
Standards development status. Summary report
International Nuclear Information System (INIS)
1981-12-01
The Standards Development Status Summary Report is designed for scheduling, monitoring, and controlling the process by which Regulatory Standards, Guides, Reports, Petitions, and Environmental Statements are written. It is a summary of the current schedule plans for development of the above products
New Genes and New Insights from Old Genes: Update on Alzheimer Disease
Ringman, John M.; Coppola, Giovanni
2013-01-01
Purpose of Review: This article discusses the current status of knowledge regarding the genetic basis of Alzheimer disease (AD) with a focus on clinically relevant aspects. Recent Findings: The genetic architecture of AD is complex, as it includes multiple susceptibility genes and likely nongenetic factors. Rare but highly penetrant autosomal dominant mutations explain a small minority of the cases but have allowed tremendous advances in understanding disease pathogenesis. The identification of a strong genetic risk factor, APOE, reshaped the field and introduced the notion of genetic risk for AD. More recently, large-scale genome-wide association studies are adding to the picture a number of common variants with very small effect sizes. Large-scale resequencing studies are expected to identify additional risk factors, including rare susceptibility variants and structural variation. Summary: Genetic assessment is currently of limited utility in clinical practice because of the low frequency (Mendelian mutations) or small effect size (common risk factors) of the currently known susceptibility genes. However, genetic studies are identifying with confidence a number of novel risk genes, and this will further our understanding of disease biology and possibly the identification of therapeutic targets. PMID:23558482
2010-01-01
... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Summary. 1805.101 Section 1805.101 Banks and Banking COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS FUND, DEPARTMENT OF THE TREASURY COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS PROGRAM General Provisions § 1805.101 Summary. Under the Community...
International Nuclear Information System (INIS)
Tinkham, M.
1991-01-01
This summary will begin with short remarks, trying to recall some of the spirit of the presentations of each of the speakers during the first day, with no attempt at detail or completeness, given the need for a 20:1 compression relative to the original talk. The author hopes these idiosyncratic recollections do not infuriate the speakers too much. Since the speakers on the second day presented such interlocking topics, he simply tries to present some sort of consensus report, to which he adds some comments of his own. The two talks preceding this Summary on the final day dealt with the prospects for applications; since he had no chance to attempt to prepare a proper report on these, he says only a few words about those presentations
Operon Gene Order Is Optimized for Ordered Protein Complex Assembly
Wells, Jonathan N.; Bergendahl, L. Therese; Marsh, Joseph A.
2016-01-01
Summary The assembly of heteromeric protein complexes is an inherently stochastic process in which multiple genes are expressed separately into proteins, which must then somehow find each other within the cell. Here, we considered one of the ways by which prokaryotic organisms have attempted to maximize the efficiency of protein complex assembly: the organization of subunit-encoding genes into operons. Using structure-based assembly predictions, we show that operon gene order has been optimized to match the order in which protein subunits assemble. Exceptions to this are almost entirely highly expressed proteins for which assembly is less stochastic and for which precisely ordered translation offers less benefit. Overall, these results show that ordered protein complex assembly pathways are of significant biological importance and represent a major evolutionary constraint on operon gene organization. PMID:26804901
Directory of Open Access Journals (Sweden)
Yan Tan
2015-06-01
Full Text Available Summary: Gene set enrichment analysis (GSEA approaches are widely used to identify coordinately regulated genes associated with phenotypes of interest. Here, we present Constellation Map, a tool to visualize and interpret the results when enrichment analyses yield a long list of significantly enriched gene sets. Constellation Map identifies commonalities that explain the enrichment of multiple top-scoring gene sets and maps the relationships between them. Constellation Map can help investigators take full advantage of GSEA and facilitates the biological interpretation of enrichment results. Availability: Constellation Map is freely available as a GenePattern module at http://www.genepattern.org.
Generating Concise Natural Language Summaries.
McKeown, Kathleen; And Others
1995-01-01
Presents an approach to summarization that combines information from multiple facts into a single sentence using linguistic constructions. Describes two applications: one produces summaries of basketball games, and the other contains summaries of telephone network planning activity. Both summarize input data as opposed to full text. Discusses…
National Oceanic and Atmospheric Administration, Department of Commerce — Multi-year summaries of one or more meteorological elements at a station or in a state. Primarily includes Form 1078, a United States Weather Bureau form designed...
Sexual Harassment and Organizational Outcomes Executive Summary
2011-10-01
quid pro quo type of Sexual harassment and Organizational, 4 sexual harassment (e.g., sexual coercion). This should drive organizational efforts to... Sexual Harassment and Organizational Outcomes Executive Summary Charlie L. Law DEFENSE EQUAL...Executive Summary] No. 99-11 Sexual harassment and Organizational, 2 Executive Summary Issue
Empirical validation of the S-Score algorithm in the analysis of gene expression data
Directory of Open Access Journals (Sweden)
Archer Kellie J
2006-03-01
Full Text Available Abstract Background Current methods of analyzing Affymetrix GeneChip® microarray data require the estimation of probe set expression summaries, followed by application of statistical tests to determine which genes are differentially expressed. The S-Score algorithm described by Zhang and colleagues is an alternative method that allows tests of hypotheses directly from probe level data. It is based on an error model in which the detected signal is proportional to the probe pair signal for highly expressed genes, but approaches a background level (rather than 0 for genes with low levels of expression. This model is used to calculate relative change in probe pair intensities that converts probe signals into multiple measurements with equalized errors, which are summed over a probe set to form the S-Score. Assuming no expression differences between chips, the S-Score follows a standard normal distribution, allowing direct tests of hypotheses to be made. Using spike-in and dilution datasets, we validated the S-Score method against comparisons of gene expression utilizing the more recently developed methods RMA, dChip, and MAS5. Results The S-score showed excellent sensitivity and specificity in detecting low-level gene expression changes. Rank ordering of S-Score values more accurately reflected known fold-change values compared to other algorithms. Conclusion The S-score method, utilizing probe level data directly, offers significant advantages over comparisons using only probe set expression summaries.
2010-01-01
... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Summary. 1806.101 Section 1806.101 Banks and Banking COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS FUND, DEPARTMENT OF THE TREASURY BANK ENTERPRISE AWARD PROGRAM General Provisions § 1806.101 Summary. (a) Under the Bank Enterprise Award Program, the...
Site environmental report summary
International Nuclear Information System (INIS)
1992-01-01
In this summary of the Fernald 1992 Site Environmental Report the authors will describe the impact of the Fernald site on man and the environment and provide results from the ongoing Environmental Monitoring Program. Also included is a summary of the data obtained from sampling conducted to determine if the site complies with DOE, US Environmental Protection Agency (USEPA), and Ohio EPA (OEPA) requirements. These requirements are set to protect both man and the environment
19 CFR 151.41 - Information on entry summary.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Information on entry summary. 151.41 Section 151... Products § 151.41 Information on entry summary. On the entry summary for petroleum or petroleum products in.... If the exact volumetric quantity cannot be determined in advance, the entry summary may be made for...
VideoSET: Video Summary Evaluation through Text
Yeung, Serena; Fathi, Alireza; Fei-Fei, Li
2014-01-01
In this paper we present VideoSET, a method for Video Summary Evaluation through Text that can evaluate how well a video summary is able to retain the semantic information contained in its original video. We observe that semantics is most easily expressed in words, and develop a text-based approach for the evaluation. Given a video summary, a text representation of the video summary is first generated, and an NLP-based metric is then used to measure its semantic distance to ground-truth text ...
QB1 - Stochastic Gene Regulation
Energy Technology Data Exchange (ETDEWEB)
Munsky, Brian [Los Alamos National Laboratory
2012-07-23
Summaries of this presentation are: (1) Stochastic fluctuations or 'noise' is present in the cell - Random motion and competition between reactants, Low copy, quantization of reactants, Upstream processes; (2) Fluctuations may be very important - Cell-to-cell variability, Cell fate decisions (switches), Signal amplification or damping, stochastic resonances; and (3) Some tools are available to mode these - Kinetic Monte Carlo simulations (SSA and variants), Moment approximation methods, Finite State Projection. We will see how modeling these reactions can tell us more about the underlying processes of gene regulation.
41 CFR 60-2.31 - Program summary.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Program summary. 60-2.31...-AFFIRMATIVE ACTION PROGRAMS Miscellaneous § 60-2.31 Program summary. The affirmative action program must be summarized and updated annually. The program summary must be prepared in a format which will be prescribed by...
Mediator and Cohesin Connect Gene Expression and Chromatin Architecture
Kagey, Michael H.; Newman, Jamie J.; Bilodeau, Steve; Zhan, Ye; Orlando, David A.; van Berkum, Nynke L.; Ebmeier, Christopher C.; Goossens, Jesse; Rahl, Peter B.; Levine, Stuart S.; Taatjes, Dylan J.; Dekker, Job; Young, Richard A.
2010-01-01
Summary Transcription factors control cell specific gene expression programs through interactions with diverse coactivators and the transcription apparatus. Gene activation may involve DNA loop formation between enhancer-bound transcription factors and the transcription apparatus at the core promoter, but this process is not well understood. We report here that Mediator and Cohesin physically and functionally connect the enhancers and core promoters of active genes in embryonic stem cells. Mediator, a transcriptional coactivator, forms a complex with Cohesin, which can form rings that connect two DNA segments. The Cohesin loading factor Nipbl is associated with Mediator/Cohesin complexes, providing a means to load Cohesin at promoters. DNA looping is observed between the enhancers and promoters occupied by Mediator and Cohesin. Mediator and Cohesin occupy different promoters in different cells, thus generating cell-type specific DNA loops linked to the gene expression program of each cell. PMID:20720539
Asención Diez, Matías D; Miah, Farzana; Stevenson, Clare E M; Lawson, David M; Iglesias, Alberto A; Bornemann, Stephen
2017-01-20
Trehalose-6-phosphate synthase OtsA from streptomycetes is unusual in that it uses GDP-glucose as the donor substrate rather than the more commonly used UDP-glucose. We now confirm that OtsA from Streptomyces venezuelae has such a preference for GDP-glucose and can utilize ADP-glucose to some extent too. A crystal structure of the enzyme shows that it shares twin Rossmann-like domains with the UDP-glucose-specific OtsA from Escherichia coli However, it is structurally more similar to Streptomyces hygroscopicus VldE, a GDP-valienol-dependent pseudoglycosyltransferase enzyme. Comparison of the donor binding sites reveals that the amino acids associated with the binding of diphosphoribose are almost all identical in these three enzymes. By contrast, the amino acids associated with binding guanine in VldE (Asn, Thr, and Val) are similar in S. venezuelae OtsA (Asp, Ser, and Phe, respectively) but not conserved in E. coli OtsA (His, Leu, and Asp, respectively), providing a rationale for the purine base specificity of S. venezuelae OtsA. To establish which donor is used in vivo, we generated an otsA null mutant in S. venezuelae The mutant had a cell density-dependent growth phenotype and accumulated galactose 1-phosphate, glucose 1-phosphate, and GDP-glucose when grown on galactose. To determine how the GDP-glucose is generated, we characterized three candidate GDP-glucose pyrophosphorylases. SVEN_3027 is a UDP-glucose pyrophosphorylase, SVEN_3972 is an unusual ITP-mannose pyrophosphorylase, and SVEN_2781 is a pyrophosphorylase that is capable of generating GDP-glucose as well as GDP-mannose. We have therefore established how S. venezuelae can make and utilize GDP-glucose in the biosynthesis of trehalose 6-phosphate. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
Asención Diez, Matías D.; Miah, Farzana; Stevenson, Clare E. M.; Lawson, David M.; Iglesias, Alberto A.; Bornemann, Stephen
2017-01-01
Trehalose-6-phosphate synthase OtsA from streptomycetes is unusual in that it uses GDP-glucose as the donor substrate rather than the more commonly used UDP-glucose. We now confirm that OtsA from Streptomyces venezuelae has such a preference for GDP-glucose and can utilize ADP-glucose to some extent too. A crystal structure of the enzyme shows that it shares twin Rossmann-like domains with the UDP-glucose-specific OtsA from Escherichia coli. However, it is structurally more similar to Streptomyces hygroscopicus VldE, a GDP-valienol-dependent pseudoglycosyltransferase enzyme. Comparison of the donor binding sites reveals that the amino acids associated with the binding of diphosphoribose are almost all identical in these three enzymes. By contrast, the amino acids associated with binding guanine in VldE (Asn, Thr, and Val) are similar in S. venezuelae OtsA (Asp, Ser, and Phe, respectively) but not conserved in E. coli OtsA (His, Leu, and Asp, respectively), providing a rationale for the purine base specificity of S. venezuelae OtsA. To establish which donor is used in vivo, we generated an otsA null mutant in S. venezuelae. The mutant had a cell density-dependent growth phenotype and accumulated galactose 1-phosphate, glucose 1-phosphate, and GDP-glucose when grown on galactose. To determine how the GDP-glucose is generated, we characterized three candidate GDP-glucose pyrophosphorylases. SVEN_3027 is a UDP-glucose pyrophosphorylase, SVEN_3972 is an unusual ITP-mannose pyrophosphorylase, and SVEN_2781 is a pyrophosphorylase that is capable of generating GDP-glucose as well as GDP-mannose. We have therefore established how S. venezuelae can make and utilize GDP-glucose in the biosynthesis of trehalose 6-phosphate. PMID:27903647
Mutation of the planar cell polarity gene VANGL1 in adolescent idiopathic scoliosis
DEFF Research Database (Denmark)
Andersen, Malene Rask; Farooq, Muhammad; Koefoed, Karen
2017-01-01
STUDY DESIGN: Mutation analysis of a candidate disease gene in a cohort of patients with moderate to severe Adolescent idiopathic scoliosis (AIS). OBJECTIVE: To investigate if damaging mutations in the planar cell polarity gene VANGL1 could be identified in AIS patients. SUMMARY OF BACKGROUND DATA......: AIS is a spinal deformity which occurs in 1-3% of the population. The cause of AIS is often unknown, but genetic factors are important in the etiology. Rare variants in genes encoding regulators of WNT/planar cell polarity (PCP) signaling were recently identified in AIS patients. METHODS: We analyzed...
Pilot Research Summaries, 1967-1970.
Casey, James L.; Hayes, Larry K.
This report contains one-page summaries of a majority of the 134 research studies funded through the Oklahoma Consortium on Research Development. The research covers the whole spectrum of academic topics , from nursing to ecology to art to politics.. Brief summaries of a majority of the 37 development seminars funded through the Consortium are…
Gene Therapy for Pancreatic Cancer: Specificity, Issues and Hopes.
Rouanet, Marie; Lebrin, Marine; Gross, Fabian; Bournet, Barbara; Cordelier, Pierre; Buscail, Louis
2017-06-08
A recent death projection has placed pancreatic ductal adenocarcinoma as the second cause of death by cancer in 2030. The prognosis for pancreatic cancer is very poor and there is a great need for new treatments that can change this poor outcome. Developments of therapeutic innovations in combination with conventional chemotherapy are needed urgently. Among innovative treatments the gene therapy offers a promising avenue. The present review gives an overview of the general strategy of gene therapy as well as the limitations and stakes of the different experimental in vivo models, expression vectors (synthetic and viral), molecular tools (interference RNA, genome editing) and therapeutic genes (tumor suppressor genes, antiangiogenic and pro-apoptotic genes, suicide genes). The latest developments in pancreatic carcinoma gene therapy are described including gene-based tumor cell sensitization to chemotherapy, vaccination and adoptive immunotherapy (chimeric antigen receptor T-cells strategy). Nowadays, there is a specific development of oncolytic virus therapies including oncolytic adenoviruses, herpes virus, parvovirus or reovirus. A summary of all published and on-going phase-1 trials is given. Most of them associate gene therapy and chemotherapy or radiochemotherapy. The first results are encouraging for most of the trials but remain to be confirmed in phase 2 trials.
International Nuclear Information System (INIS)
Beisel, P.
1975-01-01
The radiosensitivity of enzymes of the NAD metabolism localized in the cell nuclei and of NAD glycohydrolase in the total homogenate of the spleen of white mice was investigated. At the same time the DNA and protein contents were determined. After whole-body irradiation with 510 R, the activity of NAD pyrophosphorylase and NAD glycohydrolase located in the cell nuclei is markedly lower as early as 3 hours after irradiation; this decrease is noticeable until the 10th day after irradiation. With regard to the dose dependence of the radiosensitivity at 6 and 24 hours after irradiation, it was found that NAD pyrophosphorylase and the NAD glycohydrolase localized in the cell nuclei were very radiosensitive even at doses [de
Advanced Fusion Concepts project summaries. FY 1983
International Nuclear Information System (INIS)
1983-06-01
This report contains descriptions of the activities of all the projects supported by the Advanced Fusion Concepts Branch of the Office of Fusion Energy, US Department of Energy. These descriptions are project summaries of each of the individual projects, and contain the following: title, principle investigators, funding levels, purpose, approach, progress, plans, milestones, graduate studients, graduates, other professional staff, and recent publications. The individual project summaries are prepared by the principle investigators in collaboration with the Advanced Fusion Concepts (AFC) Branch. In addition to the project summaries, statements of branch objectives, and budget summaries are also provided
Sequence and annotation of the 314-kb MT325 and the 321-kb FR483 viruses that infect Chlorella Pbi.
Fitzgerald, Lisa A; Graves, Michael V; Li, Xiao; Feldblyum, Tamara; Hartigan, James; Van Etten, James L
2007-02-20
Viruses MT325 and FR483, members of the family Phycodnaviridae, genus Chlorovirus, infect the fresh water, unicellular, eukaryotic, chlorella-like green alga, Chlorella Pbi. The 314,335-bp genome of MT325 and the 321,240-bp genome of FR483 are the first viruses that infect Chlorella Pbi to have their genomes sequenced and annotated. Furthermore, these genomes are the two smallest chlorella virus genomes sequenced to date, MT325 has 331 putative protein-encoding and 10 tRNA-encoding genes and FR483 has 335 putative protein-encoding and 9 tRNA-encoding genes. The protein-encoding genes are almost evenly distributed on both strands, and intergenic space is minimal. Approximately 40% of the viral gene products resemble entries in public databases, including some that are the first of their kind to be detected in a virus. For example, these unique gene products include an aquaglyceroporin in MT325, a potassium ion transporter protein and an alkyl sulfatase in FR483, and a dTDP-glucose pyrophosphorylase in both viruses. Comparison of MT325 and FR483 protein-encoding genes with the prototype chlorella virus PBCV-1 indicates that approximately 82% of the genes are present in all three viruses.
van Nimwegen, N.; van Nimwegen, N.; van der Erf, R.
2009-01-01
The Demography Monitor 2008 gives a concise overview of current demographic trends and related developments in education, the labour market and retirement for the European Union and some other countries. This executive summary highlights the major findings of the Demography Monitor 2008 and further
40 CFR 25.8 - Responsiveness summaries.
2010-07-01
... required.) Responsiveness summaries shall be forwarded to the appropriate decision-making official and... 25.8 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC PARTICIPATION IN... part shall prepare a Responsiveness Summary at specific decision points as specified in program...
MIV Project: Executive Summary
DEFF Research Database (Denmark)
Ravazzotti, Mariolina T.; Jørgensen, John Leif; Neefs, Marc
1997-01-01
Under the ESA contract #11453/95/NL/JG(SC), aiming at assessing the feasibility of Rendez-vous and docking of unmanned spacecrafts, a reference mission scenario was defined. This report gives an executive summary of the achievements and results from the project.......Under the ESA contract #11453/95/NL/JG(SC), aiming at assessing the feasibility of Rendez-vous and docking of unmanned spacecrafts, a reference mission scenario was defined. This report gives an executive summary of the achievements and results from the project....
Key Frame Extraction in the Summary Space.
Li, Xuelong; Zhao, Bin; Lu, Xiaoqiang; Xuelong Li; Bin Zhao; Xiaoqiang Lu; Lu, Xiaoqiang; Li, Xuelong; Zhao, Bin
2018-06-01
Key frame extraction is an efficient way to create the video summary which helps users obtain a quick comprehension of the video content. Generally, the key frames should be representative of the video content, meanwhile, diverse to reduce the redundancy. Based on the assumption that the video data are near a subspace of a high-dimensional space, a new approach, named as key frame extraction in the summary space, is proposed for key frame extraction in this paper. The proposed approach aims to find the representative frames of the video and filter out similar frames from the representative frame set. First of all, the video data are mapped to a high-dimensional space, named as summary space. Then, a new representation is learned for each frame by analyzing the intrinsic structure of the summary space. Specifically, the learned representation can reflect the representativeness of the frame, and is utilized to select representative frames. Next, the perceptual hash algorithm is employed to measure the similarity of representative frames. As a result, the key frame set is obtained after filtering out similar frames from the representative frame set. Finally, the video summary is constructed by assigning the key frames in temporal order. Additionally, the ground truth, created by filtering out similar frames from human-created summaries, is utilized to evaluate the quality of the video summary. Compared with several traditional approaches, the experimental results on 80 videos from two datasets indicate the superior performance of our approach.
40 CFR 35.532 - Requirements summary.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Requirements summary. 35.532 Section 35.532 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE....532 Requirements summary. (a) Applicants and recipients of Performance Partnership Grants must meet...
40 CFR 35.132 - Requirements summary.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Requirements summary. 35.132 Section 35.132 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE... Requirements summary. Applicants and recipients of Performance Partnership Grants must meet: (a) The...
Caniza, Horacio; Romero, Alfonso E.; Heron, Samuel; Yang, Haixuan; Devoto, Alessandra; Frasca, Marco; Mesiti, Marco; Valentini, Giorgio; Paccanaro, Alberto
2014-01-01
Summary: We present GOssTo, the Gene Ontology semantic similarity Tool, a user-friendly software system for calculating semantic similarities between gene products according to the Gene Ontology. GOssTo is bundled with six semantic similarity measures, including both term- and graph-based measures, and has extension capabilities to allow the user to add new similarities. Importantly, for any measure, GOssTo can also calculate the Random Walk Contribution that has been shown to greatly improve...
National Oceanic and Atmospheric Administration, Department of Commerce — The Global Hourly Summaries are simple indicators of observational normals which include climatic data summarizations and frequency distributions. These typically...
[Gene Therapy for Inherited RETINAL AND OPTIC NERVE Disorders: Current Knowledge].
Ďuďáková, Ľ; Kousal, B; Kolářová, H; Hlavatá, L; Lišková, P
The aim of this review is to provide a comprehensive summary of current gene therapy clinical trials for monogenic and optic nerve disorders.The number of genes for which gene-based therapies are being developed is growing. At the time of writing this review gene-based clinical trials have been registered for Leber congenital amaurosis 2 (LCA2), retinitis pigmentosa 38, Usher syndrome 1B, Stargardt disease, choroideremia, achromatopsia, Leber hereditary optic neuropathy (LHON) and X-linked retinoschisis. Apart from RPE65 gene therapy for LCA2 and MT-ND4 for LHON which has reached phase III, all other trials are in investigation phase I and II, i.e. testing the efficacy and safety.Because of the relatively easy accessibility of the retina and its ease of visualization which allows monitoring of efficacy, gene-based therapies for inherited retinal disorders represent a very promising treatment option. With the development of novel therapeutic approaches, the importance of establishing not only clinical but also molecular genetic diagnosis is obvious.Key words: gene therapy, monogenic retinal diseases, optic nerve atrophy, mitochondrial disease.
Safeguards Summary Event List (SSEL)
International Nuclear Information System (INIS)
1983-02-01
The Safeguards Summary Event List (SSEL) provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC). Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, vandalism, arson, firearms, radiological sabotage and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels
Safeguards Summary Event List (SSEL)
International Nuclear Information System (INIS)
1982-07-01
The Safeguards Summary Event List (SSEL) provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC). Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, vandalism, arson, firearms, sabotage and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels
Directory of Open Access Journals (Sweden)
Melvin Anyasi Ambele
2016-05-01
Full Text Available We have undertaken an in-depth transcriptome analysis of adipogenesis in human adipose-derived stromal cells (ASCs induced to differentiate into adipocytes in vitro. Gene expression was assessed on days 1, 7, 14 and 21 post-induction and genes differentially expressed numbered 128, 218, 253 and 240 respectively. Up-regulated genes were associated with blood vessel development, leukocyte migration, as well as tumor growth, invasion and metastasis. They also shared common pathways with certain obesity-related pathophysiological conditions. Down-regulated genes were enriched for immune response processes. KLF15, LMO3, FOXO1 and ZBTB16 transcription factors were up-regulated throughout the differentiation process. CEBPA, PPARG, ZNF117, MLXIPL, MMP3 and RORB were up-regulated only on days 14 and 21, which coincide with the maturation of adipocytes and could possibly serve as candidates for controlling fat accumulation and the size of mature adipocytes. In summary, we have identified genes that were up-regulated only on days 1 and 7 or days 14 and 21 that could serve as potential early and late-stage differentiation markers.
Brock, Stephen E., Ed.
2010-01-01
This column features summaries of research articles from 3 recent crisis management publications. The first, "School Shootings and Counselor Leadership: Four Lessons from the Field" summarized by Kristi Fenning, was conducted as the result of the increased demand for trained crisis personnel on school campuses. Survey participants were…
Annual report and summary financial statement 1990-1991
International Nuclear Information System (INIS)
1992-01-01
The 1990-1991 Annual Report for Scottish Hydro-Electric PLC includes their rotating territory in Scotland, details of the Board of Directors, the Chairman's Statement, the chief Executive's Review of Operations, a summary profit and loss account, a summary balance sheet and a summary financial statement. (UK)
Genome-Wide Identification and Evolution of HECT Genes in Soybean
Directory of Open Access Journals (Sweden)
Xianwen Meng
2015-04-01
Full Text Available Proteins containing domains homologous to the E6-associated protein (E6-AP carboxyl terminus (HECT are an important class of E3 ubiquitin ligases involved in the ubiquitin proteasome pathway. HECT-type E3s play crucial roles in plant growth and development. However, current understanding of plant HECT genes and their evolution is very limited. In this study, we performed a genome-wide analysis of the HECT domain-containing genes in soybean. Using high-quality genome sequences, we identified 19 soybean HECT genes. The predicted HECT genes were distributed unevenly across 15 of 20 chromosomes. Nineteen of these genes were inferred to be segmentally duplicated gene pairs, suggesting that in soybean, segmental duplications have made a significant contribution to the expansion of the HECT gene family. Phylogenetic analysis showed that these HECT genes can be divided into seven groups, among which gene structure and domain architecture was relatively well-conserved. The Ka/Ks ratios show that after the duplication events, duplicated HECT genes underwent purifying selection. Moreover, expression analysis reveals that 15 of the HECT genes in soybean are differentially expressed in 14 tissues, and are often highly expressed in the flowers and roots. In summary, this work provides useful information on which further functional studies of soybean HECT genes can be based.
Peer-reviewed, evidence-based summaries on topics including adult and pediatric cancer treatment, supportive and palliative care, screening, prevention, genetics, and complementary and alternative medicine. References to published literature are included.
ULSGEN (Uplink Summary Generator)
Wang, Y.-F.; Schrock, M.; Reeve, T.; Nguyen, K.; Smith, B.
2014-01-01
Uplink is an important part of spacecraft operations. Ensuring the accuracy of uplink content is essential to mission success. Before commands are radiated to the spacecraft, the command and sequence must be reviewed and verified by various teams. In most cases, this process requires collecting the command data, reviewing the data during a command conference meeting, and providing physical signatures by designated members of various teams to signify approval of the data. If commands or sequences are disapproved for some reason, the whole process must be restarted. Recording data and decision history is important for traceability reasons. Given that many steps and people are involved in this process, an easily accessible software tool for managing the process is vital to reducing human error which could result in uplinking incorrect data to the spacecraft. An uplink summary generator called ULSGEN was developed to assist this uplink content approval process. ULSGEN generates a web-based summary of uplink file content and provides an online review process. Spacecraft operations personnel view this summary as a final check before actual radiation of the uplink data. .
Safeguards Summary Event List (SSEL)
International Nuclear Information System (INIS)
1984-03-01
The Safeguards Summary Event List (SSEL) provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the U.S. Nuclear Regulatory Commission (NRC). Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, tampering/vandalism, arson, firearms, radiological sabotage and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels
Annual Meteorological Summaries
National Oceanic and Atmospheric Administration, Department of Commerce — Single-year summaries of observations at Weather Bureau and cooperative stations across the United States. Predominantly the single page Form 1066, which includes...
National Oceanic and Atmospheric Administration, Department of Commerce — Oceanographic Monthly Summary contains sea surface temperature (SST) analyses on both regional and ocean basin scales for the Atlantic, Pacific, and Indian Oceans....
GenToS: Use of Orthologous Gene Information to Prioritize Signals from Human GWAS.
Directory of Open Access Journals (Sweden)
Anselm S Hoppmann
Full Text Available Genome-wide association studies (GWAS evaluate associations between genetic variants and a trait or disease of interest free of prior biological hypotheses. GWAS require stringent correction for multiple testing, with genome-wide significance typically defined as association p-value <5*10-8. This study presents a new tool that uses external information about genes to prioritize SNP associations (GenToS. For a given list of candidate genes, GenToS calculates an appropriate statistical significance threshold and then searches for trait-associated variants in summary statistics from human GWAS. It thereby allows for identifying trait-associated genetic variants that do not meet genome-wide significance. The program additionally tests for enrichment of significant candidate gene associations in the human GWAS data compared to the number expected by chance. As proof of principle, this report used external information from a comprehensive resource of genetically manipulated and systematically phenotyped mice. Based on selected murine phenotypes for which human GWAS data for corresponding traits were publicly available, several candidate gene input lists were derived. Using GenToS for the investigation of candidate genes underlying murine skeletal phenotypes in data from a large human discovery GWAS meta-analysis of bone mineral density resulted in the identification of significantly associated variants in 29 genes. Index variants in 28 of these loci were subsequently replicated in an independent GWAS replication step, highlighting that they are true positive associations. One signal, COL11A1, has not been discovered through GWAS so far and represents a novel human candidate gene for altered bone mineral density. The number of observed genes that contained significant SNP associations in human GWAS based on murine candidate gene input lists was much greater than the number expected by chance across several complex human traits (enrichment p-value as
15 CFR 785.7 - Summary decision.
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Summary decision. 785.7 Section 785.7 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) BUREAU OF INDUSTRY AND SECURITY, DEPARTMENT OF COMMERCE ADDITIONAL PROTOCOL REGULATIONS ENFORCEMENT § 785.7 Summary...
License - Gene Name Thesaurus | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available List Contact us Gene Name Thesaurus License to Use This Database Last updated : 2012/01/17 The license for this database... is the license specified in the Creative Commons Attribution-Share Alike 2.1 Japan . If you use data from this database..., please be sure attribute this database as follows: Gene Name Thesaurus, © The Data...he summary of the Creative Commons Attribution-Share Alike 2.1 Japan is found here . With regard to this database..., you are licensed to: freely access part or whole of this database, and acquire data; freely redistrib
19 CFR 151.63 - Information on entry summary.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Information on entry summary. 151.63 Section 151.63 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Information on entry summary. Each entry summary covering wool or hair subject to duty at a rate per clean...
Interoperability Assets for Patient Summary Components: A Gap Analysis.
Heitmann, Kai U; Cangioli, Giorgio; Melgara, Marcello; Chronaki, Catherine
2018-01-01
The International Patient Summary (IPS) standards aim to define the specifications for a minimal and non-exhaustive Patient Summary, which is specialty-agnostic and condition-independent, but still clinically relevant. Meanwhile, health systems are developing and implementing their own variation of a patient summary while, the eHealth Digital Services Infrastructure (eHDSI) initiative is deploying patient summary services across countries in the Europe. In the spirit of co-creation, flexible governance, and continuous alignment advocated by eStandards, the Trillum-II initiative promotes adoption of the patient summary by engaging standards organizations, and interoperability practitioners in a community of practice for digital health to share best practices, tools, data, specifications, and experiences. This paper compares operational aspects of patient summaries in 14 case studies in Europe, the United States, and across the world, focusing on how patient summary components are used in practice, to promote alignment and joint understanding that will improve quality of standards and lower costs of interoperability.
He, Huagang; Zhu, Shanying; Jiang, Zhengning; Ji, Yaoyong; Wang, Feng; Zhao, Renhui; Bie, Tongde
2016-04-01
The powdery mildew resistance gene Pm21 was physically and comparatively mapped by newly developed markers. Seven candidate genes were verified to be required for Pm21 -mediated resistance to wheat powdery mildew. Pm21, a gene derived from wheat wild relative Dasypyrum villosum, has been transferred into common wheat and widely utilized in wheat resistance breeding for powdery mildew. Previously, Pm21 has been located to the bin FL0.45-0.58 of 6VS by using deletion stocks. However, its fine mapping is still a hard work. In the present study, 30 gene-derived 6VS-specific markers were obtained based on the collinearity among genomes of Brachypodium distachyon, Oryza and Triticeae, and then physically and comparatively mapped in the bin FL0.45-0.58 and its nearby chromosome region. According to the maps, the bin FL0.45-0.58 carrying Pm21 was closely flanked by the markers 6VS-03 and 6VS-23, which further narrowed the orthologous regions to 1.06 Mb in Brachypodium and 1.38 Mb in rice, respectively. Among the conserved genes shared by Brachypodium and rice, four serine/threonine protein kinase genes (DvMPK1, DvMLPK, DvUPK and DvPSYR1), one protein phosphatase gene (DvPP2C) and two transcription factor genes (DvGATA and DvWHY) were confirmed to be required for Pm21-mediated resistance to wheat powdery mildew by barley stripe mosaic virus-induced gene silencing (BSMV-VIGS) and transcriptional pattern analyses. In summary, this study gives new insights into the genetic basis of the Pm21 locus and the disease resistance pathways mediated by Pm21.
29 CFR 18.40 - Motion for summary decision.
2010-07-01
... OFFICE OF ADMINISTRATIVE LAW JUDGES General § 18.40 Motion for summary decision. (a) Any party may, at... that a party is entitled to summary decision. The administrative law judge may deny the motion whenever... 29 Labor 1 2010-07-01 2010-07-01 true Motion for summary decision. 18.40 Section 18.40 Labor...
Surgical discharge summaries: improving the record.
Adams, D C; Bristol, J B; Poskitt, K R
1993-03-01
The problem area of communication between hospital and general practitioners may potentially be improved by the advent of new information technology. The introduction of a regional computer database for general surgery allows the rapid automated production of discharge summaries and has provided us with the opportunity for auditing the quality of old and new styles of discharge communication. A total of 118 general practitioners were sent a postal questionnaire to establish their views on the relative importance of various aspects of patient information and management after discharge. A high response rate (97%) indicated the interest of general practitioners in this topic. The majority (73%) believed that summaries should be delayed no more than 3 days. The structured and shortened new format was preferred to the older style of discharge summary. The older format rarely arrived within an appropriate time and its content was often felt to be either inadequate (35%) or excessive (7%) compared with the new format (8% and 1%, respectively). The diagnosis, information given to the patient, clinic date, list of medications and investigations were considered the more important details in the summary. Improvements in the discharge information were suggested and have subsequently been incorporated in our discharge policy. The use of new information technology, intended to facilitate clinical audit, has improved our ability to generate prompt, well-structured discharge summaries which are accepted by the general practitioners.
The capacity limitations of orientation summary statistics
Attarha, Mouna; Moore, Cathleen M.
2015-01-01
The simultaneous–sequential method was used to test the processing capacity of establishing mean orientation summaries. Four clusters of oriented Gabor patches were presented in the peripheral visual field. One of the clusters had a mean orientation that was tilted either left or right while the mean orientations of the other three clusters were roughly vertical. All four clusters were presented at the same time in the simultaneous condition whereas the clusters appeared in temporal subsets of two in the sequential condition. Performance was lower when the means of all four clusters had to be processed concurrently than when only two had to be processed in the same amount of time. The advantage for establishing fewer summaries at a given time indicates that the processing of mean orientation engages limited-capacity processes (Experiment 1). This limitation cannot be attributed to crowding, low target-distractor discriminability, or a limited-capacity comparison process (Experiments 2 and 3). In contrast to the limitations of establishing multiple summary representations, establishing a single summary representation unfolds without interference (Experiment 4). When interpreted in the context of recent work on the capacity of summary statistics, these findings encourage reevaluation of the view that early visual perception consists of summary statistic representations that unfold independently across multiple areas of the visual field. PMID:25810160
National Oceanic and Atmospheric Administration, Department of Commerce — The Worldwide Airfield Summary contains a selection of climatological data produced by the U.S. Air Force, Air Weather Service. The reports were compiled from dozens...
International Nuclear Information System (INIS)
2002-01-01
On 18 May 2001, the Finnish Parliament ratified the Decision in Principle on the final disposal facility for spent nuclear fuel at Olkiluoto, within the municipality of Eurajoki. The Municipality Council and the government has made positive decisions earlier, at the end of 2000, and in compliance with the Nuclear Energy Act, Parliament's ratification was then required. The decision is valid for the spent fuel generated by the existing Finnish nuclear power plants and means that the construction of the final disposal facility is considered to be in line with the overall good of society. Earlier steps included, amongst others, the approval of the technical project by the Safety Authority. Future steps include construction of an underground rock characterisation facility, ONKALO (2003-2004), and application for separate construction and operating licences for the final disposal facility (from about 2010). How did this political and societal decision come about? The FSC Workshop provided the opportunity to present the history leading up to the Decision in Principle (DiP), and to examine future perspectives with an emphasis on stakeholder involvement. This Executive Summary gives an overview of the presentations and discussions that took place at the workshop. It presents, for the most part, a factual account of the individual presentations and of the discussions that took place. It relies importantly on the notes that were taken at the meeting. Most materials are elaborated upon in a fuller way in the texts that the various speakers and session moderators contributed for these proceedings. The structure of the Executive Summary follows the structure of the workshop itself. Complementary to this Summary and also provided with this document, is a NEA Secretariat's perspective aiming to place the results of all discussions, feedback and site visit into an international perspective. (authors)
The Ideal Hospital Discharge Summary: A Survey of U.S. Physicians.
Sorita, Atsushi; Robelia, Paul M; Kattel, Sharma B; McCoy, Christopher P; Keller, Allan Scott; Almasri, Jehad; Murad, Mohammad Hassan; Newman, James S; Kashiwagi, Deanne T
2017-09-06
Hospital discharge summaries enable communication between inpatient and outpatient physicians. Despite existing guidelines for discharge summaries, they are frequently suboptimal. The aim of this study was to assess physicians' perspectives about discharge summaries and the differences between summaries' authors (hospitalists) and readers (primary care physicians [PCPs]). A national survey of 1600 U.S. physicians was undertaken. Primary measures included physicians' preferences in discharge summary standardization, content, format, and audience. A total of 815 physicians responded (response rate = 51%). Eighty-nine percent agreed that discharge summaries "should have a standardized format." Most agreed that summaries should "document everything that was done, found, and recommended in the hospital" (64%) yet "only include details that are highly pertinent to the hospitalization" (66%). Although 74% perceived patients as an important audience of discharge summaries, only 43% agreed that summaries "should be written in language that patients…can easily understand," and 68% agreed that it "should be written solely for provider-to-provider communication." Compared with hospitalists, PCPs preferred comprehensive summaries (68% versus 59%, P = 0.002). More PCPs agreed that separate summaries should be created for patients and for provider-to-provider communication than hospitalists (60% versus 47%, P summary" (44% versus 23%, P summary" (60% versus 38%, P summaries should have a standardized format but do not agree on how comprehensive or in what format they should be. Efforts are necessary to build consensus toward the ideal discharge summary.
Studying Functions of All Yeast Genes Simultaneously
Stolc, Viktor; Eason, Robert G.; Poumand, Nader; Herman, Zelek S.; Davis, Ronald W.; Anthony Kevin; Jejelowo, Olufisayo
2006-01-01
A method of studying the functions of all the genes of a given species of microorganism simultaneously has been developed in experiments on Saccharomyces cerevisiae (commonly known as baker's or brewer's yeast). It is already known that many yeast genes perform functions similar to those of corresponding human genes; therefore, by facilitating understanding of yeast genes, the method may ultimately also contribute to the knowledge needed to treat some diseases in humans. Because of the complexity of the method and the highly specialized nature of the underlying knowledge, it is possible to give only a brief and sketchy summary here. The method involves the use of unique synthetic deoxyribonucleic acid (DNA) sequences that are denoted as DNA bar codes because of their utility as molecular labels. The method also involves the disruption of gene functions through deletion of genes. Saccharomyces cerevisiae is a particularly powerful experimental system in that multiple deletion strains easily can be pooled for parallel growth assays. Individual deletion strains recently have been created for 5,918 open reading frames, representing nearly all of the estimated 6,000 genetic loci of Saccharomyces cerevisiae. Tagging of each deletion strain with one or two unique 20-nucleotide sequences enables identification of genes affected by specific growth conditions, without prior knowledge of gene functions. Hybridization of bar-code DNA to oligonucleotide arrays can be used to measure the growth rate of each strain over several cell-division generations. The growth rate thus measured serves as an index of the fitness of the strain.
15 CFR 904.505 - Summary sale.
2010-01-01
... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Summary sale. 904.505 Section 904.505 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade (Continued) NATIONAL OCEANIC... and Forfeiture Procedures § 904.505 Summary sale. (a) In view of the perishable nature of fish, any...
Annual report and summary financial statement 1991-1992
International Nuclear Information System (INIS)
1993-01-01
The 1991-92 Annual Report for Scottish Hydro-Electric PLC is presented. It includes key financial statistics, the financial calendar, details of the Board of Directors, the Chairman's Statement, the Chief Executives' review of operations, operational statistics, a summary financial statement, a summary group profit and loss account, summary balance sheets, the Auditors' Report and a customer map. (UK)
Electron-Cloud Build-Up: Summary
International Nuclear Information System (INIS)
Furman, M.A.
2007-01-01
I present a summary of topics relevant to the electron-cloud build-up and dissipation that were presented at the International Workshop on Electron-Cloud Effects 'ECLOUD 07' (Daegu, S. Korea, April 9-12, 2007). This summary is not meant to be a comprehensive review of the talks. Rather, I focus on those developments that I found, in my personal opinion, especially interesting. The contributions, all excellent, are posted in http://chep.knu.ac.kr/ecloud07/
International Nuclear Information System (INIS)
1986-01-01
This volume contains conference summaries of the international conference on radioactive waste management of the Canadian Nuclear Society. Topics of discussion include: storage and disposal; hydrogeology and geochemistry; transportation; buffers and backfill; public attitudes; tailings; site investigations and geomechanics; concrete; economics; licensing; matrix materials and container design; durability of fuel; biosphere modelling; radioactive waste processing; and, future options
Summaries of FY 1997 engineering research
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-09-01
This report documents the Basic Energy Sciences (BES) Engineering Research Program for fiscal year 1997, it provides a summary for each of the program projects in addition to a brief program overview. The report is intended to provide staff of Congressional committees, other executive departments, and other DOE offices with substantive program information so as to facilitate governmental overview and coordination of Federal research programs. Of equal importance, its availability facilitates communication of program information to interested research engineers and scientists. The individual project summaries follow the program overview. The summaries are ordered alphabetically by name of institution; the table of contents lists all the institutions at which projects were sponsored in fiscal year 1997. Each project entry begins with an institutional-departmental heading. The names of investigators are listed immediately below the title. The funding level for fiscal year 1997 appears to the right of address. The summary description of the project completes the entry. A separate index of Principal Investigators includes phone number, fax number and e-main address, where available.
FAIR - Baseline technical report. Executive summary
International Nuclear Information System (INIS)
Gutbrod, H.H.; Augustin, I.; Eickhoff, H.; Gross, K.D.; Henning, W.F.; Kraemer, D.; Walter, G.
2006-09-01
This document presents the Executive Summary, the first of six volumes comprising the 2006 Baseline Technical Report (BTR) for the international FAIR project (Facility for Antiproton and Ion Research). The BTR provides the technical description, cost, schedule, and assessments of risk for the proposed new facility. The purpose of the BTR is to provide a reliable basis for the construction, commissioning and operation of FAIR. The BTR is one of the central documents requested by the FAIR International Steering Committee (ISC) and its working groups, in order to prepare the legal process and the decisions on the construction and operation of FAIR in an international framework. It provides the technical basis for legal contracts on contributions to be made by, so far, 13 countries within the international FAIR Consortium. The BTR begins with this extended Executive Summary as Volume 1, which is also intended for use as a stand-alone document. The Executive Summary provides brief summaries of the accelerator facilities, the scientific programs and experimental stations, civil construction and safety, and of the workproject structure, costs and schedule. (orig.)
Loss of Sfpq Causes Long-Gene Transcriptopathy in the Brain
Directory of Open Access Journals (Sweden)
Akihide Takeuchi
2018-05-01
Full Text Available Summary: Genes specifically expressed in neurons contain members with extended long introns. Longer genes present a problem with respect to fulfilment of gene length transcription, and evidence suggests that dysregulation of long genes is a mechanism underlying neurodegenerative and psychiatric disorders. Here, we report the discovery that RNA-binding protein Sfpq is a critical factor for maintaining transcriptional elongation of long genes. We demonstrate that Sfpq co-transcriptionally binds to long introns and is required for sustaining long-gene transcription by RNA polymerase II through mediating the interaction of cyclin-dependent kinase 9 with the elongation complex. Phenotypically, Sfpq disruption caused neuronal apoptosis in developing mouse brains. Expression analysis of Sfpq-regulated genes revealed specific downregulation of developmentally essential neuronal genes longer than 100 kb in Sfpq-disrupted brains; those genes are enriched in associations with neurodegenerative and psychiatric diseases. The identified molecular machinery yields directions for targeted investigations of the association between long-gene transcriptopathy and neuronal diseases. : It has been a long-standing question how mammalian neuronal cells achieve full gene length transcription of extra-long genes. Takeuchi et al. show that RNA-binding protein Sfpq sustains long-gene transcription through Pol II-CTD activation. Loss of Sfpq caused long-gene transcriptopathy, which could be the cause of neurodegenerative and psychiatric disorders. Keywords: RNA-binding protein, transcriptional regulation, RNA polymerase II, cyclin-dependent kinase 9, RBP/transcript-dependent elongation, long-gene transcriptotherapy, neuronal development, neurological and psychiatric diseases, long-gene diseases, long genopathies
Qualitative Features of Written Summary Texts Produced by Teachers
Directory of Open Access Journals (Sweden)
Hülya YAZICI OKUYAN
2011-12-01
Full Text Available This research aimed to find an answer to the question: "Do summary texts produced by teachers have the characteristics that a summary text is supposed to have?” Descriptive method was used in the research. The study group consisted of 55 teachers who work as Turkish Language and Literature teachers at central primary and secondary schools in Burdur. During the research, the essay “Kitap Az Yaşamayı Önler” by Çetin Altan was used as the source text and the summary texts produced by teachers were evaluated using a criteria-based and gradual analysis instrument. At the end of the study, it was determined that the teachers only managed to reach the sufficient level in terms of reconstructing the summary texts through authentic sentences and reflecting the main idea of the source text in the summary texts. However, according to the research results regarding the teachers’ competence in creating a new title for the summary texts, including the source text’s all supporting ideas and important information in the summary texts and providing the summary texts with the capacity of reflecting the source text, it has been observed that the teachers lack the required knowledge and skill
Summary of the ECLOUD'04 Workshop
International Nuclear Information System (INIS)
Macek, R.; Furman, M.
2004-01-01
The 31st ICFA Advanced Beam Dynamics Workshop on Electron-Cloud Effects ''ECLOUD'04'' was held April 19-23, 2004 at Napa, CA, USA. A broad range of current topics in this field were illuminated by 53 talks in 7 sessions plus 6 session summaries at the final summary session. These covered a variety of experimental methods and results, along with progress on understanding of the topic obtained from simulations and analytic theory, and evaluations of the effectiveness of various methods/mechanisms for mitigation of the adverse impact on accelerator performance. In addition, a panel discussion was held on ''Future Needs and Future Directions''. A summary of progress on the major themes covered at ECLOUD'04 is presented
78 FR 17746 - Petition for Exemption; Summary of Petition Received
2013-03-22
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
78 FR 53185 - Petition for Exemption; Summary of Petition Received
2013-08-28
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
75 FR 19672 - Petition for Exemption; Summary of Petition Received
2010-04-15
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. DATES: Comments...
78 FR 46673 - Petition for Exemption; Summary of Petition Received
2013-08-01
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
75 FR 60164 - Petition for Exemption; Summary of Petition Received
2010-09-29
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
77 FR 2120 - Petition for Exemption; Summary of Petition Received
2012-01-13
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
78 FR 73918 - Petition for Exemption; Summary of Petition Received
2013-12-09
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. [[Page 73919...
78 FR 13746 - Petition for Exemption; Summary of Petition Received
2013-02-28
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. DATES: Comments...
76 FR 39975 - Petition for Exemption; Summary of Petition Received
2011-07-07
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. DATES: Comments...
78 FR 46672 - Petition for Exemption; Summary of Petition Received
2013-08-01
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
78 FR 978 - Petition for Exemption; Summary of Petition Received
2013-01-07
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
76 FR 14744 - Petition for Exemption; Summary of Petition Received
2011-03-17
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... summary is intended to affect the legal status of the petition or its final disposition. DATES: Comments...
78 FR 36294 - Petition for Exemption; Summary of Petition Received
2013-06-17
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
78 FR 66986 - Petition for Exemption; Summary of Petition Received
2013-11-07
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
78 FR 39824 - Petition for Exemption; Summary of Petition Received
2013-07-02
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... information in the summary is intended to affect the legal status of the petition or its final disposition...
Advanced fusion concepts project summaries, FY 1988
International Nuclear Information System (INIS)
1988-04-01
This report summarizes all the projects supported by the Advanced Fusion Concepts Branch of the Applied Plasma Physics Division of the Office of Fusion Energy, US Department of Energy. Each project summary was written by the respective principal investigator using the format: title, principal investigators, funding levels, purpose, approach, progress, plans, milestones, graduate students, graduates, other professional staff, and recent publications. This report is organized into three sections: Section one contains five summaries describing work in the reversed-field pinch program being performed by a diversified group of contractors, these include a national laboratory, a private company, and several universities. Section two contains eight summaries of work from the compact toroid area which encompasses field-reversed configurations, spheromaks, and heating and formation experiments. Section three contains summaries from two other programs, a density Z-pinch experiment and high-beta Q machine experiment. The intent of this collection of project summaries is to help the contractors of the Advanced Fusion Concepts Branch understand their relationship with the rest of the branch's activities. It is also meant to provide background to those outside the program by showing the range of activities of interest of the Advanced Fusion Concepts Branch
Circadian Enhancers Coordinate Multiple Phases of Rhythmic Gene Transcription In Vivo
Fang, Bin; Everett, Logan J.; Jager, Jennifer; Briggs, Erika; Armour, Sean M.; Feng, Dan; Roy, Ankur; Gerhart-Hines, Zachary; Sun, Zheng; Lazar, Mitchell A.
2014-01-01
SUMMARY Mammalian transcriptomes display complex circadian rhythms with multiple phases of gene expression that cannot be accounted for by current models of the molecular clock. We have determined the underlying mechanisms by measuring nascent RNA transcription around the clock in mouse liver. Unbiased examination of eRNAs that cluster in specific circadian phases identified functional enhancers driven by distinct transcription factors (TFs). We further identify on a global scale the components of the TF cistromes that function to orchestrate circadian gene expression. Integrated genomic analyses also revealed novel mechanisms by which a single circadian factor controls opposing transcriptional phases. These findings shed new light on the diversity and specificity of TF function in the generation of multiple phases of circadian gene transcription in a mammalian organ. PMID:25416951
Electron and muon physics sessions: Summary
International Nuclear Information System (INIS)
Montgomery, H.E.
1988-06-01
The electromagnetic interaction needs no introduction as a probe of the structure of systems on many scales. The continued use of this technique dominated the sessions on Electron and Muon Physics at the Samoset Meeting. The experimental results continue to stimulate large numbers of theorists and the results on polarized deep inelastic muon scattering and their various interpretations permeated beyond these sessions. The breadth of physics attacked with electrons and muons makes a summary such as this rather peculiar. As one of my nuclear physics friends (I think) commented after my summary, ''it was interesting to see Nuclear Physics from a long distance with the telescope inverted.'' The comment may well be applied to this written version of the summary talk. 21 refs
Kim, Jeong-Soon; Sagaram, Uma Shankar; Burns, Jacqueline K; Li, Jian-Liang; Wang, Nian
2009-01-01
Citrus greening or huanglongbing (HLB) is a devastating disease of citrus. HLB is associated with the phloem-limited fastidious prokaryotic alpha-proteobacterium 'Candidatus Liberibacter spp.' In this report, we used sweet orange (Citrus sinensis) leaf tissue infected with 'Ca. Liberibacter asiaticus' and compared this with healthy controls. Investigation of the host response was examined with citrus microarray hybridization based on 33,879 expressed sequence tag sequences from several citrus species and hybrids. The microarray analysis indicated that HLB infection significantly affected expression of 624 genes whose encoded proteins were categorized according to function. The categories included genes associated with sugar metabolism, plant defense, phytohormone, and cell wall metabolism, as well as 14 other gene categories. The anatomical analyses indicated that HLB bacterium infection caused phloem disruption, sucrose accumulation, and plugged sieve pores. The up-regulation of three key starch biosynthetic genes including ADP-glucose pyrophosphorylase, starch synthase, granule-bound starch synthase and starch debranching enzyme likely contributed to accumulation of starch in HLB-affected leaves. The HLB-associated phloem blockage resulted from the plugged sieve pores rather than the HLB bacterial aggregates since 'Ca. Liberibacter asiaticus' does not form aggregate in citrus. The up-regulation of pp2 gene is related to callose deposition to plug the sieve pores in HLB-affected plants.
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1982-07-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1982-05-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1983-01-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1983-03-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1982-11-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1982-10-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1982-08-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1982-09-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
International Nuclear Information System (INIS)
2006-01-01
This document provides summaries of the discussions occurred during the second international workshop on the indemnification of nuclear damage. It concerns the second accident scenario: a fire on board of a ship transporting enriched uranium hexafluoride along the Danube River. (A.L.B.)
Indian Academy of Sciences (India)
First page Back Continue Last page Overview Graphics. Summary of Trends. Optical Ethernet: Direct Ethernet connectivity to businesses through optical fiber. Automation of network infrastructure: Cross-connects for interconnections; Intelligence through software for OA&M. New “data-centric” protection mechanisms ...
2012-12-05
teaching students with autism spectrum disorders 4.52 Learn strategies for incorporating IEP goals and district standard into daily teaching...W403 Columbus, OH 43205 Final Report Comprehensive Clinical Phenotyping & Genetic Mapping for the Discovery of Autism Susceptibility Genes...QFOXGHDUHDFRGH 1.0 Summary In 2006, the Central Ohio Registry for Autism (CORA) was initiated as a collaboration between Wright-Patterson Air
Summaries of FY 1996 engineering research
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-06-01
This report documents the Basic Energy Sciences (BES) Engineering Research Program for fiscal year 1996; it provides a summary for each of the program projects in addition to a brief program overview. The report is intended to provide staff of Congressional committees, other executive departments, and other DOE offices with substantive program information so as to facilitate governmental overview and coordination of Federal research programs. Of equal importance, its availability facilitates communication of program information to interested research engineers and scientists. Each BES Division administers basic, mission oriented research programs in the area indicated by its title. The BES Engineering Research Program is one such program; it is administered by the Engineering and Geosciences Division of BES. In preparing this report the principal investigators were asked to submit summaries for their projects that were specifically applicable to fiscal year 1996. The summaries received have been edited if necessary, but the press for timely publication made it impractical to have the investigators review and approve the revised summaries prior to publication. For more information about a given project, it is suggested that the investigators be contacted directly.
The progress of radiosensitive genes of human brain glioma
International Nuclear Information System (INIS)
Wang Xi; Liu Qiang
2008-01-01
Human gliomas are one of the most aggressive tumors in brain which grow infiltrativly. Surgery is the mainstay of treatment. But as the tumor could not be entirely cut off, it is easy to relapse. Radiotherapy plays an important role for patients with gliomas after surgery. The efficacy of radiotherapy is associated with radio sensitivity of human gliomas. This paper makes a summary of current situation and progress for radiosensitive genes of human brain gliomas. (authors)
The summary of national environmental restoration needs
International Nuclear Information System (INIS)
1993-07-01
The Office of Technology Development of the US Department of Energy (DOE) has directed the Savannah River Technology Center to implement an Integrated Demonstration Program at Savannah River Site to assess new environmental remediation systems and technologies and transfer them to other DOE sites and private industry for use in full-scale remediation efforts. The first phase of the Integrated Demonstration Program is coming to a successful conclusion and the Savannah River Technology Center has asked a panel of environmental experts to prioritize national, DOE, and Savannah River Site environmental problems and make programmatic recommendations for future technology research and demonstrations. This document is a summary of national and DOE environmental problems that are common to Savannah River Site and was created as a decision making tool for the expert panel. There are many diverse environmental problems, therefore the summary has been limited to environmental problems that are significant to the Savannah River Site. National environmental problems identified in the summary are soil and water contaminated with organic compounds. Specifically, groundwater contaminated with dense non-aqueous phase liquid hydrocarbons was found to be a significant national environmental problem. The DOE environmental problems identified in the summary are soil and water contaminated with fuel and chlorinated hydrocarbon compounds, metal compounds, and radioactive elements. Savannah River Site environmental problems identified in the summary are soil and groundwater contaminated with chlorinated hydrocarbons, metal compounds, tritiated water, and other radioactive elements. Technology deficiencies that were identified in the summary were deficiencies in in situ remediation technologies, in situ characterization technologies, and in situ isolation and containment technologies
Summary of quantum aspects of gravitation workshop
Indian Academy of Sciences (India)
Summary of quantum aspects of gravitation workshop. GHANASHYAM DATE and JNANADEV MAHARANA. The Institute of Mathematical Sciences, CIT Campus, Taramani, Chennai 600 113, India. The Institute of Physics, Sachivalaya Marg, Bhubaneswar 751 005, India. Abstract. This is a summary of the presentations at ...
FEMA Disaster Declarations Summary
Department of Homeland Security — The FEMA Disaster Declarations Summary is a summarized dataset describing all federally declared disasters, starting with the first disaster declaration in 1953,...
International Nuclear Information System (INIS)
Johnson, R.C.
1981-01-01
In this summary talk some implications of points raised during the Daresbury Study Weekend on heavy-ion reactions are examined and discussed in particular those concerning polarized heavy ions, the connection between analyzing powers and dynamics, transfer reactions, total reaction cross section measurements with polarized beams, and the implications of break-up reaction results for theories of nuclear reactions involving loosely bound projectiles. (U.K.)
International Nuclear Information System (INIS)
Harari, H.
1978-10-01
A general overview is given in this high energy physics conference summary. Quantum chromodynamics as a theory of strong interactions and studied by experimental tests, SU(2) x U(1) theory of weak and electromagnetic interactions and its experimental tests, weak interactions above 100 GeV, simple unification of weak and electromagnetic interactions, and the grand and the ultimate unifications with extended supergravity are discussed. 28 references
Safeguards summary event list (SSEL)
International Nuclear Information System (INIS)
1989-07-01
The Safeguards Summary Event List (SSEL) provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC). Because of public interest, also included are events reported involving byproduct material which is exempt from safeguards requirements. Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, tampering/vandalism, arson, firearms, radiological sabotage, nonradiological sabotage, alcohol and drugs, and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels
Experimental Plasma Research project summaries
International Nuclear Information System (INIS)
1980-09-01
This report contains descriptions of the activities supported by the Experimental Plasma Research Branch of APP. The individual project summaries were prepared by the principal investigators and include objectives and milestones for each project. The projects are arranged in six research categories: Plasma Properties; Plasma Heating; Plasma Diagnostics; Atomic, Molecular and Nuclear Physics; Advanced Superconducting Materials; and the Fusion Plasma Research Facility (FPRF). Each category is introduced with a statement of objectives and recent progress and followed by descriptions of individual projects. An overall budget summary is provided at the beginning of the report
Safeguards Summary Event List (SSEL)
International Nuclear Information System (INIS)
Fadden, M.; Yardumian, J.
1993-07-01
The Safeguards Summary Event List provides brief summaries of hundreds of safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission. Events are described under the categories: Bomb-related, Intrusion, Missing/Allegedly Stolen, Transportation-related, Tampering/Vandalism, Arson, Firearms-related, Radiological Sabotage, Non-radiological Sabotage, and Miscellaneous. Because of the public interest, the Miscellaneous category also includes events reported involving source material, byproduct material, and natural uranium, which are exempt from safeguards requirements. Information in the event descriptions was obtained from official NRC sources
Experimental Plasma Research project summaries
Energy Technology Data Exchange (ETDEWEB)
None
1980-09-01
This report contains descriptions of the activities supported by the Experimental Plasma Research Branch of APP. The individual project summaries were prepared by the principal investigators and include objectives and milestones for each project. The projects are arranged in six research categories: Plasma Properties; Plasma Heating; Plasma Diagnostics; Atomic, Molecular and Nuclear Physics; Advanced Superconducting Materials; and the Fusion Plasma Research Facility (FPRF). Each category is introduced with a statement of objectives and recent progress and followed by descriptions of individual projects. An overall budget summary is provided at the beginning of the report.
Summary reports of activities under visiting research program (1993)
International Nuclear Information System (INIS)
1993-10-01
The summary reports of activities under visiting research program in the Research Reactor Institute, Kyoto University, in fiscal year 1992 are included. In this report, 104 summaries of researches using the Kyoto University Reactor (KUR) and 9 summaries of the researches using the Kyoto University Critical Assembly (KUCA) are collected. (J.P.N.)
Gene set analysis of purine and pyrimidine antimetabolites cancer therapies.
Fridley, Brooke L; Batzler, Anthony; Li, Liang; Li, Fang; Matimba, Alice; Jenkins, Gregory D; Ji, Yuan; Wang, Liewei; Weinshilboum, Richard M
2011-11-01
Responses to therapies, either with regard to toxicities or efficacy, are expected to involve complex relationships of gene products within the same molecular pathway or functional gene set. Therefore, pathways or gene sets, as opposed to single genes, may better reflect the true underlying biology and may be more appropriate units for analysis of pharmacogenomic studies. Application of such methods to pharmacogenomic studies may enable the detection of more subtle effects of multiple genes in the same pathway that may be missed by assessing each gene individually. A gene set analysis of 3821 gene sets is presented assessing the association between basal messenger RNA expression and drug cytotoxicity using ethnically defined human lymphoblastoid cell lines for two classes of drugs: pyrimidines [gemcitabine (dFdC) and arabinoside] and purines [6-thioguanine and 6-mercaptopurine]. The gene set nucleoside-diphosphatase activity was found to be significantly associated with both dFdC and arabinoside, whereas gene set γ-aminobutyric acid catabolic process was associated with dFdC and 6-thioguanine. These gene sets were significantly associated with the phenotype even after adjusting for multiple testing. In addition, five associated gene sets were found in common between the pyrimidines and two gene sets for the purines (3',5'-cyclic-AMP phosphodiesterase activity and γ-aminobutyric acid catabolic process) with a P value of less than 0.0001. Functional validation was attempted with four genes each in gene sets for thiopurine and pyrimidine antimetabolites. All four genes selected from the pyrimidine gene sets (PSME3, CANT1, ENTPD6, ADRM1) were validated, but only one (PDE4D) was validated for the thiopurine gene sets. In summary, results from the gene set analysis of pyrimidine and purine therapies, used often in the treatment of various cancers, provide novel insight into the relationship between genomic variation and drug response.
PROP1 gene mutations in a 36-year-old female presenting with psychosis
Directory of Open Access Journals (Sweden)
Durgesh Prasad Chaudhary
2017-03-01
Full Text Available Combined pituitary hormonal deficiency (CPHD is a rare disease that results from mutations in genes coding for transcription factors that regulate the differentiation of pituitary cells. PROP1 gene mutations are one of the etiological diagnoses of congenital panhypopituitarism, however symptoms vary depending on phenotypic expression. We present a case of psychosis in a 36-year-old female with congenital panhypopituitarism who presented with paranoia, flat affect and ideas of reference without a delirious mental state, which resolved with hormone replacement and antipsychotics. Further evaluation revealed that she had a homozygous mutation of PROP1 gene. In summary, compliance with hormonal therapy for patients with hypopituitarism appears to be effective for the prevention and treatment of acute psychosis symptoms.
31 CFR 501.727 - Motion for summary disposition.
2010-07-01
... party's arguments. Any party opposing a motion for summary disposition must file a statement setting... be supported by evidence of the same type as that submitted with the motion for summary disposition...
Compact Visualisation of Video Summaries
Directory of Open Access Journals (Sweden)
Janko Ćalić
2007-01-01
Full Text Available This paper presents a system for compact and intuitive video summarisation aimed at both high-end professional production environments and small-screen portable devices. To represent large amounts of information in the form of a video key-frame summary, this paper studies the narrative grammar of comics, and using its universal and intuitive rules, lays out visual summaries in an efficient and user-centered way. In addition, the system exploits visual attention modelling and rapid serial visual presentation to generate highly compact summaries on mobile devices. A robust real-time algorithm for key-frame extraction is presented. The system ranks importance of key-frame sizes in the final layout by balancing the dominant visual representability and discovery of unanticipated content utilising a specific cost function and an unsupervised robust spectral clustering technique. A final layout is created using an optimisation algorithm based on dynamic programming. Algorithm efficiency and robustness are demonstrated by comparing the results with a manually labelled ground truth and with optimal panelling solutions.
43 CFR Appendix A to Part 10 - Sample Summary
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Sample Summary A Appendix A to Part 10... REPATRIATION REGULATIONS Pt. 10, App. A Appendix A to Part 10—Sample Summary The following is a generic sample and should be used as a guideline for preparation of summaries tailoring the information to the...
Summary Information report. Vol. 2, No. 3
International Nuclear Information System (INIS)
1983-08-01
The Summary Information Report (SIR) provides summary data concerning NRC and its licensees for general use by the Chairman, other Commissioners and Commission staff offices, the Executive Director for Operations, and the Office Directors. SIR is published quarterly by the Management Information Branch (49-27834) of the Office of Resource Management
Functional summary statistics for the Johnson-Mehl model
DEFF Research Database (Denmark)
Møller, Jesper; Ghorbani, Mohammad
The Johnson-Mehl germination-growth model is a spatio-temporal point process model which among other things have been used for the description of neurotransmitters datasets. However, for such datasets parametric Johnson-Mehl models fitted by maximum likelihood have yet not been evaluated by means...... of functional summary statistics. This paper therefore invents four functional summary statistics adapted to the Johnson-Mehl model, with two of them based on the second-order properties and the other two on the nuclei-boundary distances for the associated Johnson-Mehl tessellation. The functional summary...... statistics theoretical properties are investigated, non-parametric estimators are suggested, and their usefulness for model checking is examined in a simulation study. The functional summary statistics are also used for checking fitted parametric Johnson-Mehl models for a neurotransmitters dataset....
Summary and outlook for KEKTC5
International Nuclear Information System (INIS)
Quinn, Helen
2002-01-01
This is the summary talk of a meeting held at the KEK, Tsukuba, Japan, November 20-22, 2001. I give a brief summary of the talks we heard, and a few comments of my own on various points that have been made. Other talks given at this meeting are referred to by the speakers last name; these talks will appear in the same proceedings. See these talks for the detailed references for each subject
Experimental plasma research project summaries
International Nuclear Information System (INIS)
1978-08-01
This report contans descriptions of the activities supported by the Experimental Plasma Research Branch of APP. The individual project summaries were prepared by the principal investigators and include objectives and milestones for each project. The projects are arranged in six research categories: Plasma Properties; Plasma Heating; Plasma Measurements and Instrumentation; Atomic, Molecular and Nuclear Physics; Advanced Superconducting Materials; and the Fusion Plasma Research Facility (FPRF). Each category is introduced with a statement of objectives and recent progress and followed by descriptions of individual projects. An overall budget summary is provided at the beginning of the report
Smith, Jennifer A; Zhao, Wei; Wang, Xu; Ratliff, Scott M; Mukherjee, Bhramar; Kardia, Sharon L R; Liu, Yongmei; Roux, Ava V Diez; Needham, Belinda L
2017-08-01
Living in a disadvantaged neighborhood is associated with poor health outcomes even after accounting for individual-level socioeconomic factors. The chronic stress of unfavorable neighborhood conditions may lead to dysregulation of the stress reactivity and inflammatory pathways, potentially mediated through epigenetic mechanisms such as DNA methylation. We used multi-level models to examine the relationship between 2 neighborhood conditions and methylation levels of 18 genes related to stress reactivity and inflammation in purified monocytes from 1,226 participants of the Multi-Ethnic Study of Atherosclerosis (MESA), a population-based sample of US adults. Neighborhood socioeconomic disadvantage, a summary of 16 census-based metrics, was associated with DNA methylation [False discovery rate (FDR) q-value ≤ 0.1] in 2 out of 7 stress-related genes evaluated (CRF, SLC6A4) and 2 out of 11 inflammation-related genes (F8, TLR1). Neighborhood social environment, a summary measure of aesthetic quality, safety, and social cohesion, was associated with methylation in 4 of the 7 stress-related genes (AVP, BDNF, FKBP5, SLC6A4) and 7 of the 11 inflammation-related genes (CCL1, CD1D, F8, KLRG1, NLRP12, SLAMF7, TLR1). High socioeconomic disadvantage and worse social environment were primarily associated with increased methylation. In 5 genes with significant associations between neighborhood and methylation (FKBP5, CD1D, F8, KLRG1, NLRP12), methylation was associated with gene expression of at least one transcript. These results demonstrate that multiple dimensions of neighborhood context may influence methylation levels and subsequent gene expression of stress- and inflammation-related genes, even after accounting for individual socioeconomic factors. Further elucidating the molecular mechanisms underlying these relationships will be important for understanding the etiology of health disparities.
Summary Report for Online Schools and Programs
Colorado Department of Education, 2014
2014-01-01
Pursuant to State Law, the Colorado Department of Education, Office of Blended and Online Learning is required to prepare an annual summary report for submission. The passage of a later State House Bill repealed the annual requirement for the Summary Report and also the annual reporting mandates that were required of all online schools and…
Computer software summaries. Numbers 1 through 423
International Nuclear Information System (INIS)
1979-09-01
The National Energy Software Center (NESC) serves as the software exchange and information center for the US Department of Energy and the Nuclear Regulatory Commission. A major activity of the Center is the preparation and publication of two reports issued periodically - the Center's compilation of program abstracts, ANL-7411, and this software summaries report, ANL-8040. The abstracts describe the softward packages available in the software exchange library maintained and distributed by the Center. The summaries describe agency-sponsored software that is at the specification stage, under development, being checked out, in use, or available at agency offices, laboratories, and contractor installations. Summaries describe software that is not included in the NESC library due to its preliminary status or because it is believed to be of limited interest. The purpose of the summaries report is to keep agency and contractor personnel informed as to the existence, status, and availability of computer programs within the agency, and thereby minimize duplication costs and maximize the value of agency software development efforts
O'Reilly, Marina; Federoff, Howard J; Fong, Yuman; Kohn, Donald B; Patterson, Amy P; Ahmed, Nabil; Asokan, Aravind; Boye, Shannon E; Crystal, Ronald G; De Oliveira, Satiro; Gargiulo, Linda; Harper, Scott Q; Ikeda, Yasuhiro; Jambou, Robert; Montgomery, Maureen; Prograis, Lawrence; Rosenthal, Eugene; Sterman, Daniel H; Vandenberghe, Luk H; Zoloth, Laurie; Abedi, Mehrdad; Adair, Jennifer; Adusumilli, Prasad S; Goins, William F; Gray, Jhanelle; Monahan, Paul; Popplewell, Leslie; Sena-Esteves, Miguel; Tannous, Bakhos; Weber, Thomas; Wierda, William; Gopal-Srivastava, Rashmi; McDonald, Cheryl L; Rosenblum, Daniel; Corrigan-Curay, Jacqueline
2014-06-01
Recently, the gene therapy field has begun to experience clinical successes in a number of different diseases using various approaches and vectors. The workshop Gene Therapy: Charting a Future Course, sponsored by the National Institutes of Health (NIH) Office of Biotechnology Activities, brought together early and mid-career researchers to discuss the key scientific challenges and opportunities, ethical and communication issues, and NIH and foundation resources available to facilitate further clinical advances.
O'Reilly, Marina; Federoff, Howard J.; Fong, Yuman; Kohn, Donald B.; Patterson, Amy P.; Ahmed, Nabil; Asokan, Aravind; Boye, Shannon E.; Crystal, Ronald G.; De Oliveira, Satiro; Gargiulo, Linda; Harper, Scott Q.; Ikeda, Yasuhiro; Jambou, Robert; Montgomery, Maureen; Prograis, Lawrence; Rosenthal, Eugene; Sterman, Daniel H.; Vandenberghe, Luk H.; Zoloth, Laurie; Abedi, Mehrdad; Adair, Jennifer; Adusumilli, Prasad S.; Goins, William F.; Gray, Jhanelle; Monahan, Paul; Popplewell, Leslie; Sena-Esteves, Miguel; Tannous, Bakhos; Weber, Thomas; Wierda, William; Gopal-Srivastava, Rashmi; McDonald, Cheryl L.; Rosenblum, Daniel
2014-01-01
Abstract Recently, the gene therapy field has begun to experience clinical successes in a number of different diseases using various approaches and vectors. The workshop Gene Therapy: Charting a Future Course, sponsored by the National Institutes of Health (NIH) Office of Biotechnology Activities, brought together early and mid-career researchers to discuss the key scientific challenges and opportunities, ethical and communication issues, and NIH and foundation resources available to facilitate further clinical advances. PMID:24773122
International Nuclear Information System (INIS)
1991-01-01
This volume contains conference summaries for the 31. annual conference of the Canadian Nuclear Association and the 12. annual conference of the Canadian Nuclear Society. Topics of discussion include: reactor physics; thermalhydraulics; industrial irradiation; computer applications; fuel channel analysis; small reactors; severe accidents; fuel behaviour under accident conditions; reactor components, safety related computer software; nuclear fuel management; fuel behaviour and performance; reactor safety; reactor engineering; nuclear waste management; and, uranium mining and processing
U.S. Department of Health & Human Services — This page provides background needed to take advantage of the capabilities of the MSIS State Summary Datamart. This mart allows the user to develop high-level...
Cloud Compute for Global Climate Station Summaries
Baldwin, R.; May, B.; Cogbill, P.
2017-12-01
Global Climate Station Summaries are simple indicators of observational normals which include climatic data summarizations and frequency distributions. These typically are statistical analyses of station data over 5-, 10-, 20-, 30-year or longer time periods. The summaries are computed from the global surface hourly dataset. This dataset totaling over 500 gigabytes is comprised of 40 different types of weather observations with 20,000 stations worldwide. NCEI and the U.S. Navy developed these value added products in the form of hourly summaries from many of these observations. Enabling this compute functionality in the cloud is the focus of the project. An overview of approach and challenges associated with application transition to the cloud will be presented.
Summary of Steve Jobs, Walter Isaacson
Reader, Capitol
2013-01-01
This ebook consists of a summary of the ideas, viewpoints and facts presented by Walter Isaacson in his book "Steve Jobs". This summary offers a concise overview of the entire book in less than 30 minutes reading time. However this work does not replace in any case Walter Isaacson's book.Isaacson reveals the story of Steve Jobs career, which is a tale filled with lessons about innovation, character, leadership and being true to one's own values.
75 FR 80106 - Petition for Exemption; Summary of Petition Received
2010-12-21
... training facilities requirements given the school's use of online training material, as well as the ground...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition...
75 FR 20881 - Petition for Exemption; Summary of Petition Received
2010-04-21
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
76 FR 33807 - Petition for Exemption; Summary of Petition Received
2011-06-09
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
76 FR 39976 - Petition for Exemption; Summary of Petition Received
2011-07-07
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATE: Comments on this petition must...
75 FR 60859 - Petition for Exemption; Summary of Petition Received
2010-10-01
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
77 FR 35103 - Petition for Exemption; Summary of Petition Received
2012-06-12
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
77 FR 36333 - Petition for Exemption; Summary of Petition Received
2012-06-18
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 57676 - Petition for Exemption; Summary of Petition Received
2013-09-19
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
76 FR 65772 - Petition for Exemption; Summary of Petition Received
2011-10-24
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 53186 - Petition for Exemption; Summary of Petition Received
2013-08-28
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATE: Comments on this petition must...
76 FR 16653 - Petition for Exemption; Summary of Petition Received
2011-03-24
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 56768 - Petition for Exemption; Summary of Petition Received
2013-09-13
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 26839 - Petition for Exemption; Summary of Petition Received
2010-05-12
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 13745 - Petition for Exemption; Summary of Petition Received
2013-02-28
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
77 FR 58210 - Petition for Exemption; Summary of Petition Received
2012-09-19
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 65396 - Petition for Exemption; Summary of Petition Received
2010-10-22
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
77 FR 71865 - Petition for Exemption; Summary of Petition Received
2012-12-04
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 73919 - Petition for Exemption; Summary of Petition Received
2013-12-09
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 34139 - Petition for Exemption; Summary of Petition Received
2013-06-06
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
77 FR 50760 - Petition for Exemption; Summary of Petition Received
2012-08-22
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
76 FR 2746 - Petition for Exemption; Summary of Petition Received
2011-01-14
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 21388 - Petition for Exemption; Summary of Petition Received
2010-04-23
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petitions or their final disposition. DATES: Comments on these petitions must...
76 FR 51119 - Petition for Exemption; Summary of Petition Received
2011-08-17
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
76 FR 9852 - Petition for Exemption; Summary of Petition Received
2011-02-22
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 80107 - Petition for Exemption; Summary of Petition Received
2010-12-21
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 979 - Petition for Exemption; Summary of Petition Received
2013-01-07
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 21389 - Petition for Exemption; Summary of Petition Received
2010-04-23
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petitions or their final disposition. DATES: Comments on these petitions must...
77 FR 71864 - Petition for Exemption; Summary of Petition Received
2012-12-04
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATE: Comments on this petition must...
78 FR 66098 - Petition for Exemption; Summary of Petition Received
2013-11-04
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 21387 - Petition for Exemption; Summary of Petition Received
2010-04-23
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
76 FR 24560 - Petition for Exemption; Summary of Petition Received
2011-05-02
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 10016 - Petition for Exemption; Summary of Petition Received
2010-03-04
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATE: Comments on this petition must...
78 FR 53818 - Petition for Exemption; Summary of Petition Received
2013-08-30
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
77 FR 5087 - Petition for Exemption; Summary of Petition Received
2012-02-01
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 51525 - Petition for Exemption; Summary of Petition Received
2010-08-20
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petitions or their final disposition. DATES: Comments on these petitions must...
78 FR 35353 - Petition for Exemption; Summary of Petition Received
2013-06-12
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
77 FR 44309 - Petition for Exemption; Summary of Petition Received
2012-07-27
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
77 FR 31064 - Petition for Exemption; Summary of Petition Received
2012-05-24
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 26843 - Petition for Exemption; Summary of Petition Received
2010-05-12
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of any petition or its final disposition. DATES: Comments on petitions received must...
78 FR 24290 - Petition for Exemption; Summary of Petition Received
2013-04-24
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 66099 - Petition for Exemption; Summary of Petition Received
2013-11-04
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 39825 - Petition for Exemption; Summary of Petition Received
2013-07-02
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
76 FR 20806 - Petition for Exemption; Summary of Petition Received
2011-04-13
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
78 FR 21701 - Petition for Exemption; Summary of Petition Received
2013-04-11
...] Petition for Exemption; Summary of Petition Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of a petition... the legal status of the petition or its final disposition. DATES: Comments on this petition must...
75 FR 10016 - Petition for Exemption; Summary of Petitions Received
2010-03-04
...] Petition for Exemption; Summary of Petitions Received AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of petition for exemption received. SUMMARY: This notice contains a summary of two petitions seeking relief from specified requirements of 14 CFR. The purpose of this notice is to improve the...
Zhu, Yizhang; Wang, Likun; Yin, Yuxin; Yang, Ence
2017-07-14
Postmortem mRNA degradation is considered to be the major concern in gene expression research utilizing human postmortem tissues. A key factor in this process is the postmortem interval (PMI), which is defined as the interval between death and sample collection. However, global patterns of postmortem mRNA degradation at individual gene levels across diverse human tissues remain largely unknown. In this study, we performed a systematic analysis of alteration of gene expression associated with PMI in human tissues. From the Genotype-Tissue Expression (GTEx) database, we evaluated gene expression levels of 2,016 high-quality postmortem samples from 316 donors of European descent, with PMI ranging from 1 to 27 hours. We found that PMI-related mRNA degradation is tissue-specific, gene-specific, and even genotype-dependent, thus drawing a more comprehensive picture of PMI-associated gene expression across diverse human tissues. Additionally, we also identified 266 differentially variable (DV) genes, such as DEFB4B and IFNG, whose expression is significantly dispersed between short PMI (S-PMI) and long PMI (L-PMI) groups. In summary, our analyses provide a comprehensive profile of PMI-associated gene expression, which will help interpret gene expression patterns in the evaluation of postmortem tissues.
Over-expression of KdSOC1 gene affected plantlet morphogenesis in Kalanchoe daigremontiana.
Zhu, Chen; Wang, Li; Chen, Jinhua; Liu, Chenglan; Zeng, Huiming; Wang, Huafang
2017-07-17
Kalanchoe daigremontiana reproduces asexually by producing plantlets along the leaf margin. The aim of this study was to identify the function of the SUPPRESSOR OF OVEREXPRESSION OF CONSTANS 1 gene in Kalanchoe daigremontiana (KdSOC1) during plantlet morphogenesis. In this study, KdSOC1 gene expression was detected at stem cell niche during in vitro somatic embryogenesis and plantlet morphogenesis. Disrupting endogenous auxin transportation suppressed the KdSOC1 gene response. Knockdown of the KdSOC1 gene caused a defect in cotyledon formation during the early heart stage of somatic embryogenesis. Over-expression (OE) of the KdSOC1 gene resulted in asymmetric plantlet distribution, a reduced number of plantlets, thicker leaves, and thicker vascular fibers. Higher KdPIN1 gene expression and auxin content were found in OE plant compared to those of wild-type plant leaves, which indicated possible KdSOC1 gene role in affecting auxin distribution and accumulation. KdSOC1 gene OE in DR5-GUS Arabidopsis reporting lines resulted in an abnormal auxin response pattern during different stages of somatic embryogenesis. In summary, the KdSOC1 gene OE might alter auxin distribution and accumulation along leaf margin to initiate plantlet formation and distribution, which is crucial for plasticity during plantlet formation under various environmental conditions.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Alternative methods of compliance for furnishing the summary plan description and summaries of material modifications of a pension plan to a retired participant, a separated participant with vested benefits, and a beneficiary receiving benefits. 2520.104b-4 Section 2520.104b-4 Labor Regulations Relating to...
Directory of Open Access Journals (Sweden)
David J. Burks
2016-12-01
Full Text Available The Auxin Response Factor (ARF family of transcription factors is an important regulator of environmental response and symbiotic nodulation in the legume Medicago truncatula. While previous studies have identified members of this family, a recent spurt in gene expression data coupled with genome update and reannotation calls for a reassessment of the prevalence of ARF genes and their interaction networks in M. truncatula. We performed a comprehensive analysis of the M. truncatula genome and transcriptome that entailed search for novel ARF genes and the co-expression networks. Our investigation revealed 8 novel M. truncatula ARF (MtARF genes, of the total 22 identified, and uncovered novel gene co-expression networks as well. Furthermore, the topological clustering and single enrichment analysis of several network models revealed the roles of individual members of the MtARF family in nitrogen regulation, nodule initiation, and post-embryonic development through a specialized protein packaging and secretory pathway. In summary, this study not just shines new light on an important gene family, but also provides a guideline for identification of new members of gene families and their functional characterization through network analyses.
Summaries of FY 1983 research in the chemical sciences
International Nuclear Information System (INIS)
1983-09-01
These summaries provide a means for becoming acquainted, either generally or in some depth, with the US DOE Chemical Sciences Program. Areas of research supported by the Division are to be seen in the section headings, the index and the summaries themselves. Energy technologies which may be advanced by use of the basic knowledge generated in this program can be seen in the index and again in the summaries
Research in the nuclear sciences: summaries of FY 1978
International Nuclear Information System (INIS)
1978-06-01
Programs funded in fiscal year 1978 by the Division of Nuclear Sciences/Office of Basic Energy Sciences are summarized. Each summary is preceded by a heading that includes institution, title, principal investigators, budget reporting category, and operating funds provided in FY 1978. The summaries are presented in alphabetical order by institution. Indexes are appended to facilitate the location of a summary according to an investigator's name or a budget reporting category
Bakker, Frederik Theodoor
1995-01-01
In this study, phylogenetic relationships among genera, species and biogeographic representatives of single Cladophora species within the Cladophorales were analyzed using rDNA gene and spacer sequences. Based on phylogenetic analysis of 18S rRNA gene sequences, the Cladophora complex is shown to be paraphyletic with respect to Cladophora species and includes several genera shich werde traditionally ascribed to the Siphonocladales (Chapter 3). ... Zie: Summary/Samenvatting
Meson 2000 Conference Summary lite
International Nuclear Information System (INIS)
Barnes, T.
2000-01-01
This short contribution is a late MESON2000 conference summary. As appropriate for the 600th anniversary of the Jagiellonian University, it begins with a brief summary of the last 600 years of European history and its place in hadron physics. Next a ''physicist chirality'' order parameter PC is introduced. When applied to MESON2000 plenary speakers this order parameter illustrates the separation of hadron physicists into disjoint communities. The individual plenary talks in MESON2000 are next sorted according to the subconference associated with each of the 36 plenary speakers. Finally, I conclude with a previously unreported Feynman story regarding the use of models in hadron physics. (author)
Safeguards Summary Event List (SSEL)
International Nuclear Information System (INIS)
1991-07-01
The Safeguards Summary Event List (SSEL) provides brief summaries of several hundred safeguards-related events involving nuclear material or facilities regulated by the US Nuclear Regulatory Commission (NRC). Because of public interest, the Miscellaneous category includes a few events which involve either source material, byproduct material, or natural uranium which are exempt from safeguards requirements. Events are described under the categories of bomb-related, intrusion, missing and/or allegedly stolen, transportation, tampering/vandalism, arson, firearms, radiological sabotage, nonradiological sabotage, pre-1990 alcohol and drugs (involving reactor operators, security force members, or management persons), and miscellaneous. The information contained in the event descriptions is derived primarily from official NRC reporting channels
Altered Gene Expression Profile in Mouse Bladder Cancers Induced by Hydroxybutyl(butylnitrosamine
Directory of Open Access Journals (Sweden)
Ruisheng Yao
2004-09-01
Full Text Available A variety of genetic alterations and gene expression changes are involved in the pathogenesis of bladder tumor. To explore these changes, oligonucleotide array analysis was performed on RNA obtained from carcinogen-induced mouse bladder tumors and normal mouse bladder epithelia using Affymetrix (Santa Clara, CA MGU74Av2 GeneChips. Analysis yielded 1164 known genes that were changed in the tumors. Certain of the upregulated genes included EGFR-Ras signaling genes, transcription factors, cell cycle-related genes, and intracellular signaling cascade genes. However, downregulated genes include mitogen-activated protein kinases, cell cycle checkpoint genes, Rab subfamily genes, Rho subfamily genes, and SH2 and SH3 domains-related genes. These genes are involved in a broad range of different pathways including control of cell proliferation, differentiation, cell cycle, signal transduction, and apoptosis. Using the pathway visualization tool GenMAPP, we found that several genes, including TbR-l, STAT1, Smad1, Smad2, Jun, NFκB, and so on, in the TGF-β signaling pathway and p115 RhoGEF, RhoGDl3, MEKK4A/MEKK4B, P13KA, and JNK in the G13 signaling pathway were differentially expressed in the tumors. In summary, we have determined the expression profiles of genes differentially expressed during mouse bladder tumorigenesis. Our results suggest that activation of the EGFR-Ras pathway, uncontrolled cell cycle, aberrant transcription factors, and G13 and TGF-β pathways are involved, and the cross-talk between these pathways seems to play important roles in mouse bladder tumorigenesis.
Fiscal Year 2010 Budget Request. Summary Justification
2009-05-01
SERVICES AND DEFENSE AGENCIES INTRODUCTION Services and Defense Agencies HIGHLIGHTS Overview The FY 2010 budget request organizes, trains...DoD FY 2010 Budget Request Summary Justification SPECIAL TOPICS INTRODUCTION Special Topics HIGHLIGHTS Overview The FY 2010 budget... MANGEMENT 2-48 DoD FY 2010 Budget Request Summary Justification SPECIAL TOPICS FINANCIAL MANGEMENT 2-49 While DoD has made progress in
Detecting Terrorism Incidence Type from News Summary
DEFF Research Database (Denmark)
Nizamani, Sarwat; Memon, Nasrullah
2012-01-01
The paper presents the experiments to detect terrorism incidence type from news summary data. We have applied classification techniques on news summary data to analyze the incidence and detect the type of incidence. A number of experiments are conducted using various classification algorithms...... and results show that a simple decision tree classifier can learn incidence type with satisfactory results from news data....
Summary of repository siting models. Final report
International Nuclear Information System (INIS)
Thomas, S.D.; Ross, B.; Mercer, J.W.
1982-07-01
This report is the first in a series of reports that will provide critical reviews and summaries of computer programs that can be used to analyze the potential performance of a high-level radioactive waste repository. The computer programs identified address the following phenomena: saturated and unsaturated subsurface flow, heat transport, solute transport, surface water runoff, geomechanical interactions, and geochemical interactions. The report identifies 183 computer programs that can be used to analyze a repository site and provides a summary description of 31 computer programs. The summary descriptions can be used: to assist in code evaluation, to facilitate code comparison, to determine applicability of codes to specific problems, to identify code deficiencies, and to provide a screening mechanism for code selection
Summaries of FY 1995 engineering research
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
The individual engineering project summaries follow the program overview. The summaries are ordered alphabetically by name of institution and so the table of contents lists all the institutions at which projects were sponsored in fiscal year 1995. Each project entry begins with an institutional-departmental heading. The names of investigators are listed immediately below the title. The funding level for fiscal year 1995 appears to the right of title; it is followed by the budget activity number. These numbers categorize the projects for budgetary purposes and the categories are described in the budget number index. A separate index of Principal Investigators includes phone number, fax number and e-mail address, where available. The fiscal year in which either the project began or was renewed and the anticipated duration in years are indicated respectively by the first two and last digits of the sequence directly below the budget activity number. The summary description of the project completes the entry.
Unresolved safety issues summary: aqua book
International Nuclear Information System (INIS)
1982-06-01
The unresolved safety issues summary is designed to provide the management of the Nuclear Regulatory Commission with a quarterly overview of the progress and plans for completion of generic tasks addressing unresolved safety issues reported to Congress pursuant to Section 210 of the Energy Reorganization Act of 1974 as amended. This summary utilizes data collected from the Office of Nuclear Reactor Regulation, Office of Nuclear Regulatory Research, and the National Laboratories and is prepared by the Office of Resource Management. The schedules in this book include a milestone at the end of each action plan which represents the initiation of the implementation process both with respect to incorporation of the technical resolution in the NRC official guidance or requirements and also the application of changes to individual operating plants. The progress and status for implementation of unresolved safety issues for which a technical resolution has been completed are reported specifically in a separate table provided in this summary
Carnevale, Anthony P.; Smith, Nicole; Gulish, Artem; Beach, Bennett H.
2012-01-01
This executive summary highlights several findings about healthcare. These are: (1) Healthcare is 18 percent of the U.S. economy, twice as high as in other countries; (2) There are two labor markets in healthcare: high-skill, high-wage professional and technical jobs and low-skill, low-wage support jobs; (3) Demand for postsecondary education in…
Research in the nuclear sciences: summaries of FY 1978
Energy Technology Data Exchange (ETDEWEB)
1978-06-01
Programs funded in fiscal year 1978 by the Division of Nuclear Sciences/Office of Basic Energy Sciences are summarized. Each summary is preceded by a heading that includes institution, title, principal investigators, budget reporting category, and operating funds provided in FY 1978. The summaries are presented in alphabetical order by institution. Indexes are appended to facilitate the location of a summary according to an investigator's name or a budget reporting category. (RWR)
INC93: international nuclear congress. Technical sessions summaries
International Nuclear Information System (INIS)
Boulton, J.
1993-01-01
The conference dealt mainly with safety, environmental and human aspects of nuclear energy, including waste management. This volume consists of summaries of the technical sessions contained in Volumes 2 and 3. The individual papers have also been abstracted separately for INIS, with the summaries abridged
INC93: international nuclear congress. Technical sessions summaries
Energy Technology Data Exchange (ETDEWEB)
Boulton, J
1994-12-31
The conference dealt mainly with safety, environmental and human aspects of nuclear energy, including waste management. This volume consists of summaries of the technical sessions contained in Volumes 2 and 3. The individual papers have also been abstracted separately for INIS, with the summaries abridged.
Maier, William B.; Cleary, David D.
1997-01-01
This report contains summaries of research projects in the Department of Physics. A list of recent publications in also included which consists of conference presentations and publications, books, contributions to books, published jounal papers, technical reports, and thesis abstracts.
International Nuclear Information System (INIS)
Furman, M.A.
2002-01-01
This is a summary of the talks presented in Session III ''Simulations of Electron-Cloud Build Up'' of the Mini-Workshop on Electron-Cloud Simulations for Proton and Positron Beams ECLOUD-02, held at CERN, 15-18 April 2002
Identification of differentially expressed genes and biological pathways in bladder cancer
Tang, Fucai; He, Zhaohui; Lei, Hanqi; Chen, Yuehan; Lu, Zechao; Zeng, Guohua; Wang, Hangtao
2018-01-01
The purpose of the present study was to identify key genes and investigate the related molecular mechanisms of bladder cancer (BC) progression. From the Gene Expression Omnibus database, the gene expression dataset GSE7476 was downloaded, which contained 43 BC samples and 12 normal bladder tissues. GSE7476 was analyzed to screen the differentially expressed genes (DEGs). Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analyses were performed for the DEGs using the DAVID database, and a protein-protein interaction (PPI) network was then constructed using Cytoscape software. The results of the GO analysis showed that the upregulated DEGs were significantly enriched in cell division, nucleoplasm and protein binding, while the downregulated DEGs were significantly enriched in ‘extracellular matrix organization’, ‘proteinaceous extracellular matrix’ and ‘heparin binding’. The results of the KEGG pathway analysis showed that the upregulated DEGs were significantly enriched in the ‘cell cycle’, whereas the downregulated DEGs were significantly enriched in ‘complement and coagulation cascades’. JUN, cyclin-dependent kinase 1, FOS, PCNA, TOP2A, CCND1 and CDH1 were found to be hub genes in the PPI network. Sub-networks revealed that these gene were enriched in significant pathways, including the ‘cell cycle’ signaling pathway and ‘PI3K-Akt signaling pathway’. In summary, the present study identified DEGs and key target genes in the progression of BC, providing potential molecular targets and diagnostic biomarkers for the treatment of BC. PMID:29532898
Summaries of poster contributions
International Nuclear Information System (INIS)
1981-01-01
The 10. meeting covered subjects on the application of electron microscopy in numerous fields such as biology and medicine, solid state physics, semiconductor research and production, crystallography, materials science, and chemistry of polymers. 174 summaries of poster contributions are included
International Nuclear Information System (INIS)
1981-02-01
This paper is an 'executive summary' of work undertaken to review proposals for transport, handling and emplacement of high level radioactive wastes in an underground repository, appropriate to the U.K. context, with particular reference to: waste block size and configuration; self-shielded or partially-shielded block; stages of disposal; transportation within the repository; emplacement in vertical holes or horizontal tunnels; repository access by adit, incline or shaft; and costs. The paper contains a section on general conclusions and recommendations. (U.K.)
Directory of Open Access Journals (Sweden)
Aurélien Tellier
Full Text Available Understanding the processes and conditions under which populations diverge to give rise to distinct species is a central question in evolutionary biology. Since recently diverged populations have high levels of shared polymorphisms, it is challenging to distinguish between recent divergence with no (or very low inter-population gene flow and older splitting events with subsequent gene flow. Recently published methods to infer speciation parameters under the isolation-migration framework are based on summarizing polymorphism data at multiple loci in two species using the joint site-frequency spectrum (JSFS. We have developed two improvements of these methods based on a more extensive use of the JSFS classes of polymorphisms for species with high intra-locus recombination rates. First, using a likelihood based method, we demonstrate that taking into account low-frequency polymorphisms shared between species significantly improves the joint estimation of the divergence time and gene flow between species. Second, we introduce a local linear regression algorithm that considerably reduces the computational time and allows for the estimation of unequal rates of gene flow between species. We also investigate which summary statistics from the JSFS allow the greatest estimation accuracy for divergence time and migration rates for low (around 10 and high (around 100 numbers of loci. Focusing on cases with low numbers of loci and high intra-locus recombination rates we show that our methods for the estimation of divergence time and migration rates are more precise than existing approaches.
Hazmat Yearly Incident Summary Reports
Department of Transportation — Series of Incident data and summary statistics reports produced which provide statistical information on incidents by type, year, geographical location, and others....
Computational fitness landscape for all gene-order permutations of an RNA virus.
Directory of Open Access Journals (Sweden)
Kwang-il Lim
2009-02-01
Full Text Available How does the growth of a virus depend on the linear arrangement of genes in its genome? Answering this question may enhance our basic understanding of virus evolution and advance applications of viruses as live attenuated vaccines, gene-therapy vectors, or anti-tumor therapeutics. We used a mathematical model for vesicular stomatitis virus (VSV, a prototype RNA virus that encodes five genes (N-P-M-G-L, to simulate the intracellular growth of all 120 possible gene-order variants. Simulated yields of virus infection varied by 6,000-fold and were found to be most sensitive to gene-order permutations that increased levels of the L gene transcript or reduced levels of the N gene transcript, the lowest and highest expressed genes of the wild-type virus, respectively. Effects of gene order on virus growth also depended upon the host-cell environment, reflecting different resources for protein synthesis and different cell susceptibilities to infection. Moreover, by computationally deleting intergenic attenuations, which define a key mechanism of transcriptional regulation in VSV, the variation in growth associated with the 120 gene-order variants was drastically narrowed from 6,000- to 20-fold, and many variants produced higher progeny yields than wild-type. These results suggest that regulation by intergenic attenuation preceded or co-evolved with the fixation of the wild type gene order in the evolution of VSV. In summary, our models have begun to reveal how gene functions, gene regulation, and genomic organization of viruses interact with their host environments to define processes of viral growth and evolution.
Directory of Open Access Journals (Sweden)
Brian K. Lohman
2017-09-01
Full Text Available Heritable population differences in immune gene expression following infection can reveal mechanisms of host immune evolution. We compared gene expression in infected and uninfected threespine stickleback (Gasterosteus aculeatus from two natural populations that differ in resistance to a native cestode parasite, Schistocephalus solidus. Genes in both the innate and adaptive immune system were differentially expressed as a function of host population, infection status, and their interaction. These genes were enriched for loci controlling immune functions known to differ between host populations or in response to infection. Coexpression network analysis identified two distinct processes contributing to resistance: parasite survival and suppression of growth. Comparing networks between populations showed resistant fish have a dynamic expression profile while susceptible fish are static. In summary, recent evolutionary divergence between two vertebrate populations has generated population-specific gene expression responses to parasite infection, affecting parasite establishment and growth.
Danubian lowland - ground water model. Final Report. Vol. 1. Summary Report
International Nuclear Information System (INIS)
1995-12-01
The summary report contains the next parts: (0) Executive summary; (1) Introduction; (2) Project staffing; (3) Project management issues; (4) Establishment of the integrated modelling system; (5) Summary of model application; (6) Conclusions and recommendations; and List of references
Elsweiler, John A., Jr.; And Others
1990-01-01
Presents summaries of 12 papers presented at the 1990 Computers in Libraries Conference. Topics discussed include online searching; microcomputer-based serials management; microcomputer-based workstations; online public access catalogs (OPACs); multitype library networking; CD-ROM searches; locally mounted online databases; collection evaluation;…
ENDF-201, ENDF/B-VI summary documentation supplement 1, ENDF/HE-VI summary documentation
International Nuclear Information System (INIS)
McLane, V.
1996-12-01
The National Nuclear Data Center (NNDC) provides coordination for and serves as the secretariat to the Cross Section Evaluation Working Group (CSWEG). CSEWG is responsible for the oversight of the ENDF/B Evaluated Nuclear Data File. All data are checked and reviewed by CSEWG, and the file is maintained at the NNDC. For a description of the ENDF/B-VI file, see the ENDF-102 Data Formats and Procedures for the Evaluated Nuclear Data File ENDF-6. The purpose of this addendum to the ENDF/B-VI Summary Documentation is to provide documentation of Releases 1, 2, 3, and 4 for the ENDF/B-VI and ENDF/HE-VI evaluated nuclear data libraries. These releases contain many new and revised evaluations for the neutron, photo-atomic interaction, radioactive decay data, spontaneous fission product yield, neutron-induced fission product yield, thermal neutron scattering, proton, deuteron, and triton sublibraries. The summaries have been extracted mainly from the ENDF/B-VI File 1 comments (MT = 451), which have been checked, edited, and may also include supplementary information. Some summaries have been provided by the evaluators in electronic format, while others are extracted from reports on the evaluations. All references have been checked and corrected, or updated where appropriate. A list of the laboratories which have contributed evaluations used in ENDF/B-VI is given
ENDF-201, ENDF/B-VI summary documentation supplement 1, ENDF/HE-VI summary documentation
Energy Technology Data Exchange (ETDEWEB)
McLane, V.
1996-12-01
The National Nuclear Data Center (NNDC) provides coordination for and serves as the secretariat to the Cross Section Evaluation Working Group (CSWEG). CSEWG is responsible for the oversight of the ENDF/B Evaluated Nuclear Data File. All data are checked and reviewed by CSEWG, and the file is maintained at the NNDC. For a description of the ENDF/B-VI file, see the ENDF-102 Data Formats and Procedures for the Evaluated Nuclear Data File ENDF-6. The purpose of this addendum to the ENDF/B-VI Summary Documentation is to provide documentation of Releases 1, 2, 3, and 4 for the ENDF/B-VI and ENDF/HE-VI evaluated nuclear data libraries. These releases contain many new and revised evaluations for the neutron, photo-atomic interaction, radioactive decay data, spontaneous fission product yield, neutron-induced fission product yield, thermal neutron scattering, proton, deuteron, and triton sublibraries. The summaries have been extracted mainly from the ENDF/B-VI File 1 comments (MT = 451), which have been checked, edited, and may also include supplementary information. Some summaries have been provided by the evaluators in electronic format, while others are extracted from reports on the evaluations. All references have been checked and corrected, or updated where appropriate. A list of the laboratories which have contributed evaluations used in ENDF/B-VI is given.
International Nuclear Information System (INIS)
Kinsey, R.
1979-07-01
This publication provides a localized source of descriptions for the evaluations contained in the ENDF/B Library. The summary documentation presented is intended to be a more detailed description than the (File 1) comments contained in the computer readable data files, but not so detailed as the formal reports describing each ENDF/B evaluation. The summary documentations were written by the CSEWB (Cross Section Evaluation Working Group) evaluators and compiled by NNDC (National Nuclear Data Center). This edition includes documentation for materials found on ENDF/B Version V tapes 501 to 516 (General Purpose File) excluding tape 504. ENDF/B-V also includes tapes containing partial evaluations for the Special Purpose Actinide (521, 522), Dosimetry (531), Activation (532), Gas Production (533), and Fission Product (541-546) files. The materials found on these tapes are documented elsewhere. Some of the evaluation descriptions in this report contain cross sections or energy level information
Lo, Wen-Sui; Kuo, Chih-Horng
2017-12-01
Genetic differentiation among symbiotic bacteria is important in shaping biodiversity. The genus Spiroplasma contains species occupying diverse niches and is a model system for symbiont evolution. Previous studies have established that two mosquito-associated species have diverged extensively in their carbohydrate metabolism genes despite having a close phylogenetic relationship. Notably, although the commensal Spiroplasma diminutum lacks identifiable pathogenicity factors, the pathogenic Spiroplasma taiwanense was found to have acquired a virulence factor glpO and its associated genes through horizontal transfer. However, it is unclear if these acquired genes have been integrated into the regulatory network. In this study, we inferred the gene content evolution in these bacteria, as well as examined their transcriptomes in response to glucose availability. The results indicated that both species have many more gene acquisitions from the Mycoides-Entomoplasmataceae clade, which contains several important pathogens of ruminants, than previously thought. Moreover, several acquired genes have higher expression levels than the vertically inherited homologs, indicating possible functional replacement. Finally, the virulence factor and its functionally linked genes in S. taiwanense were up-regulated in response to glucose starvation, suggesting that these acquired genes are under expression regulation and the pathogenicity may be a stress response. In summary, although differential gene losses are a major process for symbiont divergence, gene gains are critical in counteracting genome degradation and driving diversification among facultative symbionts. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Innovative algorithms and tools summary and outlook
International Nuclear Information System (INIS)
Fine, V.E.; Naumann, N.A.
2003-01-01
This contribution provides a summary of the 'Session IV: Innovative Algorithms and Tools'. The 'tools' portion of the session IV comprised three oral sessions, 12 talks by seven speakers, and three posters. The algorithmic part was covered by 15 talks and three poster presentations. We will try to give a summary of the main development directions, and state our personal views and interpretation on it as well as an outlook
USACE AIS Transmit Technical Support Summary Report
2014-09-01
the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public
Gene expression in the aging human brain: an overview.
Mohan, Adith; Mather, Karen A; Thalamuthu, Anbupalam; Baune, Bernhard T; Sachdev, Perminder S
2016-03-01
The review aims to provide a summary of recent developments in the study of gene expression in the aging human brain. Profiling differentially expressed genes or 'transcripts' in the human brain over the course of normal aging has provided valuable insights into the biological pathways that appear activated or suppressed in late life. Genes mediating neuroinflammation and immune system activation in particular, show significant age-related upregulation creating a state of vulnerability to neurodegenerative and neuropsychiatric disease in the aging brain. Cellular ionic dyshomeostasis and age-related decline in a host of molecular influences on synaptic efficacy may underlie neurocognitive decline in later life. Critically, these investigations have also shed light on the mobilization of protective genetic responses within the aging human brain that help determine health and disease trajectories in older age. There is growing interest in the study of pre and posttranscriptional regulators of gene expression, and the role of noncoding RNAs in particular, as mediators of the phenotypic diversity that characterizes human brain aging. Gene expression studies in healthy brain aging offer an opportunity to unravel the intricately regulated cellular underpinnings of neurocognitive aging as well as disease risk and resiliency in late life. In doing so, new avenues for early intervention in age-related neurodegenerative disease could be investigated with potentially significant implications for the development of disease-modifying therapies.
Modifying sales summaries can aid forest products industries
G. B. Harpole
1976-01-01
This Note illustrates how a sales summary can be modified to separately identify changes in sales realization caused by changes in market prices and by changes in the product mix sold. With this information, a sales summary can become a helpful record to gage effects of past production and marketing decisions.
USING BLOGS TO IMPROVE STUDENTS’ SUMMARY WRITING ABILITIES
Directory of Open Access Journals (Sweden)
Orachorn KITCHAKARN,
2012-08-01
Full Text Available The research compared students’ summary writing ability before and after they were taught through blog, a new medium or tool for written communication and interaction in many different languages around the world. The research design is a kind of one group pretest posttest. Participants were 33 first-year students who studied EN 011 course (English in Action in the first semester of the academic year 2012 at Bangkok University. They were divided into six groups. Five or six students in each group created a blog; www.blogger.com, and they worked together for fourteen weeks to produce six pieces of summary written work. Each member in the group worked through providing comments, editing and revising on the blog until the group got a final summary paper and submitted that to the teacher for grading. The instruments used in this study were (1 two summary writing tests (2 a questionnaire surveying students’ attitude toward learning through blogs, and (3 postings on blogs to reflect their learning experience. The results revealed that after the students worked together on weblogs, their English summary writing mean score of the posttest was higher than that of the pretest, and they had positive attitudes towards using weblogs in learning. Regarding cooperative learning experiences through using weblogs, most students thought that it was interesting, a new experience to work with their friends on the weblogs.
Access this manual of codes and coding instructions for the summary stage field for cases diagnosed January 1, 2018 and forward. 2018 version applies to every site and/or histology combination, including lymphomas and leukemias. Historically, also called General Staging, California Staging, and SEER Staging.
Physics through the 1990s: A summary
International Nuclear Information System (INIS)
1986-01-01
This summary presents some highlights of the recently released physics survey Physics Through the 1990s. The purpose of the survey is to provide an authoritative research assessment of the major fields of physics. To accomplish that, the Physics Survey Committee prepared six volumes on the fields of physics and two cross-cutting volumes - Scientific interfaces and Technological Applications and An Overview. This brief summary can do little more than pique the reader's interest in the more complete treatment in those eight volumes, which provide convincing documentation of a physics enterprise that is vital and productive. The summary is organized into three parts. The first part sketches the progress that has occurred over the past decade and gives an indication of where the field is headed. Only a few highlights have been included; in each field of physics, important elements have been omitted for the sake of brevity. The second part relates physics to other sciences and the needs of society. The first two sections are quite selective; applications have received strong emphasis as a principal theme of this summary. The third part indicates some of the requirements for maintaining excellence in physics and includes a brief synopsis of the major recommendations of the Physics Survey Committee
Summaries of FY 1989 research in the chemical sciences
International Nuclear Information System (INIS)
1989-08-01
These summaries provide the scientific and technical public, as well as the legislative and executive branches of the Government, information, either generally or in some depth, about the Chemical Sciences program. Areas of research supported are indicated in the section headings, the ''Selected Topics of General Interest'' list, and the summaries themselves. Energy technologies that may be advanced by use of the basic knowledge generated in this program are included in the ''Selected Topics of General Interest'' list and are often referenced in the summaries
Transcriptomic epidemiology of smoking: the effect of smoking on gene expression in lymphocytes
Directory of Open Access Journals (Sweden)
Almasy Laura
2010-07-01
Full Text Available Abstract Background This investigation offers insights into system-wide pathological processes induced in response to cigarette smoke exposure by determining its influences at the gene expression level. Methods We obtained genome-wide quantitative transcriptional profiles from 1,240 individuals from the San Antonio Family Heart Study, including 297 current smokers. Using lymphocyte samples, we identified 20,413 transcripts with significantly detectable expression levels, including both known and predicted genes. Correlation between smoking and gene expression levels was determined using a regression model that allows for residual genetic effects. Results With a conservative false-discovery rate of 5% we identified 323 unique genes (342 transcripts whose expression levels were significantly correlated with smoking behavior. These genes showed significant over-representation within a range of functional categories that correspond well with known smoking-related pathologies, including immune response, cell death, cancer, natural killer cell signaling and xenobiotic metabolism. Conclusions Our results indicate that not only individual genes but entire networks of gene interaction are influenced by cigarette smoking. This is the largest in vivo transcriptomic epidemiological study of smoking to date and reveals the significant and comprehensive influence of cigarette smoke, as an environmental variable, on the expression of genes. The central importance of this manuscript is to provide a summary of the relationships between gene expression and smoking in this exceptionally large cross-sectional data set.
Spontaneous Pancreatitis Caused by Tissue-Specific Gene Ablation of Hhex in MiceSummary
Directory of Open Access Journals (Sweden)
Mark J. Ferreira
2015-09-01
Full Text Available Background & Aims: Perturbations in pancreatic ductal bicarbonate secretion cause chronic pancreatitis. The physiologic mechanism of ductal secretion is known, but its transcriptional control is not. We determine the role of the transcription factor hematopoietically expressed homeobox protein (Hhex in ductal secretion and pancreatitis. Methods: We derived mice with pancreas-specific, Cre-mediated Hhex gene ablation to determine the requirement of Hhex in the pancreatic duct in early life and in adult stages. Histologic and immunostaining analyses were used to detect the presence of pathology. Pancreatic primary ductal cells were isolated to discover differentially expressed transcripts upon acute Hhex ablation on a cell autonomous level. Results: Hhex protein was detected throughout the embryonic and adult ductal trees. Ablation of Hhex in pancreatic progenitors resulted in postnatal ductal ectasia associated with acinar-to-ductal metaplasia, a progressive phenotype that ultimately resulted in chronic pancreatitis. Hhex ablation in adult mice, however, did not cause any detectable pathology. Ductal ectasia in young mice did not result from perturbation of expression of Hnf6, Hnf1β, or the primary cilia genes. RNA-seq analysis of Hhex-ablated pancreatic primary ductal cells showed mRNA levels of the G-protein coupled receptor natriuretic peptide receptor 3 (Npr3, implicated in paracrine signaling, up-regulated by 4.70-fold. Conclusions: Although Hhex is dispensable for ductal cell function in the adult, ablation of Hhex in pancreatic progenitors results in pancreatitis. Our data highlight the critical role of Hhex in maintaining ductal homeostasis in early life and support ductal hypersecretion as a novel etiology of pediatric chronic pancreatitis. Keywords: Npr3, Pancreatic Ducts, Primary Cilia
Bioinformatics Analysis of MAPKKK Family Genes in Medicago truncatula
Directory of Open Access Journals (Sweden)
Wei Li
2016-04-01
Full Text Available Mitogen‐activated protein kinase kinase kinase (MAPKKK is a component of the MAPK cascade pathway that plays an important role in plant growth, development, and response to abiotic stress, the functions of which have been well characterized in several plant species, such as Arabidopsis, rice, and maize. In this study, we performed genome‐wide and systemic bioinformatics analysis of MAPKKK family genes in Medicago truncatula. In total, there were 73 MAPKKK family members identified by search of homologs, and they were classified into three subfamilies, MEKK, ZIK, and RAF. Based on the genomic duplication function, 72 MtMAPKKK genes were located throughout all chromosomes, but they cluster in different chromosomes. Using microarray data and high‐throughput sequencing‐data, we assessed their expression profiles in growth and development processes; these results provided evidence for exploring their important functions in developmental regulation, especially in the nodulation process. Furthermore, we investigated their expression in abiotic stresses by RNA‐seq, which confirmed their critical roles in signal transduction and regulation processes under stress. In summary, our genome‐wide, systemic characterization and expressional analysis of MtMAPKKK genes will provide insights that will be useful for characterizing the molecular functions of these genes in M. truncatula.
Radioactive waste disposal from Austria. Summary of experts' discussion
International Nuclear Information System (INIS)
Benischek, I.; Dincmen, T.; Ehrenstrasser, G.; Komurka, M.; Krejsa, P.; Kudlicza, P.; Schreiber, R.
1992-06-01
The aims of this report are: (1) A summary of relevant decision bases (2) A summary of comparative evaluation of ground-level and underground deposition (3) Recommendations for further investigations and on the acceptance. (authors, translated by Quittner)
Summary reports of activities under visiting research program (1992)
International Nuclear Information System (INIS)
1992-09-01
Now the summary report of activities under visiting research program in the Research Reactor Institute, Kyoto University, in fiscal year 1991 has been put in order and published. As compared with the past reports, in the report of this year, pages increased and the style changed, but this is due to the change of the method of adopting researches to that throughout one year from fiscal year 1991. So far one page was allotted to every subject, but this limit was relaxed according to the contents. This style is not yet fixed. As well known, discussion is going on about the way the research reactor and the Research Reactor Institute should be. As for this summary report, in order to receive the international evaluation, it was decided to publish the report in English from fiscal year 1992, and the Progress Report on the research by the Institute personnel is included in it. In this report, 98 summaries of the researches using the KUR and 15 summaries of the researches using the KUCA are collected. One summary which was not reported in fiscal year 1990 is added. (K.I.)
Summaries of special research project on nuclear fusion 1980
International Nuclear Information System (INIS)
Uchida, Taijiro
1981-09-01
This is a report of the research project entitled ''Nuclear fusion'', supported by the grant in aid for fusion research from the Ministry of Education in the fiscal year 1980. The research project was started in April, 1980, and comprises the following seventeen subjects of nuclear fusion research. 1) Heavy irradiation effects, 2) plasma-wall interaction, 3) neutronics, 4) welding engineering, 5) science and technology of tritium, 6) biological effects of tritium, 7) diagnostics of high temperature plasma, 8) new lasers, 9) fundamentals of plasma heating, 10) high efficiency energy conversion, 11) theory and computer simulation, 12) superconducting materials, 13) fundamental phenomena of superconductivity, 14) magnet technology, 15) heat transfer and structural engineering, 16) system design, and 17) resources and assessment of fusion energy. 43 summaries concerning reactor materials and plasma-wall interaction, 29 summaries concerning the science, technology and biological effects of tritium, 41 summaries concerning the fundamentals of reactor plasma control, 15 summaries concerning the technology of superconducting magnets, and 14 summaries concerning the design of fusion reactors and its evaluation are collected in this report, and their results and progress can be known. (Kako, I.)
Quantitative and qualitative analysis of student textbook summary writing
Demaree, Dedra; Allie, Saalih; Low, Michael; Taylor, Julian
2008-10-01
The majority of "special access" students at the University of Cape Town are second language English speakers for whom reading the physics textbook is daunting. As a strategy to encourage meaningful engagement with the text, students wrote textbook summaries due the day material was covered in class. The summaries were returned, and they could bring them or re-write them for use during their examinations. A framework was developed to analyze the summaries based on Waywood, defining three cognitive levels seen in mathematics journaling: recounting, summarizing, and dialoging. This framework was refined, expanded, and tested. Interviews with students were conducted for their views on summary writing and survey questions were included on their final exams. The study was carried out in the 2007 spring semester of the "Foundation Physics Course," a component of the special access program.
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1981-08-01
The Operating Reactors Licensing Actions Summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors
Energy Technology Data Exchange (ETDEWEB)
Kinsey, R. (comp.)
1979-07-01
This publication provides a localized source of descriptions for the evaluations contained in the ENDF/B Library. The summary documentation presented is intended to be a more detailed description than the (File 1) comments contained in the computer readable data files, but not so detailed as the formal reports describing each ENDF/B evaluation. The summary documentations were written by the CSEWB (Cross Section Evaluation Working Group) evaluators and compiled by NNDC (National Nuclear Data Center). This edition includes documentation for materials found on ENDF/B Version V tapes 501 to 516 (General Purpose File) excluding tape 504. ENDF/B-V also includes tapes containing partial evaluations for the Special Purpose Actinide (521, 522), Dosimetry (531), Activation (532), Gas Production (533), and Fission Product (541-546) files. The materials found on these tapes are documented elsewhere. Some of the evaluation descriptions in this report contain cross sections or energy level information. (RWR)
Runx family genes in a cartilaginous fish, the elephant shark (Callorhinchus milii.
Directory of Open Access Journals (Sweden)
Giselle Sek Suan Nah
Full Text Available The Runx family genes encode transcription factors that play key roles in hematopoiesis, skeletogenesis and neurogenesis and are often implicated in diseases. We describe here the cloning and characterization of Runx1, Runx2, Runx3 and Runxb genes in the elephant shark (Callorhinchus milii, a member of Chondrichthyes, the oldest living group of jawed vertebrates. Through the use of alternative promoters and/or alternative splicing, each of the elephant shark Runx genes expresses multiple isoforms similar to their orthologs in human and other bony vertebrates. The expression profiles of elephant shark Runx genes are similar to those of mammalian Runx genes. The syntenic blocks of genes at the elephant shark Runx gene loci are highly conserved in human, but represented by shorter conserved blocks in zebrafish indicating a higher degree of rearrangements in this teleost fish. Analysis of promoter regions revealed conservation of binding sites for transcription factors, including two tandem binding sites for Runx that are totally conserved in the distal promoter regions of elephant shark Runx1-3. Several conserved noncoding elements (CNEs, which are putative cis-regulatory elements, and miRNA binding sites were identified in the elephant shark and human Runx gene loci. Some of these CNEs and miRNA binding sites are absent in teleost fishes such as zebrafish and fugu. In summary, our analysis reveals that the genomic organization and expression profiles of Runx genes were already complex in the common ancestor of jawed vertebrates.
Danubian lowland - ground water model. Final Report. Vol. 1. Summary Report
Energy Technology Data Exchange (ETDEWEB)
Danish Hydraulic Inst. (DK); BV, DHV Consultants [NL; TNO, Inst. of Applied Geoscience (NL); Water Quality Institute (DK); Krueger, I [DK; The Royal Veterinary and Agricultural Univ. (DK); Water Resources Research Institute (SK); Research Institute of Irrigation (SK); Consulting Ltd, Ground Water [SK; Faculty of Natural Sciences, Comenius Univ. (SK)
1995-12-01
The summary report contains the next parts: (0) Executive summary; (1) Introduction; (2) Project staffing; (3) Project management issues; (4) Establishment of the integrated modelling system; (5) Summary of model application; (6) Conclusions and recommendations; and List of references. Contains several maps in the parts. figs, tabs, 146 refs.
The 2002 RPA Plot Summary database users manual
Patrick D. Miles; John S. Vissage; W. Brad Smith
2004-01-01
Describes the structure of the RPA 2002 Plot Summary database and provides information on generating estimates of forest statistics from these data. The RPA 2002 Plot Summary database provides a consistent framework for storing forest inventory data across all ownerships across the entire United States. The data represents the best available data as of October 2001....
A Summary Score for the Framingham Heart Study Neuropsychological Battery.
Downer, Brian; Fardo, David W; Schmitt, Frederick A
2015-10-01
To calculate three summary scores of the Framingham Heart Study neuropsychological battery and determine which score best differentiates between subjects classified as having normal cognition, test-based impaired learning and memory, test-based multidomain impairment, and dementia. The final sample included 2,503 participants. Three summary scores were assessed: (a) composite score that provided equal weight to each subtest, (b) composite score that provided equal weight to each cognitive domain assessed by the neuropsychological battery, and (c) abbreviated score comprised of subtests for learning and memory. Receiver operating characteristic analysis was used to determine which summary score best differentiated between the four cognitive states. The summary score that provided equal weight to each subtest best differentiated between the four cognitive states. A summary score that provides equal weight to each subtest is an efficient way to utilize all of the cognitive data collected by a neuropsychological battery. © The Author(s) 2015.
Generation of Natural-Language Textual Summaries from Longitudinal Clinical Records.
Goldstein, Ayelet; Shahar, Yuval
2015-01-01
Physicians are required to interpret, abstract and present in free-text large amounts of clinical data in their daily tasks. This is especially true for chronic-disease domains, but holds also in other clinical domains. We have recently developed a prototype system, CliniText, which, given a time-oriented clinical database, and appropriate formal abstraction and summarization knowledge, combines the computational mechanisms of knowledge-based temporal data abstraction, textual summarization, abduction, and natural-language generation techniques, to generate an intelligent textual summary of longitudinal clinical data. We demonstrate our methodology, and the feasibility of providing a free-text summary of longitudinal electronic patient records, by generating summaries in two very different domains - Diabetes Management and Cardiothoracic surgery. In particular, we explain the process of generating a discharge summary of a patient who had undergone a Coronary Artery Bypass Graft operation, and a brief summary of the treatment of a diabetes patient for five years.
Summary 2010 Greenhouse Gas Data
U.S. Environmental Protection Agency — This file contains a summary of the publicly available data from the GHG Reporting Program for 2010. This data includes non-confidential data reported by facilities...
Summary of ENDF/B pre-processing codes
International Nuclear Information System (INIS)
Cullen, D.E.
1981-12-01
This document contains the summary documentation for the ENDF/B pre-processing codes: LINEAR, RECENT, SIGMA1, GROUPIE, EVALPLOT, MERGER, DICTION, CONVERT. This summary documentation is merely a copy of the comment cards that appear at the beginning of each programme; these comment cards always reflect the latest status of input options, etc. For the latest published documentation on the methods used in these codes see UCRL-50400, Vol.17 parts A-E, Lawrence Livermore Laboratory (1979)
The Development and Evaluation of a Novel Instrument Assessing Residents' Discharge Summaries.
Hommos, Musab S; Kuperman, Ethan F; Kamath, Aparna; Kreiter, Clarence D
2017-04-01
To develop and determine the reliability of a novel measurement instrument assessing the quality of residents' discharge summaries. In 2014, the authors created a discharge summary evaluation instrument based on consensus recommendations from national regulatory bodies and input from primary care providers at their institution. After a brief pilot, they used the instrument to evaluate discharge summaries written by first-year internal medicine residents (n = 24) at a single U.S. teaching hospital during the 2013-2014 academic year. They conducted a generalizability study to determine the reliability of the instrument and a series of decision studies to determine the number of discharge summaries and raters needed to achieve a reliable evaluation score. The generalizability study demonstrated that 37% of the variance reflected residents' ability to generate an adequate discharge summary (true score variance). The decision studies estimated that the mean score from six discharge summary reviews completed by a unique rater for each review would yield a reliability coefficient of 0.75. Because of high interrater reliability, multiple raters per discharge summary would not significantly enhance the reliability of the mean rating. This evaluation instrument reliably measured residents' performance writing discharge summaries. A single rating of six discharge summaries can achieve a reliable mean evaluation score. Using this instrument is feasible even for programs with a limited number of inpatient encounters and a small pool of faculty preceptors.
Crisis Management: Research Summaries
Brock, Stephen E., Ed.; Dorman, Sally; Anderson, Luke; McNair, Daniel
2013-01-01
This article presents summaries of three studies relevant to school crisis response. The first report, "A Framework for International Crisis Intervention" (Sally Dorman), is a review of how existing crisis intervention models (including the NASP PREPaRE model) have been adapted for international use. The second article, "Responding…
Symposium summary and prognosis
International Nuclear Information System (INIS)
Bjorken, J.D.
1975-11-01
The summary of the symposium on high energy physics experiments includes phenomena at low energies, the foundations of physics (considered to be mainly gravitation and quantum electrodynamics), standards of reference used for interpretation of experimental data, the new physics, particle proliferation, theoretical development, and a prognosis for the future
Dynamic and modular gene regulatory networks drive the development of gametogenesis.
Che, Dongxue; Wang, Yang; Bai, Weiyang; Li, Leijie; Liu, Guiyou; Zhang, Liangcai; Zuo, Yongchun; Tao, Shiheng; Hua, Jinlian; Liao, Mingzhi
2017-07-01
Gametogenesis is a complex process, which includes mitosis and meiosis and results in the production of ovum and sperm. The development of gametogenesis is dynamic and needs many different genes to work synergistically, but it is lack of global perspective research about this process. In this study, we detected the dynamic process of gametogenesis from the perspective of systems biology based on protein-protein interaction networks (PPINs) and functional analysis. Results showed that gametogenesis genes have strong synergistic effects in PPINs within and between different phases during the development. Addition to the synergistic effects on molecular networks, gametogenesis genes showed functional consistency within and between different phases, which provides the further evidence about the dynamic process during the development of gametogenesis. At last, we detected and provided the core molecular modules of different phases about gametogenesis. The gametogenesis genes and related modules can be obtained from our Web site Gametogenesis Molecule Online (GMO, http://gametsonline.nwsuaflmz.com/index.php), which is freely accessible. GMO may be helpful for the reference and application of these genes and modules in the future identification of key genes about gametogenesis. Summary, this work provided a computational perspective and frame to the analysis of the gametogenesis dynamics and modularity in both human and mouse. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Energy Technology Data Exchange (ETDEWEB)
Jong, M. de, E-mail: mjg@nikhef.nl [Nikhef - National Institute for Subatomic Physics, Science Park 105, 1098 XG Amsterdam (Netherlands); LION - Leiden Institute of Physics, Leiden University, PO Box 9504, 2300 RA Leiden (Netherlands)
2013-10-11
In 2003, a series of Very Large Volume Neutrino Telescope Workshops (VLVnT) was initiated in Amsterdam, the Netherlands. The 5th workshop in this series took place in Erlangen, Germany, between 12–14 October 2011 and focused on the aspects of high-energy neutrino astronomy. In this summary report, an overview of the activities world-wide is presented as well as the perspectives of the field.
Implementing Keyword and Question Generation Approaches in Teaching EFL Summary Writing
Chou, Mu-hsuan
2012-01-01
Summary writing has been considered an important aspect of academic writing. However, writing summaries can be a challenging task for the majority of English as a Foreign Language (EFL) learners. Research into teaching summary writing has focused on different processes to teach EFL learners. The present study adopted two methods--keyword and…
Long term performance session summary
Energy Technology Data Exchange (ETDEWEB)
Hanauer, S.
1996-05-01
This paper presents brief summaries of reports given on plutonium disposal. Topics include: performance of waste forms; glass leaching; ceramic leaching; safeguards and security issues; safeguards of vitrification; and proliferation risks of geologic disposal.
Czech Academy of Sciences Publication Activity Database
Bahaji, A.; Sanchez-Lopez, A.M.; De Diego, N.; Munoz, F.J.; Humplík, J.F.; Novák, Ondřej; Spíchal, L.; Doležal, K.; Pozueta-Romero, J.
2015-01-01
Roč. 10, č. 3 (2015) E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : ADP-GLUCOSE PYROPHOSPHORYLASE * PENTOSE-PHOSPHATE PATHWAY * POSTTRANSLATIONAL REDOX-MODIFICATION Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.057, year: 2015
Command Leadership DEOCS 4.1 Construct Validity Summary
2017-08-01
Command Leadership DEOCS 4.1 Construct Validity Summary DEFENSE EQUAL OPPORTUNITY MANAGEMENT INSTITUTE...Report #15-18 1 Command Leadership DEOCS 4.1 Construct Validity Summary Background In 2014, DEOMI released DEOCS 4.0 for Department of Defense...individual items on the DEOCS. The following paper details the work conducted to modify the factor of Leadership Cohesion so that it focuses more
Current State of Dental Education: Executive Summary.
Formicola, Allan J
2017-08-01
This executive summary for Section 1 of the "Advancing Dental Education in the 21 st Century" project provides a composite picture of information from 12 background articles on the current state of dental education in the United States. The summary includes the following topics: the current status of the dental curriculum, the implications of student debt and dental school finances, the expansion of enrollment, student diversity, pre- and postdoctoral education, safety net status of dental school clinics, and trends in faculty.
Summary of pre and post-processors for V-TOUGH
International Nuclear Information System (INIS)
Daveler, S.
1995-08-01
This report summaries the preprocessor utility, LMESH and the postprocessor utility, EXTOOL. These utilities support the input file generation and postprocessing analysis for V-TOUGH. LMESH is a mesh generator for V-TOUGH and generates a rectangular or cylindrical mesh in two dimensions. The format for the LMESH summary is a discussion of input options, followed by a sample problem and output from the sample problem. EXTOOL is an analysis tool that extracts, manipulates and plots V-TOUGH output. The format for the EXTOOL summary is a discussion of the development of EXTOOL and an overview of the programs capabilities
SUMMARY (SUMMARY TALK AT THE QUARKONIUM PRODUCTION IN NUCLEAR COLLISIONS WORKSHOP)
International Nuclear Information System (INIS)
KHARZEEV, D.
1998-01-01
This summary is an attempt to overview the wealth of new results and ideas in quarkonium physics presented at the Seattle Workshop. The Workshop in Seattle has shown that the physics of heavy quarkonium continues to develop at a fast pace; moreover, we have every reason to believe that the next year, with RHIC turning on, will mark the beginning of the new exciting era in this field
National Oceanic and Atmospheric Administration, Department of Commerce — This Summary of the Day data file contains daily selected elements of observations recorded by certified observers. The stations were located in the U.S. and were...
Geothermal energy. Program summary
Energy Technology Data Exchange (ETDEWEB)
1979-06-01
Brief descriptions of geothermal projects funded through the Department of Energy during FY 1978 are presented. Each summary gives the project title, contractor name, contract number, funding level, dates, location, and name of the principal investigator, together with project highlights, which provide informaion such as objectives, strategies, and a brief project description. (MHR)
Methods for meta-analysis of multiple traits using GWAS summary statistics.
Ray, Debashree; Boehnke, Michael
2018-03-01
Genome-wide association studies (GWAS) for complex diseases have focused primarily on single-trait analyses for disease status and disease-related quantitative traits. For example, GWAS on risk factors for coronary artery disease analyze genetic associations of plasma lipids such as total cholesterol, LDL-cholesterol, HDL-cholesterol, and triglycerides (TGs) separately. However, traits are often correlated and a joint analysis may yield increased statistical power for association over multiple univariate analyses. Recently several multivariate methods have been proposed that require individual-level data. Here, we develop metaUSAT (where USAT is unified score-based association test), a novel unified association test of a single genetic variant with multiple traits that uses only summary statistics from existing GWAS. Although the existing methods either perform well when most correlated traits are affected by the genetic variant in the same direction or are powerful when only a few of the correlated traits are associated, metaUSAT is designed to be robust to the association structure of correlated traits. metaUSAT does not require individual-level data and can test genetic associations of categorical and/or continuous traits. One can also use metaUSAT to analyze a single trait over multiple studies, appropriately accounting for overlapping samples, if any. metaUSAT provides an approximate asymptotic P-value for association and is computationally efficient for implementation at a genome-wide level. Simulation experiments show that metaUSAT maintains proper type-I error at low error levels. It has similar and sometimes greater power to detect association across a wide array of scenarios compared to existing methods, which are usually powerful for some specific association scenarios only. When applied to plasma lipids summary data from the METSIM and the T2D-GENES studies, metaUSAT detected genome-wide significant loci beyond the ones identified by univariate analyses
International Nuclear Information System (INIS)
1988-01-01
This volume contains conference summaries of the 28. annual conference of the Canadian Nuclear Association, and the 9. annual conference of the Canadian Nuclear Society. Topics of discussion include: power reactors; fuel cycles; nuclear power and public understanding; future trends; applications of nuclear technology; CANDU reactors; operational enhancements; design of small reactors; accident behaviour in fuel channels; fuel storage and waste management; reactor commissioning/decommissioning; nuclear safety experiments and modelling; the next generation reactors; advances in nuclear engineering education in Canada; safety of small reactors; current position and improvements of fuel channels; current issues in nuclear safety; and radiation applications - medical and industrial
International Nuclear Information System (INIS)
Livingston, A.E.
1981-01-01
Experimental studies of the atomic structures of both simple and complex atoms and ions provide crucial tests of atomic structure theory and of calculational techniques for a wide range of atomic systems. This summary is restricted to a brief discussion of some recent and current experiments in few-electron and many-electron atoms and ions which represent exciting challenges to sophisticated atomic structure calculations, discussed elsewhere. In particular the emphasis is on high-Z systems
Directory of Open Access Journals (Sweden)
Robert eGerlai
2016-04-01
Full Text Available Gene targeting with homologous recombination in embryonic stem cells created a revolution in the analysis of the function of genes in behavioral brain research. The technology allowed unprecedented precision with which one could manipulate genes and study the effect of this manipulation on the central nervous system. With gene targeting, the uncertainty inherent in psychopharmacology regarding whether a particular compound would act only through a specific target was removed. Thus, gene targeting became highly popular. However, with this popularity came the realization that like other methods, gene targeting also suffered from some technical and principal problems. For example, two decades ago, issues about compensatory changes and about genetic linkage were raised. Since then, the technology developed, and its utility has been better delineated. This review will discuss the pros and cons of the technique along with these advancements from the perspective of the neuroscientist user. It will also compare and contrast methods that may represent novel alternatives to the homologous recombination based gene targeting approach, including the TALEN and the CRISPR/Cas9 systems. The goal of the review is not to provide detailed recipes, but to attempt to present a short summary of these approaches a behavioral geneticist or neuroscientist may consider for the analysis of brain function and behavior.
Summary and conclusions [Chapter 11
Daniel G. Neary; John N. Rinne; Alvin L.. Medina
2012-01-01
Summaries and conclusions of each chapter are compiled here to provide a âQuick Referenceâ guide of major results and recommendations for the UVR. More detail can be obtained from individual chapters.
17 CFR 229.1001 - (Item 1001) Summary term sheet.
2010-04-01
... sheet that is written in plain English. The summary term sheet must briefly describe in bullet point format the most material terms of the proposed transaction. The summary term sheet must provide security... transaction. The bullet points must cross-reference a more detailed discussion contained in the disclosure...
Gene Expression Profiles of Main Olfactory Epithelium in Adenylyl Cyclase 3 Knockout Mice
Directory of Open Access Journals (Sweden)
Zhenshan Wang
2015-11-01
Full Text Available Adenylyl Cyclase 3 (AC3 plays an important role in the olfactory sensation-signaling pathway in mice. AC3 deficiency leads to defects in olfaction. However, it is still unknown whether AC3 deficiency affects gene expression or olfactory signal transduction pathways within the main olfactory epithelium (MOE. In this study, gene microarrays were used to screen differentially expressed genes in MOE from AC3 knockout (AC3−/− and wild-type (AC3+/+ mice. The differentially expressed genes identified were subjected to bioinformatic analysis and verified by qRT-PCR. Gene expression in the MOE from AC3−/− mice was significantly altered, compared to AC3+/+ mice. Of the 41266 gene probes, 3379 had greater than 2-fold fold change in expression levels between AC3−/− and AC3+/+ mice, accounting for 8% of the total gene probes. Of these genes, 1391 were up regulated, and 1988 were down regulated, including 425 olfactory receptor genes, 99 genes that are specifically expressed in the immature olfactory neurons, 305 genes that are specifically expressed in the mature olfactory neurons, and 155 genes that are involved in epigenetic regulation. Quantitative RT-PCR verification of the differentially expressed epigenetic regulation related genes, olfactory receptors, ion transporter related genes, neuron development and differentiation related genes, lipid metabolism and membrane protein transport etc. related genes showed that P75NTR, Hinfp, Gadd45b, and Tet3 were significantly up-regulated, while Olfr370, Olfr1414, Olfr1208, Golf, Faim2, Tsg101, Mapk10, Actl6b, H2BE, ATF5, Kirrrel2, OMP, Drd2 etc. were significantly down-regulated. In summary, AC3 may play a role in proximal olfactory signaling and play a role in the regulation of differentially expressed genes in mouse MOE.
Time-Course Analysis of Gene Expression During the Saccharomyces cerevisiae Hypoxic Response
Directory of Open Access Journals (Sweden)
Nasrine Bendjilali
2017-01-01
Full Text Available Many cells experience hypoxia, or low oxygen, and respond by dramatically altering gene expression. In the yeast Saccharomyces cerevisiae, genes that respond are required for many oxygen-dependent cellular processes, such as respiration, biosynthesis, and redox regulation. To more fully characterize the global response to hypoxia, we exposed yeast to hypoxic conditions, extracted RNA at different times, and performed RNA sequencing (RNA-seq analysis. Time-course statistical analysis revealed hundreds of genes that changed expression by up to 550-fold. The genes responded with varying kinetics suggesting that multiple regulatory pathways are involved. We identified most known oxygen-regulated genes and also uncovered new regulated genes. Reverse transcription-quantitative PCR (RT-qPCR analysis confirmed that the lysine methyltransferase EFM6 and the recombinase DMC1, both conserved in humans, are indeed oxygen-responsive. Looking more broadly, oxygen-regulated genes participate in expected processes like respiration and lipid metabolism, but also in unexpected processes like amino acid and vitamin metabolism. Using principle component analysis, we discovered that the hypoxic response largely occurs during the first 2 hr and then a new steady-state expression state is achieved. Moreover, we show that the oxygen-dependent genes are not part of the previously described environmental stress response (ESR consisting of genes that respond to diverse types of stress. While hypoxia appears to cause a transient stress, the hypoxic response is mostly characterized by a transition to a new state of gene expression. In summary, our results reveal that hypoxia causes widespread and complex changes in gene expression to prepare the cell to function with little or no oxygen.
Time-Course Analysis of Gene Expression During the Saccharomyces cerevisiae Hypoxic Response.
Bendjilali, Nasrine; MacLeon, Samuel; Kalra, Gurmannat; Willis, Stephen D; Hossian, A K M Nawshad; Avery, Erica; Wojtowicz, Olivia; Hickman, Mark J
2017-01-05
Many cells experience hypoxia, or low oxygen, and respond by dramatically altering gene expression. In the yeast Saccharomyces cerevisiae, genes that respond are required for many oxygen-dependent cellular processes, such as respiration, biosynthesis, and redox regulation. To more fully characterize the global response to hypoxia, we exposed yeast to hypoxic conditions, extracted RNA at different times, and performed RNA sequencing (RNA-seq) analysis. Time-course statistical analysis revealed hundreds of genes that changed expression by up to 550-fold. The genes responded with varying kinetics suggesting that multiple regulatory pathways are involved. We identified most known oxygen-regulated genes and also uncovered new regulated genes. Reverse transcription-quantitative PCR (RT-qPCR) analysis confirmed that the lysine methyltransferase EFM6 and the recombinase DMC1, both conserved in humans, are indeed oxygen-responsive. Looking more broadly, oxygen-regulated genes participate in expected processes like respiration and lipid metabolism, but also in unexpected processes like amino acid and vitamin metabolism. Using principle component analysis, we discovered that the hypoxic response largely occurs during the first 2 hr and then a new steady-state expression state is achieved. Moreover, we show that the oxygen-dependent genes are not part of the previously described environmental stress response (ESR) consisting of genes that respond to diverse types of stress. While hypoxia appears to cause a transient stress, the hypoxic response is mostly characterized by a transition to a new state of gene expression. In summary, our results reveal that hypoxia causes widespread and complex changes in gene expression to prepare the cell to function with little or no oxygen. Copyright © 2017 Bendjilali et al.
Summary of Notifiable Infectious Diseases and Conditions - United States, 2015.
Adams, Deborah A; Thomas, Kimberly R; Jajosky, Ruth Ann; Foster, Loretta; Baroi, Gitangali; Sharp, Pearl; Onweh, Diana H; Schley, Alan W; Anderson, Willie J
2017-08-11
The Summary of Notifiable Infectious Diseases and Conditions - United States, 2015 (hereafter referred to as the summary) contains the official statistics, in tabular and graphical form, for the reported occurrence of nationally notifiable infectious diseases and conditions in the United States for 2015. Unless otherwise noted, data are final totals for 2015 reported as of June 30, 2016. These statistics are collected and compiled from reports sent by U.S. state and territories, New York City, and District of Columbia health departments to the National Notifiable Diseases Surveillance System (NNDSS), which is operated by CDC in collaboration with the Council of State and Territorial Epidemiologists (CSTE). This summary is available at https://www.cdc.gov/MMWR/MMWR_nd/index.html. This site also includes summary publications from previous years.
Summary of Notifiable Infectious Diseases and Conditions - United States, 2013.
Adams, Deborah; Fullerton, Kathleen; Jajosky, Ruth; Sharp, Pearl; Onweh, Diana; Schley, Alan; Anderson, Willie; Faulkner, Amanda; Kugeler, Kiersten
2015-10-23
The Summary of Notifiable Infectious Diseases and Condition-United States, 2013 (hereafter referred to as the summary) contains the official statistics, in tabular and graphic form, for the reported occurrence of nationally notifiable infectious diseases and conditions in the United States for 2013. Unless otherwise noted, data are final totals for 2013 reported as of June 30, 2014. These statistics are collected and compiled from reports sent by U.S. state and territory, New York City, and District of Columbia health departments to the National Notifiable Diseases Surveillance System (NNDSS), which is operated by CDC in collaboration with the Council of State and Territorial Epidemiologists (CSTE). This summary is available at http://www.cdc.gov/mmwr/mmwr_nd/index.html. This site also includes summary publications from previous years.
Nevada Test Site Environmental Report 2007 Summary
Energy Technology Data Exchange (ETDEWEB)
Cathy Wills
2008-09-01
The U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office (NNSA/NSO) directs the management and operation of the Nevada Test Site (NTS). The NTS is the nation's historical testing site for nuclear weapons from 1951 through 1992 and is currently the nation's unique site for ongoing national-security related missions and high-risk operations. NNSA/NSO strives to provide to the public an understanding of the current activities on the NTS, including environmental monitoring and compliance activities aimed at protecting the public and the environment from radiation hazards and from nonradiological impacts. This document is a summary of the Nevada Test Site Environmental Report (NTSER) for calendar year 2007 (see attached compact disc on inside back cover). The NTSER is a comprehensive report of environmental activities performed at the NTS and offsite facilities over the previous calendar year. It is prepared annually to meet the requirements and guidelines of the U.S. Department of Energy (DOE) and the information needs of NNSA/NSO stakeholders. To provide an abbreviated and more readable version of the NTSER, this summary report is produced. This summary does not include detailed data tables, monitoring methods or design, a description of the NTS environment, or a discussion of all environmental program activities performed throughout the year. The reader may obtain a hard copy of the full NTSER as directed on the inside front cover of this summary report.
Peripheral blood gene expression as a novel genomic biomarker in complicated sarcoidosis.
Directory of Open Access Journals (Sweden)
Tong Zhou
Full Text Available Sarcoidosis, a systemic granulomatous syndrome invariably affecting the lung, typically spontaneously remits but in ~20% of cases progresses with severe lung dysfunction or cardiac and neurologic involvement (complicated sarcoidosis. Unfortunately, current biomarkers fail to distinguish patients with remitting (uncomplicated sarcoidosis from other fibrotic lung disorders, and fail to identify individuals at risk for complicated sarcoidosis. We utilized genome-wide peripheral blood gene expression analysis to identify a 20-gene sarcoidosis biomarker signature distinguishing sarcoidosis (n = 39 from healthy controls (n = 35, 86% classification accuracy and which served as a molecular signature for complicated sarcoidosis (n = 17. As aberrancies in T cell receptor (TCR signaling, JAK-STAT (JS signaling, and cytokine-cytokine receptor (CCR signaling are implicated in sarcoidosis pathogenesis, a 31-gene signature comprised of T cell signaling pathway genes associated with sarcoidosis (TCR/JS/CCR was compared to the unbiased 20-gene biomarker signature but proved inferior in prediction accuracy in distinguishing complicated from uncomplicated sarcoidosis. Additional validation strategies included significant association of single nucleotide polymorphisms (SNPs in signature genes with sarcoidosis susceptibility and severity (unbiased signature genes - CX3CR1, FKBP1A, NOG, RBM12B, SENS3, TSHZ2; T cell/JAK-STAT pathway genes such as AKT3, CBLB, DLG1, IFNG, IL2RA, IL7R, ITK, JUN, MALT1, NFATC2, PLCG1, SPRED1. In summary, this validated peripheral blood molecular gene signature appears to be a valuable biomarker in identifying cases with sarcoidoisis and predicting risk for complicated sarcoidosis.
Accelerator technology working group summary
International Nuclear Information System (INIS)
Jameson, R.A.
1985-01-01
A summary is presented of workshop deliberations on basic scaling, the economic viability of laser drive power for HEP accelerators, the availability of electron beam injectors for near-term experiments, and a few very general remarks on technology issues
Summaries and future projections
International Nuclear Information System (INIS)
Egelstaff, P.A.
1989-01-01
In this paper the author gives a brief summary of this meeting. He discusses the status at the current neutron sources and future sources. The current problems with targets, moderators, performance of storage rings and shields are briefly mentioned. Finally, he speculates on the prospects of neutron sources for the future and gives his version of the ultimate source
Summary of Waste Calcination at INTEC
Energy Technology Data Exchange (ETDEWEB)
O' Brien, Barry Henry; Newby, Bill Joe
2000-10-01
Fluidized-bed calcination at the Idaho Nuclear Technologies and Engineering Center (INTEC, formally called the Idaho Chemical Processing Plant) has been used to solidify acidic metal nitrate fuel reprocessing and incidental wastes wastes since 1961. A summary of waste calcination in full-scale and pilot plant calciners has been compiled for future reference. It contains feed compositions and operating conditions for all the processing campaigns for the original Waste Calcining Facility (WCF), the New Waste Calcining Facility (NWCF) started up in 1982, and numerous small scale pilot plant tests for various feed types. This summary provides a historical record of calcination at INTEC, and will be useful for evaluating calcinability of future wastes.
Ansback AHP, Germany Limited Surface Observations Climatic Summary (LISOCS).
1984-09-01
AL ., I V PSYCHROMETRIC SUMMARY ra ,. , a’ . .. MIT BULB TEMPERATURE DEPRESION (P) TOTAL TOTAL C 2,3 4 7 1 9.10 It 1213 14 15 16 17-1619 20*21 22 23...lt* a~ 4 * 4* 1lcl3 *,~ i, - . . . . . . ... . .... ... . .. . . * : .. .. . .... T "PSYCHROMETRIC SUMMARY - - ., WIT IUL$ ’IMPIIATUIE DEPRESION (F
Bayesian Modeling of MPSS Data: Gene Expression Analysis of Bovine Salmonella Infection
Dhavala, Soma S.
2010-09-01
Massively Parallel Signature Sequencing (MPSS) is a high-throughput, counting-based technology available for gene expression profiling. It produces output that is similar to Serial Analysis of Gene Expression and is ideal for building complex relational databases for gene expression. Our goal is to compare the in vivo global gene expression profiles of tissues infected with different strains of Salmonella obtained using the MPSS technology. In this article, we develop an exact ANOVA type model for this count data using a zero-inflatedPoisson distribution, different from existing methods that assume continuous densities. We adopt two Bayesian hierarchical models-one parametric and the other semiparametric with a Dirichlet process prior that has the ability to "borrow strength" across related signatures, where a signature is a specific arrangement of the nucleotides, usually 16-21 base pairs long. We utilize the discreteness of Dirichlet process prior to cluster signatures that exhibit similar differential expression profiles. Tests for differential expression are carried out using nonparametric approaches, while controlling the false discovery rate. We identify several differentially expressed genes that have important biological significance and conclude with a summary of the biological discoveries. This article has supplementary materials online. © 2010 American Statistical Association.
Bayesian Modeling of MPSS Data: Gene Expression Analysis of Bovine Salmonella Infection
Dhavala, Soma S.; Datta, Sujay; Mallick, Bani K.; Carroll, Raymond J.; Khare, Sangeeta; Lawhon, Sara D.; Adams, L. Garry
2010-01-01
Massively Parallel Signature Sequencing (MPSS) is a high-throughput, counting-based technology available for gene expression profiling. It produces output that is similar to Serial Analysis of Gene Expression and is ideal for building complex relational databases for gene expression. Our goal is to compare the in vivo global gene expression profiles of tissues infected with different strains of Salmonella obtained using the MPSS technology. In this article, we develop an exact ANOVA type model for this count data using a zero-inflatedPoisson distribution, different from existing methods that assume continuous densities. We adopt two Bayesian hierarchical models-one parametric and the other semiparametric with a Dirichlet process prior that has the ability to "borrow strength" across related signatures, where a signature is a specific arrangement of the nucleotides, usually 16-21 base pairs long. We utilize the discreteness of Dirichlet process prior to cluster signatures that exhibit similar differential expression profiles. Tests for differential expression are carried out using nonparametric approaches, while controlling the false discovery rate. We identify several differentially expressed genes that have important biological significance and conclude with a summary of the biological discoveries. This article has supplementary materials online. © 2010 American Statistical Association.
Chin, Young-Wook; Seo, Nari; Kim, Jae-Han; Seo, Jin-Ho
2016-11-01
2'-Fucosyllactose (2-FL) is one of the key oligosaccharides in human milk. In the present study, the salvage guanosine 5'-diphosphate (GDP)-l-fucose biosynthetic pathway from fucose was employed in engineered Escherichia coli BL21star(DE3) for efficient production of 2-FL. Introduction of the fkp gene coding for fucokinase/GDP-l-fucose pyrophosphorylase (Fkp) from Bacteroides fragilis and the fucT2 gene encoding α-1,2-fucosyltransferase from Helicobacter pylori allows the engineered E. coli to produce 2-FL from fucose, lactose and glycerol. To enhance the lactose flux to 2-FL production, the attenuated, and deleted mutants of β-galactosidase were employed. Moreover, the 2-FL yield and productivity were further improved by deletion of the fucI-fucK gene cluster coding for fucose isomerase (FucI) and fuculose kinase (FucK). Finally, fed-batch fermentation of engineered E. coli BL21star(DE3) deleting lacZ and fucI-fucK, and expressing fkp and fucT2 resulted in 23.1 g/L of extracellular concentration of 2-FL and 0.39 g/L/h productivity. Biotechnol. Bioeng. 2016;113: 2443-2452. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Genetic variation of clock genes and cancer risk: a field synopsis and meta-analysis.
Benna, Clara; Helfrich-Förster, Charlotte; Rajendran, Senthilkumar; Monticelli, Halenya; Pilati, Pierluigi; Nitti, Donato; Mocellin, Simone
2017-04-04
The number of studies on the association between clock genes' polymorphisms and cancer susceptibility has increased over the last years but the results are often conflicting and no comprehensive overview and quantitative summary of the evidence in this field is available. Literature search identified 27 eligible studies comprising 96756 subjects (cases: 38231) and investigating 687 polymorphisms involving 14 clock genes. Overall, 1025 primary and subgroup meta-analyses on 366 gene variants were performed. Study distribution by tumor was as follows: breast cancer (n=15), prostate cancer (n=3), pancreatic cancer (n=2), non-Hodgkin's lymphoma (n=2), glioma (n=1), chronic lymphocytic leukemia (n=1), colorectal cancer (n=1), non-small cell lung cancer (n=1) and ovarian cancer (n=1).We identified 10 single nucleotide polymorphisms (SNPs) significantly associated with cancer risk: NPAS2 rs10165970 (mixed and breast cancer shiftworkers), rs895520 (mixed), rs17024869 (breast) and rs7581886 (breast); CLOCK rs3749474 (breast) and rs11943456 (breast); RORA rs7164773 (breast and breast cancer postmenopausal), rs10519097 (breast); RORB rs7867494 (breast cancer postmenopausal), PER3 rs1012477 (breast cancer subgroups) and assessed the level of quality evidence to be intermediate. We also identified polymorphisms with lower quality statistically significant associations (n=30). Our work supports the hypothesis that genetic variation of clock genes might affect cancer risk. These findings also highlight the need for more efforts in this research field in order to fully establish the contribution of clock gene variants to the risk of developing cancer. We conducted a systematic review and meta-analysis of the evidence on the association between clock genes' germline variants and the risk of developing cancer. To assess result credibility, summary evidence was graded according to the Venice criteria and false positive report probability (FPRP) was calculated to further validate
Facilitating the Information Exchange Using a Modular Electronic Discharge Summary.
Denecke, Kerstin; Dittli, Pascal A; Kanagarasa, Niveadha; Nüssli, Stephan
2018-01-01
Discharge summaries are a standard communication tool delivering important clinical information from inpatient to ambulatory care. To ensure a high quality, correctness and completeness, the generation process is time consuming. It requires also contributions of multiple persons. This is problematic since the primary care provider needs the information from the discharge summary for continuing the intended treatment. To address this challenge, we developed a concept for exchanging a modular electronic discharge summary. Through a literature review and interviews with multiple stakeholders, we analysed existing processes and derived requirements for an improved communication of the discharge summary. In this paper, we suggest a concept of a modular electronic discharge summary that is exchanged through the electronic patient dossier in CDA CH level 2 documents. Until 2020, all Swiss hospitals are obliged to connect to the electronic patient dossier. Our concept allows to access already completed modules of the discharge summary from the primary care side, before the entire report is entirely finalised. The data is automatically merged with the local patient record on the physician side and prepared for data integration into the practice information system. Our concept offers the opportunity not only to improve the information exchange between hospital and primary care, but it also provides a potential use case and demonstrates a benefit of the electronic patient dossier for primary care providers who are so far not obliged to connect to the patient dossier in Switzerland.
Comparison of Brief Summary Formats Through a Health Literacy Lens.
Sharp, Michele L; Hall, Lori; Eleftherion, Anthony; Simpson, Katherine; Neuhauser, Linda
2018-01-01
Print pharmaceutical advertisements in the United States require inclusion of a brief summary of side effects, warnings, precautions, and contraindications from the labeling. The full package insert, which sponsors have traditionally used to fulfill the brief summary requirement, does not adhere to health literacy best practices, limiting its value to consumers. This study compared the understandability and usability of brief summaries in 3 formats designed to be more consumer friendly. Three brief summary formats were tested: (1) 2-column "Question and Answer"; (2) "Prescription Drug Facts Box," similar to current US over-the-counter drug facts labeling; and (3) "Health Literacy," based on clear communication principles. Researchers evaluated the formats using the Suitability Assessment of Materials (SAM) tool and conducted structured, scripted, one-on-one interviews (usability tests) with participants with estimated low to average education levels. This research was replicated across 2 therapeutic areas (type 2 diabetes and plaque psoriasis). SAM scores showed that the Health Literacy format outperformed the Question and Answer format and the Prescription Drug Facts Box format in both therapeutic areas, with both Health Literacy brief summaries rated on the SAM as "superior." Qualitative usability tests supported the SAM findings, with the Health Literacy format preferred consistently over the Question and Answer format, and more often than not over the Prescription Drug Facts Box format. Sponsors can employ a user-tested Health Literacy format to improve the understandability and usability of brief summaries with patients.
27 CFR 555.127 - Daily summary of magazine transactions.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Daily summary of magazine....127 Daily summary of magazine transactions. In taking the inventory required by §§ 555.122, 555.123... transactions to be kept at each magazine of an approved storage facility; however, these records may be kept at...
Watson, Emma; MacNeil, Lesley T.; Ritter, Ashlyn D.; Yilmaz, L. Safak; Rosebrock, Adam P.; Caudy, Amy A.; Walhout, Albertha J. M.
2014-01-01
SUMMARY Diet greatly influences gene expression and physiology. In mammals, elucidating the effects and mechanisms of individual nutrients is challenging due to the complexity of both the animal and its diet. Here we used an interspecies systems biology approach with Caenorhabditis elegans and two if its bacterial diets, Escherichia coli and Comamonas aquatica, to identify metabolites that affect the animal’s gene expression and physiology. We identify vitamin B12 as the major dilutable metabolite provided by Comamonas aq. that regulates gene expression, accelerates development and reduces fertility, but does not affect lifespan. We find that vitamin B12 has a dual role in the animal: it affects development and fertility via the methionine/S-Adenosylmethionine (SAM) cycle and breaks down the short-chain fatty acid propionic acid preventing its toxic buildup. Our interspecies systems biology approach provides a paradigm for understanding complex interactions between diet and physiology. PMID:24529378
Continuum of eLearning: 2012 Project Summary Report
2012-10-01
multimedia, and Continuum of eLearning | Purpose and Vision 19 << UNCLASSIFIED>> (limited) situated learning. Future versions of the CoL self-paced...Continuum of eLearning : 2012 Project Summary Report Continuum of eLearning The Next Evolution of Joint Training on JKO October 2012 Joint...Technical Report November 2011 – August 2012 Continuum of eLearning : 2012 Project Summary Report N00140-06-D-0060 David T. Fautua, Sae Schatz, Andrea
Summary Staging Manual 2000 - SEER
Access this manual of codes and coding instructions for the summary stage field for cases diagnosed 2001-2017. 2000 version applies to every anatomic site. It uses all information in the medical record. Also called General Staging, California Staging, and SEER Staging.
Energy Technology Data Exchange (ETDEWEB)
Halsnaes, K.; Painuly, J.P.; Turkson, J.; Meyer, H.J.; Markandya, A.
1999-09-01
This document is a summary version of the methodological guidelines for climate change mitigation assessment developed as part of the Global Environment Facility (GEF) project Economics of Greenhouse Gas Limitations; Methodological Guidelines. The objectives of this project have been to develop a methodology, an implementing framework and a reporting system which countries can use in the construction of national climate change mitigation policies and in meeting their future reporting obligations under the FCCC. The methodological framework developed in the Methodological Guidelines covers key economic concepts, scenario building, modelling tools and common assumptions. It was used by several country studies included in the project. (au) 13 refs.
Well data summary sheets. Vol. 33: North sea wells
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-31
This 33rd volume of the `Well Data Summary sheets` includes data from seven recently released offshore wells from the North Sea. The wells Baron-2, S.E. Adda-1 and Skjold Flank-1 were presented in our `Well Data Summary Sheets, special volume`, published May 1, 1997. In volume 33, the wells Baron-2 and Skjold Flank-1 are updated with respect to information on sidewall cores. Information regarding all released well data, included in our well data summary sheets, are available on GEUS homepage: http://www.geus.dk/ or the departments homepage: http://www.geus.dk/departments/geol-info-data-centre/geoldata.htm/. A complete index of releases wells in volumes 17-33 is included. (au)
Visualizing Summary Statistics and Uncertainty
Potter, K.; Kniss, J.; Riesenfeld, R.; Johnson, C.R.
2010-01-01
The graphical depiction of uncertainty information is emerging as a problem of great importance. Scientific data sets are not considered complete without indications of error, accuracy, or levels of confidence. The visual portrayal of this information is a challenging task. This work takes inspiration from graphical data analysis to create visual representations that show not only the data value, but also important characteristics of the data including uncertainty. The canonical box plot is reexamined and a new hybrid summary plot is presented that incorporates a collection of descriptive statistics to highlight salient features of the data. Additionally, we present an extension of the summary plot to two dimensional distributions. Finally, a use-case of these new plots is presented, demonstrating their ability to present high-level overviews as well as detailed insight into the salient features of the underlying data distribution. © 2010 The Eurographics Association and Blackwell Publishing Ltd.
Visualizing Summary Statistics and Uncertainty
Potter, K.
2010-08-12
The graphical depiction of uncertainty information is emerging as a problem of great importance. Scientific data sets are not considered complete without indications of error, accuracy, or levels of confidence. The visual portrayal of this information is a challenging task. This work takes inspiration from graphical data analysis to create visual representations that show not only the data value, but also important characteristics of the data including uncertainty. The canonical box plot is reexamined and a new hybrid summary plot is presented that incorporates a collection of descriptive statistics to highlight salient features of the data. Additionally, we present an extension of the summary plot to two dimensional distributions. Finally, a use-case of these new plots is presented, demonstrating their ability to present high-level overviews as well as detailed insight into the salient features of the underlying data distribution. © 2010 The Eurographics Association and Blackwell Publishing Ltd.
International conference on spin observables of nuclear probes: Summary talk
International Nuclear Information System (INIS)
Garvey, G.T.
1988-01-01
A selected summary of the presentation and discussions at the 4th Telluride Conference is presented. The summary deals mainly with the effects of nuclear spin and isospin on the interaction between nucleons and their consequences in nuclear structure. 11 figs
NASA GeneLab Project: Bridging Space Radiation Omics with Ground Studies.
Beheshti, Afshin; Miller, Jack; Kidane, Yared; Berrios, Daniel; Gebre, Samrawit G; Costes, Sylvain V
2018-04-13
Accurate assessment of risks of long-term space missions is critical for human space exploration. It is essential to have a detailed understanding of the biological effects on humans living and working in deep space. Ionizing radiation from galactic cosmic rays (GCR) is a major health risk factor for astronauts on extended missions outside the protective effects of the Earth's magnetic field. Currently, there are gaps in our knowledge of the health risks associated with chronic low-dose, low-dose-rate ionizing radiation, specifically ions associated with high (H) atomic number (Z) and energy (E). The NASA GeneLab project ( https://genelab.nasa.gov/ ) aims to provide a detailed library of omics datasets associated with biological samples exposed to HZE. The GeneLab Data System (GLDS) includes datasets from both spaceflight and ground-based studies, a majority of which involve exposure to ionizing radiation. In addition to detailed information on radiation exposure for ground-based studies, GeneLab is adding detailed, curated dosimetry information for spaceflight experiments. GeneLab is the first comprehensive omics database for space-related research from which an investigator can generate hypotheses to direct future experiments, utilizing both ground and space biological radiation data. The GLDS is continually expanding as omics-related data are generated by the space life sciences community. Here we provide a brief summary of the space radiation-related data available at GeneLab.
Frasson, Amanda Piccoli; Dos Santos, Odelta; Meirelles, Lúcia Collares; Macedo, Alexandre José; Tasca, Tiana
2016-01-01
Trichomonas vaginalis is a protozoan that parasitizes the human urogenital tract causing trichomoniasis, the most common non-viral sexually transmitted disease. The parasite has unique genomic characteristics such as a large genome size and expanded gene families. Ectonucleoside triphosphate diphosphohydrolase (E-NTPDase) is an enzyme responsible for hydrolyzing nucleoside tri- and diphosphates and has already been biochemically characterized in T. vaginalis. Considering the important role of this enzyme in the production of extracellular adenosine for parasite uptake, we evaluated the gene expression of five putative NTPDases in T. vaginalis. We showed that all five putative TvNTPDase genes (TvNTPDase1-5) were expressed by both fresh clinical and long-term grown isolates. The amino acid alignment predicted the presence of the five crucial apyrase conserved regions, transmembrane domains, signal peptides, phosphorylation and catalytic sites. Moreover, a phylogenetic analysis showed that TvNTPDase sequences make up a clade with NTPDases intracellularly located. Biochemical NTPDase activity (ATP and ADP hydrolysis) is responsive to the serum-restrictive conditions and the gene expression of TvNTPDases was mostly increased, mainly TvNTPDase2 and TvNTPDase4, although there was not a clear pattern of expression among them. In summary, the present report demonstrates the gene expression patterns of predicted NTPDases in T. vaginalis. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Phylogenetic analysis of the expansion of the MATH-BTB gene family in the grasses.
Juranić, Martina; Dresselhaus, Thomas
2014-01-01
MATH-BTB proteins are known to act as substrate-specific adaptors of cullin3 (CUL3)-based ubiquitin E3 ligases to target protein for ubiquitination. In a previous study we reported the presence of 31 MATH-BTB genes in the maize genome and determined the regulatory role of the MATH-BTB protein MAB1 during meiosis to mitosis transition. In contrast to maize, there are only 6 homologous genes in the model plant Arabidopsis, while this family has largely expanded in grasses. Here, we report a phylogenetic analysis of the MATH-BTB gene family in 9 land plant species including various mosses, eudicots, and grasses. We extend a previous classification of the plant MATH-BTB family and additionally arrange the expanded group into 5 grass-specific clades. Synteny studies indicate that expansion occurred to a large extent due to local gene duplications. Expression studies of 3 closely related MATH-BTB genes in maize (MAB1-3) indicate highly specific expression pattern. In summary, this work provides a solid base for further studies comparing genetic and functional information of the MATH-BTB family especially in the grasses.
Directory of Open Access Journals (Sweden)
Dunja Knapp
Full Text Available Understanding how the limb blastema is established after the initial wound healing response is an important aspect of regeneration research. Here we performed parallel expression profile time courses of healing lateral wounds versus amputated limbs in axolotl. This comparison between wound healing and regeneration allowed us to identify amputation-specific genes. By clustering the expression profiles of these samples, we could detect three distinguishable phases of gene expression - early wound healing followed by a transition-phase leading to establishment of the limb development program, which correspond to the three phases of limb regeneration that had been defined by morphological criteria. By focusing on the transition-phase, we identified 93 strictly amputation-associated genes many of which are implicated in oxidative-stress response, chromatin modification, epithelial development or limb development. We further classified the genes based on whether they were or were not significantly expressed in the developing limb bud. The specific localization of 53 selected candidates within the blastema was investigated by in situ hybridization. In summary, we identified a set of genes that are expressed specifically during regeneration and are therefore, likely candidates for the regulation of blastema formation.
Hunter, James; Freer, Yvonne; Gatt, Albert; Reiter, Ehud; Sripada, Somayajulu; Sykes, Cindy; Westwater, Dave
2011-01-01
The BT-Nurse system uses data-to-text technology to automatically generate a natural language nursing shift summary in a neonatal intensive care unit (NICU). The summary is solely based on data held in an electronic patient record system, no additional data-entry is required. BT-Nurse was tested for two months in the Royal Infirmary of Edinburgh NICU. Nurses were asked to rate the understandability, accuracy, and helpfulness of the computer-generated summaries; they were also asked for free-text comments about the summaries. The nurses found the majority of the summaries to be understandable, accurate, and helpful (pgenerated summaries. In conclusion, natural language NICU shift summaries can be automatically generated from an electronic patient record, but our proof-of-concept software needs considerable additional development work before it can be deployed.
Summary of ENDF/B Pre-Processing Codes June 1983
International Nuclear Information System (INIS)
Cullen, D.E.
1983-06-01
This is the summary documentation for the 1983 version of the ENDF/B Pre-Processing Codes LINEAR, RECENT, SIGMA1, GROUPIE, EVALPLOT, MERGER, DICTION, COMPLOT, CONVERT. This summary documentation is merely a copy of the comment cards that appear at the beginning of each programme; these comment cards always reflect the latest status of input options, etc
fRNAdb Summary - fRNAdb | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available citation, etc. Data file File name: frnadb_summary.zip File URL: ftp://ftp.biosc...iencedbc.jp/archive/frnadb/LATEST/frnadb_summary.zip File size: 46.5 MB Simple search URL http://togodb.bios...ciencedbc.jp/togodb/view/frnadb_summary#en Data acquisition method Main RNA information was acquired from jo
Apolipoprotein A5: A newly identified gene impacting plasmatriglyceride levels in humans and mice
Energy Technology Data Exchange (ETDEWEB)
Pennacchio, Len A.; Rubin, Edward M.
2002-09-15
Apolipoprotein A5 (APOA5) is a newly described member of theapolipoprotein gene family whose initial discovery arose from comparativesequence analysis of the mammalian APOA1/C3/A4 gene cluster. Functionalstudies in mice indicated that alteration in the level of APOA5significantly impacted plasma triglyceride concentrations. Miceover-expressing human APOA5 displayed significantly reducedtriglycerides, while mice lacking apoA5 had a large increase in thislipid parameter. Studies in humans have also suggested an important rolefor APOA5 in determining plasma triglyceride concentrations. In theseexperiments, polymorphisms in the human gene were found to define severalcommon haplotypes that were associated with significant changes intriglyceride concentrations in multiple populations. Several separateclinical studies have provided consistent and strong support for theeffect with 24 percent of Caucasians, 35 percent of African-Americans and53 percent of Hispanics carrying APOA5 haplotypes associated withincreased plasma triglyceride levels. In summary, APOA5 represents anewly discovered gene involved in triglyceride metabolism in both humansand mice whose mechanism of action remains to be deciphered.
Identification of pathogenicity‐related genes in Fusarium oxysporum f. sp. cepae
Vágány, Viktória; Jackson, Alison C.; Harrison, Richard J.; Rainoni, Alessandro; Clarkson, John P.
2016-01-01
Summary Pathogenic isolates of Fusarium oxysporum, distinguished as formae speciales (f. spp.) on the basis of their host specificity, cause crown rots, root rots and vascular wilts on many important crops worldwide. Fusarium oxysporum f. sp. cepae (FOC) is particularly problematic to onion growers worldwide and is increasing in prevalence in the UK. We characterized 31 F. oxysporum isolates collected from UK onions using pathogenicity tests, sequencing of housekeeping genes and identification of effectors. In onion seedling and bulb tests, 21 isolates were pathogenic and 10 were non‐pathogenic. The molecular characterization of these isolates, and 21 additional isolates comprising other f. spp. and different Fusarium species, was carried out by sequencing three housekeeping genes. A concatenated tree separated the F. oxysporum isolates into six clades, but did not distinguish between pathogenic and non‐pathogenic isolates. Ten putative effectors were identified within FOC, including seven Secreted In Xylem (SIX) genes first reported in F. oxysporum f. sp. lycopersici. Two highly homologous proteins with signal peptides and RxLR motifs (CRX1/CRX2) and a gene with no previously characterized domains (C5) were also identified. The presence/absence of nine of these genes was strongly related to pathogenicity against onion and all were shown to be expressed in planta. Different SIX gene complements were identified in other f. spp., but none were identified in three other Fusarium species from onion. Although the FOC SIX genes had a high level of homology with other f. spp., there were clear differences in sequences which were unique to FOC, whereas CRX1 and C5 genes appear to be largely FOC specific. PMID:26609905
SCOPING SUMMARY FOR THE P-AREA OPERABLE UNIT
International Nuclear Information System (INIS)
Kupar, J; Sadika Baladi, S; Mark Amidon, M
2007-01-01
This scoping summary supports development of the combined Remedial Investigation (RI)/Baseline Risk Assessment (BRA)/Feasibility Study (FS) for the P-Area Operable Unit (PAOU), or Combined document, which will be submitted on or before 09/28/2007. The objective of this Feasibility Study scoping summary meeting is to agree on the likely response actions to be evaluated and developed as alternatives in the combined document and agree on the uncertainties identified and whether they have been adequately managed
SCOPING SUMMARY FOR THE P-AREA OPERABLE UNIT
Energy Technology Data Exchange (ETDEWEB)
Kupar, J; Sadika Baladi, S; Mark Amidon, M
2007-05-22
This scoping summary supports development of the combined Remedial Investigation (RI)/Baseline Risk Assessment (BRA)/Feasibility Study (FS) for the P-Area Operable Unit (PAOU), or Combined document, which will be submitted on or before 09/28/2007. The objective of this Feasibility Study scoping summary meeting is to agree on the likely response actions to be evaluated and developed as alternatives in the combined document and agree on the uncertainties identified and whether they have been adequately managed.
Livermore Big Trees Park: 1998 summary results; TOPICAL
International Nuclear Information System (INIS)
Gallegos, G; MacQueen, D; Surano, K
1999-01-01
This report summarizes work conducted in 1998 by the Lawrence Livermore National Laboratory (LLNL) to determine the extent and origin of plutonium at concentrations above background levels at Big Trees Park in the city of Livermore. This summary includes the project background and sections that explain the sampling, radiochemical and data analysis, and data interpretation. This report is a summary report only and is not intended as a rigorous technical or statistical analysis of the data
Gu, Fangyi; Zhang, Han; Hyland, Paula L; Berndt, Sonja; Gapstur, Susan M; Wheeler, William; Ellipse Consortium, The; Amos, Christopher I; Bezieau, Stephane; Bickeböller, Heike; Brenner, Hermann; Brennan, Paul; Chang-Claude, Jenny; Conti, David V; Doherty, Jennifer Anne; Gruber, Stephen B; Harrison, Tabitha A; Hayes, Richard B; Hoffmeister, Michael; Houlston, Richard S; Hung, Rayjean J; Jenkins, Mark A; Kraft, Peter; Lawrenson, Kate; McKay, James; Markt, Sarah; Mucci, Lorelei; Phelan, Catherine M; Qu, Conghui; Risch, Angela; Rossing, Mary Anne; Wichmann, H-Erich; Shi, Jianxin; Schernhammer, Eva; Yu, Kai; Landi, Maria Teresa; Caporaso, Neil E
2017-11-01
Circadian disruption has been linked to carcinogenesis in animal models, but the evidence in humans is inconclusive. Genetic variation in circadian rhythm genes provides a tool to investigate such associations. We examined associations of genetic variation in nine core circadian rhythm genes and six melatonin pathway genes with risk of colorectal, lung, ovarian and prostate cancers using data from the Genetic Associations and Mechanisms in Oncology (GAME-ON) network. The major results for prostate cancer were replicated in the Prostate, Lung, Colorectal and Ovarian (PLCO) cancer screening trial, and for colorectal cancer in the Genetics and Epidemiology of Colorectal Cancer Consortium (GECCO). The total number of cancer cases and controls was 15,838/18,159 for colorectal, 14,818/14,227 for prostate, 12,537/17,285 for lung and 4,369/9,123 for ovary. For each cancer site, we conducted gene-based and pathway-based analyses by applying the summary-based Adaptive Rank Truncated Product method (sARTP) on the summary association statistics for each SNP within the candidate gene regions. Aggregate genetic variation in circadian rhythm and melatonin pathways were significantly associated with the risk of prostate cancer in data combining GAME-ON and PLCO, after Bonferroni correction (p pathway circadian rhythm pathway in GAME-ON (p pathway = 0.021); this association was not confirmed in GECCO (p pathway = 0.76) or the combined data (p pathway = 0.17). No significant association was observed for ovarian and lung cancer. These findings support a potential role for circadian rhythm and melatonin pathways in prostate carcinogenesis. Further functional studies are needed to better understand the underlying biologic mechanisms. © 2017 UICC.
Training Activity Summary Page (TASP) Campus
U.S. Department of Health & Human Services — The Training Activity Summary Page (formerly the Training Exit Survey Cover Page) dataset contains data about each training event. This dataset includes information...
SPS Abundance - Salmon Population Summary Database
National Oceanic and Atmospheric Administration, Department of Commerce — The data contained in the SPS database are primarily summary data, compiled at the population level and available through the SPS website...
Towards precise classification of cancers based on robust gene functional expression profiles
Directory of Open Access Journals (Sweden)
Zhu Jing
2005-03-01
Full Text Available Abstract Background Development of robust and efficient methods for analyzing and interpreting high dimension gene expression profiles continues to be a focus in computational biology. The accumulated experiment evidence supports the assumption that genes express and perform their functions in modular fashions in cells. Therefore, there is an open space for development of the timely and relevant computational algorithms that use robust functional expression profiles towards precise classification of complex human diseases at the modular level. Results Inspired by the insight that genes act as a module to carry out a highly integrated cellular function, we thus define a low dimension functional expression profile for data reduction. After annotating each individual gene to functional categories defined in a proper gene function classification system such as Gene Ontology applied in this study, we identify those functional categories enriched with differentially expressed genes. For each functional category or functional module, we compute a summary measure (s for the raw expression values of the annotated genes to capture the overall activity level of the module. In this way, we can treat the gene expressions within a functional module as an integrative data point to replace the multiple values of individual genes. We compare the classification performance of decision trees based on functional expression profiles with the conventional gene expression profiles using four publicly available datasets, which indicates that precise classification of tumour types and improved interpretation can be achieved with the reduced functional expression profiles. Conclusion This modular approach is demonstrated to be a powerful alternative approach to analyzing high dimension microarray data and is robust to high measurement noise and intrinsic biological variance inherent in microarray data. Furthermore, efficient integration with current biological knowledge
Directory of Open Access Journals (Sweden)
Schirmacher Peter
2008-09-01
Full Text Available Abstract Background Invasion-related genes over-expressed by tumor cells as well as by reacting host cells represent promising drug targets for anti-cancer therapy. Such candidate genes need to be validated in appropriate animal models. Results This study examined the suitability of a murine model (CT26/Balb/C of colorectal liver metastasis to represent clinical liver metastasis specimens using a global gene expression approach. Cross-species similarity was examined between pure liver, liver invasion, tumor invasion and pure tumor compartments through overlap of up-regulated genes and gene ontology (GO-based biological themes on the level of single GO-terms and of condensed GO-term families. Three out of four GO-term families were conserved in a compartment-specific way between the species: secondary metabolism (liver, invasion (invasion front, and immune response (invasion front and liver. Among the individual GO-terms over-represented in the invasion compartments in both species were "extracellular matrix", "cell motility", "cell adhesion" and "antigen presentation" indicating that typical invasion related processes are operating in both species. This was reflected on the single gene level as well, as cross-species overlap of potential target genes over-expressed in the combined invasion front compartments reached up to 36.5%. Generally, histopathology and gene expression correlated well as the highest single gene overlap was found to be 44% in syn-compartmental comparisons (liver versus liver whereas cross-compartmental overlaps were much lower (e.g. liver versus tumor: 9.7%. However, single gene overlap was surprisingly high in some cross-compartmental comparisons (e.g. human liver invasion compartment and murine tumor invasion compartment: 9.0% despite little histolopathologic similarity indicating that invasion relevant genes are not necessarily confined to histologically defined compartments. Conclusion In summary, cross
Summary the race to reinvent energy and stop global warming
2013-01-01
Complete summary of Fred Krupp and Miriam Horn's book: ""Earth: The Sequel: The Race to Reinvent Energy and Stop Global Warming"". This summary of the ideas from Fred Krupp and Miriam Horn's book ""Earth: The Sequel"" explains how capitalism, as the most powerful economic force in the world, is the only engine of change that has the strength to stop global warming. In their book, the authors demonstrate how this can be achieved by installing a cap-and-trade initiative, providing genuine economic incentives for companies and reducing their carbon footprint. This summary explains their theory in
Sperschneider, Jana; Gardiner, Donald M.; Thatcher, Louise F.; Lyons, Rebecca; Singh, Karam B.; Manners, John M.; Taylor, Jennifer M.
2015-01-01
Pathogens and hosts are in an ongoing arms race and genes involved in host–pathogen interactions are likely to undergo diversifying selection. Fusarium plant pathogens have evolved diverse infection strategies, but how they interact with their hosts in the biotrophic infection stage remains puzzling. To address this, we analyzed the genomes of three Fusarium plant pathogens for genes that are under diversifying selection. We found a two-speed genome structure both on the chromosome and gene group level. Diversifying selection acts strongly on the dispensable chromosomes in Fusarium oxysporum f. sp. lycopersici and on distinct core chromosome regions in Fusarium graminearum, all of which have associations with virulence. Members of two gene groups evolve rapidly, namely those that encode proteins with an N-terminal [SG]-P-C-[KR]-P sequence motif and proteins that are conserved predominantly in pathogens. Specifically, 29 F. graminearum genes are rapidly evolving, in planta induced and encode secreted proteins, strongly pointing toward effector function. In summary, diversifying selection in Fusarium is strongly reflected as genomic footprints and can be used to predict a small gene set likely to be involved in host–pathogen interactions for experimental verification. PMID:25994930
Trust in Leadership DEOCS 4.1 Construct Validity Summary
2017-08-01
Trust in Leadership DEOCS 4.1 Construct Validity Summary DEFENSE EQUAL OPPORTUNITY MANAGEMENT INSTITUTE...Report #04-18 1 Trust in Leadership DEOCS 4.1 Construct Validity Summary Background In 2014, DEOMI released DEOCS 4.0 for Department of Defense...and individual items on the DEOCS. The following details the efforts directed toward updating the factor of Trust in Leadership . Included is a review
Inclusion at Work DEOCS 4.1 Construct Validity Summary
2017-08-01
Inclusion at Work DEOCS 4.1 Construct Validity Summary DEFENSE EQUAL OPPORTUNITY MANAGEMENT INSTITUTE DIRECTORATE...Report #10-18 1 Inclusion DEOCS 4.1 Construct Validity Summary Background In 2011, the Department of Defense (DoD) published the Government-Wide...Diversity and Inclusion Strategic Plan that established a government-wide initiative to promote Diversity and Inclusion . While the military is a
Southern Appalachian assessment. Summary report, Report 1 of 5
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-07-01
This final report for the Southern Appalachian Man and the Biosphere Program is comprised of two documents: (1) a brief summary of programs and projects, and (2) a more extensive summary report included as an attachment. The purpose of the program is to promote a sustainable balance between the conservation of biological diversity, compatible economic uses, and cultural values across the Southern Appalachians. Program and project areas addressing regional issues include environmental monitoring and assessment, sustainable development/sustainable technologies, conservation biology, ecosystem management, environmental education and training, cultural and historical resources, and public information and education. The attached summary report is one of five that documents the results of the Southern Appalachian Assessment; it includes atmospheric, social/cultural/economic, terrestrial, and aquatic reports.
Ma, Lichao; Wang, Yanrong; Liu, Wenxian; Liu, Zhipeng
2014-11-01
GDP-mannose 3', 5'-epimerase (GME) catalyses the conversion of GDP-D-mannose to GDP-L-galactose, an important step in the ascorbic acid (ascorbic acid) biosynthetic pathway in higher plants. In this study, a novel cDNA fragment (MsGME) encoding a GME protein was isolated and characterised from alfalfa (Medicago sativa). An expression analysis confirmed that MsGME expression was induced by salinity, PEG and acidity stresses. MsGME overexpression in Arabidopsis enhanced tolerance of the transgenic plants to salt, drought and acid. Real-time PCR analysis revealed that the transcript levels of GDP-D-mannose pyrophosphorylase (GMP), L-galactose-phosphate 1-P phosphatase (GP) and GDP-L-galactose phosphorylase (GGP) were increased in transgenic Arabidopsis (T3 generation). Moreover, the ascorbate content was increased in transgenic Arabidopsis. Our results suggest that MsGME can effectively enhance tolerance of transgenic Arabidopsis to acid, drought and salt by increasing ascorbate accumulation.
Variability of Creatine Metabolism Genes in Children with Autism Spectrum Disorder
Directory of Open Access Journals (Sweden)
Jessie M. Cameron
2017-07-01
Full Text Available Creatine deficiency syndrome (CDS comprises three separate enzyme deficiencies with overlapping clinical presentations: arginine:glycine amidinotransferase (GATM gene, glycine amidinotransferase, guanidinoacetate methyltransferase (GAMT gene, and creatine transporter deficiency (SLC6A8 gene, solute carrier family 6 member 8. CDS presents with developmental delays/regression, intellectual disability, speech and language impairment, autistic behaviour, epileptic seizures, treatment-refractory epilepsy, and extrapyramidal movement disorders; symptoms that are also evident in children with autism. The objective of the study was to test the hypothesis that genetic variability in creatine metabolism genes is associated with autism. We sequenced GATM, GAMT and SLC6A8 genes in 166 patients with autism (coding sequence, introns and adjacent untranslated regions. A total of 29, 16 and 25 variants were identified in each gene, respectively. Four variants were novel in GATM, and 5 in SLC6A8 (not present in the 1000 Genomes, Exome Sequencing Project (ESP or Exome Aggregation Consortium (ExAC databases. A single variant in each gene was identified as non-synonymous, and computationally predicted to be potentially damaging. Nine variants in GATM were shown to have a lower minor allele frequency (MAF in the autism population than in the 1000 Genomes database, specifically in the East Asian population (Fisher’s exact test. Two variants also had lower MAFs in the European population. In summary, there were no apparent associations of variants in GAMT and SLC6A8 genes with autism. The data implying there could be a lower association of some specific GATM gene variants with autism is an observation that would need to be corroborated in a larger group of autism patients, and with sub-populations of Asian ethnicities. Overall, our findings suggest that the genetic variability of creatine synthesis/transport is unlikely to play a part in the pathogenesis of autism
Variability of Creatine Metabolism Genes in Children with Autism Spectrum Disorder.
Cameron, Jessie M; Levandovskiy, Valeriy; Roberts, Wendy; Anagnostou, Evdokia; Scherer, Stephen; Loh, Alvin; Schulze, Andreas
2017-07-31
Creatine deficiency syndrome (CDS) comprises three separate enzyme deficiencies with overlapping clinical presentations: arginine:glycine amidinotransferase ( GATM gene, glycine amidinotransferase), guanidinoacetate methyltransferase ( GAMT gene), and creatine transporter deficiency ( SLC6A8 gene, solute carrier family 6 member 8). CDS presents with developmental delays/regression, intellectual disability, speech and language impairment, autistic behaviour, epileptic seizures, treatment-refractory epilepsy, and extrapyramidal movement disorders; symptoms that are also evident in children with autism. The objective of the study was to test the hypothesis that genetic variability in creatine metabolism genes is associated with autism. We sequenced GATM , GAMT and SLC6A8 genes in 166 patients with autism (coding sequence, introns and adjacent untranslated regions). A total of 29, 16 and 25 variants were identified in each gene, respectively. Four variants were novel in GATM , and 5 in SLC6A8 (not present in the 1000 Genomes, Exome Sequencing Project (ESP) or Exome Aggregation Consortium (ExAC) databases). A single variant in each gene was identified as non-synonymous, and computationally predicted to be potentially damaging. Nine variants in GATM were shown to have a lower minor allele frequency (MAF) in the autism population than in the 1000 Genomes database, specifically in the East Asian population (Fisher's exact test). Two variants also had lower MAFs in the European population. In summary, there were no apparent associations of variants in GAMT and SLC6A8 genes with autism. The data implying there could be a lower association of some specific GATM gene variants with autism is an observation that would need to be corroborated in a larger group of autism patients, and with sub-populations of Asian ethnicities. Overall, our findings suggest that the genetic variability of creatine synthesis/transport is unlikely to play a part in the pathogenesis of autism spectrum
A summary of genomic data relating to E. coli organized by metabolic pathways: An initial version
Energy Technology Data Exchange (ETDEWEB)
Price, M.; Raju, M.; Taylor, R.
1993-01-01
This report summarizes the reactions that occur in some of the principal metabolic pathways of E. coli. These pathways have been encoded as objects in GenoBase, an integrated database under development at Argonne National Laboratory in collaboration with researchers at the National Institutes of Health and at Harvard University. The report lists the substrates, products, enzymes, and cofactors for each pathway as a whole, followed by a detailed description of each reaction in the pathway. In addition, for each enzyme, the report displays a description and activity as listed in the Enzyme Data Bank, followed by the corresponding Swiss Protein Data Bank entries. Separate summary lines are included for each of the E. coli genes associated with each enzyme.
International Consensus Statement on Allergy and Rhinology: Rhinosinusitis Executive Summary.
Orlandi, Richard R; Kingdom, Todd T; Hwang, Peter H
2016-02-01
The body of knowledge regarding rhinosinusitis (RS) continues to expand, with rapid growth in number of publications yet substantial variability in the quality of those presentations. In an effort to both consolidate and critically appraise this information, rhinologic experts from around the world have produced the International Consensus Statement on Allergy and Rhinology: Rhinosinusitis (ICAR:RS). This executive summary consolidates the findings of the ICAR:RS document. ICAR:RS presents over 140 topics in the forms of evidence-based reviews with recommendations (EBRRs) and evidence-based reviews (EBR). The structured recommendations of the EBRR sections are summarized in this executive summary. This summary compiles the EBRRs regarding medical and surgical management of acute RS (ARS) and chronic RS with and without nasal polyps (CRSwNP and CRSsNP). This ICAR:RS Executive Summary provides a compilation of the evidence-based recommendations for medical and surgical treatment of the most common forms of RS. © 2016 ARS-AAOA, LLC.
Mouse mammary tumor virus-like gene sequences are present in lung patient specimens
Directory of Open Access Journals (Sweden)
Rodríguez-Padilla Cristina
2011-09-01
Full Text Available Abstract Background Previous studies have reported on the presence of Murine Mammary Tumor Virus (MMTV-like gene sequences in human cancer tissue specimens. Here, we search for MMTV-like gene sequences in lung diseases including carcinomas specimens from a Mexican population. This study was based on our previous study reporting that the INER51 lung cancer cell line, from a pleural effusion of a Mexican patient, contains MMTV-like env gene sequences. Results The MMTV-like env gene sequences have been detected in three out of 18 specimens studied, by PCR using a specific set of MMTV-like primers. The three identified MMTV-like gene sequences, which were assigned as INER6, HZ101, and HZ14, were 99%, 98%, and 97% homologous, respectively, as compared to GenBank sequence accession number AY161347. The INER6 and HZ-101 samples were isolated from lung cancer specimens, and the HZ-14 was isolated from an acute inflammatory lung infiltrate sample. Two of the env sequences exhibited disruption of the reading frame due to mutations. Conclusion In summary, we identified the presence of MMTV-like gene sequences in 2 out of 11 (18% of the lung carcinomas and 1 out of 7 (14% of acute inflamatory lung infiltrate specimens studied of a Mexican Population.
US nuclear power plant operating cost and experience summaries
International Nuclear Information System (INIS)
Kohn, W.E.; Reid, R.L.; White, V.S.
1998-02-01
NUREG/CR-6577, U.S. Nuclear Power Plant Operating Cost and Experience Summaries, has been prepared to provide historical operating cost and experience information on U.S. commercial nuclear power plants. Cost incurred after initial construction are characterized as annual production costs, representing fuel and plant operating and maintenance expenses, and capital expenditures related to facility additions/modifications which are included in the plant capital asset base. As discussed in the report, annual data for these two cost categories were obtained from publicly available reports and must be accepted as having different degrees of accuracy and completeness. Treatment of inconclusive and incomplete data is discussed. As an aid to understanding the fluctuations in the cost histories, operating summaries for each nuclear unit are provided. The intent of these summaries is to identify important operating events; refueling, major maintenance, and other significant outages; operating milestones; and significant licensing or enforcement actions. Information used in the summaries is condensed from annual operating reports submitted by the licensees, plant histories contained in Nuclear Power Experience, trade press articles, and the Nuclear Regulatory Commission (NRC) web site (www.nrc.gov)
US nuclear power plant operating cost and experience summaries
Energy Technology Data Exchange (ETDEWEB)
Kohn, W.E.; Reid, R.L.; White, V.S.
1998-02-01
NUREG/CR-6577, U.S. Nuclear Power Plant Operating Cost and Experience Summaries, has been prepared to provide historical operating cost and experience information on U.S. commercial nuclear power plants. Cost incurred after initial construction are characterized as annual production costs, representing fuel and plant operating and maintenance expenses, and capital expenditures related to facility additions/modifications which are included in the plant capital asset base. As discussed in the report, annual data for these two cost categories were obtained from publicly available reports and must be accepted as having different degrees of accuracy and completeness. Treatment of inconclusive and incomplete data is discussed. As an aid to understanding the fluctuations in the cost histories, operating summaries for each nuclear unit are provided. The intent of these summaries is to identify important operating events; refueling, major maintenance, and other significant outages; operating milestones; and significant licensing or enforcement actions. Information used in the summaries is condensed from annual operating reports submitted by the licensees, plant histories contained in Nuclear Power Experience, trade press articles, and the Nuclear Regulatory Commission (NRC) web site (www.nrc.gov).
TaWRKY68 responses to biotic stresses are revealed by the orthologous genes from major cereals
Directory of Open Access Journals (Sweden)
Bo Ding
2014-01-01
Full Text Available WRKY transcription factors have been extensively characterized in the past 20 years, but in wheat, studies onWRKY genes and their function are lagging behind many other species. To explore the function of wheat WRKY genes, we identified a TaWRKY68 gene from a common wheat cultivar. It encodes a protein comprising 313 amino acids which harbors 19 conserved motifs or active sites. Gene expression patterns were determined by analyzing microarray data of TaWRKY68 in wheat and of orthologous genes from maize, rice and barley using Genevestigator. TaWRKY68 orthologs were identified and clustered using DELTA-BLAST and COBALT programs available at NCBI. The results showed that these genes, which are expressed in all tissues tested, had relatively higher levels in the roots and were up-regulated in response to biotic stresses. Bioinformatics results were confirmed by RT-PCR experiments using wheat plants infected by Agrobacterium tumefaciens and Blumeria graminis, or treated with Deoxynivalenol, a Fusarium graminearum-induced mycotoxin in wheat or barley. In summary,TaWRKY68 functions differ during plant developmental stages and might be representing a hub gene function in wheat responses to various biotic stresses. It was also found that including data from major cereal genes in the bioinformatics analysis gave more accurate and comprehensive predictions of wheat gene functions.
Biomass energy systems program summary
Energy Technology Data Exchange (ETDEWEB)
None
1980-07-01
Research programs in biomass which were funded by the US DOE during fiscal year 1978 are listed in this program summary. The conversion technologies and their applications have been grouped into program elements according to the time frame in which they are expected to enter the commercial market. (DMC)
Better Metrics to Automatically Predict the Quality of a Text Summary
Directory of Open Access Journals (Sweden)
Judith D. Schlesinger
2012-09-01
Full Text Available In this paper we demonstrate a family of metrics for estimating the quality of a text summary relative to one or more human-generated summaries. The improved metrics are based on features automatically computed from the summaries to measure content and linguistic quality. The features are combined using one of three methods—robust regression, non-negative least squares, or canonical correlation, an eigenvalue method. The new metrics significantly outperform the previous standard for automatic text summarization evaluation, ROUGE.
Online Mendelian Inheritance in Man (OMIM), a knowledgebase of human genes and genetic disorders.
Hamosh, Ada; Scott, Alan F; Amberger, Joanna S; Bocchini, Carol A; McKusick, Victor A
2005-01-01
Online Mendelian Inheritance in Man (OMIM) is a comprehensive, authoritative and timely knowledgebase of human genes and genetic disorders compiled to support human genetics research and education and the practice of clinical genetics. Started by Dr Victor A. McKusick as the definitive reference Mendelian Inheritance in Man, OMIM (http://www.ncbi.nlm.nih.gov/omim/) is now distributed electronically by the National Center for Biotechnology Information, where it is integrated with the Entrez suite of databases. Derived from the biomedical literature, OMIM is written and edited at Johns Hopkins University with input from scientists and physicians around the world. Each OMIM entry has a full-text summary of a genetically determined phenotype and/or gene and has numerous links to other genetic databases such as DNA and protein sequence, PubMed references, general and locus-specific mutation databases, HUGO nomenclature, MapViewer, GeneTests, patient support groups and many others. OMIM is an easy and straightforward portal to the burgeoning information in human genetics.
Altered gene synchrony suggests a combined hormone-mediated dysregulated state in major depression.
Directory of Open Access Journals (Sweden)
Chris Gaiteri
2010-04-01
Full Text Available Coordinated gene transcript levels across tissues (denoted "gene synchrony" reflect converging influences of genetic, biochemical and environmental factors; hence they are informative of the biological state of an individual. So could brain gene synchrony also integrate the multiple factors engaged in neuropsychiatric disorders and reveal underlying pathologies? Using bootstrapped Pearson correlation for transcript levels for the same genes across distinct brain areas, we report robust gene transcript synchrony between the amygdala and cingulate cortex in the human postmortem brain of normal control subjects (n = 14; Control/Permutated data, p<0.000001. Coordinated expression was confirmed across distinct prefrontal cortex areas in a separate cohort (n = 19 subjects and affected different gene sets, potentially reflecting regional network- and function-dependent transcriptional programs. Genewise regional transcript coordination was independent of age-related changes and array technical parameters. Robust shifts in amygdala-cingulate gene synchrony were observed in subjects with major depressive disorder (MDD, denoted here "depression" (n = 14; MDD/Permutated data, p<0.000001, significantly affecting between 100 and 250 individual genes (10-30% false discovery rate. Biological networks and signal transduction pathways corresponding to the identified gene set suggested putative dysregulated functions for several hormone-type factors previously implicated in depression (insulin, interleukin-1, thyroid hormone, estradiol and glucocorticoids; p<0.01 for association with depression-related networks. In summary, we showed that coordinated gene expression across brain areas may represent a novel molecular probe for brain structure/function that is sensitive to disease condition, suggesting the presence of a distinct and integrated hormone-mediated corticolimbic homeostatic, although maladaptive and pathological, state in major depression.
Summary how Google's social network changes everything
2014-01-01
This work offers a summary of the book: « Google+ for business: How Google's Social Network Changes Everything » by Chris Brogan.Summary of the ideas in Chris Brogan's book « Google+ for business » highlights that the social network created by Google now has lore than 175 million users and is tied to the largest search engines in the world. Therefore, Google+ could end up being the best online business building tool ever developed. So if you can master using Google+ today, you will be well positioned for what happens in the future as Google, YouTube and others continue to bring new developmen
Genes underlying reproductive division of labor in termites, with comparisons to social Hymenoptera
Directory of Open Access Journals (Sweden)
Judith eKorb
2016-04-01
Full Text Available All social insects are characterized by a reproductive division of labor. Within a colony only a few individuals reproduce (queens and in termites, also a king while the large majority (workers and soldiers forgo reproduction, at least temporarily. The evolution of such reproductive altruism can ultimately be explained by inclusive fitness theory. Here, I will review the proximate genetic mechanisms underlying this altruism in termites. As social cockroaches they evolved eusociality independently from the social Hymenoptera, which makes them interesting test cases to look for common underlying mechanisms of eusociality and lineage specific idiosyncrasies. First, I will provide a summary of the genes and their function that have been identified to underlie reproductive division of labor - so called 'queen genes,' - in the drywood termite Cryptotermes secundus, an emerging model to study termite social evolution. Second, I outline how widespread these queen genes are across the termite phylogeny, using also evidence from recent genome analyses. I will provide hypotheses about the evolutionary origin of these queen genes, aiming to link proximate mechanisms with ultimate functions. Finally, I will draw comparisons to social Hymenoptera to indicate potential common underpinnings that warrant further testing.
Summary of Natural Hazard Statistics for 2017 in the United States
Summary of Natural Hazard Statistics for 2017 in the United States This National Weather Service (NWS) report ... and the National Climatic Data Center compiled this Summary of U.S. Natural Hazard Statistics from Storm Data, ...
International Nuclear Information System (INIS)
1978-01-01
The report provides summary information on all phases of nuclear regulation, and is intended as an information and decision-making tool for mid and upper level management of the Nuclear Regulatory Commission. The report is divided functionally into ten sections: (1) nuclear power plants in the United States; (2) operating nuclear power plants; (3) reactors under construction; (4) operating license applications under NRC review; (5) construction permit applications and special projects under NRC review; (6) ACRS and ASLBP; (7) nuclear materials; (8) standards and regulations; (9) research projects; and (10) foreign reactors
Charles River Residual Designation: Executive Summary
Read an executive summary of the Record of Decision's preliminary decision by the Regional Administrator of EPA Region 1 that storm water permits are needed to address serious water quality problems in the Charles River.
Mercury Lander Mission Concept Study Summary
Eng, D. A.
2018-05-01
Provides a summary of the Mercury Lander Mission Concept Study performed as part of the last Planetary Decadal Survey. The presentation will focus on engineering trades and the challenges of developing a Mercury lander mission.
Multi-Object Spectroscopy in the Next Decade: A Conference Summary
Trager, S. C.; Skillen, I.; Barcells, M.
2016-01-01
I present a highly-biased summary of the conference "Multi-Object Spectroscopy in the Next Decade: Big Questions, Large Surveys, and Wide Fields," held 2-6 March 2015 in Santa Cruz de la Palma, Spain. I focus on four issues in this summary: (1) complexity in objects, physics, and instruments is
Directory of Open Access Journals (Sweden)
Martha L Slattery
Full Text Available Several diet and lifestyle factors may impact health by influencing oxidative stress levels. We hypothesize that level of cigarette smoking, alcohol, anti-inflammatory drugs, and diet alter gene expression. We analyzed RNA-seq data from 144 colon cancer patients who had information on recent cigarette smoking, recent alcohol consumption, diet, and recent aspirin/non-steroidal anti-inflammatory use. Using a false discovery rate of 0.1, we evaluated gene differential expression between high and low levels of exposure using DESeq2. Ingenuity Pathway Analysis (IPA was used to determine networks associated with de-regulated genes in our data. We identified 46 deregulated genes associated with recent cigarette use; these genes enriched causal networks regulated by TEK and MAP2K3. Different differentially expressed genes were associated with type of alcohol intake; five genes were associated with total alcohol, six were associated with beer intake, six were associated with wine intake, and four were associated with liquor consumption. Recent use of aspirin and/or ibuprofen was associated with differential expression of TMC06, ST8SIA4, and STEAP3 while a summary oxidative balance score (OBS was associated with SYCP3, HDX, and NRG4 (all up-regulated with greater oxidative balance. Of the dietary antioxidants and carotenoids evaluated only intake of beta carotene (1 gene, Lutein/Zeaxanthine (5 genes, and Vitamin E (4 genes were associated with differential gene expression. There were similarities in biological function of de-regulated genes associated with various dietary and lifestyle factors. Our data support the hypothesis that diet and lifestyle factors associated with oxidative stress can alter gene expression. However genes altered were unique to type of alcohol and type of antioxidant. Because of potential differences in associations observed between platforms these findings need replication in other populations.
Begara-Morales, Juan C; Sánchez-Calvo, Beatriz; Luque, Francisco; Leyva-Pérez, María O; Leterrier, Marina; Corpas, Francisco J; Barroso, Juan B
2014-06-01
S-Nitrosoglutathione (GSNO) is a nitric oxide-derived molecule that can regulate protein function by a post-translational modification designated S-nitrosylation. GSNO has also been detected in different plant organs under physiological and stress conditions, and it can also modulate gene expression. Thirty-day-old Arabidopsis plants were grown under hydroponic conditions, and exogenous 1 mM GSNO was applied to the root systems for 3 h. Differential gene expression analyses were carried out both in roots and in leaves by RNA sequencing (RNA-seq). A total of 3,263 genes were identified as being modulated by GSNO. Most of the genes identified were associated with the mechanism of protection against stress situations, many of these having previously been identified as target genes of GSNO by array-based methods. However, new genes were identified, such as that for methionine sulfoxide reductase (MSR) in leaves or different miscellaneous RNA (miscRNA) genes in Arabidopsis roots. As a result, 1,945 GSNO-responsive genes expressed differently in leaves and roots were identified, and 114 of these corresponded exclusively to one of these organs. In summary, it is demonstrated that RNA-seq extends our knowledge of GSNO as a signaling molecule which differentially modulates gene expression in roots and leaves under non-stress conditions. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Albrow, M. G.
1993-09-01
The author gives a summary talk of the best experimental data given at the 5th Blois Workshop on Elastic and Diffractive Scattering. He addresses the following eight areas in his talk: total and elastic cross sections; single diffractive excitation; electron-proton scattering; di-jets and rapidity gaps; areas of future study; spins and asymmetries; high-transverse momentum and masses at the Tevatron; and disoriented chiral condensates and cosmic radiation.
International Nuclear Information System (INIS)
Albrow, M.G.
1993-09-01
The author gives a summary talk of the best experimental data given at the Vth Blois Workshop on Elastic and Diffractive Scattering. He addresses the following eight areas in his talk: total and elastic cross sections; single diffractive excitation; electron-proton scattering; di-jets and rapidity gaps; areas of future study; spins and asymmetries; high-transverse momentum and masses at the Tevatron; and disoriented chiral condensates and cosmic radiation
Energy Technology Data Exchange (ETDEWEB)
Albrow, M.G.
1993-09-01
The author gives a summary talk of the best experimental data given at the Vth Blois Workshop on Elastic and Diffractive Scattering. He addresses the following eight areas in his talk: total and elastic cross sections; single diffractive excitation; electron-proton scattering; di-jets and rapidity gaps; areas of future study; spins and asymmetries; high-transverse momentum and masses at the Tevatron; and disoriented chiral condensates and cosmic radiation.
Physician-Supplier Procedure Summary Master File
U.S. Department of Health & Human Services — This file is a 100 percent summary of all Part B Carrier and DMERC Claims processed through the Common Working File and stored in the National Claims History...
Summary of Sandia Laboratories technical capabilities
International Nuclear Information System (INIS)
1977-05-01
The technical capabilities of Sandia Laboratories are detailed in a series of companion reports. In this summary the use of the capabilities in technical programs is outlined and the capabilities are summarized. 25 figures, 3 tables
Place of the nuclear medicine in the clinical development of the gene therapy
International Nuclear Information System (INIS)
Crochet, T.; Vis, J. de; Vincent, D.; Zanca, M.
2006-01-01
Although gene therapy has been proposed first for genetic diseases, its concept has been extended to many acquired diseases, owing to a better understanding of pathology at a molecular level. Overall, very few trials have shown to be efficient, and safety concerns have emerged, as a result of several patients deaths. There is a need for new techniques able to improve both the knowledge of the therapeutic gene fate once administered and the early detection of events likely to lead to serious adverse events. In vivo imaging of a reporter gene associated with the therapeutic one is certainly the most promising technique for these goals. Among available imaging modalities, nuclear imaging is the most likely to be applied to patients. This review begins with a summary of current knowledge about the steps that a therapeutic gene has to cross from vector delivery to appropriate expression in target cells. We show how gene imaging could allow to investigate many pitfalls of trials by providing a better understanding of these steps in patients. The reporter genes available for nuclear imaging are presented in the second section, through animal studies. Then, relevant examples of clinical trials are presented. These include cancer (suicide gene therapy and adoptive immunotherapy), ischemic heart diseases and cystic fibrosis. The results are commented with emphasis on the role of nuclear imaging to address the questions raised by these studies, and imaging studies carried out on animals or patients for the corresponding diseases or organs are presented. The results obtained in animal studies warrant the introduction of gene imaging in clinical trials. (authors)
Wikidata as a semantic framework for the Gene Wiki initiative.
Burgstaller-Muehlbacher, Sebastian; Waagmeester, Andra; Mitraka, Elvira; Turner, Julia; Putman, Tim; Leong, Justin; Naik, Chinmay; Pavlidis, Paul; Schriml, Lynn; Good, Benjamin M; Su, Andrew I
2016-01-01
Open biological data are distributed over many resources making them challenging to integrate, to update and to disseminate quickly. Wikidata is a growing, open community database which can serve this purpose and also provides tight integration with Wikipedia. In order to improve the state of biological data, facilitate data management and dissemination, we imported all human and mouse genes, and all human and mouse proteins into Wikidata. In total, 59,721 human genes and 73,355 mouse genes have been imported from NCBI and 27,306 human proteins and 16,728 mouse proteins have been imported from the Swissprot subset of UniProt. As Wikidata is open and can be edited by anybody, our corpus of imported data serves as the starting point for integration of further data by scientists, the Wikidata community and citizen scientists alike. The first use case for these data is to populate Wikipedia Gene Wiki infoboxes directly from Wikidata with the data integrated above. This enables immediate updates of the Gene Wiki infoboxes as soon as the data in Wikidata are modified. Although Gene Wiki pages are currently only on the English language version of Wikipedia, the multilingual nature of Wikidata allows for usage of the data we imported in all 280 different language Wikipedias. Apart from the Gene Wiki infobox use case, a SPARQL endpoint and exporting functionality to several standard formats (e.g. JSON, XML) enable use of the data by scientists. In summary, we created a fully open and extensible data resource for human and mouse molecular biology and biochemistry data. This resource enriches all the Wikipedias with structured information and serves as a new linking hub for the biological semantic web. Database URL: https://www.wikidata.org/. © The Author(s) 2016. Published by Oxford University Press.
Comparative sequence analysis of nitrogen fixation-related genes in six legumes
Directory of Open Access Journals (Sweden)
Dong Hyun eKim
2013-08-01
Full Text Available Legumes play an important role as food and forage crops in international agriculture especially in developing countries. Legumes have a unique biological process called nitrogen fixation (NF by which they convert atmospheric nitrogen to ammonia. Although legume genomes have undergone polyploidization, duplication and divergence, NF-related genes, because of their essential functional role for legumes, might have remained conserved. To understand the relationship of divergence and evolutionary processes in legumes, this study analyzes orthologs and paralogs for selected 20 NF-related genes by using comparative genomic approaches in six legumes i.e. Medicago truncatula (Mt, Cicer arietinum, Lotus japonicus, Cajanus cajan (Cc, Phaseolus vulgaris (Pv and Glycine max (Gm. Subsequently, sequence distances, numbers of synonymous substitutions per synonymous site (Ks and nonsynonymous substitutions per nonsynonymous site (Ka between orthologs and paralogs were calculated and compared across legumes. These analyses suggest the closest relationship between Gm and Cc and the farthest distance between Mt and Pv in 6 legumes. Ks proportional plots clearly showed ancient genome duplication in all legumes, whole genome duplication event in Gm and also speciation pattern in different legumes. This study also reported some interesting observations e.g. no peak at Ks 0.4 in Gm-Gm, location of two independent genes next to each other in Mt and low Ks values for outparalogs for three genes as compared to other 12 genes. In summary, this study underlines the importance of NF-related genes and provides important insights in genome organization and evolutionary aspects of six legume species analyzed.
Enrichr: interactive and collaborative HTML5 gene list enrichment analysis tool.
Chen, Edward Y; Tan, Christopher M; Kou, Yan; Duan, Qiaonan; Wang, Zichen; Meirelles, Gabriela Vaz; Clark, Neil R; Ma'ayan, Avi
2013-04-15
System-wide profiling of genes and proteins in mammalian cells produce lists of differentially expressed genes/proteins that need to be further analyzed for their collective functions in order to extract new knowledge. Once unbiased lists of genes or proteins are generated from such experiments, these lists are used as input for computing enrichment with existing lists created from prior knowledge organized into gene-set libraries. While many enrichment analysis tools and gene-set libraries databases have been developed, there is still room for improvement. Here, we present Enrichr, an integrative web-based and mobile software application that includes new gene-set libraries, an alternative approach to rank enriched terms, and various interactive visualization approaches to display enrichment results using the JavaScript library, Data Driven Documents (D3). The software can also be embedded into any tool that performs gene list analysis. We applied Enrichr to analyze nine cancer cell lines by comparing their enrichment signatures to the enrichment signatures of matched normal tissues. We observed a common pattern of up regulation of the polycomb group PRC2 and enrichment for the histone mark H3K27me3 in many cancer cell lines, as well as alterations in Toll-like receptor and interlukin signaling in K562 cells when compared with normal myeloid CD33+ cells. Such analyses provide global visualization of critical differences between normal tissues and cancer cell lines but can be applied to many other scenarios. Enrichr is an easy to use intuitive enrichment analysis web-based tool providing various types of visualization summaries of collective functions of gene lists. Enrichr is open source and freely available online at: http://amp.pharm.mssm.edu/Enrichr.
Market review: Market values summary July market review/current market data
International Nuclear Information System (INIS)
Anon.
1996-01-01
A summary of financial data for the uranium spot market is provided. Recent transactions are tabulated, including uranium sales, natural uranium loans, conversion sales, and enrichment sales. A market values summary and long-term price indicators are also provided. The July 1996 market review data includes summaries of near-term uranium sales, near-term supply/demand, NUEXCO values, USEC prices, and calculated worth of enriched uranium. Active projects in uranium, conversion, and separative work supply and demand are listed. International market values are tabulated for 22 selected currencies
Research and Technology Objectives and Plans Summary (RTOPS)
1993-01-01
This publication represents the NASA research and technology program for FY-93. It is a compilation of the Summary portions of each of the RTOP's (Research and Technology Objectives and Plans) used for management review and control of research currently in progress throughout NASA. The RTOP Summary is designed to facilitate communication and coordination among concerned technical personnel in government, in industry, and in universities. The first section containing citations and abstracts of the RTOP's is followed by four indexes: Subject, Technical Monitor, Responsible NASA Organization, and RTOP Number.
29 CFR 1904.43 - Summary and posting of the 2001 data.
2010-07-01
... keep OSHA 200 Logs in 2001, you must post a 2000 annual summary from the OSHA 200 Log of occupational... summary? (i) You must include a copy of the totals from the 2001 OSHA 200 Log and the following...
International Nuclear Information System (INIS)
2006-01-01
In conjunction with its 6. annual meeting, the WPDD in close co-operation with the FSC held a Topical session on 'Stakeholder Involvement in Decommissioning' on November 14, 2005. The session was attended by 36 participants totally representing 14 NEA member countries and 2 international organisations. Two keynote addresses were given at the Topical Session. The first one treated of what is needed for robust decisions and how to bring all stakeholders into the debate. In the second keynote address a summary was made on what have been said on stakeholder involvement in decommissioning during earlier meetings of the WPDD. The main part of the session was then devoted to views from different stakeholders regarding their role and their involvement. This part contained viewpoints from local communities (Kaevlinge in Sweden and Port Hope in Canada), authorities (Scottish Executive and CSNC) and operators (EDF from France and EWN from Germany). Case studies from the decommissioning of Dounrey in the UK and from Trojan and Main Yankee in the USA were presented in the end part of the Topical session followed by a summary and lessons learnt report by the Rapporteur. A detailed programme of the Topical session can be seen in Appendix 1
Fusion Plasma Theory project summaries
Energy Technology Data Exchange (ETDEWEB)
1993-10-01
This Project Summary book is a published compilation consisting of short descriptions of each project supported by the Fusion Plasma Theory and Computing Group of the Advanced Physics and Technology Division of the Department of Energy, Office of Fusion Energy. The summaries contained in this volume were written by the individual contractors with minimal editing by the Office of Fusion Energy. Previous summaries were published in February of 1982 and December of 1987. The Plasma Theory program is responsible for the development of concepts and models that describe and predict the behavior of a magnetically confined plasma. Emphasis is given to the modelling and understanding of the processes controlling transport of energy and particles in a toroidal plasma and supporting the design of the International Thermonuclear Experimental Reactor (ITER). A tokamak transport initiative was begun in 1989 to improve understanding of how energy and particles are lost from the plasma by mechanisms that transport them across field lines. The Plasma Theory program has actively-participated in this initiative. Recently, increased attention has been given to issues of importance to the proposed Tokamak Physics Experiment (TPX). Particular attention has been paid to containment and thermalization of fast alpha particles produced in a burning fusion plasma as well as control of sawteeth, current drive, impurity control, and design of improved auxiliary heating. In addition, general models of plasma behavior are developed from physics features common to different confinement geometries. This work uses both analytical and numerical techniques. The Fusion Theory program supports research projects at US government laboratories, universities and industrial contractors. Its support of theoretical work at universities contributes to the office of Fusion Energy mission of training scientific manpower for the US Fusion Energy Program.
Plutonium focus area: Technology summary
International Nuclear Information System (INIS)
1996-03-01
To ensure research and development programs focus on the most pressing environmental restoration and waste management problems at the U.S. Department of Energy (DOE), the Assistant Secretary for the Office of Environmental Management (EM) established a working group in August 1993 to implement a new approach to research and technology development. As part of this approach, EM developed a management structure and principles that led to creation of specific focus areas. These organizations were designed to focus scientific and technical talent throughout DOE and the national scientific community on major environmental restoration and waste management problems facing DOE. The focus area approach provides the framework for inter-site cooperation and leveraging of resources on common problems. After the original establishment of five major focus areas within the Office of Technology Development (EM-50), the Nuclear Materials Stabilization Task Group (NMSTG, EM-66) followed EM-50's structure and chartered the Plutonium Focus Area (PFA). NMSTG's charter to the PFA, described in detail later in this book, plays a major role in meeting the EM-66 commitments to the Defense Nuclear Facilities Safety Board (DNFSB). The PFA is a new program for FY96 and as such, the primary focus of revision 0 of this Technology Summary is an introduction to the Focus Area; its history, development, and management structure, including summaries of selected technologies being developed. Revision 1 to the Plutonium Focus Area Technology Summary is slated to include details on all technologies being developed, and is currently planned for release in August 1996. The following report outlines the scope and mission of the Office of Environmental Management, EM-60, and EM-66 organizations as related to the PFA organizational structure
Fusion plasma theory project summaries
1993-10-01
This Project Summary book is a published compilation consisting of short descriptions of each project supported by the Fusion Plasma Theory and Computing Group of the Advanced Physics and Technology Division of the Department of Energy, Office of Fusion Energy. The summaries contained in this volume were written by the individual contractors with minimal editing by the Office of Fusion Energy. Previous summaries were published in February of 1982 and December of 1987. The Plasma Theory program is responsible for the development of concepts and models that describe and predict the behavior of a magnetically confined plasma. Emphasis is given to the modelling and understanding of the processes controlling transport of energy and particles in a toroidal plasma and supporting the design of the International Thermonuclear Experimental Reactor (ITER). A tokamak transport initiative was begun in 1989 to improve understanding of how energy and particles are lost from the plasma by mechanisms that transport them across field lines. The Plasma Theory program has actively participated in this initiative. Recently, increased attention has been given to issues of importance to the proposed Tokamak Physics Experiment (TPX). Particular attention has been paid to containment and thermalization of fast alpha particles produced in a burning fusion plasma as well as control of sawteeth, current drive, impurity control, and design of improved auxiliary heating. In addition, general models of plasma behavior are developed from physics features common to different confinement geometries. This work uses both analytical and numerical techniques. The Fusion Theory program supports research projects at U.S. government laboratories, universities and industrial contractors. Its support of theoretical work at universities contributes to the office of Fusion Energy mission of training scientific manpower for the U.S. Fusion Energy Program.
Fusion Plasma Theory project summaries
International Nuclear Information System (INIS)
1993-10-01
This Project Summary book is a published compilation consisting of short descriptions of each project supported by the Fusion Plasma Theory and Computing Group of the Advanced Physics and Technology Division of the Department of Energy, Office of Fusion Energy. The summaries contained in this volume were written by the individual contractors with minimal editing by the Office of Fusion Energy. Previous summaries were published in February of 1982 and December of 1987. The Plasma Theory program is responsible for the development of concepts and models that describe and predict the behavior of a magnetically confined plasma. Emphasis is given to the modelling and understanding of the processes controlling transport of energy and particles in a toroidal plasma and supporting the design of the International Thermonuclear Experimental Reactor (ITER). A tokamak transport initiative was begun in 1989 to improve understanding of how energy and particles are lost from the plasma by mechanisms that transport them across field lines. The Plasma Theory program has actively-participated in this initiative. Recently, increased attention has been given to issues of importance to the proposed Tokamak Physics Experiment (TPX). Particular attention has been paid to containment and thermalization of fast alpha particles produced in a burning fusion plasma as well as control of sawteeth, current drive, impurity control, and design of improved auxiliary heating. In addition, general models of plasma behavior are developed from physics features common to different confinement geometries. This work uses both analytical and numerical techniques. The Fusion Theory program supports research projects at US government laboratories, universities and industrial contractors. Its support of theoretical work at universities contributes to the office of Fusion Energy mission of training scientific manpower for the US Fusion Energy Program
Hsu, Shih-Che; Huang, Shih-Ming; Lin, Shih-Hua; Ka, Shuk-Man; Chen, Ann; Shih, Meng-Fu; Hsu, Yu-Juei
2014-12-01
Gender is known to be associated with longevity and oestrogen administration induced longevity-associated gene expression is one of the potential mechanisms underlying the benefits of oestrogen on lifespan, whereas the role of testosterone in the regulation of longevity-associated gene expressions remains largely unclear. The klotho gene, predominantly expressed in the kidney, has recently been discovered to be an aging suppressor gene. In the present study, we investigated the regulatory effects of testosterone on renal klotho gene expression in vivo and in vitro. In testosterone-administered mouse kidney and NRK-52E cells, increased klotho expression was accompanied by the up-regulation of the nuclear androgen receptor (AR). Overexpression of AR enhanced the expression of klotho mRNA and protein. Conversely, testosterone-induced klotho expression was attenuated in the presence of flutamide, an AR antagonist. A reporter assay and a chromatin immunoprecipitation (ChIP) assay demonstrated that AR directly binds to the klotho promoter via androgen response elements (AREs) which reconfirmed its importance for AR binding via the element mutation. In summary, our study demonstrates that testosterone up-regulates anti-aging klotho together with AR expression in the kidney in vivo and in vitro by recruiting AR on to the AREs of the klotho promoter.
Vision Hampton Roads : public responsiveness summary.
2010-02-23
All comments submitted to Vision Hampton Roads were reviewed prior to addition to the final : document. Using this Public Responsiveness Summary, citizens will be able to see and track how : their engagement has impacted results. On the following pag...
KEEP Five-Year Summary Report.
Gallimore, Ronald; Tharp, Roland G.
This brief summary outlines the activities and findings of the research and development efforts of the Kamehameha Early Education Program (KEEP) from 1971 to 1976. The paper suggests that the original goals of the program were met and that the initial operating procedures agreed upon by KEEP and the Hawaii State Department of Education were…
International Nuclear Information System (INIS)
Garber, D.
1975-10-01
Descriptions of the evaluations contained in the ENDF/B library are given. The summary documentation presented is intended to be a more detailed description than the (File 1) comments contained in the computer-readable data files, but not so detailed as the formal reports describing each ENDF/B evaluation. The documentations were written by the CSEWG evaluators and compiled by NNCSC. Selected materials which comprise this volume include from 1 H to 244 Cm
A comparison of brain gene expression levels in domesticated and wild animals.
Directory of Open Access Journals (Sweden)
Frank W Albert
2012-09-01
Full Text Available Domestication has led to similar changes in morphology and behavior in several animal species, raising the question whether similarities between different domestication events also exist at the molecular level. We used mRNA sequencing to analyze genome-wide gene expression patterns in brain frontal cortex in three pairs of domesticated and wild species (dogs and wolves, pigs and wild boars, and domesticated and wild rabbits. We compared the expression differences with those between domesticated guinea pigs and a distant wild relative (Cavia aperea as well as between two lines of rats selected for tameness or aggression towards humans. There were few gene expression differences between domesticated and wild dogs, pigs, and rabbits (30-75 genes (less than 1% of expressed genes were differentially expressed, while guinea pigs and C. aperea differed more strongly. Almost no overlap was found between the genes with differential expression in the different domestication events. In addition, joint analyses of all domesticated and wild samples provided only suggestive evidence for the existence of a small group of genes that changed their expression in a similar fashion in different domesticated species. The most extreme of these shared expression changes include up-regulation in domesticates of SOX6 and PROM1, two modulators of brain development. There was almost no overlap between gene expression in domesticated animals and the tame and aggressive rats. However, two of the genes with the strongest expression differences between the rats (DLL3 and DHDH were located in a genomic region associated with tameness and aggression, suggesting a role in influencing tameness. In summary, the majority of brain gene expression changes in domesticated animals are specific to the given domestication event, suggesting that the causative variants of behavioral domestication traits may likewise be different.
Operating reactors licensing actions summary. Volume 5, No. 2
International Nuclear Information System (INIS)
1985-04-01
The Operating Reactors Licensing Actions Summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Resource Management. This summary report is published primarily for internal NRC use in managing the Operating Reactors Licensing Actions Program
The perceptual processing capacity of summary statistics between and within feature dimensions
Attarha, Mouna; Moore, Cathleen M.
2015-01-01
The simultaneous–sequential method was used to test the processing capacity of statistical summary representations both within and between feature dimensions. Sixteen gratings varied with respect to their size and orientation. In Experiment 1, the gratings were equally divided into four separate smaller sets, one of which with a mean size that was larger or smaller than the other three sets, and one of which with a mean orientation that was tilted more leftward or rightward. The task was to report the mean size and orientation of the oddball sets. This therefore required four summary representations for size and another four for orientation. The sets were presented at the same time in the simultaneous condition or across two temporal frames in the sequential condition. Experiment 1 showed evidence of a sequential advantage, suggesting that the system may be limited with respect to establishing multiple within-feature summaries. Experiment 2 eliminates the possibility that some aspect of the task, other than averaging, was contributing to this observed limitation. In Experiment 3, the same 16 gratings appeared as one large superset, and therefore the task only required one summary representation for size and another one for orientation. Equal simultaneous–sequential performance indicated that between-feature summaries are capacity free. These findings challenge the view that within-feature summaries drive a global sense of visual continuity across areas of the peripheral visual field, and suggest a shift in focus to seeking an understanding of how between-feature summaries in one area of the environment control behavior. PMID:26360153
Plutonium focus area. Technology summary
International Nuclear Information System (INIS)
1997-09-01
The Assistant Secretary for the Office of Environmental Management (EM) at the U.S. Department of Energy (DOE) chartered the Plutonium Focus Area (PFA) in October 1995. The PFA open-quotes...provides for peer and technical reviews of research and development in plutonium stabilization activities...close quotes In addition, the PFA identifies and develops relevant research and technology. The purpose of this document is to focus attention on the requirements used to develop research and technology for stabilization, storage, and preparation for disposition of nuclear materials. The PFA Technology Summary presents the approach the PFA uses to identify, recommend, and review research. It lists research requirements, research being conducted, and gaps where research is needed. It also summarizes research performed by the PFA in the traditional research summary format. This document encourages researchers and commercial enterprises to do business with PFA by submitting research proposals or open-quotes white papers.close quotes In addition, it suggests ways to increase the likelihood that PFA will recommend proposed research to the Nuclear Materials Stabilization Task Group (NMSTG) of DOE
Clinical Trial Results Summary for Laypersons: A User Testing Study.
Raynor, D K; Myers, L; Blackwell, K; Kress, B; Dubost, A; Joos, A
2018-01-01
To apply "user testing" to maximize readability and acceptability of a Clinical Trial Results Laypersons Summary-a new European requirement. "User testing" (using questionnaire and semistructured interview) assessed whether people could find and understand key points. Findings were used to improve content and design, prior to retesting. Participants had a range of levels of health literacy and there was a higher education group. Participants accessed the summary on screen. In round 1 we tested 12 points of information. In round 2 a revised summary addressing round 1 findings was tested, leading to a third final version. In round 1, 2 of 12 points of information did not reach the target and interviews raised further format and content issues (some distracting technical explanations and inability to find or understand the 2 main study purposes). These findings informed revisions for the version tested in round 2, with 2 different points not reaching the target (inclusion criteria relating to duration of seasonal allergies and how researchers found out about participants' symptoms). Identified problems in both rounds were addressed and reflected in the final version. Despite improvements, participants did not consistently understand that summaries were intended for the public, or to only interpret results of single trials in the context of additional trials. All readers, including those with higher education, found the clear and straightforward language acceptable. Applying "user testing" resulted in a largely health-literate summary suitable for people across a range of backgrounds.
Operating reactors licensing actions summary
International Nuclear Information System (INIS)
1982-04-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis
Summary of the law relating to atomic energy and radioactive substances
International Nuclear Information System (INIS)
Sim, D.F.; Ritchie, K.J.S.
1982-01-01
This Summary is an updated version of a previous revision of the Summary of the United Kingdom's legislation on atomic energy and reviews the main texts in that field. Reference is made to the regulations on atomic energy, nuclear installations, radioactive substances, transport of such substances, radiation protection etc. It is intended to be a signpost to the relevant law, but does not cover any aspect in detail. The Summary also refers to international agreements in the nuclear field: conventions and regulations on the transport of radioactive substances and nuclear material, nuclear third party liability, radiation protection and environmental protection. (NEA) [fr
Operating reactors licensing actions summary. Vol. 3, No. 3
International Nuclear Information System (INIS)
1983-04-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regularory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program
Li-Tempel, Ting; Larra, Mauro F; Winnikes, Ulrike; Tempel, Tobias; DeRijk, Roel H; Schulz, André; Schächinger, Hartmut; Meyer, Jobst; Schote, Andrea B
2016-09-01
The hypothalamus-pituitary-adrenal (HPA) axis is a crucial endocrine system for coping with stress. A reliable and stable marker for the basal state of that system is the cortisol awakening response (CAR). We examined the influence of variants of four relevant candidate genes; the mineralocorticoid receptor gene (MR), the glucocorticoid receptor gene (GR), the serotonin transporter gene (5-HTT) and the gene encoding the brain-derived neurotrophic factor (BDNF) on CAR and self-perceived stress in 217 healthy subjects. We found that polymorphisms of GR influenced both, the basal state of the HPA axis as well as self-perceived stress. MR only associated with self-perceived stress and 5-HTT only with CAR. BDNF did not affected any of the investigated indices. In summary, we suggest that GR variants together with the CAR and supplemented with self reports on perceived stress might be useful indicators for the basal HPA axis activity. Copyright © 2016 Elsevier B.V. All rights reserved.
FDIC Summary of Deposits (SOD) Download File
Federal Deposit Insurance Corporation — The FDIC's Summary of Deposits (SOD) download file contains deposit data for branches and offices of all FDIC-insured institutions. The Federal Deposit Insurance...
Summary statistics for end-point conditioned continuous-time Markov chains
DEFF Research Database (Denmark)
Hobolth, Asger; Jensen, Jens Ledet
Continuous-time Markov chains are a widely used modelling tool. Applications include DNA sequence evolution, ion channel gating behavior and mathematical finance. We consider the problem of calculating properties of summary statistics (e.g. mean time spent in a state, mean number of jumps between...... two states and the distribution of the total number of jumps) for discretely observed continuous time Markov chains. Three alternative methods for calculating properties of summary statistics are described and the pros and cons of the methods are discussed. The methods are based on (i) an eigenvalue...... decomposition of the rate matrix, (ii) the uniformization method, and (iii) integrals of matrix exponentials. In particular we develop a framework that allows for analyses of rather general summary statistics using the uniformization method....
Savannah River Site Environmental Report for 1995 Summary Pamphlet (U)
International Nuclear Information System (INIS)
Arnett, M.W.; Mamatey, A.
1995-01-01
Welcome to the Savannah River Site Environmental Report for 1995 Summary Pamphlet.Ibis pamphlet is written so you can better understand what goes on at the Savannah River Site and how it affects the environment and you personally. We hope this document also will help answer your questions on radiation and its effects. In this pamphlet we will discuss the operations at SRS, the potential impact of operations on the environment and the public, and special programs that SRS supports. This pamphlet is a summary of a detailed re- port entitled Savannah River Site Environmental Report for 1995 The report contains a summary of environmental Monitoring activities for the calendar year 1995. Additional data on groundwater are found in quarterly groundwater reports
Mineral commodity summaries 2015
,
2015-01-01
Each chapter of the 2015 edition of the U.S. Geological Survey (USGS) Mineral Commodity Summaries (MCS) includes information on events, trends, and issues for each mineral commodity as well as discussions and tabular presentations on domestic industry structure, Government programs, tariffs, 5-year salient statistics, and world production and resources. The MCS is the earliest comprehensive source of 2014 mineral production data for the world. More than 90 individual minerals and materials are covered by two-page synopses.
Summary and Outlook for KEKTC5
International Nuclear Information System (INIS)
Quinn, Helen R
2002-01-01
This is the summary talk of a meeting held at the KEK, Tsukuba, Japan, November 20-22, 2001. This meeting has been a wonderful testimony to the success of particle physics in Japan. The hosts are involved in all aspects of flavor physics, both with the world-class facilities in this laboratory and elsewhere in this country, and through their participation in experiments elsewhere. The results they have shown these past few days are at the forefront of B physics and neutrino physics, and the plans for the future we have seen are equally impressive. I give a brief summary of the talks we heard, and a few comments of my own on various points that have been made. Other talks given at this meeting are referred to by the speakers last name; these talks will appear in the same proceedings. See these talks for the detailed references for each subject
Allen Brain Atlas-Driven Visualizations: a web-based gene expression energy visualization tool.
Zaldivar, Andrew; Krichmar, Jeffrey L
2014-01-01
The Allen Brain Atlas-Driven Visualizations (ABADV) is a publicly accessible web-based tool created to retrieve and visualize expression energy data from the Allen Brain Atlas (ABA) across multiple genes and brain structures. Though the ABA offers their own search engine and software for researchers to view their growing collection of online public data sets, including extensive gene expression and neuroanatomical data from human and mouse brain, many of their tools limit the amount of genes and brain structures researchers can view at once. To complement their work, ABADV generates multiple pie charts, bar charts and heat maps of expression energy values for any given set of genes and brain structures. Such a suite of free and easy-to-understand visualizations allows for easy comparison of gene expression across multiple brain areas. In addition, each visualization links back to the ABA so researchers may view a summary of the experimental detail. ABADV is currently supported on modern web browsers and is compatible with expression energy data from the Allen Mouse Brain Atlas in situ hybridization data. By creating this web application, researchers can immediately obtain and survey numerous amounts of expression energy data from the ABA, which they can then use to supplement their work or perform meta-analysis. In the future, we hope to enable ABADV across multiple data resources.
Allen Brain Atlas-Driven Visualizations: A Web-Based Gene Expression Energy Visualization Tool
Directory of Open Access Journals (Sweden)
Andrew eZaldivar
2014-05-01
Full Text Available The Allen Brain Atlas-Driven Visualizations (ABADV is a publicly accessible web-based tool created to retrieve and visualize expression energy data from the Allen Brain Atlas (ABA across multiple genes and brain structures. Though the ABA offers their own search engine and software for researchers to view their growing collection of online public data sets, including extensive gene expression and neuroanatomical data from human and mouse brain, many of their tools limit the amount of genes and brain structures researchers can view at once. To complement their work, ABADV generates multiple pie charts, bar charts and heat maps of expression energy values for any given set of genes and brain structures. Such a suite of free and easy-to-understand visualizations allows for easy comparison of gene expression across multiple brain areas. In addition, each visualization links back to the ABA so researchers may view a summary of the experimental detail. ABADV is currently supported on modern web browsers and is compatible with expression energy data from the Allen Mouse Brain Atlas in situ hybridization data. By creating this web application, researchers can immediately obtain and survey numerous amounts of expression energy data from the ABA, which they can then use to supplement their work or perform meta-analysis. In the future, we hope to enable ABADV across multiple data resources.
The putative protein methyltransferase LAE1 controls cellulase gene expression in Trichoderma reesei
Seiboth, Bernhard; Karimi, Razieh Aghcheh; Phatale, Pallavi A; Linke, Rita; Hartl, Lukas; Sauer, Dominik G; Smith, Kristina M; Baker, Scott E; Freitag, Michael; Kubicek, Christian P
2012-01-01
Summary Trichoderma reesei is an industrial producer of enzymes that degrade lignocellulosic polysaccharides to soluble monomers, which can be fermented to biofuels. Here we show that the expression of genes for lignocellulose degradation are controlled by the orthologous T. reesei protein methyltransferase LAE1. In a lae1 deletion mutant we observed a complete loss of expression of all seven cellulases, auxiliary factors for cellulose degradation, β-glucosidases and xylanases were no longer expressed. Conversely, enhanced expression of lae1 resulted in significantly increased cellulase gene transcription. Lae1-modulated cellulase gene expression was dependent on the function of the general cellulase regulator XYR1, but also xyr1 expression was LAE1-dependent. LAE1 was also essential for conidiation of T. reesei. Chromatin immunoprecipitation followed by high-throughput sequencing (‘ChIP-seq’) showed that lae1 expression was not obviously correlated with H3K4 di- or trimethylation (indicative of active transcription) or H3K9 trimethylation (typical for heterochromatin regions) in CAZyme coding regions, suggesting that LAE1 does not affect CAZyme gene expression by directly modulating H3K4 or H3K9 methylation. Our data demonstrate that the putative protein methyltransferase LAE1 is essential for cellulase gene expression in T. reesei through mechanisms that remain to be identified. PMID:22554051
U.S. Nuclear Power Plant Operating Cost and Experience Summaries
International Nuclear Information System (INIS)
Reid, RL
2003-01-01
The ''U.S. Nuclear Power Plant Operating Cost and Experience Summaries'' (NUREG/CR-6577, Supp. 2) report has been prepared to provide historical operating cost and experience information on U.S. commercial nuclear power plants during 2000-2001. Costs incurred after initial construction are characterized as annual production costs, which represent fuel and plant operating and maintenance expenses, and capital expenditures related to facility additions/modifications, which are included in the plant capital asset base. As discussed in the report, annual data for these two cost categories were obtained from publicly available reports and must be accepted as having different degrees of accuracy and completeness. Treatment of inconclusive and incomplete data is discussed. As an aid to understanding the fluctuations in the cost histories, operations summaries for each nuclear unit are provided. The intent of these summaries is to identify important operating events; refueling, major maintenance, and other significant outages; operating milestones; and significant licensing or enforcement actions. Information used in the summaries is condensed from operating reports submitted by the licensees, the Nuclear Regulatory Commission (NRC) database for enforcement actions, and outage reports
SNAP and AI Fuel Summary Report
International Nuclear Information System (INIS)
Lords, R.E.
1994-08-01
The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized
Novel Myopia Genes and Pathways Identified From Syndromic Forms of Myopia
Loughman, James; Wildsoet, Christine F.; Williams, Cathy; Guggenheim, Jeremy A.
2018-01-01
Purpose To test the hypothesis that genes known to cause clinical syndromes featuring myopia also harbor polymorphisms contributing to nonsyndromic refractive errors. Methods Clinical phenotypes and syndromes that have refractive errors as a recognized feature were identified using the Online Mendelian Inheritance in Man (OMIM) database. One hundred fifty-four unique causative genes were identified, of which 119 were specifically linked with myopia and 114 represented syndromic myopia (i.e., myopia and at least one other clinical feature). Myopia was the only refractive error listed for 98 genes and hyperopia and the only refractive error noted for 28 genes, with the remaining 28 genes linked to phenotypes with multiple forms of refractive error. Pathway analysis was carried out to find biological processes overrepresented within these sets of genes. Genetic variants located within 50 kb of the 119 myopia-related genes were evaluated for involvement in refractive error by analysis of summary statistics from genome-wide association studies (GWAS) conducted by the CREAM Consortium and 23andMe, using both single-marker and gene-based tests. Results Pathway analysis identified several biological processes already implicated in refractive error development through prior GWAS analyses and animal studies, including extracellular matrix remodeling, focal adhesion, and axon guidance, supporting the research hypothesis. Novel pathways also implicated in myopia development included mannosylation, glycosylation, lens development, gliogenesis, and Schwann cell differentiation. Hyperopia was found to be linked to a different pattern of biological processes, mostly related to organogenesis. Comparison with GWAS findings further confirmed that syndromic myopia genes were enriched for genetic variants that influence refractive errors in the general population. Gene-based analyses implicated 21 novel candidate myopia genes (ADAMTS18, ADAMTS2, ADAMTSL4, AGK, ALDH18A1, ASXL1, COL4A1
Why Summary Comorbidity Measures Such As the Charlson Comorbidity Index and Elixhauser Score Work.
Austin, Steven R; Wong, Yu-Ning; Uzzo, Robert G; Beck, J Robert; Egleston, Brian L
2015-09-01
Comorbidity adjustment is an important component of health services research and clinical prognosis. When adjusting for comorbidities in statistical models, researchers can include comorbidities individually or through the use of summary measures such as the Charlson Comorbidity Index or Elixhauser score. We examined the conditions under which individual versus summary measures are most appropriate. We provide an analytic proof of the utility of comorbidity summary measures when used in place of individual comorbidities. We compared the use of the Charlson and Elixhauser scores versus individual comorbidities in prognostic models using a SEER-Medicare data example. We examined the ability of summary comorbidity measures to adjust for confounding using simulations. We devised a mathematical proof that found that the comorbidity summary measures are appropriate prognostic or adjustment mechanisms in survival analyses. Once one knows the comorbidity score, no other information about the comorbidity variables used to create the score is generally needed. Our data example and simulations largely confirmed this finding. Summary comorbidity measures, such as the Charlson Comorbidity Index and Elixhauser scores, are commonly used for clinical prognosis and comorbidity adjustment. We have provided a theoretical justification that validates the use of such scores under many conditions. Our simulations generally confirm the utility of the summary comorbidity measures as substitutes for use of the individual comorbidity variables in health services research. One caveat is that a summary measure may only be as good as the variables used to create it.
Cichonska, Anna; Rousu, Juho; Marttinen, Pekka; Kangas, Antti J; Soininen, Pasi; Lehtimäki, Terho; Raitakari, Olli T; Järvelin, Marjo-Riitta; Salomaa, Veikko; Ala-Korpela, Mika; Ripatti, Samuli; Pirinen, Matti
2016-07-01
A dominant approach to genetic association studies is to perform univariate tests between genotype-phenotype pairs. However, analyzing related traits together increases statistical power, and certain complex associations become detectable only when several variants are tested jointly. Currently, modest sample sizes of individual cohorts, and restricted availability of individual-level genotype-phenotype data across the cohorts limit conducting multivariate tests. We introduce metaCCA, a computational framework for summary statistics-based analysis of a single or multiple studies that allows multivariate representation of both genotype and phenotype. It extends the statistical technique of canonical correlation analysis to the setting where original individual-level records are not available, and employs a covariance shrinkage algorithm to achieve robustness.Multivariate meta-analysis of two Finnish studies of nuclear magnetic resonance metabolomics by metaCCA, using standard univariate output from the program SNPTEST, shows an excellent agreement with the pooled individual-level analysis of original data. Motivated by strong multivariate signals in the lipid genes tested, we envision that multivariate association testing using metaCCA has a great potential to provide novel insights from already published summary statistics from high-throughput phenotyping technologies. Code is available at https://github.com/aalto-ics-kepaco anna.cichonska@helsinki.fi or matti.pirinen@helsinki.fi Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press.
Directory of Open Access Journals (Sweden)
Michael Seiler
2018-04-01
Full Text Available Summary: Hotspot mutations in splicing factor genes have been recently reported at high frequency in hematological malignancies, suggesting the importance of RNA splicing in cancer. We analyzed whole-exome sequencing data across 33 tumor types in The Cancer Genome Atlas (TCGA, and we identified 119 splicing factor genes with significant non-silent mutation patterns, including mutation over-representation, recurrent loss of function (tumor suppressor-like, or hotspot mutation profile (oncogene-like. Furthermore, RNA sequencing analysis revealed altered splicing events associated with selected splicing factor mutations. In addition, we were able to identify common gene pathway profiles associated with the presence of these mutations. Our analysis suggests that somatic alteration of genes involved in the RNA-splicing process is common in cancer and may represent an underappreciated hallmark of tumorigenesis. : Seiler et al. report that 119 splicing factor genes carry putative driver mutations over 33 tumor types in TCGA. The most common mutations appear to be mutually exclusive and are associated with lineage-independent altered splicing. Samples with these mutations show deregulation of cell-autonomous pathways and immune infiltration. Keywords: splicing, SF3B1, U2AF1, SRSF2, RBM10, FUBP1, cancer, mutation
Divon, Hege H; Rothan-Denoyes, Beatrice; Davydov, Olga; DI Pietro, Antonio; Fluhr, Robert
2005-07-01
SUMMARY Nitrogen is an essential growth component whose availability will limit microbial spread, and as such it serves as a key control point in dictating an organism's adaptation to various environments. Little is known about fungal nutrition in planta. To enhance our understanding of this process we examined the transcriptional adaptation of Fusarium oxysporum f. sp. lycopersici, the causal agent for vascular wilt in tomato, during nutritional stress and plant colonization. Using RT-PCR and microarray technology we compared fungal gene expression in planta to axenic nitrogen starvation culture. Several expressed sequence tags, representing at least four genes, were identified that are concomitantly induced during nitrogen starvation and in planta growth. Three of these genes show similarity to a general amino acid permease, a peptide transporter and an uricase, all functioning in organic nitrogen acquisition. We further show that these genes represent a distinguishable subset of the nitrogen-responsive transcripts that respond to amino acids commonly available in the plant. Our results indicate that nitrogen starvation partially mimics in planta growth conditions, and further suggest that minute levels of organic nitrogen sources dictate the final outcome of fungal gene expression in planta. The nature of the identified transcripts suggests modes of nutrient uptake and survival for Fusarium during colonization.
Stream Habitat Reach Summary - NCWAP [ds158
California Natural Resource Agency — The Stream Habitat - NCWAP - Reach Summary [ds158] shapefile contains in-stream habitat survey data summarized to the stream reach level. It is a derivative of the...
FIXING HEALTH SYSTEMS / Executive Summary (2008 update ...
International Development Research Centre (IDRC) Digital Library (Canada)
2010-12-14
Dec 14, 2010 ... FIXING HEALTH SYSTEMS / Executive Summary (2008 update) ... In several cases, specific approaches recommended by the TEHIP team have been acted upon regionally and internationally, including the ... Related articles ...
Summaries of FY 1982 research in the chemical sciences
Energy Technology Data Exchange (ETDEWEB)
None
1982-09-01
The purpose of this booklet is to help those interested in research supported by the Department of Energy's Division of Chemical Sciences, which is one of six Divisions of the Office of Basic Energy Sciences in the Office of Energy Research. These summaries are intended to provide a rapid means for becoming acquainted with the Chemical Sciences program to members of the scientific and technological public and interested persons in the Legislative and Executive Branches of the Government. Areas of research supported by the Division are to be seen in the section headings, the index and the summaries themselves. Energy technologies which may be advanced by use of the basic knowledge discovered in this program can be seen in the index and again (by reference) in the summaries. The table of contents lists the following: photochemical and radiation sciences; chemical physics; atomic physics; chemical energy; separation and analysis; chemical engineering sciences; offsite contracts; equipment funds; special facilities; topical index; institutional index for offsite contracts; investigator index.
Summaries of FY 1982 research in the chemical sciences
International Nuclear Information System (INIS)
1982-09-01
The purpose of this booklet is to help those interested in research supported by the Department of Energy's Division of Chemical Sciences, which is one of six Divisions of the Office of Basic Energy Sciences in the Office of Energy Research. These summaries are intended to provide a rapid means for becoming acquainted with the Chemical Sciences program to members of the scientific and technological public and interested persons in the Legislative and Executive Branches of the Government. Areas of research supported by the Division are to be seen in the section headings, the index and the summaries themselves. Energy technologies which may be advanced by use of the basic knowledge discovered in this program can be seen in the index and again (by reference) in the summaries. The table of contents lists the following: photochemical and radiation sciences; chemical physics; atomic physics; chemical energy; separation and analysis; chemical engineering sciences; offsite contracts; equipment funds; special facilities; topical index; institutional index for offsite contracts; investigator index
Zhang, Ao; Tian, Suyan
2018-05-01
Pathway-based feature selection algorithms, which utilize biological information contained in pathways to guide which features/genes should be selected, have evolved quickly and become widespread in the field of bioinformatics. Based on how the pathway information is incorporated, we classify pathway-based feature selection algorithms into three major categories-penalty, stepwise forward, and weighting. Compared to the first two categories, the weighting methods have been underutilized even though they are usually the simplest ones. In this article, we constructed three different genes' connectivity information-based weights for each gene and then conducted feature selection upon the resulting weighted gene expression profiles. Using both simulations and a real-world application, we have demonstrated that when the data-driven connectivity information constructed from the data of specific disease under study is considered, the resulting weighted gene expression profiles slightly outperform the original expression profiles. In summary, a big challenge faced by the weighting method is how to estimate pathway knowledge-based weights more accurately and precisely. Only until the issue is conquered successfully will wide utilization of the weighting methods be impossible. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Summary status of K Basins sludge characterization
International Nuclear Information System (INIS)
Baker, R.B.
1995-01-01
A number of activities are underway as part of the Spent Nuclear Fuels Project (SNFP) related to the processing and disposing of sludge in the 105-K Basins (K Basins). Efforts to rigorously define data requirements for these activities are being made using the Data Quality Objectives (DQO) process. Summaries of current sludge characterization data are required to both help support this DQO process and to allow continued progress with on-going engineering activities (e.g., evaluations of disposal alternatives). This document provides the status of K Basins sludge characterization data currently available to the Nuclear Fuel Evaluations group. This group is tasked by the SNFP to help develop and maintain the characterization baseline for the K Basins. The specific objectives of this document are to: (1) provide a current summary (and set of references) of sludge characterization data for use by SNFP initiatives, to avoid unnecessary duplication of effort and to support on-going initiatives; (2) submit these data to an open forum for review and comment, and identify additional sources of significant data that may be available; (3) provide a summary of current data to use as part of the basis to develop requirements for additional sludge characterization data through the DQO process; (4) provide an overview of the intended activities that will be used to develop and maintain the sludge characterization baseline
Operating reactors licensing actions summary. Vol. 3, No. 6
International Nuclear Information System (INIS)
1983-07-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Management and Program Analysis. This summary report is published primarily for internal NRC use in managing the operating reactors licensing actions program. Its content will change based on NRC management informational requirements
Operating reactors licensing actions summary. Volume 5, No. 6
International Nuclear Information System (INIS)
1985-08-01
The operating reactors licensing actions summary is designed to provide the management of the Nuclear Regulatory Commission (NRC) with an overview of licensing actions dealing with operating power and nonpower reactors. These reports utilize data collected from the Division of Licensing in the Office of Nuclear Reactor Regulation and are prepared by the Office of Resource Management. This summary report is published for internal NRC use in managing the Operating Reactors Licensing Actions Program. Its content will change based on NRC management informational requirements
Global Surface Summary of the Day - GSOD
National Oceanic and Atmospheric Administration, Department of Commerce — Global Surface Summary of the Day is derived from The Integrated Surface Hourly (ISH) dataset. The ISH dataset includes global data obtained from the USAF...
2011 statistical summaries : FTA grant assistance programs.
2013-05-01
The 2011 Statistical Summaries provides information about the Federal Transit Administrations (FTA) major financial aid programs for Federal Fiscal Year (FY) 2011. The report covers the following programs: Urbanized Area Formula, Non-urbanized Are...
2010 statistical summaries : FTA grant assistance programs.
2013-07-01
The 2010 Statistical Summaries provides information about the Federal Transit Administrations (FTA) major financial aid programs for Federal Fiscal Year (FY) 2010. The report covers the following programs: Urbanized Area Formula, Non-urbanized Are...
2012 statistical summaries : FTA grant assistance programs.
2013-12-01
The 2012 Statistical Summaries provides information about the Federal Transit Administrations (FTA) major financial aid programs for : Federal Fiscal Year (FY) 2012. The report covers the following programs: Urbanized Area Formula, Non-urbanized A...
Gene expression programming for prediction of scour depth downstream of sills
Azamathulla, H. Md.
2012-08-01
SummaryLocal scour is crucial in the degradation of river bed and the stability of grade control structures, stilling basins, aprons, ski-jump bucket spillways, bed sills, weirs, check dams, etc. This short communication presents gene-expression programming (GEP), which is an extension to genetic programming (GP), as an alternative approach to predict scour depth downstream of sills. Published data were compiled from the literature for the scour depth downstream of sills. The proposed GEP approach gives satisfactory results (R2 = 0.967 and RMSE = 0.088) compared to the existing predictors (Chinnarasri and Kositgittiwong, 2008) with R2 = 0.87 and RMSE = 2.452 for relative scour depth.
Compendium of Executive Summaries from the Maglev System Concept Definition. Final Reports.
1993-03-01
This report contains the Executive Summaries from the four System Concept Definition (SCD) studies awarded under the National Maglev Initiative...These summaries present the technical feasibility, performance, capital, operating and maintenance costs for a maglev system that would be available by
FNS Research Corner: Summary of Research
Gola, Alice Ann H.; Burdg, Jinee
2018-01-01
The FNS Research Corner provides a continuing series to summarize recently completed and current research conducted by the U.S. Department of Agriculture's Food and Nutrition Service (FNS) in the area of child nutrition. Summaries of recently completed research projects and in-progress research are provided in this article.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Summary action. 4.10 Section 4.10 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE RULES OF PRACTICE GOVERNING PROCEEDINGS UNDER THE ANIMAL WELFARE ACT Supplemental Rules of...
Assessing Health Professional Education: Workshop Summary
Cuff, Patricia A.
2014-01-01
"Assessing Health Professional Education" is the summary of a workshop hosted by the Institute of Medicine's Global Forum on Innovation in Health Professional Education to explore assessment of health professional education. At the event, Forum members shared personal experiences and learned from patients, students, educators, and…
... correctly, a child can have a genetic disorder. Gene therapy is an experimental technique that uses genes to ... or prevent disease. The most common form of gene therapy involves inserting a normal gene to replace an ...
Regional Management Plan: Summary report
International Nuclear Information System (INIS)
Drobny, N.L.
1986-01-01
This summary report describes the results of a 16-month project to develop a Regional Management Plan for low-level radioactive waste management in a seven-state area. The seven states are Indiana, Iowa, Michigan, Minnesota, Missouri, Ohio, and Wisconsin. These states have formed the Midwest Interstate Low-Level Radioactive Waste Commission in accord with Congressional requirements established in 1980. 14 refs., 13 figs., 9 tabs
Separations innovative concepts: Project summary
Energy Technology Data Exchange (ETDEWEB)
Lee, V.E. (ed.)
1988-05-01
This project summary includes the results of 10 innovations that were funded under the US Department's Innovative Concept Programs. The concepts address innovations that can substantially reduce the energy used in industrial separations. Each paper describes the proposed concept, and discusses the concept's potential energy savings, market applications, technical feasibility, prior work and state of the art, and future development needs.
Summary of the Day Observations - Misawa Japan
National Oceanic and Atmospheric Administration, Department of Commerce — Summary of the Day Observations - Misawa Japan is a collection of data summarizing daily weather observations taken at Misawa Naval Air Station, near the north end...
International Nuclear Information System (INIS)
Dover, C.B.
1992-12-01
We present a summary of the many new results in antiproton (bar p) physics presented at the LEAP '92 conference, in the areas of meson spectroscopy, bar NN scattering, annihilation and spin observables, strangeness and charm production, bar N annihilation in nuclei, atomic physics with very low energy bar p's, the exploration of fundamental symmetries and interactions with bar p (CP, T, CPT, gravitation), and the prospects for new bar p facilities at ultralow energies or energies above the LEAR regime (≥ 2 GeV/c)
Summary of recorded external radiation doses for Hanford workers 1944--1989
International Nuclear Information System (INIS)
Buschbom, R.L.; Gilbert, E.S.
1993-10-01
This report summarizes recorded external radiation doses for the years 1944 through 1989 received by operations workers who were included in the Hanford Mortality Study. This study population includes all operations workers who were initially employed at the Hanford site from 1944 through 1978. Descriptive summaries are provided for both annual and cumulative whole body penetrating doses. Although the main emphasis of the report is on recorded whole body penetrating dose, summary tables are included for the components of whole body penetrating dose, non-penetrating dose, and extremity dose. Summaries are provided for the entire study population and for subgroups of the population defined by sex, age, number of years since first monitoring, and socioeconomic groups
Improving the accuracy of operation coding in surgical discharge summaries
Martinou, Eirini; Shouls, Genevieve; Betambeau, Nadine
2014-01-01
Procedural coding in surgical discharge summaries is extremely important; as well as communicating to healthcare staff which procedures have been performed, it also provides information that is used by the hospital's coding department. The OPCS code (Office of Population, Censuses and Surveys Classification of Surgical Operations and Procedures) is used to generate the tariff that allows the hospital to be reimbursed for the procedure. We felt that the OPCS coding on discharge summaries was often incorrect within our breast and endocrine surgery department. A baseline measurement over two months demonstrated that 32% of operations had been incorrectly coded, resulting in an incorrect tariff being applied and an estimated loss to the Trust of £17,000. We developed a simple but specific OPCS coding table in collaboration with the clinical coding team and breast surgeons that summarised all operations performed within our department. This table was disseminated across the team, specifically to the junior doctors who most frequently complete the discharge summaries. Re-audit showed 100% of operations were accurately coded, demonstrating the effectiveness of the coding table. We suggest that specifically designed coding tables be introduced across each surgical department to ensure accurate OPCS codes are used to produce better quality surgical discharge summaries and to ensure correct reimbursement to the Trust. PMID:26734286
Systemic RNAi-mediated Gene Silencing in Nonhuman Primate and Rodent Myeloid Cells
Directory of Open Access Journals (Sweden)
Tatiana I Novobrantseva
2012-01-01
Full Text Available Leukocytes are central regulators of inflammation and the target cells of therapies for key diseases, including autoimmune, cardiovascular, and malignant disorders. Efficient in vivo delivery of small interfering RNA (siRNA to immune cells could thus enable novel treatment strategies with broad applicability. In this report, we develop systemic delivery methods of siRNA encapsulated in lipid nanoparticles (LNP for durable and potent in vivo RNA interference (RNAi-mediated silencing in myeloid cells. This work provides the first demonstration of siRNA-mediated silencing in myeloid cell types of nonhuman primates (NHPs and establishes the feasibility of targeting multiple gene targets in rodent myeloid cells. The therapeutic potential of these formulations was demonstrated using siRNA targeting tumor necrosis factor-α (TNFα which induced substantial attenuation of disease progression comparable to a potent antibody treatment in a mouse model of rheumatoid arthritis (RA. In summary, we demonstrate a broadly applicable and therapeutically relevant platform for silencing disease genes in immune cells.
Daily Summary Observations, First Order - United States
National Oceanic and Atmospheric Administration, Department of Commerce — This collection consists of data that has been quality controlled through both an automated and manual QC processes. The dataset consisted of summary of the day data...
Energy Technology Data Exchange (ETDEWEB)
Reynolds, Tim [Inta Communication Limited for European Service Network/ DG Research, Trillium House, 32 New Street, St. Neots, Cambridge PE19 1AJ (United Kingdom)
2004-07-01
The summaries were derived from presentations, interviews and discussions at the conference. The summaries are given at two levels, overall for the conference and for specific sessions as follows: 1) Overall Conference: 'A Sound Scientific Basis for Serious Decisions; 2) Sessions on EC Policy and Socio-Political Issues: 'Promoting Safety and Protecting Society'; 3) Session on P and T: 'Partitioning and Transmutation: A Technical Fix or Technical Training?'; 4) Sessions on Geological Disposal and Research Networking: 'No Technical Barriers to Geological Disposal'. First an overall summary of Euradwaste '04 is presented. Significant progress was made on the technical and scientific basis for geological disposal of radioactive waste during the European Commission's Fifth EURATOM Framework Programme for Research (FP5). Deep geological disposal is technically feasible now and can demonstrate the guarantees of long-term isolation and protection of the public. In parallel, socio-political studies have produced methodologies for constructive dialogue with potential host communities that reflect the honesty and openness expected by a democratic society. A harmonized legislative framework for nuclear safety and waste disposal across the enlarged European Union is currently being discussed. Disposal in deep (> 300 metre) geological repositories, the favoured strategy in Europe for long-lived high-level radioactive waste, is now possible. The Sessions on EC Policy and Socio-Political Issues are summarized as follows. The opening day of Euradwaste '04 focused on European Commission policy, including the proposed Directives on disposal of radioactive waste and nuclear safety and socio-political aspects including governance and decision making, public perception/acceptance of waste disposal and its sustainability. A decision on the proposed package will now be made after Union enlargement. Public agreement on the siting of
Undergraduate Chemistry Education: A Workshop Summary
Sawyer, Keegan; Alper, Joe
2014-01-01
"Undergraduate Chemistry Education" is the summary of a workshop convened in May 2013 by the Chemical Science Roundtable of the National Research Council to explore the current state of undergraduate chemistry education. Research and innovation in undergraduate chemistry education has been done for many years, and one goal of this…
Summary of measurements with MicroVent
DEFF Research Database (Denmark)
Dreau, Jerome Le; Heiselberg, Per Kvols; Jensen, Rasmus Lund
This summary presents the main results when MicroVent is used in the cooling case, without heat recovery. Experiments have thus been performed with relatively low inlet air temperature (below 15°C). Different solutions have been compared to decrease the risk of draught in the occupied zone: ‐ usi...
International Working Group on Fast Reactors Thirteenth Annual Meeting. Summary Report. Part II
International Nuclear Information System (INIS)
1980-10-01
The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes
International Working Group on Fast Reactors Thirteenth Annual Meeting. Summary Report. Part I
International Nuclear Information System (INIS)
1980-09-01
The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes
International Working Group on Past Reactors Thirteenth Annual Meeting. Summary Report. Part III
International Nuclear Information System (INIS)
1981-04-01
The Thirteenth Annual Meeting of the IAEA International Working Group on Fast Reactors was held at the IAEA Headquarters, Vienna, Austria from 9 to 11 April 1980. The Summary Report (Part I) contains the Minutes of the Meeting. The Summary Report (Part II) contains the papers which review the national programme in the field of LMFBRs and other presentations at the Meeting. The Summary Report (Part III) contains the discussions on the review of the national programmes
BACTERICIDAL COATINGS ON TEXTILES FOR REMEDIATION OF INTERMICROBE ACTIVITY (BaCTeRIA) SUMMARY REPORT
2017-07-07
TEXTILES FOR REMEDIATION OF INTERMICROBE ACTIVITY (BaCTeRIA) SUMMARY REPORT by Tobyn A. Branck Courtney M. Cowell Jennifer M. Rego and...October 2011 – September 2015 4. TITLE AND SUBTITLE BACTERICIDAL COATINGS ON TEXTILES FOR REMEDIATION OF INTERMICROBE ACTIVITY (BaCTeRIA) SUMMARY REPORT... REMEDIATION OF INTERMICROBE ACTIVITY (BaCTeRIA) SUMMARY REPORT Introduction The Biological Sciences and Technology Team (BSTT), Warfighter
Collections Summary for Fort Indiantown Gap, Pennsylvania
National Research Council Canada - National Science Library
1995-01-01
..., and to draft Section 6 Summary letters for each installation. A two-stage process was used to identify, locate and assess the contents of the collections, consisting of archival research and telephone interviews with the repository personnel...
Advanced Energy Projects FY 1990 research summaries
International Nuclear Information System (INIS)
1990-09-01
This report serves as a guide to prepare proposals and provides summaries of the research projects active in FY 1990, sponsored by the Office of Basic Energy Sciences Division of Advanced Energy Projects, Department of Energy. (JF)
The Multi-Purpose Tool of Tumor Immunotherapy: Gene-Engineered T Cells.
Mo, Zeming; Du, Peixin; Wang, Guoping; Wang, Yongsheng
2017-01-01
A detailed summary of the published clinical trials of chimeric antigen receptor T cells (CAR-T) and TCR-transduced T cells (TCR-T) was constructed to understand the development trend of adoptive T cell therapy (ACT). In contrast to TCR-T, the number of CAR-T clinical trials has increased dramatically in China in the last three years. The ACT seems to be very prosperous. But, the multidimensional interaction of tumor, tumor associated antigen (TAA) and normal tissue exacerbates the uncontrolled outcome of T cells gene therapy. It reminds us the importance that optimizing treatment security to prevent the fatal serious adverse events. How to balance the safety and effectiveness of the ACT? At least six measures can potentially optimize the safety of ACT. At the same time, with the application of gene editing techniques, more endogenous receptors are disrupted while more exogenous receptors are expressed on T cells. As a multi-purpose tool of tumor immunotherapy, gene-engineered T cells (GE-T) have been given different functional weapons. A network which is likely to link radiation therapy, tumor vaccines, CAR-T and TCR-T is being built. Moreover, more and more evidences indicated that the combination of the ACT and other therapies would further enhance the anti-tumor capacity of the GE-T.
Sawaki, Yoshiharu; Kobayashi, Yuriko; Kihara-Doi, Tomonori; Nishikubo, Nobuyuki; Kawazu, Tetsu; Kobayashi, Masatomo; Kobayashi, Yasufumi; Iuchi, Satoshi; Koyama, Hiroyuki; Sato, Shigeru
2014-06-01
Tolerance to soil acidity is an important trait for eucalyptus clones that are introduced to commercial forestry plantations in pacific Asian countries, where acidic soil is dominant in many locations. A conserved transcription factor regulating aluminum (Al) and proton (H⁺) tolerance in land-plant species, STOP1 (SENSITIVE TOPROTON RHIZOTOXICITY 1)-like protein, was isolated by polymerase chain reaction-based cloning, and then suppressed by RNA interference in hairy roots produced by Agrobacterium rhizogenes-mediated transformation. Eucalyptus STOP1-like protein complemented proton tolerance in an Arabidopsis thaliana stop1-mutant, and localized to the nucleus in a transient assay of a green fluorescent protein fusion protein expressed in tobacco leaves by Agrobacterium tumefaciens-mediated transformation. Genes encoding a citrate transporting MULTIDRUGS AND TOXIC COMPOUND EXTRUSION protein and an orthologue of ALUMINUM SENSITIVE 3 were suppressed in transgenic hairy roots in which the STOP1 orthologue was knocked down. In summary, we identified a series of genes for Al-tolerance in eucalyptus, including a gene for STOP1-like protein and the Al-tolerance genes it regulates. These genes may be useful for molecular breeding and genomic selection of elite clones to introduce into acid soil regions. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Hazmat Yearly Incident Summary Reports - Data Mining Tool
Department of Transportation — Series of Incident data and summary statistics reports produced which provide statistical information on incidents by type, year, geographical location, and others....
Semantic-Web Architecture for Electronic Discharge Summary Based on OWL 2.0 Standard.
Tahmasebian, Shahram; Langarizadeh, Mostafa; Ghazisaeidi, Marjan; Safdari, Reza
2016-06-01
Patients' electronic medical record contains all information related to treatment processes during hospitalization. One of the most important documents in this record is the record summary. In this document, summary of the whole treatment process is presented which is used for subsequent treatments and other issues pertaining to the treatment. Using suitable architecture for this document, apart from the aforementioned points we can use it in other fields such as data mining or decision making based on the cases. In this study, at first, a model for patient's medical record summary has been suggested using semantic web-based architecture. Then, based on service-oriented architecture and using Java programming language, a software solution was designed and run in a way to generate medical record summary with this structure and at the end, new uses of this structure was explained. in this study a structure for medical record summaries along with corrective points within semantic web has been offered and a software running within Java along with special ontologies are provided. After discussing the project with the experts of medical/health data management and medical informatics as well as clinical experts, it became clear that suggested design for medical record summary apart from covering many issues currently faced in the medical records has also many advantages including its uses in research projects, decision making based on the cases etc.
Hazing DEOCS 4.1 Construct Validity Summary
2017-08-01
Hazing DEOCS 4.1 Construct Validity Summary DEFENSE EQUAL OPPORTUNITY MANAGEMENT INSTITUTE DIRECTORATE OF...water; and the forced consumption of food , alcohol, drugs, or any other substance. Hazing can be conducted through the use of electronic devices or
Summary of third Nordic symposium on digital pathology.
Lundström, Claes; Waltersson, Marie; Persson, Anders; Treanor, Darren
2016-01-01
Cross-disciplinary and cross-sectorial collaboration is a key success factor for turning the promise of digital pathology into actual clinical benefits. The Nordic symposium on digital pathology (NDP) was created to promote knowledge exchange in this area, among stakeholders in health care, industry, and academia. This article is a summary of the third NDP symposium in Linkφping, Sweden. The Nordic experiences, including several hospitals using whole-slide imaging for substantial parts of their primary reviews, formed a fertile base for discussions among the 190 NDP attendees originating from 15 different countries. This summary also contains results from a survey on adoption and validation aspects of clinical digital pathology use.
Summary of third Nordic symposium on digital pathology
Directory of Open Access Journals (Sweden)
Claes Lundstrom
2016-01-01
Full Text Available Cross-disciplinary and cross-sectorial collaboration is a key success factor for turning the promise of digital pathology into actual clinical benefits. The Nordic symposium on digital pathology (NDP was created to promote knowledge exchange in this area, among stakeholders in health care, industry, and academia. This article is a summary of the third NDP symposium in Linkφping, Sweden. The Nordic experiences, including several hospitals using whole-slide imaging for substantial parts of their primary reviews, formed a fertile base for discussions among the 190 NDP attendees originating from 15 different countries. This summary also contains results from a survey on adoption and validation aspects of clinical digital pathology use.
Summary reports of activities under visiting research program
International Nuclear Information System (INIS)
1984-01-01
The Research Reactor Institute, Kyoto University, publishes any time the necessary data at the time of research and experiment, the conspicuous results obtained during research, new methods, the discussion on other papers and reports and so on as prompt reports, for example, the results of the functional test of various experimental facilities, the results of the test on things made for trial, radiation control, the state of waste treatment and the reports of study meetings. This is the summary report of the research carried out in the second half of 1983 by the common utilization of the facilities in the KURRI. The title, reporters and summary of 64 researches are reported. (Kako, I.)
The Circadian Clock Gene BMAL1 Coordinates Intestinal RegenerationSummary
Directory of Open Access Journals (Sweden)
Kyle Stokes
2017-07-01
Full Text Available Background & Aims: The gastrointestinal syndrome is an illness of the intestine caused by high levels of radiation. It is characterized by extensive loss of epithelial tissue integrity, which initiates a regenerative response by intestinal stem and precursor cells. The intestine has 24-hour rhythms in many physiological functions that are believed to be outputs of the circadian clock: a molecular system that produces 24-hour rhythms in transcription/translation. Certain gastrointestinal illnesses are worsened when the circadian rhythms are disrupted, but the role of the circadian clock in gastrointestinal regeneration has not been studied. Methods: We tested the timing of regeneration in the mouse intestine during the gastrointestinal syndrome. The role of the circadian clock was tested genetically using the BMAL1 loss of function mouse mutant in vivo, and in vitro using intestinal organoid culture. Results: The proliferation of the intestinal epithelium follows a 24-hour rhythm during the gastrointestinal syndrome. The circadian clock runs in the intestinal epithelium during this pathologic state, and the loss of the core clock gene, BMAL1, disrupts both the circadian clock and rhythmic proliferation. Circadian activity in the intestine involves a rhythmic production of inflammatory cytokines and subsequent rhythmic activation of the JNK stress response pathway. Conclusions: Our results show that a circadian rhythm in inflammation and regeneration occurs during the gastrointestinal syndrome. The study and treatment of radiation-induced illnesses, and other gastrointestinal illnesses, should consider 24-hour timing in physiology and pathology. Keywords: Intestine, Circadian Rhythms, Gastrointestinal Syndrome, TNF, Intestinal Stem Cells
NASA GeneLab Project: Bridging Space Radiation Omics with Ground Studies
Beheshti, Afshin; Miller, Jack; Kidane, Yared H.; Berrios, Daniel; Gebre, Samrawit G.; Costes, Sylvain V.
2018-01-01
Accurate assessment of risk factors for long-term space missions is critical for human space exploration: therefore it is essential to have a detailed understanding of the biological effects on humans living and working in deep space. Ionizing radiation from Galactic Cosmic Rays (GCR) is one of the major risk factors factor that will impact health of astronauts on extended missions outside the protective effects of the Earth's magnetic field. Currently there are gaps in our knowledge of the health risks associated with chronic low dose, low dose rate ionizing radiation, specifically ions associated with high (H) atomic number (Z) and energy (E). The GeneLab project (genelab.nasa.gov) aims to provide a detailed library of Omics datasets associated with biological samples exposed to HZE. The GeneLab Data System (GLDS) currently includes datasets from both spaceflight and ground-based studies, a majority of which involve exposure to ionizing radiation. In addition to detailed information for ground-based studies, we are in the process of adding detailed, curated dosimetry information for spaceflight missions. GeneLab is the first comprehensive Omics database for space related research from which an investigator can generate hypotheses to direct future experiments utilizing both ground and space biological radiation data. In addition to previously acquired data, the GLDS is continually expanding as Omics related data are generated by the space life sciences community. Here we provide a brief summary of space radiation related data available at GeneLab.
Comparative Transcriptome Analysis of Cultivated and Wild Watermelon during Fruit Development.
Guo, Shaogui; Sun, Honghe; Zhang, Haiying; Liu, Jingan; Ren, Yi; Gong, Guoyi; Jiao, Chen; Zheng, Yi; Yang, Wencai; Fei, Zhangjun; Xu, Yong
2015-01-01
Watermelon [Citrullus lanatus (Thunb.) Matsum. & Nakai] is an important vegetable crop world-wide. Watermelon fruit quality is a complex trait determined by various factors such as sugar content, flesh color and flesh texture. Fruit quality and developmental process of cultivated and wild watermelon are highly different. To systematically understand the molecular basis of these differences, we compared transcriptome profiles of fruit tissues of cultivated watermelon 97103 and wild watermelon PI296341-FR. We identified 2,452, 826 and 322 differentially expressed genes in cultivated flesh, cultivated mesocarp and wild flesh, respectively, during fruit development. Gene ontology enrichment analysis of these genes indicated that biological processes and metabolic pathways related to fruit quality such as sweetness and flavor were significantly changed only in the flesh of 97103 during fruit development, while those related to abiotic stress response were changed mainly in the flesh of PI296341-FR. Our comparative transcriptome profiling analysis identified critical genes potentially involved in controlling fruit quality traits including α-galactosidase, invertase, UDP-galactose/glucose pyrophosphorylase and sugar transporter genes involved in the determination of fruit sugar content, phytoene synthase, β-carotene hydroxylase, 9-cis-epoxycarotenoid dioxygenase and carotenoid cleavage dioxygenase genes involved in carotenoid metabolism, and 4-coumarate:coenzyme A ligase, cellulose synthase, pectinesterase, pectinesterase inhibitor, polygalacturonase inhibitor and α-mannosidase genes involved in the regulation of flesh texture. In addition, we found that genes in the ethylene biosynthesis and signaling pathway including ACC oxidase, ethylene receptor and ethylene responsive factor showed highly ripening-associated expression patterns, indicating a possible role of ethylene in fruit development and ripening of watermelon, a non-climacteric fruit. Our analysis provides
Discourse Measures for Basque Summary Grading
Zipitria, I.; Arruarte, A.; Elorriaga, J. A.
2013-01-01
In the context of Learning Technologies, the need to be able to assess the learning and domain comprehension in open-ended learner responses has been present in artificial intelligence and education since its beginnings. The advantage of using summaries is that they allow teachers to diagnose comprehension and the amount of information remembered…
Beryllium in aircraft brakes - a summary
International Nuclear Information System (INIS)
Zenczak, S.
1977-01-01
Beryllium has been in use in aircraft brakes for ten years. During the original design phases of the several aircraft programs using beryllium a number of problems requiring solution confronted the designers. In actual service the solution to these problems performed much better than had been anticipated. A summary is presented. (author)
Theoretical summary talk of QCD 2002
International Nuclear Information System (INIS)
Basu, Rahul
2003-01-01
This is a summary of the talks on QCD, not including QCD at finite temperature or density (which are discussed elsewhere) presented at the QCD 2002 meeting held at IIT, Kanpur. I have attempted to give only an overview of the talks since the details may be found in the individual contributions. (author)
Summaries of discussion groups and closeout
International Nuclear Information System (INIS)
1998-01-01
The Beam Instrumentation Workshop registrants selected the following topics for group discussions: Commercial technology and beam instrumentation, 4th generation light source instrumentation, feedback systems, beam loss monitors, calibration methods, high resolution and highly stable BPM methods, challenges in beam profiling. Summaries of these discussion sessions are listed in the article that follows
Summary of exotic collider concepts group
International Nuclear Information System (INIS)
Pellegrini, C.
1995-01-01
We present a summary of the discussions in the Exotic Collider Concepts Group. Most of the discussions were centered around the status and open problems for muon-muon and gamma-gamma colliders. In addition the group discussed some general problems and new results of accelerator physics. copyright 1995 American Institute of Physics
International Nuclear Information System (INIS)
Rezniczek, Günther A.; Jüngst, Friederike; Jütte, Hendrik; Tannapfel, Andrea; Hilal, Ziad; Hefler, Lukas A.; Reymond, Marc-André; Tempfer, Clemens B.
2016-01-01
Intraperitoneal chemotherapy is used to treat peritoneal cancer. The pattern of gene expression changes of peritoneal cancer during intraperitoneal chemotherapy has not been studied before. Pressurized intraperitoneal aerosol chemotherapy is a new form of intraperitoneal chemotherapy using repeated applications and allowing repeated tumor sampling during chemotherapy. Here, we present the analysis of gene expression changes during pressurized intraperitoneal aerosol chemotherapy with doxorubicin and cisplatin using a 22-gene panel. Total RNA was extracted from 152 PC samples obtained from 63 patients in up to six cycles of intraperitoneal chemotherapy. Quantitative real-time PCR was used to determine the gene expression levels. For select genes, immunohistochemistry was used to verify gene expression changes observed on the transcript level on the protein level. Observed (changes in) expression levels were correlated with clinical outcomes. Gene expression profiles differed significantly between peritoneal cancer and non- peritoneal cancer samples and between ascites-producing and non ascites-producing peritoneal cancers. Changes of gene expression patterns during repeated intraperitoneal chemotherapy cycles were prognostic of overall survival, suggesting a molecular tumor response of peritoneal cancer. Specifically, downregulation of the whole gene panel during intraperitoneal chemotherapy was associated with better treatment response and survival. In summary, molecular changes of peritoneal cancer during pressurized intraperitoneal aerosol chemotherapy can be documented and may be used to refine individual treatment and prognostic estimations. The online version of this article (doi:10.1186/s12885-016-2668-4) contains supplementary material, which is available to authorized users