Chromosomal heterozygosity and fertility in house mice (Mus musculus domesticus) from Northern Italy.

OpenAIRE

Hauffe, H C; Searle, J B

1998-01-01

Following the discovery of over 40 Robertsonian (Rb) races of Mus musculus domesticus in Europe and North Africa, the house mouse has been studied extensively as an ideal model to determine the chromosomal changes that may cause or accompany speciation. Current models of chromosomal speciation are based on the assumption that heterozygous individuals have a particularly low fertility, although recent studies indicate otherwise. Despite their importance, fertility estimates for the house mouse...

Mitochondrial, Y-chromosomal and autosomal variation in Mbenzele Pygmies from the Central African Republic.

Science.gov (United States)

Anagnostou, Paolo; Coia, Valentina; Spedini, Gabriella; Destro-Bisol, Giovanni

2010-06-01

In this paper, we carry out a combined analysis of autosomal (ten microsatellites and an Alu insertion), mitochondrial (HVR-1 sequence, 360 nucleotides) and Y-chromosomal (seven microsatellites) variation in the Mbenzele Pygmies from the Central African Republic. This study focuses on two important questions concerning the admixture and origin of African Pygmies. Ethnographic observations suggest a sex-biased gene flow between the Bantus and Pygmies, an issue which could be clarified through genetic analyses may shed light. A study of intrapopulational variation of mtDNA and Y-chromosome produces results in accordance with the hypothesized matrimonial behaviour. In fact, while shared mitochondrial haplotypes belonging to the L1c5 (or L1c1a1 clade) sub-haplogroup provides evidence of a Pygmy-to-Bantu female biased gene flow, a male biased gene flow from Bantu to Pygmies is supported by the distribution of the Y-chromosomes bearing M2 mutation. The second part of our study regards the question of the genetic relationships between Western and Eastern Pygmies. Our results favour the pre-Bantu hypothesis which suggests that the two Pygmy groups separated in ancient times (at least 18,000 years ago), whereas they do not support the recent divergence and differential admixture hypothesis which posits their separation as a consequence of the Bantu expansion (2,000-3,000 years ago).

Two genetic determinants acquired late in Mus evolution regulate the inclusion of exon 5, which alters mouse APOBEC3 translation efficiency.

Directory of Open Access Journals (Sweden)

Jun Li

2012-01-01

Full Text Available Mouse apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like editing complex 3 (mA3, an intracellular antiviral factor, has 2 allelic variations that are linked with different susceptibilities to beta- and gammaretrovirus infections among various mouse strains. In virus-resistant C57BL/6 (B6 mice, mA3 transcripts are more abundant than those in susceptible BALB/c mice both in the spleen and bone marrow. These strains of mice also express mA3 transcripts with different splicing patterns: B6 mice preferentially express exon 5-deficient (Δ5 mA3 mRNA, while BALB/c mice produce exon 5-containing full-length mA3 mRNA as the major transcript. Although the protein product of the Δ5 mRNA exerts stronger antiretroviral activities than the full-length protein, how exon 5 affects mA3 antiviral activity, as well as the genetic mechanisms regulating exon 5 inclusion into the mA3 transcripts, remains largely uncharacterized. Here we show that mA3 exon 5 is indeed a functional element that influences protein synthesis at a post-transcriptional level. We further employed in vitro splicing assays using genomic DNA clones to identify two critical polymorphisms affecting the inclusion of exon 5 into mA3 transcripts: the number of TCCT repeats upstream of exon 5 and the single nucleotide polymorphism within exon 5 located 12 bases upstream of the exon 5/intron 5 boundary. Distribution of the above polymorphisms among different Mus species indicates that the inclusion of exon 5 into mA3 mRNA is a relatively recent event in the evolution of mice. The widespread geographic distribution of this exon 5-including genetic variant suggests that in some Mus populations the cost of maintaining an effective but mutagenic enzyme may outweigh its antiviral function.

Diet-related buccal dental microwear patterns in Central African Pygmy foragers and Bantu-speaking farmer and pastoralist populations.

Directory of Open Access Journals (Sweden)

Alejandro Romero

Full Text Available Pygmy hunter-gatherers from Central Africa have shared a network of socioeconomic interactions with non-Pygmy Bantu speakers since agropastoral lifestyle spread across sub-Saharan Africa. Ethnographic studies have reported that their diets differ in consumption of both animal proteins and starch grains. Hunted meat and gathered plant foods, especially underground storage organs (USOs, are dietary staples for pygmies. However, scarce information exists about forager-farmer interaction and the agricultural products used by pygmies. Since the effects of dietary preferences on teeth in modern and past pygmies remain unknown, we explored dietary history through quantitative analysis of buccal microwear on cheek teeth in well-documented Baka pygmies. We then determined if microwear patterns differ among other Pygmy groups (Aka, Mbuti, and Babongo and between Bantu-speaking farmer and pastoralist populations from past centuries. The buccal dental microwear patterns of Pygmy hunter-gatherers and non-Pygmy Bantu pastoralists show lower scratch densities, indicative of diets more intensively based on nonabrasive foodstuffs, compared with Bantu farmers, who consume larger amounts of grit from stoneground foods. The Baka pygmies showed microwear patterns similar to those of ancient Aka and Mbuti, suggesting that the mechanical properties of their preferred diets have not significantly changed through time. In contrast, Babongo pygmies showed scratch densities and lengths similar to those of the farmers, consistent with sociocultural contacts and genetic factors. Our findings support that buccal microwear patterns predict dietary habits independent of ecological conditions and reflect the abrasive properties of preferred or fallback foods such as USOs, which may have contributed to the dietary specializations of ancient human populations.

The pygmy whitefish, Coregonus coulteri, in Lake Superior

Science.gov (United States)

Eschmeyer, Paul H.; Bailey, Reeve M.

1955-01-01

Bottom trawling by the U. S. Fish and Wildlife Service motor vessel Cisco in Lake Superior in 1952–1953 revealed a large population of a tiny whitefish, Coregonus (Prosopium) coulteri, which has been reported previously only from northwestern North America. The hiatus in range, from Lake Superior to the Columbia River basin, is the greatest known for a North American freshwater fish. Although minor structural differences characterize the disjunct populations of the pygmy whitefish, these are not deemed worthy of nomenclatorial recognition. Comparisons with related species indicate that the pygmy whitefish is distinctive in the small size, large scales, few vertebrae, few pyloric caeca, and in other characters.

Music induces universal emotion-related psychophysiological responses: comparing Canadian listeners to Congolese Pygmies

Science.gov (United States)

Egermann, Hauke; Fernando, Nathalie; Chuen, Lorraine; McAdams, Stephen

2015-01-01

Subjective and psychophysiological emotional responses to music from two different cultures were compared within these two cultures. Two identical experiments were conducted: the first in the Congolese rainforest with an isolated population of Mebenzélé Pygmies without any exposure to Western music and culture, the second with a group of Western music listeners, with no experience with Congolese music. Forty Pygmies and 40 Canadians listened in pairs to 19 music excerpts of 29–99 s in duration in random order (eight from the Pygmy population and 11 Western instrumental excerpts). For both groups, emotion components were continuously measured: subjective feeling (using a two- dimensional valence and arousal rating interface), peripheral physiological activation, and facial expression. While Pygmy music was rated as positive and arousing by Pygmies, ratings of Western music by Westerners covered the range from arousing to calming and from positive to negative. Comparing psychophysiological responses to emotional qualities of Pygmy music across participant groups showed no similarities. However, Western stimuli, rated as high and low arousing by Canadians, created similar responses in both participant groups (with high arousal associated with increases in subjective and physiological activation). Several low-level acoustical features of the music presented (tempo, pitch, and timbre) were shown to affect subjective and physiological arousal similarly in both cultures. Results suggest that while the subjective dimension of emotional valence might be mediated by cultural learning, changes in arousal might involve a more basic, universal response to low-level acoustical characteristics of music. PMID:25620935

Music Induces Universal Emotion-Related Psychophysiological Responses: Comparing Canadian Listeners To Congolese Pygmies

Directory of Open Access Journals (Sweden)

Hauke eEgermann

2015-01-01

Full Text Available Subjective and psychophysiological emotional responses to music from two different cultures were compared within these two cultures. Two identical experiments were conducted: the first in the Congolese rainforest with an isolated population of Mbenzélé Pygmies without any exposure to Western music and culture, the second with a group of Western music listeners, with no experience with Congolese music. Forty Pygmies and 40 Canadians listened in pairs to 19 music excerpts of 29 to 99 seconds in duration in random order (8 from the Pygmy population and 11 Western instrumental excerpts. For both groups, emotion components were continuously measured: subjective feeling (using a two- dimensional valence and arousal rating interface, peripheral physiological activation, and facial expression. While Pygmy music was rated as positive and arousing by Pygmies, ratings of Western music by Westerners covered the range from arousing to calming and from positive to negative. Comparing psychophysiological responses to emotional qualities of Pygmy music across participant groups showed no similarities. However, Western stimuli, rated as high and low arousing by Canadians, created similar responses in both participant groups (with high arousal associated with increases in subjective and physiological activation. Several low-level acoustical features of the music presented (tempo, pitch, and timbre were shown to affect subjective and physiological arousal similarly in both cultures. Results suggest that while the subjective dimension of emotional valence might be mediated by cultural learning, changes in arousal might involve a more basic, universal response to low-level acoustical characteristics of music.

On the tear proteome of the house mouse (Mus musculus musculus in relation to chemical signalling

Directory of Open Access Journals (Sweden)

Romana Stopkova

2017-07-01

Full Text Available Mammalian tears are produced by lacrimal glands to protect eyes and may function in chemical communication and immunity. Recent studies on the house mouse chemical signalling revealed that major urinary proteins (MUPs are not individually unique in Mus musculus musculus. This fact stimulated us to look for other sexually dimorphic proteins that may—in combination with MUPs—contribute to a pool of chemical signals in tears. MUPs and other lipocalins including odorant binding proteins (OBPs have the capacity to selectively transport volatile organic compounds (VOCs in their eight-stranded beta barrel, thus we have generated the tear proteome of the house mouse to detect a wider pool of proteins that may be involved in chemical signalling. We have detected significant male-biased (7.8% and female-biased (7% proteins in tears. Those proteins that showed the most elevated sexual dimorphisms were highly expressed and belong to MUP, OBP, ESP (i.e., exocrine gland-secreted peptides, and SCGB/ABP (i.e., secretoglobin families. Thus, tears may have the potential to elicit sex-specific signals in combination by different proteins. Some tear lipocalins are not sexually dimorphic—with MUP20/darcin and OBP6 being good examples—and because all proteins may flow with tears through nasolacrimal ducts to nasal and oral cavities we suggest that their roles are wider than originally thought. Also, we have also detected several sexually dimorphic bactericidal proteins, thus further supporting an idea that males and females may have adopted alternative strategies in controlling microbiota thus yielding different VOC profiles.

Allergen and Epitope Targets of Mouse-Specific T Cell Responses in Allergy and Asthma

Directory of Open Access Journals (Sweden)

Véronique Schulten

2018-02-01

Full Text Available Mouse allergy has become increasingly common, mainly affecting laboratory workers and inner-city households. To date, only one major allergen, namely Mus m 1, has been described. We sought to identify T cell targets in mouse allergic patients. PBMC from allergic donors were expanded with either murine urine or epithelial extract and subsequently screened for cytokine production (IL-5 and IFNγ in response to overlapping peptides spanning the entire Mus m 1 sequence, peptides from various Mus m 1 isoforms [major urinary proteins (MUPs], peptides from mouse orthologs of known allergens from other mammalian species and peptides from proteins identified by immunoproteomic analysis of IgE/IgG immunoblots of mouse urine and epithelial extracts. This approach let to the identification of 106 non-redundant T cell epitopes derived from 35 antigens. Three major T cell-activating regions were defined in Mus m 1 alone. Moreover, our data show that immunodominant epitopes were largely shared between Mus m 1 and other MUPs even from different species, suggesting that sequence conservation in different allergens is a determinant for immunodominance. We further identified several novel mouse T cell antigens based on their homology to known mammalian allergens. Analysis of cohort-specific T cell responses revealed that rhinitis and asthmatic patients recognized different epitope repertoires. Epitopes defined herein can be formulated into an epitope “megapool” used to diagnose mouse allergy and study mouse-specific T cell responses directly ex vivo. This analysis of T cell epitopes provides a good basis for future studies to increase our understanding of the immunopathology associated with MO-allergy and asthma.

Fish, fans and hydroids: host species of pygmy seahorses

Directory of Open Access Journals (Sweden)

Bastian Reijnen

2011-06-01

Full Text Available An overview of the octocoral and hydrozoa host species of pygmy seahorses is provided, based on recently collected data for H. bargibanti, H. denise and H. pontohi and literature records. Seven new interspecific host-species associations are recognized, and an overview of the so far documented number of host species is given. Detailed re-examination of octocoral type material and a review of the taxonomic history are included, as a baseline for further studies. The host-specificity and colour morphs of pygmy seahorses are discussed, as well as the validity of (previous identifications and conservations issues.

Fish, fans and hydroids: host species of pygmy seahorses.

Science.gov (United States)

Reijnen, Bastian T; van der Meij, Sancia E T; van Ofwegen, Leen P

2011-01-01

An overview of the octocoral and hydrozoan host species of pygmy seahorses is provided based on literature records and recently collected field data for Hippocampus bargibanti, Hippocampus denise and Hippocampus pontohi. Seven new associations are recognized and an overview of the so far documented host species is given. A detailed re-examination of octocoral type material and a review of the taxonomic history of the alcyonacean genera Annella (Subergorgiidae) and Muricella (Acanthogorgiidae) are included as baseline for future revisions. The host specificity and colour morphs of pygmy seahorses are discussed, as well as the reliability of (previous) identifications and conservation issues.

Pygmy resonances probed with electron scattering

International Nuclear Information System (INIS)

Bertulani, C.A.

2007-01-01

Pygmy resonances in light nuclei excited in electron scattering are discussed. These collective modes will be explored in future electron-ion colliders such as ELISe/FAIR (spokesperson: Haik Simon - GSI). Response functions for direct breakup are explored with few-body and hydrodynamical models, including the dependence upon final state interactions

Host subspecific viral strains in European house mice: Murine cytomegalovirus in the Eastern (Mus musculus musculus) and Western house mouse (Mus musculus domesticus).

Science.gov (United States)

Čížková, Dagmar; Baird, Stuart J E; Těšíková, Jana; Voigt, Sebastian; Ľudovít, Ďureje; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

2018-06-09

Murine cytomegalovirus (MCMV) has been reported from house mice (Mus musculus) worldwide, but only recently from Eastern house mice (M. m. musculus), of particular interest because they form a semi-permeable species barrier in Europe with Western house mice, M. m. domesticus. Here we report genome sequences of EastMCMV (from Eastern mice), and set these in the context of MCMV genomes from genus Mus hosts. We show EastMCMV and WestMCMV are genetically distinct. Phylogeny splitting analyses show a genome wide (94%) pattern consistent with no West-East introgression, the major exception (3.8%) being a genome-terminal region of duplicated genes involved in host immune system evasion. As expected from its function, this is a region of maintenance of ancestral polymorphism: The lack of clear splitting signal cannot be interpreted as evidence of introgression. The EastMCMV genome sequences reported here can therefore serve as a well-described resource for exploration of murid MCMV diversity. Copyright © 2018 Elsevier Inc. All rights reserved.

The uncharacterized gene 1700093K21Rik and flanking regions are correlated with reproductive isolation in the house mouse, Mus musculus.

Science.gov (United States)

Kass, David H; Janoušek, Václav; Wang, Liuyang; Tucker, Priscilla K

2014-06-01

Reproductive barriers exist between the house mouse subspecies, Mus musculus musculus and M. m. domesticus, members of the Mus musculus species complex, primarily as a result of hybrid male infertility, and a hybrid zone exists where their ranges intersect in Europe. Using single nucleotide polymorphisms (SNPs) diagnostic for the two taxa, the extent of introgression across the genome was previously compared in these hybrid populations. Sixty-nine of 1316 autosomal SNPs exhibited reduced introgression in two hybrid zone transects suggesting maladaptive interactions among certain loci. One of these markers is within a region on chromosome 11 that, in other studies, has been associated with hybrid male sterility of these subspecies. We assessed sequence variation in a 20 Mb region on chromosome 11 flanking this marker, and observed its inclusion within a roughly 150 kb stretch of DNA showing elevated sequence differentiation between the two subspecies. Four genes are associated with this genomic subregion, with two entirely encompassed. One of the two genes, the uncharacterized 1700093K21Rik gene, displays distinguishing features consistent with a potential role in reproductive isolation between these subspecies. Along with its expression specifically within spermatogenic cells, we present various sequence analyses that demonstrate a high rate of molecular evolution of this gene, as well as identify a subspecies amino acid variant resulting in a structural difference. Taken together, the data suggest a role for this gene in reproductive isolation.

Grand Coulee Dam Wildlife Mitigation Program : Pygmy Rabbit Programmatic Management Plan, Douglas County, Washington.

Energy Technology Data Exchange (ETDEWEB)

Ashley, Paul

1992-06-01

The Northwest Power Planning Council and the Bonneville Power Administration approved the pygmy rabbit project as partial mitigation for impacts caused by the construction of Grand Coulee Dam. The focus of this project is the protection and enhancement of shrub-steppe/pygmy rabbit habitat in northeastern Washington.

'Pygmy' old-growth redwood characteristics on an edaphic ecotone in Mendocino County, California

Science.gov (United States)

Will Russell; Suzie. Woolhouse

2012-01-01

The 'pygmy forest' is a specialized community that is adapted to highly acidic, hydrophobic, nutrient deprived soils, and exists in pockets within the coast redwood forest in Mendocino County. While coast redwood is known as an exceptionally tall tree, stunted trees exhibit unusual growth-forms on pygmy soils. We used a stratified random sampling procedure to...

Relationships between gas field development and the presence and abundance of pygmy rabbits in southwestern Wyoming

Science.gov (United States)

Germaine, Stephen; Carter, Sarah; Ignizio, Drew A.; Freeman, Aaron T.

2017-01-01

More than 5957 km2 in southwestern Wyoming is currently covered by operational gas fields, and further development is projected through 2030. Gas fields fragment landscapes through conversion of native vegetation to roads, well pads, pipeline corridors, and other infrastructure elements. The sagebrush steppe landscape where most of this development is occurring harbors 24 sagebrush-associated species of greatest conservation need, but the effects of gas energy development on most of these species are unknown. Pygmy rabbits (Brachylagus idahoensis) are one such species. In 2011, we began collecting three years of survey data to examine the relationship between gas field development density and pygmy rabbit site occupancy patterns on four major Wyoming gas fields (Continental Divide–Creston–Blue Gap, Jonah, Moxa Arch, Pinedale Anticline Project Area). We surveyed 120 plots across four gas fields, with plots distributed across the density gradient of gas well pads on each field. In a 1 km radius around the center of each plot, we measured the area covered by each of 10 gas field infrastructure elements and by shrub cover using 2012 National Agriculture Imagery Program imagery. We then modeled the relationship between gas field elements, pygmy rabbit presence, and two indices of pygmy rabbit abundance. Gas field infrastructure elements—specifically buried utility corridors and a complex of gas well pads, adjacent disturbed areas, and well pad access roads—were negatively correlated with pygmy rabbit presence and abundance indices, with sharp declines apparent after approximately 2% of the area consisted of gas field infrastructure. We conclude that pygmy rabbits in southwestern Wyoming may be sensitive to gas field development at levels similar to those observed for greater sage-grouse, and may suffer local population declines at lower levels of development than are allowed in existing plans and policies designed to conserve greater sage-grouse by limiting

Inferring the demographic history of African farmers and pygmy hunter-gatherers using a multilocus resequencing data set.

Directory of Open Access Journals (Sweden)

Etienne Patin

2009-04-01

Full Text Available The transition from hunting and gathering to farming involved a major cultural innovation that has spread rapidly over most of the globe in the last ten millennia. In sub-Saharan Africa, hunter-gatherers have begun to shift toward an agriculture-based lifestyle over the last 5,000 years. Only a few populations still base their mode of subsistence on hunting and gathering. The Pygmies are considered to be the largest group of mobile hunter-gatherers of Africa. They dwell in equatorial rainforests and are characterized by their short mean stature. However, little is known about the chronology of the demographic events-size changes, population splits, and gene flow--ultimately giving rise to contemporary Pygmy (Western and Eastern groups and neighboring agricultural populations. We studied the branching history of Pygmy hunter-gatherers and agricultural populations from Africa and estimated separation times and gene flow between these populations. We resequenced 24 independent noncoding regions across the genome, corresponding to a total of approximately 33 kb per individual, in 236 samples from seven Pygmy and five agricultural populations dispersed over the African continent. We used simulation-based inference to identify the historical model best fitting our data. The model identified included the early divergence of the ancestors of Pygmy hunter-gatherers and farming populations approximately 60,000 years ago, followed by a split of the Pygmies' ancestors into the Western and Eastern Pygmy groups approximately 20,000 years ago. Our findings increase knowledge of the history of the peopling of the African continent in a region lacking archaeological data. An appreciation of the demographic and adaptive history of African populations with different modes of subsistence should improve our understanding of the influence of human lifestyles on genome diversity.

Molecular Epidemiology of Human Polyomavirus JC in the Biaka Pygmies and Bantu of Central Africa

Directory of Open Access Journals (Sweden)

Sylvester C Chima

1998-09-01

Full Text Available Polyomavirus JC (JCV is ubiquitous in humans and causes a chronic demyelinating disease of the central nervous system , progressive multifocal leukoencephalopathy which is common in AIDS. JCV is excreted in urine of 30-70% of adults worldwide. Based on sequence analysis of JCV complete genomes or fragments thereof, JCV can be classified into geographically derived genotypes. Types 1 and 2 are of European and Asian origin respectively while Types 3 and 6 are African in origin. Type 4, a possible recombinant of European and African genotypes (1 and 3 is common in the USA. To delineate the JCV genotypes in an aboriginal African population, random urine samples were collected from the Biaka Pygmies and Bantu from the Central African Republic. There were 43 males and 25 females aged 4-55 years, with an average age of 26 years. After PCR amplification of JCV in urine, products were directly cycle sequenced. Five of 23 Pygmy adults (22% and four of 20 Bantu adults (20% were positive for JC viruria. DNA sequence analysis revealed JCV Type 3 (two, Type 6 (two and one Type 1 variant in Biaka Pygmies. All the Bantu strains were Type 6. Type 3 and 6 strains of JCV are the predominant strains in central Africa. The presence of multiple subtypes of JCV in Biaka Pygmies may be a result of extensive interactions of Pygmies with their African tribal neighbors during their itinerant movements in the equatorial forest.

Reduced Activity of SRY and its Target Enhancer Sox9-TESCO in a Mouse Species with X*Y Sex Reversal.

Science.gov (United States)

Zhao, Liang; Quinn, Alexander; Ng, Ee Ting; Veyrunes, Frederic; Koopman, Peter

2017-02-03

In most eutherian mammals, sex determination is governed by the Y-linked gene Sry, but in African pygmy mice Mus minutoides, Sry action is overridden by a variant X chromosome (X*), yielding X*Y females. We hypothesized that X*Y sex reversal may be underpinned not only by neomorphic X chromosome functionality, but also by a compromised Sry pathway. Here, we show that neither M. minutoides SRY nor its target, the Sox9-TESCO enhancer, had appreciable transcriptional activity in in vitro assays, correlating with sequence degradation compared to Mus musculus counterparts. However, M. minutoides SRY activated its cognate TESCO to a moderate degree, and can clearly engage the male pathway in M. minutoides in the wild, indicating that SRY and TESCO may have co-evolved in M. minutoides to retain function above a threshold level. We suggest that weakening of the SRY/TESCO nexus may have facilitated the rise and spread of a variant X* chromosome carrying female-inducing modifier gene(s).

Mutations at the mei-41, mus(1)101, mus(1)103, mus(2)205 and mus(3)310 loci of Drosophila exhibit differential UDS responses with different DNA-damaging agents

International Nuclear Information System (INIS)

Dusenbery, R.L.

1987-01-01

5 mutagen-sensitive mutants of Drosophila melanogaster, reported to perform normal or only slightly reduced excision repair of UV damage, were examined by an unscheduled DNA synthesis (UDS) assay. 2 mutants, classified as completely or partially proficient for both excision and postreplication repair of UV damage, mus(1)103 and mus(2)205, were found to give positive UDS responses only for UV damage. These mutants exhibit no measurable UDS activity following DNA damage by several different alkylating agents and X-rays. 3 mutants, classified as having no defect in excision repair, but measurable defects in postreplication repair of UV damage, exhibit 3 different response patterns. The mutant mei-41 exhibits a highly positive UDS response following damage by all agents, consistent with its prior classification as excision-repair-proficient, but postreplication-repair-deficient for UV damage. The mutant mus(1)101, however, exhibits a strong positive UDS response following only UV damage and appears to be blocked in the excision repair of damage produced by both alkylating agents and X-irradiation. Finally, mus(3)310 exhibits no UDS response to alkylation, X-ray or UV damage. This is not consistent with its previous classification. Results obtained w0272the qualitative in vitro UDS assay are entirely consistent with the results from two separate in vivo measures of excision repair deficiency followign DNA damage, larval hypersensitivity to killing and hypermutability in the sex-linked recessive lethal test. (Auth.)

Structure of the pygmy dipole resonance in Sn-124

NARCIS (Netherlands)

Endres, J.; Savran, D.; Butler, P. A.; Harakeh, M. N.; Harissopulos, S.; Herzberg, R. -D.; Kruecken, R.; Lagoyannis, A.; Litvinova, E.; Pietralla, N.; Ponomarev, V. Yu.; Popescu, L.; Ring, P.; Scheck, M.; Schlueter, F.; Sonnabend, K.; Stoica, V. I.; Zilges, A.; Wortche, Heinrich

2012-01-01

Background: In atomic nuclei, a concentration of electric dipole strength around the particle threshold, commonly denoted as pygmy dipole resonance, may have a significant impact on nuclear structure properties and astrophysical scenarios. A clear identification of these states and the structure of

The decay pattern of the Pygmy Dipole Resonance of 140Ce

Directory of Open Access Journals (Sweden)

B. Löher

2016-05-01

Full Text Available The decay properties of the Pygmy Dipole Resonance (PDR have been investigated in the semi-magic N=82 nucleus 140Ce using a novel combination of nuclear resonance fluorescence and γ–γ coincidence techniques. Branching ratios for transitions to low-lying excited states are determined in a direct and model-independent way both for individual excited states and for excitation energy intervals. Comparison of the experimental results to microscopic calculations in the quasi-particle phonon model exhibits an excellent agreement, supporting the observation that the Pygmy Dipole Resonance couples to the ground state as well as to low-lying excited states. A 10% mixing of the PDR and the [21+×PDR] is extracted.

The decay pattern of the Pygmy Dipole Resonance of 140Ce

Science.gov (United States)

Löher, B.; Savran, D.; Aumann, T.; Beller, J.; Bhike, M.; Cooper, N.; Derya, V.; Duchêne, M.; Endres, J.; Hennig, A.; Humby, P.; Isaak, J.; Kelley, J. H.; Knörzer, M.; Pietralla, N.; Ponomarev, V. Yu.; Romig, C.; Scheck, M.; Scheit, H.; Silva, J.; Tonchev, A. P.; Tornow, W.; Wamers, F.; Weller, H.; Werner, V.; Zilges, A.

2016-05-01

The decay properties of the Pygmy Dipole Resonance (PDR) have been investigated in the semi-magic N = 82 nucleus 140Ce using a novel combination of nuclear resonance fluorescence and γ-γ coincidence techniques. Branching ratios for transitions to low-lying excited states are determined in a direct and model-independent way both for individual excited states and for excitation energy intervals. Comparison of the experimental results to microscopic calculations in the quasi-particle phonon model exhibits an excellent agreement, supporting the observation that the Pygmy Dipole Resonance couples to the ground state as well as to low-lying excited states. A 10% mixing of the PDR and the [21+ × PDR ] is extracted.

Repeat associated mechanisms of genome evolution and function revealed by the Mus caroli and Mus pahari genomes

Science.gov (United States)

Thybert, David; Roller, Maša; Navarro, Fábio C.P.; Fiddes, Ian; Streeter, Ian; Feig, Christine; Martin-Galvez, David; Kolmogorov, Mikhail; Janoušek, Václav; Akanni, Wasiu; Aken, Bronwen; Aldridge, Sarah; Chakrapani, Varshith; Chow, William; Clarke, Laura; Cummins, Carla; Doran, Anthony; Dunn, Matthew; Goodstadt, Leo; Howe, Kerstin; Howell, Matthew; Josselin, Ambre-Aurore; Karn, Robert C.; Laukaitis, Christina M.; Jingtao, Lilue; Martin, Fergal; Muffato, Matthieu; Nachtweide, Stefanie; Quail, Michael A.; Sisu, Cristina; Stanke, Mario; Stefflova, Klara; Van Oosterhout, Cock; Veyrunes, Frederic; Ward, Ben; Yang, Fengtang; Yazdanifar, Golbahar; Zadissa, Amonida; Adams, David J.; Brazma, Alvis; Gerstein, Mark; Paten, Benedict; Pham, Son; Keane, Thomas M.; Odom, Duncan T.; Flicek, Paul

2018-01-01

Understanding the mechanisms driving lineage-specific evolution in both primates and rodents has been hindered by the lack of sister clades with a similar phylogenetic structure having high-quality genome assemblies. Here, we have created chromosome-level assemblies of the Mus caroli and Mus pahari genomes. Together with the Mus musculus and Rattus norvegicus genomes, this set of rodent genomes is similar in divergence times to the Hominidae (human-chimpanzee-gorilla-orangutan). By comparing the evolutionary dynamics between the Muridae and Hominidae, we identified punctate events of chromosome reshuffling that shaped the ancestral karyotype of Mus musculus and Mus caroli between 3 and 6 million yr ago, but that are absent in the Hominidae. Hominidae show between four- and sevenfold lower rates of nucleotide change and feature turnover in both neutral and functional sequences, suggesting an underlying coherence to the Muridae acceleration. Our system of matched, high-quality genome assemblies revealed how specific classes of repeats can play lineage-specific roles in related species. Recent LINE activity has remodeled protein-coding loci to a greater extent across the Muridae than the Hominidae, with functional consequences at the species level such as reproductive isolation. Furthermore, we charted a Muridae-specific retrotransposon expansion at unprecedented resolution, revealing how a single nucleotide mutation transformed a specific SINE element into an active CTCF binding site carrier specifically in Mus caroli, which resulted in thousands of novel, species-specific CTCF binding sites. Our results show that the comparison of matched phylogenetic sets of genomes will be an increasingly powerful strategy for understanding mammalian biology. PMID:29563166

Genetic structure and invasion history of the house mouse (Mus musculus domesticus) in Senegal, West Africa: a legacy of colonial and contemporary times.

Science.gov (United States)

Lippens, C; Estoup, A; Hima, M K; Loiseau, A; Tatard, C; Dalecky, A; Bâ, K; Kane, M; Diallo, M; Sow, A; Niang, Y; Piry, S; Berthier, K; Leblois, R; Duplantier, J-M; Brouat, C

2017-08-01

Knowledge of the genetic make-up and demographic history of invasive populations is critical to understand invasion mechanisms. Commensal rodents are ideal models to study whether complex invasion histories are typical of introductions involving human activities. The house mouse Mus musculus domesticus is a major invasive synanthropic rodent originating from South-West Asia. It has been largely studied in Europe and on several remote islands, but the genetic structure and invasion history of this taxon have been little investigated in several continental areas, including West Africa. In this study, we focussed on invasive populations of M. m. domesticus in Senegal. In this focal area for European settlers, the distribution area and invasion spread of the house mouse is documented by decades of data on commensal rodent communities. Genetic variation at one mitochondrial locus and 16 nuclear microsatellite markers was analysed from individuals sampled in 36 sites distributed across the country. A combination of phylogeographic and population genetics methods showed that there was a single introduction event on the northern coast of Senegal, from an exogenous (probably West European) source, followed by a secondary introduction from northern Senegal into a coastal site further south. The geographic locations of these introduction sites were consistent with the colonial history of Senegal. Overall, the marked microsatellite genetic structure observed in Senegal, even between sites located close together, revealed a complex interplay of different demographic processes occurring during house mouse spatial expansion, including sequential founder effects and stratified dispersal due to human transport along major roads.

Repeat associated mechanisms of genome evolution and function revealed by the Mus caroli and Mus pahari genomes.

Science.gov (United States)

Thybert, David; Roller, Maša; Navarro, Fábio C P; Fiddes, Ian; Streeter, Ian; Feig, Christine; Martin-Galvez, David; Kolmogorov, Mikhail; Janoušek, Václav; Akanni, Wasiu; Aken, Bronwen; Aldridge, Sarah; Chakrapani, Varshith; Chow, William; Clarke, Laura; Cummins, Carla; Doran, Anthony; Dunn, Matthew; Goodstadt, Leo; Howe, Kerstin; Howell, Matthew; Josselin, Ambre-Aurore; Karn, Robert C; Laukaitis, Christina M; Jingtao, Lilue; Martin, Fergal; Muffato, Matthieu; Nachtweide, Stefanie; Quail, Michael A; Sisu, Cristina; Stanke, Mario; Stefflova, Klara; Van Oosterhout, Cock; Veyrunes, Frederic; Ward, Ben; Yang, Fengtang; Yazdanifar, Golbahar; Zadissa, Amonida; Adams, David J; Brazma, Alvis; Gerstein, Mark; Paten, Benedict; Pham, Son; Keane, Thomas M; Odom, Duncan T; Flicek, Paul

2018-04-01

Understanding the mechanisms driving lineage-specific evolution in both primates and rodents has been hindered by the lack of sister clades with a similar phylogenetic structure having high-quality genome assemblies. Here, we have created chromosome-level assemblies of the Mus caroli and Mus pahari genomes. Together with the Mus musculus and Rattus norvegicus genomes, this set of rodent genomes is similar in divergence times to the Hominidae (human-chimpanzee-gorilla-orangutan). By comparing the evolutionary dynamics between the Muridae and Hominidae, we identified punctate events of chromosome reshuffling that shaped the ancestral karyotype of Mus musculus and Mus caroli between 3 and 6 million yr ago, but that are absent in the Hominidae. Hominidae show between four- and sevenfold lower rates of nucleotide change and feature turnover in both neutral and functional sequences, suggesting an underlying coherence to the Muridae acceleration. Our system of matched, high-quality genome assemblies revealed how specific classes of repeats can play lineage-specific roles in related species. Recent LINE activity has remodeled protein-coding loci to a greater extent across the Muridae than the Hominidae, with functional consequences at the species level such as reproductive isolation. Furthermore, we charted a Muridae-specific retrotransposon expansion at unprecedented resolution, revealing how a single nucleotide mutation transformed a specific SINE element into an active CTCF binding site carrier specifically in Mus caroli , which resulted in thousands of novel, species-specific CTCF binding sites. Our results show that the comparison of matched phylogenetic sets of genomes will be an increasingly powerful strategy for understanding mammalian biology. © 2018 Thybert et al.; Published by Cold Spring Harbor Laboratory Press.

Sharp-tailed Grouse and Pygmy Rabbit Wildlife Mitigation Project

International Nuclear Information System (INIS)

1992-10-01

The Proposed Action is needed to protect and enhance shrub-steppe and riparian habitat for sharp-tailed grouse (Tympanuchus phasianellus columbianus), Pygmy rabbits (Brachylagus idahoensis), and other indigenous wildlife species. The purpose of the Proposed Action is to compensate, in part, for wildlife habitat lost from the construction of Grand Coulee Dam and the inundation of Lake Roosevelt. Bonneville Power Administration proposes to fund management agreements, conservation easements, acquisition of fee title, or a combination of these on as many as 29,000 acres in Lincoln and Douglas Counties to improve shrub-steppe and riparian habitat for sharp-tailed grouse and pygmy rabbits. The BPA also proposes to fund habitat improvements (enhancements) on project lands including existing public lands. Proposed habitat treatments would include control of grazing; planting of native trees, shrubs, forbs and grasses; protection of wetlands and streambanks; herbicide use; fire prescriptions; and wildfire suppression. Proposed management activities may include predator control, population introductions, and control of crop depredation

The role of salivary androgen-binding protein in reproductive isolation between two subspecies of house mouse: Mus musculus musculus and Mus musculus domesticus

Czech Academy of Sciences Publication Activity Database

Bímová, Barbora; Karn, R. C.; Piálek, Jaroslav

2005-01-01

Roč. 84, č. 3 (2005), s. 349-361 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA AV ČR IAA6093201; GA AV ČR IAA6045902 Grant - others:National Research Council(US) COBASE Institutional research plan: CEZ:AV0Z6093917 Keywords : assortative mating * hybrid zone * sexual selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

Effects of mutagen-sensitive mus mutations on spontaneous mitotic recombination in Aspergillus.

Science.gov (United States)

Zhao, P; Kafer, E

1992-04-01

Methyl methane-sulfonate (MMS)-sensitive, radiation-induced mutants of Aspergillus were shown to define nine new DNA repair genes, musK to musS. To test mus mutations for effects on mitotic recombination, intergenic crossing over was assayed between color markers and their centromeres, and intragenic recombination between two distinguishable adE alleles. Of eight mutants analyzed, four showed significant deviations from mus+ controls in both tests. Two mutations, musK and musL, reduced recombination, while musN and musQ caused increases. In contrast, musO diploids produced significantly higher levels only for intragenic recombination. Effects were relatively small, but averages between hypo- and hyperrec mus differed 15-20-fold. In musL diploids, most of the rare color segregants resulted from mitotic malsegregation rather than intergenic crossing over. This indicates that the musL gene product is required for recombination and that DNA lesions lead to chromosome loss when it is deficient. In addition, analysis of the genotypes of intragenic (ad+) recombinants showed that the musL mutation specifically reduced single allele conversion but increased complex conversion types (especially recombinants homozygous for ad+). Similar analysis revealed differences between the effects of two hyperrec mutations; musN apparently caused high levels solely of mitotic crossing over, while musQ increased various conversion types but not reciprocal crossovers. These results suggest that mitotic gene conversion and crossing over, while generally associated, are affected differentially in some of the mus strains of Aspergillus nidulans.

Effects of Mutagen-Sensitive Mus Mutations on Spontaneous Mitotic Recombination in Aspergillus

OpenAIRE

Zhao, P.; Kafer, E.

1992-01-01

Methyl methane-sulfonate (MMS)-sensitive, radiation-induced mutants of Aspergillus were shown to define nine new DNA repair genes, musK to musS. To test mus mutations for effects on mitotic recombination, intergenic crossing over was assayed between color markers and their centromeres, and intragenic recombination between two distinguishable adE alleles. Of eight mutants analyzed, four showed significant deviations from mus(+) controls in both tests. Two mutations, musK and musL, reduced reco...

Cross-experimental analysis of coat color variations and morphological characteristics of the japanese wild mouse, Mus musculus.

Science.gov (United States)

Suzuki, Taichi A; Iwasa, Masahiro A

2013-01-01

There are many coat colors in the laboratory mouse, Mus musculus. On the basis of traditional genetics, there are four loci, A-D, related to coat color expressions. As shown by previous studies, Japanese wild mice have gray backs and white bellies and are assumed to carry the A(w) allele at the A (agouti) locus, which is dominant over any other alleles. However, we collected Japanese wild mice from central Honshu with black coats. To understand this black coat expression, we performed cross experiments concerning the four loci using wild-caught mice and DBA/2 laboratory mice from the standpoint of traditional genetics. The offspring of the current crosses showed the wild type, the blackish type, and the intermediate type from some combinations of parents. Considering the coat colors of the offspring, we did not obtain any evidence that the Japanese wild mice always carry the A(w) allele at the A locus. Furthermore, we were not able to explain the current coat color expressions using the traditional logic with regard to the A-D loci and concluded that it is possible for another locus (loci) to be related to the coat color expressions. On the other hand, skull characteristics and external body measurements of the captured wild mice were fundamentally different from those of DBA/2 and offspring from captured wild mice and DBA/2 combinations. Thus, we concluded that the Japanese wild mice had original criteria from a morphological viewpoint.

Isospin Character of the Pygmy Dipole Resonance in Sn-124

NARCIS (Netherlands)

Endres, J.; Litvinova, E.; Savran, D.; Butler, P. A.; Harakeh, M. N.; Harissopulos, S.; Herzberg, R. -D.; Kruecken, R.; Lagoyannis, A.; Pietralla, N.; Ponomarev, V. Yu; Popescu, L.; Ring, P.; Scheck, M.; Sonnabend, K.; Stoica, V. I.; Wörtche, H. J.; Zilges, A.

2010-01-01

The pygmy dipole resonance has been studied in the proton-magic nucleus Sn-124 with the (alpha, alpha'gamma) coincidence method at E-alpha = 136 MeV. The comparison with results of photon-scattering experiments reveals a splitting into two components with different structure: one group of states

KOLONISASI Mus musculus albino DI LABORATORIUM LOKA LITBANG P2B2 BANJARNEGARA

Directory of Open Access Journals (Sweden)

Dewi Marbawati

2012-11-01

Full Text Available The improvement and development of science and technologycal in health area must be followed with improvement of requirement of test animal would especially white mouse (Mus musculus albino/mencit. Usage of white mouse (mencit because of relatively easy in handling, the size relatively small, the price relatively cheap, once birth can reach 16- 18, have similiarity in circulation system of human and doesn't have ability to vomit because having spillway in bouncing up, that is why white mouse used for drug trial research. This research expected to obtain stable white mouse colony in laboratory to fulfill requirement of white mouse as subject for research.Research was started in March-November 2008 in Loka Litbang P2B2 Banjarnegara. This research was elementary research with observational design. Data were collected from white mouse growth observation. Result of observation showed reproduction of white mouse after 5 month, from 6 white mouse increased become 17 (increased 2 times more, with number of deaths 11,76%. This white mouse survive until 12 months, but the average was 6 month. Oldest mencit until research ends (November 2008 ranges from 8 months. Daily observation data showed that white mouse can bear children until 6/pregnance. According to literature study mouse can bear children average 68/pregnance. Generaly baby mouse was around 1 gram, heavily horns depend on type (strain of white mouse. Result of white mouse weight showed increase of white mouse's body weight every 2 weeks was 8,6 grams. Observation data of development white mouse showed after 4 days the white mouse hair was seen, specially moustache that was clearly seen, on 5 day whole body was white. At the age of 10 days ear opened, part of other body like external mamilla and genitals become explains looked to be. At the age of 12 days eye started opens and active walking.

Recombinant major urinary proteins of the mouse in specific IgE and IgG testing

NARCIS (Netherlands)

Krop, Esmeralda J. M.; Matsui, Elizabeth C.; Sharrow, Scott D.; Stone, Martin J.; Gerber, Peter; van der Zee, Jaring S.; Chapman, Martin D.; Aalberse, Rob C.

2007-01-01

BACKGROUND: Recombinant allergens are preferred over natural allergen extracts in measuring antibodies. We tested the use of recombinant variants of the major mouse allergen Mus m 1 in detection of mouse-specific antibodies in sera of laboratory animal workers and children. METHODS: Six recombinant

Ancestor–descendant relationships in evolution: origin of the extant pygmy right whale, Caperea marginata

Science.gov (United States)

Tsai, Cheng-Hsiu; Fordyce, R. Ewan

2015-01-01

Ancestor–descendant relationships (ADRs), involving descent with modification, are the fundamental concept in evolution, but are usually difficult to recognize. We examined the cladistic relationship between the only reported fossil pygmy right whale, †Miocaperea pulchra, and its sole living relative, the enigmatic pygmy right whale Caperea marginata, the latter represented by both adult and juvenile specimens. †Miocaperea is phylogenetically bracketed between juvenile and adult Caperea marginata in morphologically based analyses, thus suggesting a possible ADR—the first so far identified within baleen whales (Cetacea: Mysticeti). The †Miocaperea–Caperea lineage may show long-term morphological stasis and, in turn, punctuated equilibrium. PMID:25589485

Spectral structure of the pygmy dipole resonance.

Science.gov (United States)

Tonchev, A P; Hammond, S L; Kelley, J H; Kwan, E; Lenske, H; Rusev, G; Tornow, W; Tsoneva, N

2010-02-19

High-sensitivity studies of E1 and M1 transitions observed in the reaction 138Ba(gamma,gamma{'}) at energies below the one-neutron separation energy have been performed using the nearly monoenergetic and 100% linearly polarized photon beams of the HIgammaS facility. The electric dipole character of the so-called "pygmy" dipole resonance was experimentally verified for excitations from 4.0 to 8.6 MeV. The fine structure of the M1 "spin-flip" mode was observed for the first time in N=82 nuclei.

A Comparison of mucosal surface area and villous histology in small intestines of the Brazilian free-tailed bat (Tadarida brasiliensis) and the mouse (Mus musculus).

Science.gov (United States)

Zhang, Zhi-Qiang; Brun, Antonio; Price, Edwin R; Cruz-Neto, Ariovaldo P; Karasov, William H; Caviedes-Vidal, Enrique

2015-01-01

Studies on birds have led to the hypothesis that increased intestinal absorption between enterocytes (paracellular) evolved as a compensation for smaller intestinal size in fliers, which was perhaps selected to minimize the mass of digesta carried. This hypothesis predicts that bats will also exhibit relatively reduced intestinal size and high paracellular absorption, compared with nonflying mammals. Published studies on three bat species indicate relatively high paracellular absorption. One mechanism for increasing paracellular absorption per cm2 small intestine (SI) is increased number of tight junctions (TJs) across which paracellular absorption occurs. To our knowledge, we provide the first comparative analysis of enterocyte size and number in flying and nonflying mammals. Intestines of insectivorous bats Tadarida brasiliensis were compared with Mus musculus using hematoxylin and eosin staining method. Bats had shorter and narrower SIs than mice, and after correction for body size difference by normalizing to mass3/4, the bats had 40% less nominal surface area than the mouse, as predicted. Villous enhancement of surface area was 90% greater in the bat than in the mouse, mainly because of longer villi and a greater density of villi in bat intestines. Bat and mouse were similar in enterocyte diameter. Bats exceeded mice by 54.4% in villous area per cm length SI and by 95% in number of enterocytes per cm2 of the nominal surface area of the SI. Therefore, an increased density of TJs per cm2 SI may be a mechanistic explanation that helps to understand the high paracellular absorption observed in bats compared to nonflying mammals. © 2014 Wiley Periodicals, Inc.

Phenotypic and epistatic grouping of hypo- and hyper-rec mus mutants in Aspergillus.

Science.gov (United States)

Kafer, E; Chae, S K

1994-03-01

The mutants musK to musS of Aspergillus nidulans are sensitive to methyl-methanesulfonate (MMS) and several of them are meiotic-defective and alter mitotic recombination frequencies. All were found to be cross-sensitive to 4-nitro-quinoline-N-oxide (4-NQO) but unexpectedly none of them was hypersensitive to gamma-rays and few to UV light. Double mus; uvs mutants were constructed to test for interactions with uvs mutations of the four epistatic groups of Aspergillus, "UvsF", "UvsC", "UvsI", and "UvsB". All meiotic-defective mus mutations caused some lethal interactions, usually with uvsF. None of them showed epistasis with UvsF or UvsB group mutants and one, musO, may represent a new group. Three mus mutations that affect recombination were assigned to the UvsC group, namely musN and K, and also musL which is recombination-defective and closely resembles uvsC. While uvsC mutants are mutators and lack UV-mutagenesis, most mus mutants had no effects on mutation. Only musR, which appeared epistatic with uvsI, showed reduced UV-reversion frequencies similar to uvsI. The recombination-proficient mus mutants appeared to be epistatic with more than one group, but in several cases sensitivities were slight and overlaps insufficient to obtain corroborating results with MMS and 4-NQO.

Ancestor-descendant relationships in evolution: origin of the extant pygmy right whale, Caperea marginata.

Science.gov (United States)

Tsai, Cheng-Hsiu; Fordyce, R Ewan

2015-01-01

Ancestor-descendant relationships (ADRs), involving descent with modification, are the fundamental concept in evolution, but are usually difficult to recognize. We examined the cladistic relationship between the only reported fossil pygmy right whale, †Miocaperea pulchra, and its sole living relative, the enigmatic pygmy right whale Caperea marginata, the latter represented by both adult and juvenile specimens. †Miocaperea is phylogenetically bracketed between juvenile and adult Caperea marginata in morphologically based analyses, thus suggesting a possible ADR-the first so far identified within baleen whales (Cetacea: Mysticeti). The †Miocaperea-Caperea lineage may show long-term morphological stasis and, in turn, punctuated equilibrium. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

Maternal-foetal genomic conflict and speciation: no evidence for hybrid placental dysplasia in crosses between two house mouse subspecies

Czech Academy of Sciences Publication Activity Database

Kropáčková, L.; Piálek, Jaroslav; Gergelits, Václav; Forejt, Jiří; Reifová, R.

2015-01-01

Roč. 28, č. 3 (2015), s. 688-698 ISSN 1010-061X R&D Projects: GA ČR GA13-08078S Institutional support: RVO:68081766 ; RVO:68378050 Keywords : hybrid placental dysplasia * genomic conflicts * speciation * X chromosome * house mouse * Mus musculus musculus * Mus musculus domesticus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.747, year: 2015

Hierarchical spatial models for predicting pygmy rabbit distribution and relative abundance

Science.gov (United States)

Wilson, T.L.; Odei, J.B.; Hooten, M.B.; Edwards, T.C.

2010-01-01

Conservationists routinely use species distribution models to plan conservation, restoration and development actions, while ecologists use them to infer process from pattern. These models tend to work well for common or easily observable species, but are of limited utility for rare and cryptic species. This may be because honest accounting of known observation bias and spatial autocorrelation are rarely included, thereby limiting statistical inference of resulting distribution maps. We specified and implemented a spatially explicit Bayesian hierarchical model for a cryptic mammal species (pygmy rabbit Brachylagus idahoensis). Our approach used two levels of indirect sign that are naturally hierarchical (burrows and faecal pellets) to build a model that allows for inference on regression coefficients as well as spatially explicit model parameters. We also produced maps of rabbit distribution (occupied burrows) and relative abundance (number of burrows expected to be occupied by pygmy rabbits). The model demonstrated statistically rigorous spatial prediction by including spatial autocorrelation and measurement uncertainty. We demonstrated flexibility of our modelling framework by depicting probabilistic distribution predictions using different assumptions of pygmy rabbit habitat requirements. Spatial representations of the variance of posterior predictive distributions were obtained to evaluate heterogeneity in model fit across the spatial domain. Leave-one-out cross-validation was conducted to evaluate the overall model fit. Synthesis and applications. Our method draws on the strengths of previous work, thereby bridging and extending two active areas of ecological research: species distribution models and multi-state occupancy modelling. Our framework can be extended to encompass both larger extents and other species for which direct estimation of abundance is difficult. ?? 2010 The Authors. Journal compilation ?? 2010 British Ecological Society.

Getting to know you: Identification of pygmy killer whales (Feresa attenuata and melon-headed whales (Peponocephala electra under challenging conditions

Directory of Open Access Journals (Sweden)

Salvatore Siciliano

2015-12-01

Full Text Available Abstract Melon-headed whale (Peponocephala electra and Pygmy killer whale (Feresa attenuata are very poorly known species and are often confused with each other. We examined in detail Figure 3 in MARIGO and GIFFONI (2010 who reported that two melon-headed whales were taken in a surface driftnet about 90 nm off Santos, Brazil. We concluded they were in fact pygmy killer whales and explain our reasoning. To aid in future identifications, we illustrate and describe some of the main differences between these two species of small cetaceans. The incident reported by MARIGO and GIFFONI (2010 might represent the 'tip of the iceberg' regarding the incidental catches of cetaceans by pelagic drift nets off Brazil. Offshore driftnetting operating along the south-southeastern coast of Brazil may threaten pygmy killer whales.

Taxonomic revision of the pygmy devils (Tetrigidae: Discotettiginae) with online social media as a new tool for discovering hidden diversity

OpenAIRE

Skejo, Josip

2017-01-01

Pygmy grasshoppers (Tetrigidae) are family of small grasshoppers inhabiting humid aras, where thy feed on detritus, algae and mosses, that sometimes grow on their body. Pygmy devils (Discotettiginae) are a group of genera characterized by widened subapical antennal segments. Taxonomy and biogeograpy of all the members are reviewed by examination of large series of museum material and additional photo material found in social networks (Flickr, Facebook). In total 887 specimens o...

Evolution of pygmy angelfishes: Recent divergences, introgression, and the usefulness of color in taxonomy

KAUST Repository

Gaither, Michelle R.; Schultz, Jennifer K.; Bellwood, David R.; Pyle, Richard L.; DiBattista, Joseph; Rocha, Luiz A.; Bowen, Brian W.

2014-01-01

The pygmy angelfishes (genus Centropyge, family Pomacanthidae) are brightly colored species that occupy reef habitats in every tropical ocean. Some species are rarely observed because they occur below conventional scuba depths. Their striking

How many Pygmy Marmoset (Cebuella Gray, 1870) species are there? A taxonomic re-appraisal based on new molecular evidence

OpenAIRE

Boubli, JP; da Silva, MNF; Rylands, AB; Nash, SD; Bertuol, F; Nunes, M; Mittermeier, RA; Byrne, H; da Silva, FE; Röhe, F; Sampaio, I; Schneider, H; Farias, IP; Hrbek, T

2017-01-01

The pygmy marmoset, Cebuella pygmaea, the smallest of the New World monkeys, has one of the largest geographical distributions of the Amazonian primates. Two forms have been recognized: Cebuella pygmaea pygmaea (Spix, 1823), and C. p. niveiventris Lönnberg, 1940. In this study, we investigated if the separation of pygmy marmosets into these two clades can be corroborated by molecular data. We also examine and compare coloration of the pelage in light of the new molecular results. We analyzed ...

Geographic phenetic variation of two eastern-Mediterranean non-commensal mouse species, Mus macedonicus and M. cypriacus (Rodentia: Muridae) based on traditional and geometric approaches to morphometrics

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš; Mikula, Ondřej; Vohralík, V.

2008-01-01

Roč. 247, - (2008), s. 67-80 ISSN 0044-5231 R&D Projects: GA AV ČR IAA6045307; GA ČR GA206/06/0707 Grant - others:GA ČR(CZ) GA206/05/2334 Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus macedonicus * Mus cypriacus * phenotypic variation Subject RIV: EG - Zoology Impact factor: 1.319, year: 2008

Vitamin K epoxide reductase complex subunit 1 (Vkorc1 haplotype diversity in mouse priority strains

Directory of Open Access Journals (Sweden)

Kohn Michael H

2008-12-01

Full Text Available Abstract Background Polymorphisms in the vitamin K-epoxide reductase complex subunit 1 gene, Vkorc1, could affect blood coagulation and other vitamin K-dependent proteins, such as osteocalcin (bone Gla protein, BGP. Here we sequenced the Vkorc1 gene in 40 mouse priority strains. We analyzed Vkorc1 haplotypes with respect to prothrombin time (PT and bone mineral density and composition (BMD and BMC; phenotypes expected to be vitamin K-dependent and represented by data in the Mouse Phenome Database (MPD. Findings In the commonly used laboratory strains of Mus musculus domesticus we identified only four haplotypes differing in the intron or 5' region sequence of the Vkorc1. Six haplotypes differing by coding and non-coding polymorphisms were identified in the other subspecies of Mus. We detected no significant association of Vkorc1 haplotypes with PT, BMD and BMC within each subspecies of Mus. Vkorc1 haplotype sequences divergence between subspecies was associated with PT, BMD and BMC. Conclusion Phenotypic variation in PT, BMD and BMC within subspecies of Mus, while substantial, appears to be dominated by genetic variation in genes other than the Vkorc1. This was particularly evident for M. m. domesticus, where a single haplotype was observed in conjunction with virtually the entire range of PT, BMD and BMC values of all 5 subspecies of Mus included in this study. Differences in these phenotypes between subspecies also should not be attributed to Vkorc1 variants, but should be viewed as a result of genome wide genetic divergence.

Investigation of the Pygmy Dipole Resonance in (alpha, alpha 'gamma) coincidence experiments

NARCIS (Netherlands)

Savran, D.; Babilon, M.; van den Berg, A. M.; Harakeh, M. N.; Hasper, J.; Wortche, H. J.; Zilges, A.

2007-01-01

We report on first results from experiments using the (alpha, alpha'gamma) reaction at E alpha = 136 MeV to investigate bound electric dipole (El) excitations building the so-called Pygmy Dipole Resonance (PDR) in the semi-magic nucleus Ce-140. The method of (alpha, alpha'gamma) allows the

Laju peningkatan konsentrasi timbal Pb dalam darah hewan uji mencit Mus musculus di bengkel otomotif

Directory of Open Access Journals (Sweden)

Mohammad Razif Sukatma

2012-02-01

Full Text Available This research was conducted in automotive workshop of VEDC Malang and the samples were taken at the automotive machineand automotive electric workshops. The parameters which examined were the Pb concentration in the mouse blood (Mus musculus in2 and 3 months years old. The measurement was run for 5 times every 10 days, and the result was mean value of the increasing rate ofPb concentration in the mouse blood. The aim of this research was to determine the increasing rate of Pb concentration in the mouseblood which has the relation with different working area, different age, and also duration of exposure. Based on the data of laboratorytest, research continued by T-test analysis, Simple regression test, and correlation, and also General Linear Model. By doing statisticanalysis with the different working area, duration of explanation, and different age.Result of this research showed that there were the differences of rapid increasing of Pb concentration in both workshop. Generallythe age which influence so much for that (in the mouse body and have the relation with the body stamina. If the mouse body absorbamount of Pb constantly, so the Pb concentration in it will increase more and more and it cause the decreasing of the body height.

MUS81 is associated with cell proliferation and cisplatin sensitivity in serous ovarian cancer

Energy Technology Data Exchange (ETDEWEB)

Xie, Suhong; Zheng, Hui [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Wen, Xuemei [Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Sun, Jiajun; Wang, Yanchun; Gao, Xiang; Guo, Lin [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Lu, Renquan, E-mail: lurenquan@126.com [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China)

2016-08-05

The dysfunction of DNA damage repair (DDR) pathway contributes to tumorigenesis and drug-resistance in cancer. MUS81 is a member of the conserved xeroderma pigmentosum group F (XPF) family protein of endonucleases, which is important to the DDR pathway. However, the role of MUS81 in the development of ovarian cancer remains uncertain. To explore the expression of MUS81 and its association to serous ovarian cancer (SOC), 43 biopsies of SOC patients were detected by qRT-PCR, and 29 specimens were further performed by immunohistochemistry analysis. Here, we observed that MUS81 was over-expressed in SOC tissues at both transcript and protein levels, and the expression level of MUS81 protein in ovarian cancer cell lines was also higher than that in human normal ovarian surface epithelial cell line (HOSEpiC). We also found that down-regulation of MUS81 expression in ovarian cancer cells inhibited cell proliferation and colony formation ability, and influenced cell cycle progression. Moreover, inhibition of MUS81 expression induced cellular senescence and enhanced the antitumor effect of cisplatin. Down-regulation of MUS81 expression could suppress the growth and development of SOC. These results indicate that MUS81 might play important roles in the progression of SOC and influence the antitumor effect of cisplatin. - Highlights: • MUS81 was overexpression in serous ovarian cancer (SOC). • Meanwhile down-regulation of inhibited cell proliferation and influenced cell cycle progression. • Inhibition of MUS81 induced cell cellular senescence and enhanced the antitumor effect of cisplatin. • Down-regulation of MUS81 expression could suppress the growth and development of SOC.

MUS81 is associated with cell proliferation and cisplatin sensitivity in serous ovarian cancer

International Nuclear Information System (INIS)

Xie, Suhong; Zheng, Hui; Wen, Xuemei; Sun, Jiajun; Wang, Yanchun; Gao, Xiang; Guo, Lin; Lu, Renquan

2016-01-01

The dysfunction of DNA damage repair (DDR) pathway contributes to tumorigenesis and drug-resistance in cancer. MUS81 is a member of the conserved xeroderma pigmentosum group F (XPF) family protein of endonucleases, which is important to the DDR pathway. However, the role of MUS81 in the development of ovarian cancer remains uncertain. To explore the expression of MUS81 and its association to serous ovarian cancer (SOC), 43 biopsies of SOC patients were detected by qRT-PCR, and 29 specimens were further performed by immunohistochemistry analysis. Here, we observed that MUS81 was over-expressed in SOC tissues at both transcript and protein levels, and the expression level of MUS81 protein in ovarian cancer cell lines was also higher than that in human normal ovarian surface epithelial cell line (HOSEpiC). We also found that down-regulation of MUS81 expression in ovarian cancer cells inhibited cell proliferation and colony formation ability, and influenced cell cycle progression. Moreover, inhibition of MUS81 expression induced cellular senescence and enhanced the antitumor effect of cisplatin. Down-regulation of MUS81 expression could suppress the growth and development of SOC. These results indicate that MUS81 might play important roles in the progression of SOC and influence the antitumor effect of cisplatin. - Highlights: • MUS81 was overexpression in serous ovarian cancer (SOC). • Meanwhile down-regulation of inhibited cell proliferation and influenced cell cycle progression. • Inhibition of MUS81 induced cell cellular senescence and enhanced the antitumor effect of cisplatin. • Down-regulation of MUS81 expression could suppress the growth and development of SOC.

Chromosomal heterozygosity and fertility in house mice (Mus musculus domesticus) from Northern Italy.

Science.gov (United States)

Hauffe, H C; Searle, J B

1998-11-01

Following the discovery of over 40 Robertsonian (Rb) races of Mus musculus domesticus in Europe and North Africa, the house mouse has been studied extensively as an ideal model to determine the chromosomal changes that may cause or accompany speciation. Current models of chromosomal speciation are based on the assumption that heterozygous individuals have a particularly low fertility, although recent studies indicate otherwise. Despite their importance, fertility estimates for the house mouse are incomplete because traditional measurements, such as anaphase I nondisjunction and germ cell death, are rarely estimated in conjunction with litter size. In an attempt to bridge this gap, we have taken advantage of the house mouse hybrid zone in Upper Valtellina (Lombardy, Italy) in which five Rb races interbreed. We present data on the fertility of naturally occurring ("wild-caught") hybrids and of offspring from laboratory crosses of wild-caught mice ("laboratory-reared"), using various measurements. Wild-caught mice heterozygous for one fusion were more infertile than predicted from past studies, possibly due to genic hybridity; laboratory-reared heterozygotes carrying seven or eight trivalents at meiosis I and heterozygotes carrying one pentavalent also had low fertilities. These low fertilities are especially significant given the probable occurrence of a reinforcement event in Upper Valtellina.

Genome patterns of selection and introgression of haplotypes in natural populations of the house mouse (Mus musculus.

Directory of Open Access Journals (Sweden)

Fabian Staubach

Full Text Available General parameters of selection, such as the frequency and strength of positive selection in natural populations or the role of introgression, are still insufficiently understood. The house mouse (Mus musculus is a particularly well-suited model system to approach such questions, since it has a defined history of splits into subspecies and populations and since extensive genome information is available. We have used high-density single-nucleotide polymorphism (SNP typing arrays to assess genomic patterns of positive selection and introgression of alleles in two natural populations of each of the subspecies M. m. domesticus and M. m. musculus. Applying different statistical procedures, we find a large number of regions subject to apparent selective sweeps, indicating frequent positive selection on rare alleles or novel mutations. Genes in the regions include well-studied imprinted loci (e.g. Plagl1/Zac1, homologues of human genes involved in adaptations (e.g. alpha-amylase genes or in genetic diseases (e.g. Huntingtin and Parkin. Haplotype matching between the two subspecies reveals a large number of haplotypes that show patterns of introgression from specific populations of the respective other subspecies, with at least 10% of the genome being affected by partial or full introgression. Using neutral simulations for comparison, we find that the size and the fraction of introgressed haplotypes are not compatible with a pure migration or incomplete lineage sorting model. Hence, it appears that introgressed haplotypes can rise in frequency due to positive selection and thus can contribute to the adaptive genomic landscape of natural populations. Our data support the notion that natural genomes are subject to complex adaptive processes, including the introgression of haplotypes from other differentiated populations or species at a larger scale than previously assumed for animals. This implies that some of the admixture found in inbred strains of mice

Ecology and conservation of the cactus ferruginous pygmy-owl in Arizona

Science.gov (United States)

Jean-Luc E. Cartron; Deborah M. Finch

2000-01-01

This report is the result of a cooperative effort by the Rocky Mountain Research Station and the USDA Forest Service Region 3, with participation by the Arizona Game and Fish Department and the Bureau of Land Management. It assesses the state of knowledge related to the conservation status of the cactus ferruginous pygmy-owl in Arizona. The population decline of this...

Phosphorylation by CK2 regulates MUS81/EME1 in mitosis and after replication stress.

Science.gov (United States)

Palma, Anita; Pugliese, Giusj Monia; Murfuni, Ivana; Marabitti, Veronica; Malacaria, Eva; Rinalducci, Sara; Minoprio, Anna; Sanchez, Massimo; Mazzei, Filomena; Zolla, Lello; Franchitto, Annapaola; Pichierri, Pietro

2018-06-01

The MUS81 complex is crucial for preserving genome stability through the resolution of branched DNA intermediates in mitosis. However, untimely activation of the MUS81 complex in S-phase is dangerous. Little is known about the regulation of the human MUS81 complex and how deregulated activation affects chromosome integrity. Here, we show that the CK2 kinase phosphorylates MUS81 at Serine 87 in late-G2/mitosis, and upon mild replication stress. Phosphorylated MUS81 interacts with SLX4, and this association promotes the function of the MUS81 complex. In line with a role in mitosis, phosphorylation at Serine 87 is suppressed in S-phase and is mainly detected in the MUS81 molecules associated with EME1. Loss of CK2-dependent MUS81 phosphorylation contributes modestly to chromosome integrity, however, expression of the phosphomimic form induces DSBs accumulation in S-phase, because of unscheduled targeting of HJ-like DNA intermediates, and generates a wide chromosome instability phenotype. Collectively, our findings describe a novel regulatory mechanism controlling the MUS81 complex function in human cells. Furthermore, they indicate that, genome stability depends mainly on the ability of cells to counteract targeting of branched intermediates by the MUS81/EME1 complex in S-phase, rather than on a correct MUS81 function in mitosis.

Analysis of Copy Number Variation in the Abp Gene Regions of Two House Mouse Subspecies Suggests Divergence during the Gene Family Expansions.

Science.gov (United States)

Pezer, Željka; Chung, Amanda G; Karn, Robert C; Laukaitis, Christina M

2017-06-01

The Androgen-binding protein ( Abp ) gene region of the mouse genome contains 64 genes, some encoding pheromones that influence assortative mating between mice from different subspecies. Using CNVnator and quantitative PCR, we explored copy number variation in this gene family in natural populations of Mus musculus domesticus ( Mmd ) and Mus musculus musculus ( Mmm ), two subspecies of house mice that form a narrow hybrid zone in Central Europe. We found that copy number variation in the center of the Abp gene region is very common in wild Mmd , primarily representing the presence/absence of the final duplications described for the mouse genome. Clustering of Mmd individuals based on this variation did not reflect their geographical origin, suggesting no population divergence in the Abp gene cluster. However, copy number variation patterns differ substantially between Mmd and other mouse taxa. Large blocks of Abp genes are absent in Mmm , Mus musculus castaneus and an outgroup, Mus spretus , although with differences in variation and breakpoint locations. Our analysis calls into question the reliance on a reference genome for interpreting the detailed organization of genes in taxa more distant from the Mmd reference genome. The polymorphic nature of the gene family expansion in all four taxa suggests that the number of Abp genes, especially in the central gene region, is not critical to the survival and reproduction of the mouse. However, Abp haplotypes of variable length may serve as a source of raw genetic material for new signals influencing reproductive communication and thus speciation of mice. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

Coevolution of Cryptosporidium tyzzeri and the house mouse (Mus musculus)

Czech Academy of Sciences Publication Activity Database

Kváč, Martin; McEvoy, J.; Loudová, M.; Stenger, B.; Sak, Bohumil; Květoňová, Dana; Ditrich, Oleg; Rašková, Veronika; Moriarty, E.; Rost, M.; Macholán, Miloš; Piálek, Jaroslav

2013-01-01

Roč. 43, č. 10 (2013), s. 805-817 ISSN 0020-7519 R&D Projects: GA ČR GA206/08/0640; GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 ; RVO:67985904 ; RVO:68081766 Keywords : Cryptosporidium tyzzeri * house mouse * hybrid zone * coevolution Subject RIV: EG - Zoology; GJ - Animal Vermins ; Diseases, Veterinary Medicine (BC-A) Impact factor: 3.404, year: 2013

Fluralaner as a single dose oral treatment for Caparinia tripilis in a pygmy African hedgehog.

Science.gov (United States)

Romero, Camilo; Sheinberg Waisburd, Galia; Pineda, Jocelyn; Heredia, Rafael; Yarto, Enrique; Cordero, Alberto M

2017-12-01

African pygmy hedgehogs (Atelerix albiventris) are popular pets belonging to the Erinaceidae family of spined mammals. Amongst the most common skin diseases occurring in this species is infestation caused by the mite Caparinia spp. Due to their skin anatomy and spiny coat, detection of skin lesions in these hedgehogs can be difficult. This may result in delays in seeking medical care, which may lead to secondary bacterial infection and self-inflicted trauma. Multiple therapies have been used in the treatment of this skin condition including ivermectin, amitraz, fipronil and selamectin. A drug which could be administered as a single oral dose would be advantageous to these pets and their owners. To evaluate the effect of a single oral dose (15 mg/kg) of fluralaner on Caparinia tripilis infestation in the African pygmy hedgehog. A 10-month-old African pygmy hedgehog weighing 184 g. Response to treatment was monitored by dermatological examination and superficial skin scrapings repeated at 7, 14, 21, 30, 60, 90 and 120 days following fluralaner administration. On Day 7 after treatment, adult mites were observed exhibiting normal movement. On Day 14, only dead mites were observed. No life stages of the mites were found after Day 21. A single oral dose at 15 mg/kg of fluralaner was effective within 21 days after treatment for capariniasis in this case. Further studies are required to evaluate the drug's safety and toxicology in hedgehogs, and to confirm efficacy. © 2017 ESVD and ACVD.

X-ray structure of a soluble Rieske-type ferredoxin from Mus musculus

International Nuclear Information System (INIS)

Levin, Elena J.; Elsen, Nathaniel L.; Seder, Kory D.; McCoy, Jason G.; Fox, Brian G.; Phillips Jr, George N.

2008-01-01

The X-ray crystal structure of a soluble Rieske ferredoxin from M. musculus was solved at 2.07 Å resolution, revealing an iron–sulfur cluster-binding domain with similar architecture to the Rieske-type domains of bacterial aromatic dioxygenases. The ferredoxin was also shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases. The 2.07 Å resolution X-ray crystal structure of a soluble Rieske-type ferredoxin from Mus musculus encoded by the gene Mm.266515 is reported. Although they are present as covalent domains in eukaryotic membrane oxidase complexes, soluble Rieske-type ferredoxins have not previously been observed in eukaryotes. The overall structure of the mouse Rieske-type ferredoxin is typical of this class of iron–sulfur proteins and consists of a larger partial β-barrel domain and a smaller domain containing Cys57, His59, Cys80 and His83 that binds the [2Fe–2S] cluster. The S atoms of the cluster are hydrogen-bonded by six backbone amide N atoms in a pattern typical of membrane-bound high-potential eukaryotic respiratory Rieske ferredoxins. However, phylogenetic analysis suggested that the mouse Rieske-type ferredoxin was more closely related to bacterial Rieske-type ferredoxins. Correspondingly, the structure revealed an extended loop most similar to that seen in Rieske-type ferredoxin subunits of bacterial aromatic dioxygenases, including the positioning of an aromatic side chain (Tyr85) between this loop and the [2Fe–2S] cluster. The mouse Rieske-type ferredoxin was shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases, although it was unable to serve as an electron donor for a bacterial monooxygenase complex. The human homolog of mouse Rieske-type ferredoxin was also cloned and purified. It behaved identically to mouse Rieske-type ferredoxin in all biochemical characterizations but did not crystallize. Based on its high sequence identity, the structure of the

Are ribosomal DNA clusters rearrangement hotspots? A case study in the genus Mus (Rodentia, Muridae

Directory of Open Access Journals (Sweden)

Douzery Emmanuel JP

2011-05-01

Full Text Available Abstract Background Recent advances in comparative genomics have considerably improved our knowledge of the evolution of mammalian karyotype architecture. One of the breakthroughs was the preferential localization of evolutionary breakpoints in regions enriched in repetitive sequences (segmental duplications, telomeres and centromeres. In this context, we investigated the contribution of ribosomal genes to genome reshuffling since they are generally located in pericentromeric or subtelomeric regions, and form repeat clusters on different chromosomes. The target model was the genus Mus which exhibits a high rate of karyotypic change, a large fraction of which involves centromeres. Results The chromosomal distribution of rDNA clusters was determined by in situ hybridization of mouse probes in 19 species. Using a molecular-based reference tree, the phylogenetic distribution of clusters within the genus was reconstructed, and the temporal association between rDNA clusters, breakpoints and centromeres was tested by maximum likelihood analyses. Our results highlighted the following features of rDNA cluster dynamics in the genus Mus: i rDNA clusters showed extensive diversity in number between species and an almost exclusive pericentromeric location, ii a strong association between rDNA sites and centromeres was retrieved which may be related to their shared constraint of concerted evolution, iii 24% of the observed breakpoints mapped near an rDNA cluster, and iv a substantial rate of rDNA cluster change (insertion, deletion also occurred in the absence of chromosomal rearrangements. Conclusions This study on the dynamics of rDNA clusters within the genus Mus has revealed a strong evolutionary relationship between rDNA clusters and centromeres. Both of these genomic structures coincide with breakpoints in the genus Mus, suggesting that the accumulation of a large number of repeats in the centromeric region may contribute to the high level of chromosome

Comparative analysis of Homo sapiens and Mus musculus cyclin-dependent kinase (CDK) inhibitor genes p16 (MTS1) and p15 (MTS2).

Science.gov (United States)

Jiang, P; Stone, S; Wagner, R; Wang, S; Dayananth, P; Kozak, C A; Wold, B; Kamb, A

1995-12-01

Cyclin-dependent kinase inhibitors are a growing family of molecules that regulate important transitions in the cell cycle. At least one of these molecules, p16, has been implicated in human tumorigenesis while its close homolog, p15, is induced by cell contact and transforming growth factor-beta (TGF-beta). To investigate the evolutionary and functional features of p15 and p16, we have isolated mouse (Mus musculus) homologs of each gene. Comparative analysis of these sequences provides evidence that the genes have similar functions in mouse and human. In addition, the comparison suggests that a gene conversion event is part of the evolution of the human p15 and p16 genes.

The pygmy quadrupole resonance and neutron-skin modes in 124Sn

Directory of Open Access Journals (Sweden)

M. Spieker

2016-01-01

Full Text Available We present an extensive experimental study of the recently predicted pygmy quadrupole resonance (PQR in Sn isotopes, where complementary probes were used. In this study, (α,α′γ and (γ,γ′ experiments were performed on 124Sn. In both reactions, Jπ=2+ states below an excitation energy of 5 MeV were populated. The E2 strength integrated over the full transition densities could be extracted from the (γ,γ′ experiment, while the (α,α′γ experiment at the chosen kinematics strongly favors the excitation of surface modes because of the strong α-particle absorption in the nuclear interior. The excitation of such modes is in accordance with the quadrupole-type oscillation of the neutron skin predicted by a microscopic approach based on self-consistent density functional theory and the quasiparticle-phonon model (QPM. The newly determined γ-decay branching ratios hint at a non-statistical character of the E2 strength, as it has also been recently pointed out for the case of the pygmy dipole resonance (PDR. This allows us to distinguish between PQR-type and multiphonon excitations and, consequently, supports the recent first experimental indications of a PQR in 124Sn.

Reduced predation risk for melanistic pygmy grasshoppers in post-fire environments

Science.gov (United States)

Karpestam, Einat; Merilaita, Sami; Forsman, Anders

2012-01-01

The existence of melanistic (black) color forms in many species represents interesting model systems that have played important roles for our understanding of selective processes, evolution of adaptations, and the maintenance of variation. A recent study reported on rapid evolutionary shifts in frequencies of the melanistic forms in replicated populations of Tetrix subulata pygmy grasshoppers; the incidence of the melanistic form was higher in recently burned areas with backgrounds blackened by fire than in nonburned areas, and it declined over time in postfire environments. Here, we tested the hypothesis that the frequency shifts of the black color variant were driven, at least in part, by changes in the selective regime imposed by visual predators. To study detectability of the melanistic form, we presented human “predators” with images of black grasshoppers and samples of the natural habitat on computer screens. We demonstrate that the protective value of black coloration differs between burnt and nonburnt environments and gradually increases in habitats that have been more blackened by fire. These findings support the notion that a black color pattern provides improved protection from visually oriented predators against blackened backgrounds and implicate camouflage and predation as important drivers of fire melanism in pygmy grasshoppers. PMID:23139879

Rad54 and Mus81 cooperation promotes DNA damage repair and restrains chromosome missegregation

DEFF Research Database (Denmark)

Ghamrasni, S El; Cardoso, R; Li, L

2016-01-01

. The inefficient repair of DNA double-strand breaks (DSBs) in Rad54(-/-)Mus81(-/-) cells was accompanied by elevated levels of chromosome missegregation and cell death. Perhaps as a consequence, tumor incidence in Rad54(-/-)Mus81(-/-) mice remained comparable to that in Mus81(-/-) mice. Our study highlights...

One normal void and residual following MUS surgery is all that is necessary in most patients.

Science.gov (United States)

Ballard, Paul; Shawer, Sami; Anderson, Colette; Khunda, Aethele

2018-04-01

There is considerable variation worldwide on how the assessment of voiding function is performed following midurethral sling (MUS) surgery. There is potentially a financial cost, and reduction in efficiency when patient discharge is delayed. Using our current practice of two normal void and residual (V&R) readings before discharge, the aim of this retrospective study was to evaluate the likelihood of an abnormal second V&R test if the first V&R test was normal in order to determine if a policy of discharge after only one satisfactory V&R test is reasonable. Data from 400 patients who had had MUS surgery with or without other procedures were collected. Our unit protocol included two consecutive voids of greater than 200 ml with residuals less than 150 ml before discharge. The patients were divided into the following groups: MUS only, MUS plus anterior colporrhaphy (AR) plus any other procedures (MUS/AR), and MUS with any non-AR procedures (MUS+). Complete datasets were available for 335 patients. Once inadequate tests (low volume voids <200 ml) had been excluded (28% overall), the likelihood of an abnormal second V&R test if the first test was normal was 7.1% overall, but 3.6% for MUS, 11.5% for MUS/AR and 8.6% for MUS+. The findings in the MUS-only group indicate that it is probably safe to discharge patients after one satisfactory V&R test, as long as safety measures such as 'open access' are available so that patients have unhindered readmission if problems arise.

Le MusVerre, Sars-Poteries, Hauts-de-France

OpenAIRE

Schmitt , Daniel

2017-01-01

Le MusVerre, inauguré en 2016, présente une collection patrimoniale et contemporaine d'art verrier. Le scénario de la visite propose un parcours en deux temps avec une séquence historique : de l’histoire des « bousillés » à la création du musée avec une galerie technique qui donne un aperçu des gestes de l’art verrier. Puis une séquence contemporaine développe un panorama des collections d’art verrier d’aujourd’hui, dans leur grande richesse et originalité.

INTEGRAL/JEM-X detection of fading emission from GT Mus

DEFF Research Database (Denmark)

Fiocchi, M.; Chenevez, J.; Sguera, V.

2015-01-01

On November 15th 2015 the MAXI/GSC detected a big flare from the RS CVn star GT Mus with a flux of ~100 mCrab in the 2-20 keV energy band. (ATel #8285). During recent INTEGRAL observations of the Musca region performed between 17 Nov 16:08 and 18 Nov 00:05 (UTC) the source GT Mus was within the f...

Decay properties of the Pygmy dipole resonance

Energy Technology Data Exchange (ETDEWEB)

Isaak, J.; Savran, D.; Silva, J. [EMMI, Darmstadt (Germany); FIAS, Frankfurt (Germany); Aumann, T.; Loeher, B. [IKP, TU Darmstadt (Germany); GSI, Darmstadt (Germany); Beck, T.; Gayer, U.; Pietralla, N.; Romig, C.; Scheit, H.; Werner, V.; Zweidinger, M. [IKP, TU Darmstadt (Germany); Cooper, N. [WNSL, Yale University, New Haven (United States); Derya, V.; Zilges, A. [IKP, Universitaet zu Koeln (Germany); Kelley, J. [Department of Physics, Duke University, TUNL (United States); Department of Physics, NCSU (United States); Scheck, M. [School of Engineering, UWS, Paisley (United Kingdom); SUPA, Glasgow (United Kingdom); Tornow, W.; Weller, H. [Department of Physics, Duke University, TUNL (United States)

2015-07-01

The so-called Pygmy Dipole Resonance (PDR) has been investigated in stable and in a few unstable nuclei in the past decades. So far, decay properties have been determined only in an indirect or model-dependent way. An excellent tool to extend the study of the decay pattern of the PDR is provided by the γ{sup 3}-setup at the High Intensity γ-ray Source (HIγS). The combination of the γ-γ-coincidence method and the quasi-monochromatic photon beam at HIγS allows to observe primary transitions directly with high sensitivity and to obtain information on the decay behavior of individual states as well as extracting averaged quantities in a model-independent way. Recent experimental results for nuclei in the Z=50 and N=82 mass region are presented.

Investigation of the Pygmy Dipole Resonance in {sup 60}Ni

Energy Technology Data Exchange (ETDEWEB)

Fritzsche, Matthias; Pietralla, Norbert; Romig, Christopher; Savran, Deniz; Sonnabend, Kerstin [Institut fuer Kernphysik, Technische Universitaet, Darmstadt (Germany); Rusev, Gencho; Tonchev, Anton P.; Tornow, Werner; Weller, Henry R. [Triangle Universities Nuclear Laboratory, Duke University, Durham, NC (United States); Zilges, Andreas [Institut fuer Kernphysik, Universitaet Koeln (Germany)

2009-07-01

At the High Intensity Photon Setup (HIPS) at S-DALINAC in Darmstadt {sup 60}Ni was investigated with unpolarized bremsstrahlung with energies up to 8.0 MeV and 9.9 MeV, respectively. Determination of spin and parity quantum numbers and absolute transition strengths was possible, using HPGe detectors placed under different angles. To assign also parity quantum numbers, the polarized photon beam of the High Intensity Gamma Source (HI{gamma}S) at Duke University was used. With the combined results, evidence of the Pygmy Dipole Resonance in {sup 60}Ni was found.

Nuclear Deformation and Neutron Excess as Competing Effects for Dipole Strength in the Pygmy Region

Science.gov (United States)

Massarczyk, R.; Schwengner, R.; Dönau, F.; Frauendorf, S.; Anders, M.; Bemmerer, D.; Beyer, R.; Bhatia, C.; Birgersson, E.; Butterling, M.; Elekes, Z.; Ferrari, A.; Gooden, M. E.; Hannaske, R.; Junghans, A. R.; Kempe, M.; Kelley, J. H.; Kögler, T.; Matic, A.; Menzel, M. L.; Müller, S.; Reinhardt, T. P.; Röder, M.; Rusev, G.; Schilling, K. D.; Schmidt, K.; Schramm, G.; Tonchev, A. P.; Tornow, W.; Wagner, A.

2014-02-01

The electromagnetic dipole strength below the neutron-separation energy has been studied for the xenon isotopes with mass numbers A =124, 128, 132, and 134 in nuclear resonance fluorescence experiments using the γELBE bremsstrahlung facility at Helmholtz-Zentrum Dresden-Rossendorf and the HIγS facility at Triangle Universities Nuclear Laboratory Durham. The systematic study gained new information about the influence of the neutron excess as well as of nuclear deformation on the strength in the region of the pygmy dipole resonance. The results are compared with those obtained for the chain of molybdenum isotopes and with predictions of a random-phase approximation in a deformed basis. It turned out that the effect of nuclear deformation plays a minor role compared with the one caused by neutron excess. A global parametrization of the strength in terms of neutron and proton numbers allowed us to derive a formula capable of predicting the summed E1 strengths in the pygmy region for a wide mass range of nuclides.

Nuclear deformation and neutron excess as competing effects for dipole strength in the pygmy region.

Science.gov (United States)

Massarczyk, R; Schwengner, R; Dönau, F; Frauendorf, S; Anders, M; Bemmerer, D; Beyer, R; Bhatia, C; Birgersson, E; Butterling, M; Elekes, Z; Ferrari, A; Gooden, M E; Hannaske, R; Junghans, A R; Kempe, M; Kelley, J H; Kögler, T; Matic, A; Menzel, M L; Müller, S; Reinhardt, T P; Röder, M; Rusev, G; Schilling, K D; Schmidt, K; Schramm, G; Tonchev, A P; Tornow, W; Wagner, A

2014-02-21

The electromagnetic dipole strength below the neutron-separation energy has been studied for the xenon isotopes with mass numbers A=124, 128, 132, and 134 in nuclear resonance fluorescence experiments using the γELBE bremsstrahlung facility at Helmholtz-Zentrum Dresden-Rossendorf and the HIγS facility at Triangle Universities Nuclear Laboratory Durham. The systematic study gained new information about the influence of the neutron excess as well as of nuclear deformation on the strength in the region of the pygmy dipole resonance. The results are compared with those obtained for the chain of molybdenum isotopes and with predictions of a random-phase approximation in a deformed basis. It turned out that the effect of nuclear deformation plays a minor role compared with the one caused by neutron excess. A global parametrization of the strength in terms of neutron and proton numbers allowed us to derive a formula capable of predicting the summed E1 strengths in the pygmy region for a wide mass range of nuclides.

Curcumin Is Efective In Improving Folliculogenesis Profile And Oo-cytes Quality In Vitro In Ectopic Endometriosis Mouse (Mus muscu-lus Models

Directory of Open Access Journals (Sweden)

Aulia Firmawati

2018-02-01

Full Text Available Endometriosis is the presence of ectopic endometrial tissue, such as that outside the uter-ine cavity, which can cause chronic inflammatory reactions. Curcumin is one of traditional herbal med-icines that is widely used. Some experiments have managed to find a mechanism to treat an ectopic endometriosis through the mechanism of suppression of several cytokines such as TNF-alpha, NF-kB and COX-2, this study was an experimental laboratory study, with five treatments and six replications, using female mice (Mus musculus that had reached puberty. The study consisted of three phases: the first phase was the microscopic examination of in vitro oocytes quality, and the second was histopatho-logical examination of folliculogenesis profile using Hematoxillin eosin staining, the results of this study showed significant difference between positive control group (P0 with treatment and negative control (KN groups in folliculogenesis profile (p <0.05. Examination of in vitro oocytes quality showed sig-nificant difference between positive control group with treatment group and negative control group (p <0.05. Curcumin has several roles in cytokines modulation in ectopic endometriosis mouse models. Curcumin may reduce the occurrence of apoptosis of granulosa cells so that it may directly improve oocyte quality and folliculogenesis profile, in conclusion, curcumin effectively overcomes fertility prob-lems through the mechanism of cytokines modulation that plays a role in some cases of endometriosis such as: TNF-alpha, NF-kB and COX-2. Curcumin may improve folliculogenesis profile and in vitro oocytes quality.

Acute MUS81 depletion leads to replication fork slowing and a constitutive DNA damage response

DEFF Research Database (Denmark)

Xing, Meichun; Wang, Xiaohui; Palmai-Pallag, Timea

2015-01-01

have investigated the role of MUS81 in human cells by acutely depleting the protein using shRNAs. We found that MUS81 depletion from human fibroblasts leads to accumulation of ssDNA and a constitutive DNA damage response that ultimately activates cellular senescence. Moreover, we show that MUS81...

Organochlorine Pesticides in the Ferruginous Pygmy Owl (Glaucidium brasilianum) in Chiapas, Mexico.

Science.gov (United States)

Arrona-Rivera, Alicia E; Enríquez, Paula L; García-Feria, Luis M; Orellana, Sergio Alvarado; von Osten, Jaime Rendón

2016-09-01

Concentrations of organochlorine pesticides were quantified in samples of feathers (n = 17) and blood (n = 15) of the ferruginous pygmy owl (Glaucidium brasilianum). The individuals were captured near the Protected Natural Area Cerro Sonsonate, Chiapas, Mexico, between February and June 2014. In both tissues, pesticides belonging to seven organochlorine chemical families were detected. However, the organochlorine pesticide concentrations differed between feathers and blood. The highest concentrations of hexachlorocyclohexanes were found in feathers (0.63 ± 0.89 μg/g), whereas the highest concentrations of ΣDrines were found in blood (0.31 ± 0.47 μg/mL). By using the summed concentrations for each of the seven families of pesticides found in feathers, we did not find any significant correlation between the pesticides and pectoral muscle or body weight (p > 0.15). The ΣDDT group was the only pesticide family that showed a positive correlation with owl body weight (r = 0.60, p = 0.05); the concentrations of these pesticides were also high in feather and blood tissues (r = 0.87, p = 0.02). Our results confirm that ferruginous pygmy owls in the study area are exposed to these pesticides.

The role fo the Pygmy resonance in the synthesis of heavy elements with radioactive beams

International Nuclear Information System (INIS)

Hussein, M.S.

1990-12-01

It is suggested that the inclusion of the virtual excitation of the soft giant dipole (pygmy) resonance in the calculation of the cross-section for very neutron-rich radioactive beam-induced fusion reactions may enhance the formation probability of the heavy compound nucleus produced at low excitation energy. (author)

Life history and bioeconomy of the house mouse.

Science.gov (United States)

Berry, R J; Bronson, F H

1992-11-01

1. More is known about the western European house mouse, Mus (musculus) domesticus than any other non-human mammal. If laboratory and field information is combined, an extremely valuable understanding of the species' bioeconomy could be obtained. 2. The seven stages of mouse life-history are surveyed (up to birth, nest life, sex life, social structure, population statics and stability, senescence, and death), and the interactions between the changing phenotype and the environment are described. 3. These interactions can be used to build up a model of the opportunities and compromises which result in the fitness of individual mice. It is not yet possible to quantify such a model, but this should in principle be achievable.

Chapter 6: Research needs for the conservation of the cactus ferruginous pygmy-owl in Arizona

Science.gov (United States)

Jean-Luc E. Cartron; W. Scott Richardson; Deborah M. Finch; David J. Krueper

2000-01-01

In this chapter, we describe research needs for the conservation of the cactus ferruginous pygmy-owl (Glaucidium brasilianum cactorum) in Arizona. Estimates of population size, structure, and dynamics, as well as demographic data, are needed for the recovery team to formulate sound population objectives. Habitat loss due to residential development...

Joint molecule resolution requires the redundant activities of MUS-81 and XPF-1 during Caenorhabditis elegans meiosis.

Directory of Open Access Journals (Sweden)

Nigel J O'Neil

Full Text Available The generation and resolution of joint molecule recombination intermediates is required to ensure bipolar chromosome segregation during meiosis. During wild type meiosis in Caenorhabditis elegans, SPO-11-generated double stranded breaks are resolved to generate a single crossover per bivalent and the remaining recombination intermediates are resolved as noncrossovers. We discovered that early recombination intermediates are limited by the C. elegans BLM ortholog, HIM-6, and in the absence of HIM-6 by the structure specific endonuclease MUS-81. In the absence of both MUS-81 and HIM-6, recombination intermediates persist, leading to chromosome breakage at diakinesis and inviable embryos. MUS-81 has an additional role in resolving late recombination intermediates in C. elegans. mus-81 mutants exhibited reduced crossover recombination frequencies suggesting that MUS-81 is required to generate a subset of meiotic crossovers. Similarly, the Mus81-related endonuclease XPF-1 is also required for a subset of meiotic crossovers. Although C. elegans gen-1 mutants have no detectable meiotic defect either alone or in combination with him-6, mus-81 or xpf-1 mutations, mus-81;xpf-1 double mutants are synthetic lethal. While mus-81;xpf-1 double mutants are proficient for the processing of early recombination intermediates, they exhibit defects in the post-pachytene chromosome reorganization and the asymmetric disassembly of the synaptonemal complex, presumably triggered by crossovers or crossover precursors. Consistent with a defect in resolving late recombination intermediates, mus-81; xpf-1 diakinetic bivalents are aberrant with fine DNA bridges visible between two distinct DAPI staining bodies. We were able to suppress the aberrant bivalent phenotype by microinjection of activated human GEN1 protein, which can cleave Holliday junctions, suggesting that the DNA bridges in mus-81; xpf-1 diakinetic oocytes are unresolved Holliday junctions. We propose that the

Glutamate Oxaloacetate Transaminase (Got) Genetics in the Mouse: Polymorphism of Got-1

Science.gov (United States)

Chapman, Verne M.; Ruddle, Frank H.

1972-01-01

We have examined a polymorphism for the soluble glutamate oxaloacetate (GOT-1) isozyme system which was found in the Asian mouse Mus castaneus. Variants of GOT-1 segregate as though they are controlled by codominant alleles for a single autosomal locus which we have designated Got-1. No close linkage of genes for soluble and mitochondrial forms of the enzyme, GOT-1 and GOT-2 respectively, was observed. Furthermore, no close linkage of Got-1 and the loci c, Gpi-1, Mod-2, Mod-1, Ld-1, Gpd-1, Pgm-1 or Gpo-1 was observed. Our results demonstrate the utility of sampling Mus from diverse populations to extend the repertoire of polymorphic loci and the genetic linkage map. PMID:17248564

THE MANAGEMENT OF AN ORAL ANAPLASTIC SARCOMA IN A PYGMY HIPPOPOTAMUS (CHOEROPSIS LIBERIENSIS) USING INTRALESIONAL CHEMOTHERAPY.

Science.gov (United States)

Franklinos, Lydia H V; Masters, Nicholas; Feltrer, Yedra; Pocknell, Ann; Bolt, David M; Dakin, Stephanie; Berry, Karla; Molenaar, Fieke M

2017-03-01

An adult female captive pygmy hippopotamus (Choeropsis liberiensis) was diagnosed with an oral anaplastic sarcoma. The tumor was surgically debulked and intralesional chemotherapy with mitomycin C (0.4 mg/cm 3 of tumor) and cisplatin (1 mg/cm 3 of tumor) was administered. Chemotherapeutic treatment proved difficult due to the risks of repeated anesthetics and unknown drug efficacies. Marked proliferation of the mass was observed during estrus, and chemotherapy was repeated as an experimental treatment to slow tumor progression in order for the animal to remain in the species breeding program. Tumor proliferation was detected during the first trimester of pregnancy; however, in the lactation period, the mass became quiescent. No adverse reactions to chemotherapeutic drugs were observed and the animal continues to be monitored for tumor progression. This is the first report of an anaplastic sarcoma and of chemotherapy use in a pygmy hippopotamus and it highlights logistical considerations for treating neoplasia in this species.

POSSuMUS: a position sensitive scintillating muon SiPM detector

CERN Document Server

Ruschke, Alexander

The development of a modular designed large scale scintillation detector with a two-dimensional position sensitivity is presented in this thesis. This novel POsition Sensitive Scintillating MUon SiPM Detector is named POSSuMUS. The POSSuMUS detector is capable to determine the particle’s position in two space dimensions with a fast trigger capability. Each module is constructed from two trapezoidal shaped plastic scintillators to form one rectangular shaped detector module. Both trapezoids are optically insulated against each other. In both trapezoids the scintillation light is collected by plastic fibers and guided towards silicon photomultipliers (SiPMs). SiPMs are light sensors which are capable to detect even smallest amounts of light. By combining several detector modules, position sensitive areas from 100 cm2 to few m2 are achievable with few readout channels. Therefore, POSSuMUS provides a cost effective detector concept. The position sensitivity along the trapezoidal geometry of one detector module ...

Scorpion envenomation in pygmies from Democratic Republic of Congo, the example of Pelenge Center, Lomela, DRC

Directory of Open Access Journals (Sweden)

E Biezakala Mudiandambu

2012-01-01

Full Text Available In a survey among the pygmies of central Democratic Republic of Congo, the incidence of scorpion stings seemed very high with a severity greater than expected. Species responsible were not identified. Specific studies are needed to clarify the risk emerging in the equatorial African forest.

Effect of Pasak Bumi (Eurycoma longifolia Jack) Root In Precopulation Stage to the Fertility of Female Mouse (Mus musculus L.)

OpenAIRE

Marlinza, Rosa

2012-01-01

Pasak Bumi (Eurycoma longifolia Jack) have potency to be used to increase bodyendurance, to cure malaria drug, and to act as afrodisiak. However, the effect of pasak bumi onwomen fertility, especially at pre-copulation stage was not widely known. This research seeks toreveal the effect pasak bumi extract treated at pre-copulation phase on fertility. This experimentemploy mice (Mus Musculus L.) and was undertaken at Biology and Cemistry laboratories PMIPA, andVeterinary laboratory of Jambi Uni...

Retrospective analysis of causes of death in mountain pygmy-possums (Burramys parvus) at Healesville Sanctuary, Victoria, Australia.

Science.gov (United States)

Scheelings, T F; Dobson, E C

2015-11-01

Identification and characterisation of deaths is important for the veterinary management of both wild and captive animals. It is especially important as a tool for monitoring health and disease within populations of endangered species for which little information on morbidity and mortality is known. Investigations into the causes of death and other important necropsy findings were made in a captive population of the critically endangered mountain pygmy-possum (Burramys parvus). Necropsy records from January 2000-December 2013 were reviewed for all possums that had lived and died at Healesville Sanctuary (n = 48). The average age of death of possums in this population was 4.7 years. The most common histological change in mountain pygmy-possums was varying degrees of chronic progressive kidney disease (n = 17). Of these cases, eight animals (47%) had histological changes suggesting the kidney disease was the likely cause of death. Other causes of death included neoplasia (n = 5), necrotising pancreatitis (n = 4), pneumonia (n = 2), reproductive disease (n = 2) and trauma (n = 2). No cause of death was able to be identified in 33.3% (n = 16) of cases. Hepatic lipidosis (n = 5), pneumonia (n = 2) and degenerative joint disease (n = 2) were the most common comorbidities found. Progressive renal disease, often with secondary metastatic mineralisation, appears to be a significant cause of mortality in captive mountain pygmy-possums and further investigation into its pathophysiology, antemortem diagnosis and treatment is warranted. © 2015 Australian Veterinary Association.

Context dependence of acorn handling by the Algerian mouse (Mus spretus)

Science.gov (United States)

Gallego, D.; Morán-López, T.; Torre, I.; Navarro-Castilla, Á.; Barja, I.; Díaz, M.

2017-10-01

Perceived predation risk and competition for acorns are expected to affect scatter-hoarding decisions by Algerian mice (Mus spretus). We manipulated both factors by means of predator fecal scents and ungulate exclosures. We hypothesized that high-risk perception and ungulate presence would promote acorn dispersal. In the former case, it would stimulate acorn mobilization to safe microhabitats rather than in situ consumption. In the latter, increased competition for acorns would promote their storage for later consumption. We also expected that mice would adapt their foraging behavior to previous experience modulating the strength of these effects. In the presence of ungulates, mice focused their foraging activities on food acquisition at the expenses of vigilant behaviors. However, a more efficient foraging did not entail enhanced dispersal services. Lack of anti-predatory cover in tree surroundings may have deterred mice from transporting seeds outside canopies. Increased risk interacted with previous experience. In control trees (no predator odor), mice confidence increased throughout the night resulting in decreased vigilance and enhanced acorn mobilization rates. In contrast, in risky conditions (trees with predator odor) mice maintained a base-line vigilant behavior. Contrary to our expectations, increased risk did not result in higher acorn mobilization, but the opposite. Again, the scarcity of safe microhabitats for mobilization may have been the underlying cause of this behavior. Our results show that successful acorn dispersal depends, at least partly, on plant-animal relationships that are beyond the oak-rodent mutualism. Thus, any conservation policy aimed at restoring natural regeneration of oaks should take into account the interaction network in which oak-rodent encounters are embedded. In addition, they suggest that mice incorporate direct and indirect cues of risks (habitat structure) through recent experience. A better understanding of this process

Les sens du musée

Directory of Open Access Journals (Sweden)

Laurent Grison

1999-09-01

Full Text Available Cet article, fondé sur l'exemple de la National Gallery de Londres, porte sur l'intégration dans le cadre urbain, l'aménagement et les dynamiques spatiales du lieu muséal. Sur le même thème, nous relatons un exercice réalisé avec des lycéens.

Potential of MuS1 Transgenic Tobacco for Phytoremediation of the Urban Soils Contaminated with Cadmium

Science.gov (United States)

Kim, K. H.; Kim, Y. N.; Kim, S. H.

2010-05-01

Urban soils are prone to contamination by trace elements such as Cd, Cu, Pb and Zn. Phytoremediation is one of the attractive remediation methods for soils contaminated with trace elements due to its non-destructive and environmentally-friendly characteristic. Scientists have tried to find hyper-accumulator plants in nature or to develop transgenic plant through genetic engineering. This study was carried out to identify a potential of MuS1 transgenic tobacco for phytoremediation of the urban soils contaminated with Cd. MuS1 is known as a multiple stress related gene with several lines. The previous study using RT-PCR showed that the expression of MuS1 gene in tobacco plant induced tolerance to Cd stress. For this study, MuS1 transgenic tobacco and wild-type tobacco (control) were cultivated in a hydroponic system treated with Cd (0, 50, 100 and 200μM Cd) for 3 weeks. At harvest, both tobacco and nutrient solution were collected and were analyzed for Cd. Effect of Cd treatment on morphological change of the tobacco leaves was also observed by variable-pressure scanning electron microscopy (VP-SEM). The tolerance of MuS1 transgenic tobacco to Cd stress was better than that of wild-type tobacco at all Cd levels. Especially, wild-type tobacco showed chlorosis and withering with 200μM Cd treatment, whereas MuS1 transgenic tobacco gradually recovered from Cd damage. Wild-type tobacco accumulated more Cd (4.65mg per plant) than MuS1 transgenic tobacco (2.37mg per plant) with 200μM Cd treatment. Cd translocation rate from root to leaves was 81.8 % for wild-type tobacco compared to 37.1 % for MuS1 transgenic tobacco. Result of VP-SEM showed that the number of trichome in the leaves for wild-type tobacco increased in comparison with that for untreated samples after 3 weeks, while that for MuS1 transgenic tobacco was not changed by Cd treatment. Results showed that the mechanism of the recovery of the MuS1 tobacco plant was not by high level of Cd uptake and accumulation

X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS

Energy Technology Data Exchange (ETDEWEB)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden Street, Cambridge, MA 02138 (United States); Guinan, Edward; Engle, Scott [Department of Astronomy and Astrophysics, Villanova University, 800 Lancaster Avenue, Villanova, PA 19085 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H., E-mail: nevans@cfa.harvard.edu [The CHARA Array of Georgia State University, Mount Wilson, CA 91023 (United States)

2014-04-20

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.

X-Ray Detection of the Cluster Containing the Cepheid S Mus

Science.gov (United States)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan

2014-04-01

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J - K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.

X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS

International Nuclear Information System (INIS)

Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.

2014-01-01

The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator

Dbf4-dependent kinase and the Rtt107 scaffold promote Mus81-Mms4 resolvase activation during mitosis.

Science.gov (United States)

Princz, Lissa N; Wild, Philipp; Bittmann, Julia; Aguado, F Javier; Blanco, Miguel G; Matos, Joao; Pfander, Boris

2017-03-01

DNA repair by homologous recombination is under stringent cell cycle control. This includes the last step of the reaction, disentanglement of DNA joint molecules (JMs). Previous work has established that JM resolving nucleases are activated specifically at the onset of mitosis. In case of budding yeast Mus81-Mms4, this cell cycle stage-specific activation is known to depend on phosphorylation by CDK and Cdc5 kinases. Here, we show that a third cell cycle kinase, Cdc7-Dbf4 (DDK), targets Mus81-Mms4 in conjunction with Cdc5-both kinases bind to as well as phosphorylate Mus81-Mms4 in an interdependent manner. Moreover, DDK-mediated phosphorylation of Mms4 is strictly required for Mus81 activation in mitosis, establishing DDK as a novel regulator of homologous recombination. The scaffold protein Rtt107, which binds the Mus81-Mms4 complex, interacts with Cdc7 and thereby targets DDK and Cdc5 to the complex enabling full Mus81 activation. Therefore, Mus81 activation in mitosis involves at least three cell cycle kinases, CDK, Cdc5 and DDK Furthermore, tethering of the kinases in a stable complex with Mus81 is critical for efficient JM resolution. © 2017 The Authors. Published under the terms of the CC BY NC ND 4.0 license.

Molecular heterogeneity in major urinary proteins of Mus musculus subspecies: potential candidates involved in speciation

Science.gov (United States)

Hurst, Jane L.; Beynon, Robert J.; Armstrong, Stuart D.; Davidson, Amanda J.; Roberts, Sarah A.; Gómez-Baena, Guadalupe; Smadja, Carole M.; Ganem, Guila

2017-01-01

When hybridisation carries a cost, natural selection is predicted to favour evolution of traits that allow assortative mating (reinforcement). Incipient speciation between the two European house mouse subspecies, Mus musculus domesticus and M.m.musculus, sharing a hybrid zone, provides an opportunity to understand evolution of assortative mating at a molecular level. Mouse urine odours allow subspecific mate discrimination, with assortative preferences evident in the hybrid zone but not in allopatry. Here we assess the potential of MUPs (major urinary proteins) as candidates for signal divergence by comparing MUP expression in urine samples from the Danish hybrid zone border (contact) and from allopatric populations. Mass spectrometric characterisation identified novel MUPs in both subspecies involving mostly new combinations of amino acid changes previously observed in M.m.domesticus. The subspecies expressed distinct MUP signatures, with most MUPs expressed by only one subspecies. Expression of at least eight MUPs showed significant subspecies divergence both in allopatry and contact zone. Another seven MUPs showed divergence in expression between the subspecies only in the contact zone, consistent with divergence by reinforcement. These proteins are candidates for the semiochemical barrier to hybridisation, providing an opportunity to characterise the nature and evolution of a putative species recognition signal. PMID:28337988

The screening of parasites and viral pathogens of small mammals from a farm in southern Finland, and genetic identification of the Finnish house mouse, Mus musculus

Czech Academy of Sciences Publication Activity Database

Laakkonen, J.; Kallio-Kokko, M.; Vapalahti, O.; Vaheri, A.; Vyskočilová, M.; Munclinger, P.; Macholán, Miloš; Henttonen, H.

2007-01-01

Roč. 44, - (2007), s. 202-208 ISSN 0003-455X EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus musculus Subject RIV: EG - Zoology Impact factor: 1.537, year: 2007

Isolation of three novel rat and mouse papillomaviruses and their genomic characterization.

Directory of Open Access Journals (Sweden)

Eric Schulz

Full Text Available Despite a growing knowledge about the biological diversity of papillomaviruses (PV, only little is known about non-human PV in general and about PV mice models in particular. We cloned and sequenced the complete genomes of two novel PV types from the Norway rat (Rattus norvegicus; RnPV2 and the wood mouse (Apodemus sylvaticus; AsPV1 as well as a novel variant of the recently described MmuPV1 (originally designated as MusPV from a house mouse (Mus musculus; MmuPV1 variant. In addition, we conducted phylogenetic analyses using a systematically representative set of 79 PV types, including the novel sequences. As inferred from concatenated amino acid sequences of six proteins, MmuPV1 variant and AsPV1 nested within the Beta+Xi-PV super taxon as members of the Pi-PV. RnPV2 is a member of the Iota-PV that has a distant phylogenetic position from Pi-PV. The phylogenetic results support a complex scenario of PV diversification driven by different evolutionary forces including co-divergence with hosts and adaptive radiations to new environments. PV types particularly isolated from mice and rats are the basis for new animal models, which are valuable to study PV induced tumors and new treatment options.

Paranoids, pygmies, pariahs and nonproliferation

International Nuclear Information System (INIS)

Betts, R.K.

1977-01-01

The spread of nuclear weapons has finally become a central item on the foreign policy agenda. But the fervor of most opponents of proliferation has been matched only by their reluctance to deal with the causes of the threat. The misplaced focus on ways to isolate weapons-related capabilities obscures the importance of the stickier but more salient problem of the incentives many nations have to get a bomb: fear or ambition. As long as antiproliferation strategy goes no further than schemes to keep the genie in a few bottles, we risk doing both more and less than necessary. Distressingly few arms-control enthusiasts have faced up to the full price of nonproliferation. The needed reorientation in thinking, which is really only a return to the ageless problem of balance of power, has been impeded by prevalent fallacies of emphasis about what causes the threat, who the candidates for proliferation are, and what strategies are applicable to which candidates. The author proceeds to discuss: (1) causes (the moralist fallacy, the economic fallacy, the diseconomic fallacy, and the technicist fallacy); (2) candidates (the pygmy states, the paranoid states, the pariah states, and five options of the U.S.); (3) cures (the fatalist fallacy, the multilateral fallacy, the embargo fallacy, the safeguards fallacy, the umbrella fallacy, the two-wrongs-don't-make-a-right fallacy, and the golden key fallacy); and (4) choices

Subspecies-specific response to ACTH challenge test in the house mouse (Mus musculus)

Czech Academy of Sciences Publication Activity Database

Daniszová, Kristina; Mikula, O.; Macholán, M.; Pospíšilová, I.; Vošlajerová Bímová, Barbora; Hiadlovská, Z.

2017-01-01

Roč. 252, October (2017), s. 186-192 ISSN 0016-6480 R&D Projects: GA ČR GAP506/11/1792 Institutional support: RVO:68081766 Keywords : ACTH challenge * Endocrine activity * Corticosterone * Hormone metabolites * Mouse * Noninvasive monitoring Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.585, year: 2016

A novel adipokinetic peptide from the corpus cardiacum of the primitive caeliferan pygmy grasshopper Tetrix subulata (Caelifera, Tetrigidae)

Czech Academy of Sciences Publication Activity Database

Gäde, G.; Šimek, Petr; Marco, H. G.

2015-01-01

Roč. 68, JUN 01 (2015), s. 43-49 ISSN 0196-9781 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : insects * pygmy grasshoppers * Tetrigidae Subject RIV: EH - Ecology, Behaviour Impact factor: 2.535, year: 2015 http://www.sciencedirect.com/science/article/pii/S0196978115000339

Chapter 2: A historical perspective on the population decline of the cactus ferruginous pygmy-owl in Arizona

Science.gov (United States)

R. Roy Johnson; Jean-Luc E. Cartron; Lois T. Haight; Russell B. Duncan; Kenneth J. Kingsley

2000-01-01

The cactus ferruginous pygmy-owl (Glaucidium brasilianum cactorum) was discovered in the U.S. by Bendire in 1872 in the Tucson area (Coues 1872). During the next five decades, naturalists collected many specimens of this owl and typically described the subspecies as common or fairly common along some streams and rivers of central and southern Arizona...

The pygmy dipole resonance in neutron-rich nuclei

International Nuclear Information System (INIS)

Hung, Nguyen Quang; Kiet, Hoang Anh Tuan; Duc, Huynh Ngoc; Chuong, Nguyen Thi

2016-01-01

The pygmy dipole resonance (PDR), which has been observed via the enhancement of the electric dipole strength E 1 of atomic nuclei, is studied within a microscopic collective model. The latter employs the Hartree-Fock (HF) method with effective nucleon-nucleon interactions of the Skyrme types plus the random-phase approximation (RPA). The results of the calculations obtained for various even-even nuclei such as "1"6"-"2"8O, "4"0"-"5"8Ca, "1"0"0"-"1"2"0Sn, and "1"8"2"-"2"1"8Pb show that the PDR is significantly enhanced when the number of neutrons outside the stable core of the nucleus is increased, that is, in the neutron-rich nuclei. As the result, the relative ratio between the energy weighted sum of the strength of the PDR and that of the GDR (giant dipole resonance) does not exceed 4%. The collectivity of the PDR and GDR states will be also discussed. (paper)

Subspecies-specific response to ACTH challenge test in the house mouse (Mus musculus)

Czech Academy of Sciences Publication Activity Database

Daniszová, K.; Mikula, Ondřej; Macholán, Miloš; Pospíšilová, I.; Vošlajerová Bímová, Barbora; Hiadlovská, Zuzana

2017-01-01

Roč. 252, October (2017), s. 186-192 ISSN 0016-6480 R&D Projects: GA ČR GAP506/11/1792 Institutional support: RVO:67985904 Keywords : ACTH challenge * endocrine activity * corticosterone * hormone metabolities * mouse * noninvasive monitoring Subject RIV: EA - Cell Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.585, year: 2016

The Southeastern Asian house mouse (Mus musculus castaneus Linn.) as a new passenger host for Cryptococcus neoformans var. grubii molecular type VNI.

Science.gov (United States)

Singh, Karuna; Rani, Jyoti; Neelabh; Rai, Govind Kumar; Singh, Major

2017-11-01

We describe Mus musculus castaneus as a new mammalian host for Cryptococcus neoformans var. grubii (VNI). Eighteen apparently healthy adults and pups of the rodent were collected from human dwellings in Varanasi, a city of India. Both clinical and behavioral examinations of the rodents did not reveal any sign of the disease. Among visceral organs, histological examination of only liver exhibited the presence of single celled, encapsulated, Southgate's mucicarmine positive fungal structures consistent with C. neoformans. Nevertheless, culture of tissue homogenates of brain, lungs, liver, and kidneys yielded white colonies on Sabouraud's dextrose agar and brown mucoid colonies of C. neoformans on Staib's and Tobacco agar media. The pathogen was isolated from habitat soil as well as fresh faeces of the animals. All isolates were urease positive, nitrate and canavanine-glycine bromothymol blue negative, exhibited phenoloxidase activity and grew at 37°C. The isolates were identified as C. neoformans var. grubii with ITS primers and unique marker (GACA)4. The pathogen when inoculated in immunosuppressed mice showed low pathogenicity. To our knowledge, we for the first time report case cluster of Mus musculus castaneus as new passenger host for C. neoformans var. grubii (VNI). © The Author 2017. Published by Oxford University Press on behalf of The International Society for Human and Animal Mycology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Splitting of the Pygmy Dipole Resonance

International Nuclear Information System (INIS)

Endres, J.; Zilges, A.; Butler, P.; Herzberg, R.-D.; Scheck, M.; Harakeh, M. N.; Harissopulos, S.; Lagoyannis, A.; Kruecken, R.; Ring, P.; Litvinova, E.; Pietralla, N.; Ponomarev, V. Yu.; Sonnabend, K.; Popescu, L.; Savran, D.; Stoica, V. I.; Woertche, H. J.

2011-01-01

In recent years investigations have been made to study the electric Pygmy Dipole Resonance (PDR) systematically, mainly in semi-magic nuclei. For this purpose the well understood high resolution (γ,γ') photon scattering method is used. In complementary (α,α'γ) coincidence experiments at E α = 136 MeV a similar γ-energy resolution and a high selectivity to E1 transitions can be obtained at the Big-Bite Spectrometer (BBS) at KVI, Groningen. In comparison to the (γ,γ') method a structural splitting of the PDR is observed in the N = 82 nuclei 138 Ba and 140 Ce and in the Z = 50 nucleus 124 Sn. The low energy part is excited in (γ,γ') as well as in (α,α'γ) while the high energy part is observed in (γ,γ') only. The experimental results together with theoretical QPM and RQTBA calculations on 124 Sn which are able to reproduce the splitting of the PDR qualitatively are presented. The low-lying group of J π = 1 - states seem to represent the more isoscalar neutron-skin oscillation of the PDR while the energetically higher-lying states seemingly belong to the transitional region between the PDR and the isovector Giant Dipole Resonance (IVGDR).

Predicting occupancy for pygmy rabbits in Wyoming: an independent evaluation of two species distribution models

Science.gov (United States)

Germaine, Stephen S.; Ignizio, Drew; Keinath, Doug; Copeland, Holly

2014-01-01

Species distribution models are an important component of natural-resource conservation planning efforts. Independent, external evaluation of their accuracy is important before they are used in management contexts. We evaluated the classification accuracy of two species distribution models designed to predict the distribution of pygmy rabbit Brachylagus idahoensis habitat in southwestern Wyoming, USA. The Nature Conservancy model was deductive and based on published information and expert opinion, whereas the Wyoming Natural Diversity Database model was statistically derived using historical observation data. We randomly selected 187 evaluation survey points throughout southwestern Wyoming in areas predicted to be habitat and areas predicted to be nonhabitat for each model. The Nature Conservancy model correctly classified 39 of 77 (50.6%) unoccupied evaluation plots and 65 of 88 (73.9%) occupied plots for an overall classification success of 63.3%. The Wyoming Natural Diversity Database model correctly classified 53 of 95 (55.8%) unoccupied plots and 59 of 88 (67.0%) occupied plots for an overall classification success of 61.2%. Based on 95% asymptotic confidence intervals, classification success of the two models did not differ. The models jointly classified 10.8% of the area as habitat and 47.4% of the area as nonhabitat, but were discordant in classifying the remaining 41.9% of the area. To evaluate how anthropogenic development affected model predictive success, we surveyed 120 additional plots among three density levels of gas-field road networks. Classification success declined sharply for both models as road-density level increased beyond 5 km of roads per km-squared area. Both models were more effective at predicting habitat than nonhabitat in relatively undeveloped areas, and neither was effective at accounting for the effects of gas-energy-development road networks. Resource managers who wish to know the amount of pygmy rabbit habitat present in an

Synaptic vesicles isolated from the electric organ of Torpedo californica and from the central nervous system of Mus musculus contain small ribonucleic acids (sRNAs

Directory of Open Access Journals (Sweden)

Huinan Li

2017-06-01

Full Text Available Synaptic vesicles (SVs are presynaptic organelles that load and release small molecule neurotransmitters at chemical synapses. In addition to classic neurotransmitters, we have demonstrated that SVs isolated from the Peripheral Nervous Systems (PNS of the electric organ of Torpedo californica, a model cholinergic synapse, and SVs isolated from the Central Nervous System (CNS of Mus musculus (mouse contain small ribonucleic acids (sRNAs; ≤50 nucleotides (Scientific Reports, 5:1–14(14918 Li et al. (2015 [1]. Our previous publication provided the five most abundant sequences associated with the T. californica SVs, and the ten most abundant sequences associated with the mouse SVs, representing 59% and 39% of the total sRNA reads sequenced, respectively. We provide here a full repository of the SV sRNAs sequenced from T. californica and the mouse deposited in the NCBI as biosamples. Three data studies are included: SVs isolated from the electric organ of T. californica using standard techniques, SVs isolated from the electric organ of T. californica using standard techniques with an additional affinity purification step, and finally, SVs isolated from the CNS of mouse. The three biosamples are available at https://www.ncbi.nlm.nih.gov/biosample/ SRS1523467, SRS1523466, and SRS1523472 respectively.

Recombinational hotspot specific to female meiosis in the mouse major histocompatibility complex.

Science.gov (United States)

Shiroishi, T; Hanzawa, N; Sagai, T; Ishiura, M; Gojobori, T; Steinmetz, M; Moriwaki, K

1990-01-01

The wm7 haplotype of the major histocompatibility complex (MHC), derived from the Japanese wild mouse Mus musculus molossinus, enhances recombination specific to female meiosis in the K/A beta interval of the MHC. We have mapped crossover points of fifteen independent recombinants from genetic crosses of the wm7 and laboratory haplotypes. Most of them were confined to a short segment of approximately 1 kilobase (kb) of DNA between the A beta 3 and A beta 2 genes, indicating the presence of a female-specific recombinational hotspot. Its location overlaps with a sex-independent hotspot previously identified in the Mus musculus castaneus CAS3 haplotype. We have cloned and sequenced DNA fragments surrounding the hotspot from the wm7 haplotype and the corresponding regions from the hotspot-negative B10.A and C57BL/10 strains. There is no significant difference between the sequences of these three strains, or between these and the published sequences of the CAS3 and C57BL/6 strains. However, a comparison of this A beta 3/A beta 2 hotspot with a previously characterized hotspot in the E beta gene revealed that they have a very similar molecular organization. Each hotspot consists of two elements, the consensus sequence of the mouse middle repetitive MT family and the tetrameric repeated sequences, which are separated by 1 kb of DNA.

Patterns of ancestry, signatures of natural selection, and genetic association with stature in Western African pygmies.

Directory of Open Access Journals (Sweden)

Joseph P Jarvis

Full Text Available African Pygmy groups show a distinctive pattern of phenotypic variation, including short stature, which is thought to reflect past adaptation to a tropical environment. Here, we analyze Illumina 1M SNP array data in three Western Pygmy populations from Cameroon and three neighboring Bantu-speaking agricultural populations with whom they have admixed. We infer genome-wide ancestry, scan for signals of positive selection, and perform targeted genetic association with measured height variation. We identify multiple regions throughout the genome that may have played a role in adaptive evolution, many of which contain loci with roles in growth hormone, insulin, and insulin-like growth factor signaling pathways, as well as immunity and neuroendocrine signaling involved in reproduction and metabolism. The most striking results are found on chromosome 3, which harbors a cluster of selection and association signals between approximately 45 and 60 Mb. This region also includes the positional candidate genes DOCK3, which is known to be associated with height variation in Europeans, and CISH, a negative regulator of cytokine signaling known to inhibit growth hormone-stimulated STAT5 signaling. Finally, pathway analysis for genes near the strongest signals of association with height indicates enrichment for loci involved in insulin and insulin-like growth factor signaling.

Early gene expression divergence between allopatric populations of the house mouse (Mus musculus domesticus).

Science.gov (United States)

Bryk, Jarosław; Somel, Mehmet; Lorenc, Anna; Teschke, Meike

2013-03-01

Divergence of gene expression is known to contribute to the differentiation and separation of populations and species, although the dynamics of this process in early stages of population divergence remains unclear. We analyzed gene expression differences in three organs (brain, liver, and testis) between two natural populations of Mus musculus domesticus that have been separated for at most 3000 years. We used two different microarray platforms to corroborate the results at a large scale and identified hundreds of genes with significant expression differences between the populations. We find that although the three tissues have similar number of differentially expressed genes, brain and liver have more tissue-specific genes than testis. Most genes show changes in a single tissue only, even when expressed in all tissues, supporting the notion that tissue-specific enhancers act as separable targets of evolution. In terms of functional categories, in brain and to a smaller extent in liver, we find transcription factors and their targets to be particularly variable between populations, similar to previous findings in primates. Testis, however, has a different set of differently expressed genes, both with respect to functional categories and overall correlation with the other tissues, the latter indicating that gene expression divergence of potential importance might be present in other datasets where no differences in fraction of differentially expressed genes were reported. Our results show that a significant amount of gene expression divergence quickly accumulates between allopatric populations.

POSSuMUS. A position sensitive scintillating muon SiPM detector

International Nuclear Information System (INIS)

Ruschke, Alexander

2014-01-01

The development of a modular designed large scale scintillation detector with a two-dimensional position sensitivity is presented in this thesis. This novel POsition Sensitive Scintillating MUon SiPM Detector is named POSSuMUS. The POSSuMUS detector is capable to determine the particle's position in two space dimensions with a fast trigger capability. Each module is constructed from two trapezoidal shaped plastic scintillators to form one rectangular shaped detector module. Both trapezoids are optically insulated against each other. In both trapezoids the scintillation light is collected by plastic fibers and guided towards silicon photomultipliers (SiPMs). SiPMs are light sensors which are capable to detect even smallest amounts of light. By combining several detector modules, position sensitive areas from 100 cm 2 to few m 2 are achievable with few readout channels. Therefore, POSSuMUS provides a cost effective detector concept. The position sensitivity along the trapezoidal geometry of one detector module is achieved by the path length dependent amount of detected light for crossing particles. The ratio of the light yields in both trapezoids is calculated. This value corresponds to the position of the particle traversing the detector. A spatial resolution in the order of several mm is foreseen. The position sensitivity along the scintillator module is determined by the propagation time of light to the SiPMs located on opposite sides of the detector. A spatial resolution of few cm is expected for this direction. The POSSuMUS detector is applicable as large area trigger detector with a two dimensional position information of crossing particles. This is suitable in detector tests of large area precesion detectors or for measuring the small angle scattering of cosmic muons. At the beginning of this thesis, the determination of important SiPM characteristics like the breakdown voltage is presented. In the course of this work the detector principle is proven by

Test of the Brink-Axel Hypothesis for the Pygmy Dipole Resonance

Science.gov (United States)

Martin, D.; von Neumann-Cosel, P.; Tamii, A.; Aoi, N.; Bassauer, S.; Bertulani, C. A.; Carter, J.; Donaldson, L.; Fujita, H.; Fujita, Y.; Hashimoto, T.; Hatanaka, K.; Ito, T.; Krugmann, A.; Liu, B.; Maeda, Y.; Miki, K.; Neveling, R.; Pietralla, N.; Poltoratska, I.; Ponomarev, V. Yu.; Richter, A.; Shima, T.; Yamamoto, T.; Zweidinger, M.

2017-11-01

The gamma strength function and level density of 1- states in 96Mo have been extracted from a high-resolution study of the (p → , p→ ' ) reaction at 295 MeV and extreme forward angles. By comparison with compound nucleus γ decay experiments, this allows a test of the generalized Brink-Axel hypothesis in the energy region of the pygmy dipole resonance. The Brink-Axel hypothesis is commonly assumed in astrophysical reaction network calculations and states that the gamma strength function in nuclei is independent of the structure of the initial and final state. The present results validate the Brink-Axel hypothesis for 96Mo and provide independent confirmation of the methods used to separate gamma strength function and level density in γ decay experiments.

STRUKTUR HISTOLOGI HATI MENCIT(Mus musculus L. SETELAH PEMBERIAN EKSTRAK DAUN EKOR NAGA (Rhapidhophora pinnata Schott

Directory of Open Access Journals (Sweden)

Ni Komang Tia Pramesti

2017-09-01

Full Text Available ABSTRACT Rhapidhophora pinnata, Schott is a traditional medical plant that has been use remedy for treatment of hypertension, stroke. Aims of  this research is to determine the effect of Rhapidhophora pinnata Schott leaf extract toward  mouse (Mus musculus L liverhistological structure. This research used completely randomized  design with 28 female mice that were divide into 4 groups of  P0 (control received 0,9% NaCl, group P1, P2, and P3 received 50, 100 and 150 mg/kg bw respectively by oral administration. The treatment were given daily for 14 days. All of the mice were sacrificed by ether after 15 days. The liver were examined for their histopathological changes, namely fatty degeneration, hydropic degenaration and necrosis. Results were statistically analised by Kruskal-Wallis method. Treatment groups showed no significant differences with regard of liver histopatological changes, however hemorrhage, sinusoid congestion and inflamatory cell infiltration were found in liver.   Keyword : Rhapidhophora pinnata Schott, liver, mice

Genetic variation at the ApoB 3' HVR minisatellite locus in the Mbenzele Pygmies from the Central African Republic.

Science.gov (United States)

Destro-Bisol, Giovanni; Belledi, Michele; Capelli, Cristian; Maviglia, Riccardo; Spedini, Gabriella

2000-09-01

This study analyzes the polymorphic minisatellite ApoB 3' HVR in the Mbenzele Pygmies from the Central African Republic. A total of 14 alleles was observed, with frequencies ranging from 0.020 (19, 21, 27, and 45 repeat unit alleles) to 0.210 (37 repeat unit allele). Departure from Hardy-Weinberg equilibrium was not statistically significant. The estimated heterozygosity was 0.874 +/- 0.016. Taking data from the literature into consideration, the results support the hypothesis that the Africans are different from non-Africans due to greater ApoB 3' HVR genetic diversity and a unimodal profile of ApoB 3' HVR allele frequency distribution. Interpopulational relationships were also analyzed using an F(ST) based genetic distance. The results highlight the similarity between the Mbenzele Pygmies and Bantu-speaking groups (Ewondo and Zulu), and the divergence between the Mbenzele and San, the two groups which are often considered to be the most direct descendants of proto-Africans. Am. J. Hum. Biol. 12:588-592, 2000. Copyright 2000 Wiley-Liss, Inc.

75 FR 60515 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition to List the Pygmy...

Science.gov (United States)

2010-09-30

... warranted at this time. However, we ask the public to submit to us any new information that becomes...; Larrison 1967, p. 64; Green and Flinders 1980a, p. 1; Janson 2002, p. 4). Ecology and Life History Pygmy... OMITTED] TP30SE10.008 Figure 1. Approximate historical and current range (based on data from 1877 to 2008...

Nova Mus 2018 (PNV J11261220-6531086) Is Forming Dust

Science.gov (United States)

Walter, Frederick M.

2018-02-01

Nova Mus 2018 (PNV J11261220-6531086) was discovered by R Kaufman on 2018 Jan 14.486, and reported by P. Schmeer in vsnet-alert 21772. The first detection was 2018 Jan 3.24 (ASAS-SN, reported in the TOCP).

AcEST: DK962031 [AcEST

Lifescience Database Archive (English)

Full Text Available VSFLTGLGCPNCIECFTSQGLQ 392 >tr|B1AX90|B1AX90_MOUSE Transformation related protein 73 OS=Mus musculus GN=Trp7...tr|B1AX90|B1AX90_MOUSE Transformation related protein 73 OS=Mus ... 37 1.5 tr|B7Q4E7|B7Q4E7_IXOSC Putative u...rized protein OS=Mus m... 37 1.5 tr|Q9CU77|Q9CU77_MOUSE Putative uncharacterized protein (Fragmen... 37 1.5

Stop Stalling: Mus81 Required for Efficient Replication | Center for Cancer Research

Science.gov (United States)

DNA replication is precisely controlled to ensure that daughter cells receive intact, accurate genetic information. Each segment of DNA must be copied only once, and the rate of replication coordinated genome-wide. Mild replication stress slows DNA synthesis and activates a pathway involving the Mus81 endonuclease, which generates a series of DNA breaks that are rapidly repaired, allowing the cell to avoid activating the S-phase checkpoint and its potentially damaging outcomes of apoptosis or error-prone repair. Mirit Aladjem, Ph.D., of CCR’s Developmental Therapeutics Branch, and her colleagues wondered whether Mus81 also plays a role in regulating the replication rate during growth in the absence of stress.

The role of cohesin genes in the meiosis of male house mouse

OpenAIRE

Šebestová, Lenka

2015-01-01

Cohesin genes play an important role in cell division. They ensure proper chromosome segregation during mitosis and meiosis. This study is focused on the role of cohesin genes during meiosis in male house mouse (Mus musculus). At first, this study introduces key processes of mammalian meiosis. Next, the structure of cohesin complex is described; it consists of a heterodimer SMC proteins - SMC3 and SMC1α or SMC1β, which are enclosed to the ring by cleavable subunit RAD21, RAD21L or REC8. Fourt...

RECQ5 Helicase Cooperates with MUS81 Endonuclease in Processing Stalled Replication Forks at Common Fragile Sites during Mitosis

DEFF Research Database (Denmark)

Di Marco, Stefano; Hasanova, Zdenka; Kanagaraj, Radhakrishnan

2017-01-01

The MUS81-EME1 endonuclease cleaves late replication intermediates at common fragile sites (CFSs) during early mitosis to trigger DNA-repair synthesis that ensures faithful chromosome segregation. Here, we show that these DNA transactions are promoted by RECQ5 DNA helicase in a manner dependent...... on its Ser727 phosphorylation by CDK1. Upon replication stress, RECQ5 associates with CFSs in early mitosis through its physical interaction with MUS81 and promotes MUS81-dependent mitotic DNA synthesis. RECQ5 depletion or mutational inactivation of its ATP-binding site, RAD51-interacting domain...

Imaging of Chromosome Dynamics in Mouse Testis Tissue by Immuno-FISH.

Science.gov (United States)

Scherthan, Harry

2017-01-01

The mouse (Mus musculus) represents the central mammalian genetic model system for biomedical and developmental research. Mutant mouse models have provided important insights into chromosome dynamics during the complex meiotic differentiation program that compensates for the genome doubling at fertilization. Homologous chromosomes (homologues) undergo dynamic pairing and recombine during first meiotic prophase before they become partitioned into four haploid sets by two consecutive meiotic divisions that lack an intervening S-phase. Fluorescence in situ hybridization (FISH) has been instrumental in the visualization and imaging of the dynamic reshaping of chromosome territories and mobility during prophase I, in which meiotic telomeres were found to act as pacemakers for the chromosome pairing dance. FISH combined with immunofluorescence (IF) co-staining of nuclear proteins has been instrumental for the visualization and imaging of mammalian meiotic chromosome behavior. This chapter describes FISH and IF methods for the analysis of chromosome dynamics in nuclei of paraffin-embedded mouse testes. The techniques have proven useful for fresh and archived paraffin testis material of several mammalian species.

Tooth Morphogenesis and FGF4 Expression During Development of Molar Tooth in Three Muroid Rodents: Calomyscus elburzensis (Calomyscidae), Mesocricetus auratus (Cricetidae) and Mus musculus (Muridae).

Science.gov (United States)

Hamidi, Kordiyeh; Darvish, Jamshid; Matin, Maryam M; Javanmard, Athar Sadat; Kilpatrick, C William

2017-12-01

To date, no studies have examined the tooth formation during developmental stages of brush-tailed mice (Calomyscidae) and true hamsters (Cricetidae). Herein, we compared the timing of tooth morphogenesis and FGF4 expression pattern during development of the first lower molar in Goodwin's brush-tailed mouse, Calomyscus elburzensis with two other muroid rodents; the house mouse, Mus musculus (Muridae), model organism for tooth morphogenesis, and the golden hamster, Mesocricetus auratus which shares great similarities in cusp pattern with brush-tailed mice. All three species were bred in captivity and developing embryos were isolated at different embryonic days (E). Histological evaluation of lower molars was performed and spatiotemporal pattern of FGF4 expression was determined by immunohistochemistry. Results indicated that morphogenesis of the tooth cusps starts at the beginning of the cap stage of the first lower molar (E14 in house mouse, about E11.5 in golden hamster and E22 in Goodwin's brush-tailed mouse). During the cap to bell stage (E15 in house mouse, E12 in golden hamster and at about E24 in Goodwin's brush-tailed mouse), a decrease in the expression of FGF4 was observed in the mesenchyme, except for the cusp tips. According to our observations, the developmental process of the first lower molar formation in Goodwin's brush-tailed mouse began much later as compared with the other two species. Despite the differences in the temporal pattern of molar development between these three members of the same superfamily (Muroidea), the correlation in the expression of FGF4 with specific stages of tooth morphogenesis supported its regulatory function. Anat Rec, 300:2138-2149, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Identification of an active ID-like group of SINEs in the mouse.

Science.gov (United States)

Kass, David H; Jamison, Nicole

2007-09-01

The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.

Characterization and analysis of a de novo transcriptome from the pygmy grasshopper Tetrix japonica.

Science.gov (United States)

Qiu, Zhongying; Liu, Fei; Lu, Huimeng; Huang, Yuan

2017-05-01

The pygmy grasshopper Tetrix japonica is a common insect distributed throughout the world, and it has the potential for use in studies of body colour polymorphism, genomics and the biology of Tetrigoidea (Insecta: Orthoptera). However, limited biological information is available for this insect. Here, we conducted a de novo transcriptome study of adult and larval T. japonica to provide a better understanding of its gene expression and develop genomic resources for future work. We sequenced and explored the characteristics of the de novo transcriptome of T. japonica using Illumina HiSeq 2000 platform. A total of 107 608 206 paired-end clean reads were assembled into 61 141 unigenes using the trinity software; the mean unigene size was 771 bp, and the N50 length was 1238 bp. A total of 29 225 unigenes were functionally annotated to the NCBI nonredundant protein sequences (Nr), NCBI nonredundant nucleotide sequences (Nt), a manually annotated and reviewed protein sequence database (Swiss-Prot), Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) databases. A large number of putative genes that are potentially involved in pigment pathways, juvenile hormone (JH) metabolism and signalling pathways were identified in the T. japonica transcriptome. Additionally, 165 769 and 156 796 putative single nucleotide polymorphisms occurred in the adult and larvae transcriptomes, respectively, and a total of 3162 simple sequence repeats were detected in this assembly. This comprehensive transcriptomic data for T. japonica will provide a usable resource for gene predictions, signalling pathway investigations and molecular marker development for this species and other pygmy grasshoppers. © 2016 John Wiley & Sons Ltd.

X-ray and UV observations of Nova Mus 2018 with Swift

Science.gov (United States)

Nelson, Thomas; Mukai, Koji; Chomiuk, Laura; Li, Kwan-Kok; Kawash, Adam; Sokoloski, J. L.; Rupen, Michael; Linford, Justin; Mioduszewski, Amy

2018-01-01

We observed Nova Mus 2018 (PNV J11261220-6531086) with the Neil Gehrels Swift Observatory on 2018 January 21, 18 days after the initial rapid rise to V=8.8 on 2018 January 3.24 (see link below for more details).

Helminth Infections of House Mouse (Mus musulus and Wood Mouse (Apodemus sylvaticus from the Suburban Areas of Hamadan City, Western Iran.

Directory of Open Access Journals (Sweden)

Ali Yousefi

2014-12-01

Full Text Available To determine the prevalence and intensity of helminths and their zoonotic importance in small rodents inhabiting in the suburban areas of Hamadan City, Iran.The present survey was conducted on the helminth infections of two species of rodents Apodemus sylvaticus (n=60 and Mus musculus(n=72 in the suburban areas of Hamadan City during 2010-2012. Rodents were collected and examined for helminth in the different organs. The nematodes were collected in 5% formalin solution and cleared in lactophenol, cestodes and trematodes collected from intestine fixed in AFA solution and stained by acetocarmine, cleared in xylol for identification.Helminths found in A. sylvaticus and M. musculus and their prevalence for the first time in suburban areas of Hamadan City were as follows; In A. sylvaticus: Cysticercus fasciolaris(3.33%, Syphacia fredrici(26.67%, S. stroma(8.33%, Anoplocephalidae sp. (1.67%, Skrjabinotaenia lobata(5%, Plagiorchis muris(1.67% and in M. musculus:Hymenolepis nana (16.67%, H.diminuta (5.55%, S. obvelata(30.56%, S. ohtarom (9.72%, Rodentolepis crassa (1.39%, C. fasciolaris (1.39%. Among 11 species in two rodents 4 species including S. obvelata, H. nana, H.diminuta,and P. muris have zoonotic importance. Statistically the relation between gender and their helminth infections was not significant in either M. musculus or A. sylvaticus (P>0.05.This study reports 11 species of helminths and on the other hand 3 species were identified for the first time in Iran and 5 species of them have potential health importance for public health and cat.

Toxicological Evaluation of Essential Oil From the Leaves of Croton argyrophyllus (Euphorbiaceae) on Aedes aegypti (Diptera: Culicidae) and Mus musculus (Rodentia: Muridae).

Science.gov (United States)

Cruz, R C D; Silva, S L C E; Souza, I A; Gualberto, S A; Carvalho, K S; Santos, F R; Carvalho, M G

2017-07-01

Plant-derived essential oils can be used as insecticides for vector control. However, to establish their safety, it is necessary to perform toxicological studies. Herein, we evaluated the chemical composition and insecticidal activity of the essential oil from the leaves of Croton argyrophyllus on the third- and fourth-instar larvae and adult Aedes aegypti (L., 1762). We also evaluated the acute toxicity of the essential oil in adult female Mus musculus. The lethal concentration 50 (LC50) and 90 (LC90) of C. argyrophyllus essential oil on larvae of Ae. aegypti were 0.31 and 0.70 mg ml-1, respectively, and 5.92 and 8.94 mg ml-1, respectively, on Ae. aegypti adults. The major components of the essential oil were spathulenol (22.80%), (E)-caryophyllene (15.41%), α-pinene (14.07%), and bicyclogermacrene (10.43%). It also displayed acute toxicity in adults of Mus musculus; the intraperitoneal and oral lethal dose 50 (LD50) were 2,000 mg kg-1 and 2,500 mg kg-1, respectively. The results showed that the essential oil from C. argyrophyllus leaves has insecticidal activity on Ae. aegypti larvae and adults at an average lethal concentration below the median lethal dose needed to cause acute toxicity in the common mouse. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Habitat use and demography of Mus musculus in a rural landscape of Argentina.

Science.gov (United States)

León, Vanina A; Fraschina, Jimena; Guidobono, Juan S; Busch, Maria

2013-04-01

The main goal of the paper was to determine the habitat distribution of the house mouse (Mus musculus) within a rural landscape of Buenos Aires province, Argentina. We also studied the seasonal variation in abundance and reproductive activity. The habitats studied were poultry farms, human houses in a small village, cropfields, pastures, cropfield and pasture edges, riparian habitats (streams), railway embankments and woodlots. We captured 817 M. musculus and 690 individuals of 5 native rodent species. M. musculus was captured in poultry farms, houses, riparian habitats, cropfield and borders, but it showed a significantly higher abundance in poultry farms compared to the other habitats. Its presence outside poultry farms was significantly related to the distance to streams and poultry farms. The mean trapping success index of M. musculus did not show significant variations between periods, but the proportion of active males was significantly higher in the spring-summer period than in the autumn-winter period. All captures of M. musculus in cropfields, borders and riparian habitats occurred in the spring-summer period. The capture of M. musculus in many types of habitats suggests that it can disperse outside poultry farms, and streams may be used as corridors. © 2012 Wiley Publishing Asia Pty Ltd, ISZS and IOZ/CAS.

Characterization of a male reproductive transcriptome for Peromyscus eremicus (Cactus mouse

Directory of Open Access Journals (Sweden)

Lauren L. Kordonowy

2016-10-01

Full Text Available Rodents of the genus Peromyscus have become increasingly utilized models for investigations into adaptive biology. This genus is particularly powerful for research linking genetics with adaptive physiology or behaviors, and recent research has capitalized on the unique opportunities afforded by the ecological diversity of these rodents. Well characterized genomic and transcriptomic data is intrinsic to explorations of the genetic architecture responsible for ecological adaptations. Therefore, this study characterizes the transcriptome of three male reproductive tissues (testes, epididymis and vas deferens of Peromyscus eremicus (Cactus mouse, a desert specialist. The transcriptome assembly process was optimized in order to produce a high quality and substantially complete annotated transcriptome. This composite transcriptome was generated to characterize the expressed transcripts in the male reproductive tract of P. eremicus, which will serve as a crucial resource for future research investigating our hypothesis that the male Cactus mouse possesses an adaptive reproductive phenotype to mitigate water-loss from ejaculate. This study reports genes under positive selection in the male Cactus mouse reproductive transcriptome relative to transcriptomes from Peromyscus maniculatus (deer mouse and Mus musculus. Thus, this study expands upon existing genetic research in this species, and we provide a high quality transcriptome to enable further explorations of our proposed hypothesis for male Cactus mouse reproductive adaptations to minimize seminal fluid loss.

The MusIC method: a fast and quasi-optimal solution to the muscle forces estimation problem

OpenAIRE

Muller , Antoine; Pontonnier , Charles; Dumont , Georges

2018-01-01

International audience; The present paper aims at presenting a fast and quasi-optimal method of muscle forces estimation: the MusIC method. It consists in interpolating a first estimation in a database generated offline thanks to a classical optimization problem, and then correcting it to respect the motion dynamics. Three different cost functions – two polynomial criteria and a min/max criterion – were tested on a planar musculoskeletal model. The MusIC method provides a computation frequenc...

Study of the pygmy dipole resonance in {sup 94}Mo using the (α,α{sup ′}γ) coincidence technique

Energy Technology Data Exchange (ETDEWEB)

Derya, V., E-mail: derya@ikp.uni-koeln.de [Institut für Kernphysik, Universität zu Köln, Zülpicher Straße 77, 50937 Köln (Germany); Endres, J.; Elvers, M. [Institut für Kernphysik, Universität zu Köln, Zülpicher Straße 77, 50937 Köln (Germany); Harakeh, M.N. [Kernfysisch Versneller Instituut, Rijksuniversiteit Groningen, Zernikelaan 25, 9747 AA Groningen (Netherlands); Pietralla, N.; Romig, C. [Institut für Kernphysik, TU Darmstadt, Schlossgartenstraße 9, 64289 Darmstadt (Germany); Savran, D. [ExtreMe Matter Institute EMMI and Research Division, GSI, Planckstraße 1, 64291 Darmstadt (Germany); Frankfurt Institute for Advanced Studies FIAS, Ruth-Moufang-Straße 1, 60438 Frankfurt am Main (Germany); Scheck, M.; Siebenhühner, F. [Institut für Kernphysik, TU Darmstadt, Schlossgartenstraße 9, 64289 Darmstadt (Germany); Stoica, V.I. [Kernfysisch Versneller Instituut, Rijksuniversiteit Groningen, Zernikelaan 25, 9747 AA Groningen (Netherlands); Department of Sociology/ICS, Rijksuniversiteit Groningen, Grote Rozenstraat 31, 9712 TG Groningen (Netherlands); Wörtche, H.J. [Kernfysisch Versneller Instituut, Rijksuniversiteit Groningen, Zernikelaan 25, 9747 AA Groningen (Netherlands); and others

2013-05-15

The (α,α{sup ′}γ) reaction at E{sub α}=136 MeV was used to study the electric dipole response in the open-shell vibrational nucleus {sup 94}Mo below the neutron-separation threshold. The coincidence experiment has been performed at the Kernfysisch Versneller Instituut in Groningen, The Netherlands, exploiting the Big-Bite Spectrometer and an array of large volume High-Purity Germanium (HPGe) detectors. Due to the excellent energy resolution and high selectivity to transitions stemming from the pygmy dipole resonance, singles α-scattering cross sections could be determined for individual electric dipole excitations between 4 and 8 MeV. For three of the excited low-lying J{sup π}=1{sup −} states in {sup 94}Mo a γ-decay branch into the J{sup π}=2{sub 1}{sup +} state could be observed. The experiment extends the systematic studies of the pygmy dipole resonance by real-photon scattering (γ,γ{sup ′}) experiments and (α,α{sup ′}γ) experiments. Recently, a (γ,γ{sup ′}) experiment on {sup 94}Mo was performed at the Darmstadt High-Intensity Photon Setup at the S-DALINAC in Darmstadt, Germany, permitting the comparison of B(E1)↑ strength distribution and α-scattering cross sections.

Musée ideale : unistused täiuslikust muuseumist / Mariann Raisma

Index Scriptorium Estoniae

Raisma, Mariann, 1974-

2008-01-01

18.-19. sajandi unistusi täiuslikust muuseumist kolmel tasandil: vormi ehk arhitektuuri, muuseumikogu terviklikkuse ning pärandi kättesaadavuse kaudu. Pikemalt Napoleon Bonaparte'ile pühendatud Musée Napoleoni kogudest, kontseptsioonist ja koopiamuuseumidest Lääne-Euroopas ning Tartus

Serine/threonine-protein phosphatase 1 α levels are paralleling olfactory memory formation in the CD1 mouse.

Science.gov (United States)

Winding, Christiana; Sun, Yanwei; Höger, Harald; Bubna-Littitz, Hermann; Pollak, Arnold; Schmidt, Peter; Lubec, Gert

2011-06-01

Although olfactory discrimination has already been studied in several mouse strains, data on protein levels linked to olfactory memory are limited. Wild mouse strains Mus musculus musculus, Mus musculus domesticus and CD1 laboratory outbred mice were tested in a conditioned odor preference task and trained to discriminate between two odors, Rose and Lemon, by pairing one odor with a sugar reward. Six hours following the final test, mice were sacrificed and olfactory bulbs (OB) were taken for gel-based proteomics analyses and immunoblotting. OB proteins were extracted, separated by 2-DE and quantified using specific software (Proteomweaver). Odor-trained mice showed a preference for the previously rewarded odor suggesting that conditioned odor preference occurred. In CD1 mice levels, one out of 482 protein spots was significantly increased in odor-trained mice as compared with the control group; it was in-gel digested by trypsin and chymotrypsin and analyzed by tandem mass spectrometry (nano-ESI-LC-MS/MS). The spot was unambiguously identified as serine/threonine-protein phosphatase PP1-α catalytic subunit (PP-1A) and differential levels observed in gel-based proteomic studies were verified by immunoblotting. PP-1A is a key signalling element in synaptic plasticity and memory processes and is herein shown to be paralleling olfactory discrimination representing olfactory memory. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Infrared and optical observations of Nova Mus 1983

International Nuclear Information System (INIS)

Whitelock, P.A.; Carter, B.S.; Feast, M.W.; Glass, I.S.; Laney, D.; Menzies, J.W.

1984-01-01

Extensive optical (UBVRI) and infrared (JHKL) photometry of Nova Mus 1983 obtained over a period of 300 days is tabulated. Infrared and optical spectra are described. Although by classical definition this was a fast nova its later development was slower than for typical objects of this class. Surprisingly the development of infrared thermal dust emission did not occur. Throughout the period covered, the infrared emission was characteristic of a bound-free plus free-free plasma continuum with emission lines. (author)

Morphofunctional evaluation of the testis, duration of spermatogenesis and spermatogenic efficiency in the Japanese fancy mouse (Mus musculus molossinus).

Science.gov (United States)

Costa, Guilherme M J; Leal, Marcelo C; França, Luiz R

2017-08-01

Japanese fancy mouse, mini mouse or pet mouse are common names used to refer to strains of mice that present with different colour varieties and coat types. Although many genetic studies that involve spotting phenotype based on the coat have been performed in these mice, there are no reports of quantitative data in the literature regarding testis structure and spermatogenic efficiency. Hence, in this study we researched testis function and spermatogenesis in the adult Japanese fancy mouse. The following values of 68 ± 6 mg and 0.94 ± 0.1% were obtained as mean testis weight and gonadosomatic index, respectively. In comparison with other investigated mice strains, the fancy mouse Leydig cell individual size was much smaller, resulting in higher numbers of these cells per gram of testis. As found for laboratory mice strains, as a result of the development of the acrosomic system, 12 stages of the seminiferous epithelium cycle have been described in this study. The combined frequencies of pre-meiotic and post-meiotic stages were respectively 24% and 64% and very similar to the laboratory mice. The more differentiated germ cell types marked at 1 h or 9 days after tritiated thymidine administration were preleptotene/leptotene and pachytene spermatocytes at the same stage (VIII). The mean duration of one spermatogenic cycle was 8.8 ± 0.01 days and the total length of spermatogenesis lasted 37.8 ± 0.01 days (4.5 cycles). A high number of germ cell apoptosis was evident during meiosis, resulting in lower Sertoli cell and spermatogenic efficiencies, when compared with laboratory mice strains.

Gamma decay of pygmy states in 90,94Zr from inelastic scattering of light ions

Science.gov (United States)

Crespi, F. C. L.; Bracco, A.; Tamii, A.; Blasi, N.; Camera, F.; Wieland, O.; Aoi, N.; Balabanski, D.; Bassauer, S.; Brown, A. S.; Carpenter, M. P.; Carroll, J. J.; Ciemala, M.; Czeszumska, A.; Davies, P. J.; Donaldson, L.; Fang, Y.; Fujita, H.; Gey, G.; Hoang, T. H.; Ichige, N.; Ideguchi, E.; Inoue, A.; Isaak, J.; Iwamoto, C.; Jenkins, D. G.; Jin, O. H.; Klaus, T.; Kobayashi, N.; Koike, T.; Krzysiek, M.; Raju, M. Kumar; Liu, M.; Maj, A.; Montanari, D.; Morris, L.; Noji, S.; Pickstone, S. G.; Savran, D.; Spieker, M.; Steinhilber, G.; Sullivan, C.; Wasilewska, B.; Werner, V.; Yamamoto, T.; Yamamoto, Y.; Zhou, X.; Zhu, S.

2018-05-01

We performed experiments to study the low-energy part of the E1 response (Pygmy Dipole Resonance) in 90,94Zr nuclei, by measuring the (p,p’γ) and (α,α’γ) inelastic scattering reactions at energies Ebeam,p = 80 MeV and Ebeam,α = 130 MeV respectively. The inelastically scattered particles were measured by employing the high-resolution spectrometer Grand Raiden. The gamma-rays emitted following the de-excitation of the Zr target nuclei were detected using both the clover type HPGe detectors of the CAGRA array and the large volume LaBr3:Ce scintillation detectors from the HECTOR+ array. Some preliminary results are presented here.

NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0164 ref|NP_031715.1| chondroadherin [Mus musculus] sp|O55226|CHAD_MOUSE Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAC39963.1| chondroadherin [Mus musculus] gb|AAH12672.1| Chondroad...herin [Mus musculus] emb|CAI25589.1| chondroadherin [Mus musculus] dbj|BAE34451.1| unn...amed protein product [Mus musculus] gb|EDL15934.1| chondroadherin [Mus musculus] NP_031715.1 5e-85 57% ...

The Robertsonian phenomenon in the house mouse: mutation, meiosis and speciation.

Science.gov (United States)

Garagna, Silvia; Page, Jesus; Fernandez-Donoso, Raul; Zuccotti, Maurizio; Searle, Jeremy B

2014-12-01

Many different chromosomal races with reduced chromosome number due to the presence of Robertsonian fusion metacentrics have been described in western Europe and northern Africa, within the distribution area of the western house mouse Mus musculus domesticus. This subspecies of house mouse has become the ideal model for studies to elucidate the processes of chromosome mutation and fixation that lead to the formation of chromosomal races and for studies on the impact of chromosome heterozygosities on reproductive isolation and speciation. In this review, we briefly describe the history of the discovery of the first and subsequent metacentric races in house mice; then, we focus on the molecular composition of the centromeric regions involved in chromosome fusion to examine the molecular characteristics that may explain the great variability of the karyotype that house mice show. The influence that metacentrics exert on the nuclear architecture of the male meiocytes and the consequences on meiotic progression are described to illustrate the impact that chromosomal heterozygosities exert on fertility of house mice-of relevance to reproductive isolation and speciation. The evolutionary significance of the Robertsonian phenomenon in the house mouse is discussed in the final section of this review.

NCBI nr-aa BLAST: CBRC-CJAC-01-1133 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1133 ref|NP_068677.2| hairless protein [Mus musculus] sp|Q61645|HAIR_MOUSE Protein hair...less gb|AAH49182.1| Hairless [Mus musculus] gb|EDL35888.1| hairless, isoform CRA_a [Mus musculus] gb|EDL35889.1| hai...rless, isoform CRA_a [Mus musculus] gb|EDL35890.1| hairless, isoform CRA_a [Mus musculus] NP_068677.2 5.1 44% ...

Addisonian Crisis due to Metastatic Adenocarcinoma in a Pygmy Goat

Directory of Open Access Journals (Sweden)

Nora Nogradi

2013-01-01

Full Text Available A 15-year-old Pygmy doe was evaluated for acute onset of lethargy, anorexia, and weakness. Adrenal insufficiency was diagnosed based on physical exam findings, blood work abnormalities (hyponatremia, hyperkalemia, azotemia, and hypoglycemia, and lack of cortisol response to the ACTH stimulation test. Abdominal ultrasound exam revealed an intact urinary tract and multiple bilateral peri-renal masses. The doe was treated with intravenous fluid therapy aimed at correcting the electrolyte abnormalities and intravenous corticosteroids. She responded favorably to medical therapy in 24 hours, with dramatic improvement in attitude and appetite. Fluid therapy was discontinued, and the doe was discharged from the hospital on steroid supplementation. She deteriorated rapidly and died at home 36 hours after discharge. Necropsy results revealed metastatic adenocarcinoma originating from the uterus that infiltrated the urinary bladder, the region of the adrenal glands, the left and right renal lymph nodes, the left kidney, the caudal vena cava, the submandibular lymph nodes, the diaphragm, the lungs, and the omentum. Addison’s syndrome in ruminants should be considered as an uncommon sequel of intra-abdominal neoplastic processes.

Dicty_cDB: Contig-U03991-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 32 5.2 2 ( AZ306413 ) 1M0007B05R Mouse 10kb plasmid UUGC1M library Mus ... 38 5.2 2 ( BJ824535 ) Misgurnus anguillicaudatu...us visual cortex cDNA, RIKEN full-lengt... 32 6.7 2 ( AZ500970 ) 1M0339B10R Mouse 10kb plasmid UUGC1M library...7 2 ( AZ845402 ) 2M0145M09F Mouse 10kb plasmid UUGC1M library Mus ... 32 1.7 2 ( AZ990102 ) 2M0273L11R Mouse 10kb plasmid UUGC2M libr...07.... 44 2.5 1 ( AP009510 ) Uncultured Termite group 1 bacterium phylotype Rs...... cl... 32 6.5 2 ( AZ364702 ) 1M0110P21R Mouse 10kb plasmid UUGC1M library Mus ... 32 6.5 2 ( BH053767 ) R

The MusIC method: a fast and quasi-optimal solution to the muscle forces estimation problem.

Science.gov (United States)

Muller, A; Pontonnier, C; Dumont, G

2018-02-01

The present paper aims at presenting a fast and quasi-optimal method of muscle forces estimation: the MusIC method. It consists in interpolating a first estimation in a database generated offline thanks to a classical optimization problem, and then correcting it to respect the motion dynamics. Three different cost functions - two polynomial criteria and a min/max criterion - were tested on a planar musculoskeletal model. The MusIC method provides a computation frequency approximately 10 times higher compared to a classical optimization problem with a relative mean error of 4% on cost function evaluation.

Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

Directory of Open Access Journals (Sweden)

Dufková Petra

2008-10-01

Full Text Available Abstract Background The Mus musculus musculus/M. m. domesticus contact zone in Europe is characterised by sharp frequency discontinuities for sex chromosome markers at the centre of wider clines in allozyme frequencies. Results We identify a triangular area (approximately 330 km2 where the musculus Y chromosome introgresses across this front for up to 22 km into domesticus territory. Introgression of the Y chromosome is accompanied by a perturbation of the census sex ratio: the sex ratio is significantly female biased in musculus localities and domesticus localities lacking Y chromosome introgression. In contrast, where the musculus Y is detected in domesticus localities, the sex ratio is close to parity, and significantly different from both classes of female biased localities. The geographic position of an abrupt cline in an X chromosome marker, and autosomal clines centred on the same position, seem unaffected by the musculus Y introgression. Conclusion We conclude that sex ratio distortion is playing a role in the geographic separation of speciation genes in this section of the mouse hybrid zone. We suggest that clines for genes involved in sex-ratio distortion have escaped from the centre of the mouse hybrid zone, causing a decay in the barrier to gene flow between the two house mouse taxa.

PEMANFAATAN Spirulina platensis SEBAGAI SUPLEMEN PROTEIN SEL TUNGGAL (PST MENCIT (Mus musculus

Directory of Open Access Journals (Sweden)

Haryo Kuntoro Adi

2007-06-01

Full Text Available The using of Spirulina platensis as Supplement of Single-Celled Protein (SCP to Mice. High protein in Spirulina platensis can be used as a source of Single-Celled Protein. By using mice (Mus musculus as a animal laboratory, the objective of this research is to know the influence of Biomass S. platensis to the increase of body weight of mice. The name of species is Mus musculus, strain is Swiss derivate. Utilized mice were male, 30-50 weighing gram, and 5-7 weeks of age. Treatment group was given by palette and given by biomass of S. Platensis, while control also fed palette but did not give biomass of S. platensis. Yielded biomass was used as food mixed with palette with composition of dry biomass S. platensis with palette was 0%, 10%, 20%, 30%, 40%, and 50%. Data analysis was conducted by using t-tes and analysis of variance. The results showed that by giving of dry biomass of S. platensis affected to the increasement of body weight from the first day until twelfth day of observation, and decrease on the thirteenth and fourteenth day. Pursuant to result of statistic, there is a significant difference (p < 0,05 between before giving and after giving of dry biomass S. platensis during 17 day. By giving dry biomass of S. platensis to mice (Mus musculus at first and second week, it was found the difference of average mice body weight among six concentrations of biomass but did not at the third week. It means that not all concentration of biomass have same effect to the increase of mice body weight as a Single-Celled Protein.

Corrected placement of Mus-Rattus fossil calibration forces precision in the molecular tree of rodents.

Science.gov (United States)

Kimura, Yuri; Hawkins, Melissa T R; McDonough, Molly M; Jacobs, Louis L; Flynn, Lawrence J

2015-09-28

Time calibration derived from the fossil record is essential for molecular phylogenetic and evolutionary studies. Fossil mice and rats, discovered in the Siwalik Group of Pakistan, have served as one of the best-known fossil calibration points in molecular phylogenic studies. Although these fossils have been widely used as the 12 Ma date for the Mus/Rattus split or a more basal split, conclusive paleontological evidence for the nodal assignments has been absent. This study analyzes newly recognized characters that demonstrate lineage separation in the fossil record of Siwalik murines and examines the most reasonable nodal placement of the diverging lineages in a molecular phylogenetic tree by ancestral state reconstruction. Our specimen-based approach strongly indicates that Siwalik murines of the Karnimata clade are fossil members of the Arvicanthini-Otomyini-Millardini clade, which excludes Rattus and its relatives. Combining the new interpretation with the widely accepted hypothesis that the Progonomys clade includes Mus, the lineage separation event in the Siwalik fossil record represents the Mus/Arvicanthis split. Our test analysis on Bayesian age estimates shows that this new calibration point provides more accurate estimates of murine divergence than previous applications. Thus, we define this fossil calibration point and refine two other fossil-based points for molecular dating.

Pygmy quadrupole resonance as a manifestation of the nuclear skin

Energy Technology Data Exchange (ETDEWEB)

Tsoneva, Nadia [Frankfurt Institute for Advanced Studies (FIAS), 60438 Frankfurt am Main (Germany); Institut fuer Theoretische Physik, Universitaet Giessen (Germany); Lenske, Horst [Institut fuer Theoretische Physik, Universitaet Giessen (Germany)

2016-07-01

Recently, a new mode of nuclear excitation called pygmy quadrupole resonance (PQR) was theoretically predicted in the framework of energy-density functional (EDF) theory plus three-phonon quasiparticle-phonon model (QPM) in Sn isotopic chain. It is closely connected with higher order multipole vibrations of nuclear skin induced by the action of the electromagnetic and hadronic external fields. The predictions initiated new experiments using ({sup 17}O,{sup 17}O{sup '}γ), (α,α{sup '}γ) and (γ,γ{sup '}) reactions which were carried out in {sup 124}Sn nucleus. The aim was to probe for the first time experimentally, the possibility of existence of PQR. The detailed analysis of the obtained experimental results in comparison with the EDF+QPM theory indicates clearly the presence of a multitude of discrete low-energy 2{sup +} excitations of neutron type which can be addressed to PQR mode. The independent measurements of B(E2) values with different probes and the theory allow to identify the dominant isoscalar character of these states. Furthermore, newly determined γ-decay branching ratios exclude a statistical origin of the PQR strength. The latter are important to discriminate between PQR and multiphonon excitations.

Detection of Highly-Absorbed X-rays from Nova Mus 2018 with Swift

Science.gov (United States)

Nelson, Thomas; Kuin, Paul; Mukai, Koji; Page, Kim; Chomiuk, Laura; Kawash, Adam; Sokoloski, J. L.; Linford, Justin; Rupen, Michael P.; Mioduszewski, Amy

2018-03-01

We report the detection of X-rays from Nova Mus 2018 with the Swift XRT instrument. We have been carrying out weekly monitoring of the nova with Swift since its discovery on 2018 Jan 15 (see ATel #11220), and observations up to 2018 Feb 24 yielded X-ray non-detections.

AcEST: BP921475 [AcEST

Lifescience Database Archive (English)

Full Text Available BlastX Result : Swiss-Prot sp_hit_id O35902 Definition sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus Al...gnificant alignments: (bits) Value sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 31 2....2 sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosop... 30 4.8 >sp|O35902|DSG3_MOUSE Desmog

Comparative mapping in the beige-satin region of mouse chromosome 13

Energy Technology Data Exchange (ETDEWEB)

Perou, C.M.; Pryor, R.; Kaplan, J. [Univ. of Utah School of Medicine, Salt Lake City, UT (United States)] [and others

1997-01-15

The proximal end of mouse chromosome (Chr) 13 contains regions conserved on human chromosomes 1q42-q44, 6p23-p21, and 7p22-p13. This region also contains mutations that may be models for human disease, including beige (human Chediak-Higashi syndrome). An interspecific backcross of SB/Le and Mus spretus mice was used to generate a molecular genetic linkage map of mouse chromosome 13 with an emphasis on the proximal region including beige (bg) and satin (sa). This map provides the gene order of the two phenotypic markers bg and sa relative to restriction fragment length polymorphisms and simple sequence length polymorphisms in 131 backcross animals. In parallel, we have created a physical map of the region using Nidogen (Nid) as a molecular starting point for cloning a YAC contig that was used to identify the beige gene. The physical map provides the fine-structure order of genes and anonymous DNA fragments that was not resolved by the genetic linkage mapping. The results show that the bg region of mouse Chr 13 is highly conserved on human Chr 1q42-q44 and provide a starting point for a complete functional analysis of the entire bg-sa interval. 37 refs., 4 figs., 1 tab.

AcEST: DK950322 [AcEST

Lifescience Database Archive (English)

Full Text Available 19 OS=Mus mus... 34 0.62 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms...ith multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 87.0 bits (214), Expect = 8

Responses of small mammals to clear-cutting in temperate and boreal forests of Europe: a meta-analysis and review

OpenAIRE

Bogdziewicz, Michał; Zwolak, Rafał

2013-01-01

We analyzed the responses of small mammals to clear-cutting in temperate and boreal forests in Europe. We conducted a meta-analysis of published research on most often studied small mammal species (the striped field mouse, the yellow-necked mouse, the wood mouse, the field vole, the common vole, the bank vole, the Eurasian harvest mouse, the common shrew and the Eurasian pygmy shrew), comparing their abundance on clear-cuts and in unharvested stands. For four other species (the gray-sided vol...

Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

Directory of Open Access Journals (Sweden)

Maria Balcova

2016-04-01

Full Text Available Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm and Mus m. domesticus (Mmd, it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2 genomic locus on Chromosome X (Chr X by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s responsible for variation in the global recombination rate between closely related mouse subspecies.

Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

Science.gov (United States)

Balcova, Maria; Faltusova, Barbora; Gergelits, Vaclav; Bhattacharyya, Tanmoy; Mihola, Ondrej; Trachtulec, Zdenek; Knopf, Corinna; Fotopulosova, Vladana; Chvatalova, Irena; Gregorova, Sona; Forejt, Jiri

2016-04-01

Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm) and Mus m. domesticus (Mmd), it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2) genomic locus on Chromosome X (Chr X) by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s) responsible for variation in the global recombination rate between closely related mouse subspecies.

Characterization of two forms of mouse salivary androgen-binding protein (ABP): implications for evolutionary relationships and ligand-binding function.

Science.gov (United States)

Karn, Robert C; Laukaitis, Christina M

2003-06-17

Mouse salivary androgen-binding protein (ABP) is a member of the secretoglobin family produced in the submaxillary glands of house mice (Mus musculus). We report the cDNA sequences and amino acid sequences of the beta and gamma subunits of ABP from a mouse cDNA library, identifying the two subunits by their pIs and molecular weights. An anomalously high molecular weight of the alpha subunit is likely due to glycosylation at a single site. A phylogenetic comparison of the three subunits of ABP with the chains of other mammalian secretoglobins shows that ABP is most closely related to mouse lachrymal protein and to the major cat allergen Fel dI. An evaluation of the most conserved residues in ABP and the other secretoglobins, in light of structural data reported by others [Callebaut, I., Poupon, A., Bally, R., Demaret, J.-P., Housset, D., Delettre, J., Hossenlopp, P., and Mornon, J.-P. (2000) Ann. N.Y. Acad. Sci. 923, 90-112; Pattabiraman, N., Matthews, J., Ward, K., Mantile-Selvaggi, G., Miele, L., and Mukherjee, A. (2000) Ann. N.Y. Acad. Sci. 923, 113-127], allows us to draw conclusions about the critical residues important in ligand binding by the two different ABP dimers and to assess the importance of ligand binding in the function of the molecule. In addition to the cDNAs, which represent those of the musculus subspecies of Mus musculus, we also report the coding regions of the beta and gamma subunit cDNAs from two other mouse inbred strains which represent the other two subspecies: M. musculus domesticus and M. musculus castaneus. The high nonsynonymous/synonymous substitution rate ratios (K(a)/K(s)) for both the beta and gamma subunits suggest that these two proteins are evolving under strong directional selection, as has been reported for the alpha subunit [Hwang, J., Hofstetter, J., Bonhomme, F., and Karn, R. (1997) J. Hered. 88, 93-97; Karn, R., and Clements, M. (1999) Biochem. Genet. 37, 187-199].

Teratogenic effect of yogurt in mice fetus (Mus musculus)

OpenAIRE

Dwisari Dillasamola; Almahdy A; Amirah Desri; Skunda Diliarosta

2018-01-01

Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus) has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control), 0.52 yogurt (D1), 1.04  yogurt (D2), and 2.08 g yogurt (D3). Data were analyzed using one-way ANO...

A new sodium channel {alpha}-subunit gene (Scn9a) from Schwann cells maps to the Scn1a, Scn2a, Scn3a cluster of mouse chromosome 2

Energy Technology Data Exchange (ETDEWEB)

Beckers, M.C.; Ernst, E.; Gros, P. [McGill Univ., Montreal (Canada)

1996-08-15

We have used a total of 27 AXB/BXA recombinant inbred mouse strains to determine the chromosomal location of a newly identified gene encoding an {alpha}-subunit isoform of the sodium channel from Schwann cells, Scn9a. Linkage analysis established that Scn9a mapped to the proximal segment of mouse chromosome 2. The segregation of restriction fragment length polymorphisms in 145 progeny from a Mus spretus x C57BL/6J backcross indicates that Scn9a is very tightly linked to Scn1a (gene encoding the type I sodium channel {alpha}-subunit of the brain) and forms part of a cluster of four Scna genes located on mouse chromosome 2. 17 refs., 1 fig., 3 tabs.

FRAKSI ETANOL 96% BIJI KORO BENGUK (Mucuna pruriens L. SEBAGAI PENINGKAT KUALITAS SPERMATOZOA MENCIT (Mus musculus

Directory of Open Access Journals (Sweden)

Sri Winarni

2012-11-01

Full Text Available Background: The examination of sperm quality is the main priority for infertility diagnosis. Based on previous study with mice, active ingredient of Mucuna pruriens L. or koro benguk (Papilionaceae, the L-dopa, may affect the quality of spermatozoa.Objective: Research was to study the effect of 96% ethanol fraction Mucuna pruriens seed on spermatozoaquality of mice exposed to 2-Methoxy ethanol. L-dopa in 96% ethanol fraction of M. pruriens seed was 14.7%.Methode: This was an experimental study using complete randomized design. Subjects were BALB/C mice (Mus musculus. Five groups served as control, 3 groups received subcutaneos injection of 2-ME as muchas 100 mg/kg.bw/day for 12 days, followed with 96% ethanol fraction Mucuna pruriens seed starting from14 mg/kg.bw/day, 28 mg/kg.bw/day, and 56 mg/kg.bw/day for 51 days.Result: The 96% ethanol fraction of Mucuna pruriens seeds are significant increase motility (p<0,01 andthe percentage of normal spermatozoa morphology (p= 0,042.Conclusion: 96% ethanol fraction of Mucuna pruriens seeds are able to increase motility and the percentage of normal spermatozoa morphology in mice exposed to 2-ME. Keywords: Mucuna pruriens L., L-dopa, mouse spermatozoa

New Metacentric Populations and Phylogenetic Hypotheses Involving Whole-Arm Reciprocal Translocation in Mus musculus domesticus from Sicily, Southern Italy.

Science.gov (United States)

Castiglia, Riccardo; Capanna, Ernesto; Bezerra, Alexandra M R; Bizzoco, Domenico; Zambigli, Emanuela; Solano, Emanuela

2015-01-01

The house mouse Mus musculus domesticus is characterized by more than 100 metacentric populations, due to the occurrence of Robertsonian (Rb) fusions, together with the standard all-telocentric karyotype (2n = 40). We examined G-banded karyotypes of 18 mice from 10 localities in Sicily and describe 3 new metacentric populations: 'Ragusa Ibla' (IRAG), 2n = 33-36, Rb(2.4), Rb(5.6), Rb(9.16), Rb(13.17); 'Piana degli Albanesi' (IPIA), 2n = 23, Rb(1.18), Rb(2.15), Rb(3.5), Rb(4.12), Rb(6.11), Rb(7.8), Rb(9.16), Rb(10.14), Rb(13.17); 'Trapani' (ITRA), 2n = 22, Rb(1.18), Rb(2.15), Rb(3.7), Rb(4.12), Rb(5.9), Rb(6.11), Rb(8.16), Rb(10.14), Rb(13.17). Three mice belonged to the previously reported 'Castelbuono' race (ICAS), 2n = 24, which is very similar to the nearby 'Palermo' (IPAL) race, 2n = 26. Three Rb fusions not yet observed in wild mouse populations were identified: Rb(3.5), Rb(3.7) and Rb(5.9). Rb fusions shared among 4 races (IPIA, IRAG, ICAS, and IPAL) allowed us to describe their potential phylogenetic relationships. We obtained 2 alternative phylogenetic trees. The differences between them are mainly due to various modes of formation of IPIA and ITRA. In the first hypothesis, the specific Rb fusions occurred independently. In the second, those of IRAG originated from those of IPIA via whole-arm reciprocal translocations. © 2015 S. Karger AG, Basel.

Collection and preservation of pygmy hippopotamus (Choeropsis liberiensis) semen.

Science.gov (United States)

Saragusty, J; Hildebrandt, T B; Bouts, T; Göritz, F; Hermes, R

2010-09-01

Knowledge about the reproduction of the endangered pygmy hippopotamus is almost non-existent. This study takes the first step toward changing this by devising a protocol for the collection, evaluation, and short-term preservation of semen of this endangered species. Semen was collected successfully from seven bulls by electroejaculation, using a specially designed rectal probe. Mean +/- SEM values of native sperm parameters from combined best fractions were: motility-80.0 +/- 4.1%, concentration-2421 +/- 1530 x 10(6) cells/mL, total collected cell number-759 +/- 261 x 10(6) cells, intact acrosome-87.8 +/- 1.2%, intact morphology-52.7 +/- 4.3%, and, for some, hypoosmotic swelling test-79.3 +/- 4.4% and seminal plasma osmolarity-297.5 +/- 3.3 mOsm. Seven different extenders were tested for sperm storage under chilling conditions: Berliner Cryomedium (BC), Biladyl, modification of Kenney modified Tyrode's medium (KMT), MES medium, Androhep((R)), boar M III() extender and Human Sperm Refrigeration Medium. While differences between males were apparent, the BC was consistently superior to all other extenders in sperm motility and facilitated storage for 7 d with up to 30% motility and some motility even after 3 weeks. With this knowledge in hand, the obvious two directions for future research are to conduct artificial insemination and to develop a technique for sperm cryopreservation. Copyright 2010 Elsevier Inc. All rights reserved.

Is water really a barrier for the house mouse? A comparative study of two mouse subspecies

Czech Academy of Sciences Publication Activity Database

Hiadlovská, Zuzana; Strnadová, Markéta; Macholán, Miloš; Vošlajerová Bímová, Barbora

2012-01-01

Roč. 61, 3-4 (2012), s. 319-329 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersal * Mus musculus domesticus * Mus musculus musculus * swimming * water barrier Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

Metabolic profiles in serum of mouse after chronic exposure to drinking water.

Science.gov (United States)

Zhang, Yan; Wu, Bing; Zhang, Xuxiang; Li, Aimin; Cheng, Shupei

2011-08-01

The toxicity of Nanjing drinking water on mouse (Mus musculus) was detected by (1)H nuclear magnetic resonance (NMR)-based metabonomic method. Three groups of mice were fed with drinking water (produced by Nanjing BHK Water Plant), 3.8 μg/L benzo(a)pyrene as contrast, and clean water as control, respectively, for 90 days. It was observed that the levels of lactate, alanine, and creatinine in the mice fed with drinking water were increased and that of valine was decreased. The mice of drinking water group were successfully separated from control. The total concentrations of polycyclic aromatic hydrocarbons (PAHs), phthalates (PAEs), and other organic pollutants in the drinking water were 0.23 μg/L, 4.57 μg/L, and 0.34 μg/L, respectively. In this study, Nanjing drinking water was found to induce distinct perturbations of metabolic profiles on mouse including disorders of glucose-alanine cycle, branched-chain amino acid and energy metabolism, and dysfunction of kidney. This study suggests that metabonomic method is feasible and sensitive to evaluate potential toxic effects of drinking water.

The cochlea of the enigmatic pygmy right whale Caperea marginata informs mysticete phylogeny.

Science.gov (United States)

Park, Travis; Marx, Felix G; Fitzgerald, Erich M G; Evans, Alistair R

2017-06-01

The pygmy right whale, Caperea marginata, is the least understood extant baleen whale (Cetacea, Mysticeti). Knowledge on its basic anatomy, ecology, and fossil record is limited, even though its singular position outside both balaenids (right whales) and balaenopteroids (rorquals + grey whales) gives Caperea a pivotal role in mysticete evolution. Recent investigations of the cetacean cochlea have provided new insights into sensory capabilities and phylogeny. Here, we extend this advance to Caperea by describing, for the first time, the inner ear of this enigmatic species. The cochlea is large and appears to be sensitive to low-frequency sounds, but its hearing limit is relatively high. The presence of a well-developed tympanal recess links Caperea with cetotheriids and balaenopteroids, rather than balaenids, contrary to the traditional morphological view of a close Caperea-balaenid relationship. Nevertheless, a broader sample of the cetotheriid Herpetocetus demonstrates that the presence of a tympanal recess can be variable at the specific and possibly even the intraspecific level. © 2017 Wiley Periodicals, Inc.

Pygmy dipole strength in {sup 86}Kr and systematics of N=50 isotones

Energy Technology Data Exchange (ETDEWEB)

Schwengner, R.; Bemmerer, D.; Beyer, R.; Junghans, A.R.; Marta, M.; Schilling, K.D.; Wagner, A. [Helmholtz-Zentrum Dresden-Rossendorf (HZDR) (Germany); Massarczyk, R.; Hannaske, R. [Helmholtz-Zentrum Dresden-Rossendorf (HZDR) (Germany); TU Dresden (Germany); Rusev, G.; Kelley, J.H.; Kwan, E.; Raut, R.; Tonchev, A.; Tornow, W. [Triangle Universities Nuclear Laboratory (TUNL), Durham NC (United States); Tsoneva, N.; Lenske, H. [Universitaet Giessen (Germany)

2013-07-01

We present results of the first photon-scattering study of {sup 86}Kr. Experiments were carried out with bremsstrahlung at the ELBE accelerator of HZDR and with monoenergetic, polarized γ rays at the HIγS facility of TUNL. A high-pressure gas target was used. We identified about 40 states with J{sup π} = 1{sup -} up to the neutron-separation energy for the first time. For the determination of the absorption cross section, strength in the quasicontinuum was taken into account and a correction of the cross section for inelastic transitions was performed on the basis of simulations of statistical γ-ray cascades. The resulting absorption cross section shows enhanced strength considered as a pygmy dipole resonance (PDR) and is compared with predictions of the quasiparticle-phonon model. The behavior of PDR strength within the series of N=50 isotones is discussed. Enhanced photon strength may influence neutron-capture reaction rates relevant for transmutation studies.

NCBI nr-aa BLAST: CBRC-PCAP-01-1368 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PCAP-01-1368 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1594 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-MLUC-01-1112 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-1112 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-OPRI-01-0982 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OPRI-01-0982 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-VPAC-01-1554 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-VPAC-01-1554 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-MMUR-01-1494 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUR-01-1494 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-TTRU-01-0117 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0117 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-GGOR-01-1297 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1297 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

NCBI nr-aa BLAST: CBRC-CINT-01-0186 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0186 ref|NP_083045.3| synovial apoptosis inhibitor 1, synoviolin [Mus ...musculus] sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin precursor (Synovial apoptosis inhibit...or 1) gb|AAH42199.1| Synovial apoptosis inhibitor 1, synoviolin [Mus musculus] gb|AAH57917.1| Synovial apoptosis inhibitor 1, synovio...lin [Mus musculus] gb|AAH80722.1| Synovial apoptosis inhibitor 1, synoviolin... [Mus musculus] gb|EDL33195.1| synovial apoptosis inhibitor 1, synoviolin, isoform CRA_b [Mus musculus] NP_083045.3 1e-167 51% ...

Hold your horSSEs: controlling structure-selective endonucleases MUS81 and Yen1/GEN1.

Science.gov (United States)

Blanco, Miguel G; Matos, Joao

2015-01-01

Repair of DNA lesions through homologous recombination promotes the establishment of stable chromosomal interactions. Multiple helicases, topoisomerases and structure-selective endonucleases (SSEs) act upon recombining joint molecules (JMs) to disengage chromosomal connections and safeguard chromosome segregation. Recent studies on two conserved SSEs - MUS81 and Yen1/GEN1- uncovered multiple layers of regulation that operate to carefully tailor JM-processing according to specific cellular needs. Temporal restriction of SSE function imposes a hierarchy in pathway usage that ensures efficient JM-processing while minimizing reciprocal exchanges between the recombining DNAs. Whereas a conserved strategy of fine-tuning SSE functions exists in different model systems, the precise molecular mechanisms to implement it appear to be significantly different. Here, we summarize the current knowledge on the cellular switches that are in place to control MUS81 and Yen1/GEN1 functions.

Meiotic synapsis of homogeneously staining regions (HSRs) in chromosome 1 of Mus musculus.

Science.gov (United States)

Winking, H; Reuter, C; Traut, W

1993-05-01

About 50 copies of a long-range repeat DNA family with a repeat size of roughly 100 kb and with sequence homology to mRNAs are clustered in the G-light band D of chromosome 1 of the house mouse, Mus musculus. We studied amplified versions of the cluster which are found in many wild populations of M. musculus. They are cytogenetically conspicuous as one or two C-band positive homogeneously staining regions (single- and double band HSRs) which increase the mitotic length of chromosome 1. The double band HSR was phylogenetically derived from a single band HSR by a paracentric inversion. In homozygous condition, such HSRs contribute, albeit not as much as expected from their mitotic length, to the synaptonemal complex (SC) length of chromosome 1. In HSR heterozygous animals an elongation of the SCs was not noticeable. In single band HSR heterozygous males, synapsis proceeds regularly and continuously from the distal telomere towards the centromeric end without forming buckles. Thus, the single band HSR has no adverse effect on pairing. The same straight pairing behaviour was found in the majority of double band HSR heterozygous spermatocytes. This shows that extensive nonhomologous pairing can take place in the earliest phase of synapsis. Synapsis was discontinuous, leaving the central part of the bivalent 1 asynapsed, in only 14.3% of double band HSR heterozygous cells. In such cells the chromosome 1 SC is completed at a later stage of meiosis. The delay is presumably an effect of the inversion that includes one HSR band and the segment between the two HSR bands.

MUS81 promotes common fragile site expression

DEFF Research Database (Denmark)

Ying, Songmin; Minocherhomji, Sheroy; Chan, Kok Lung

2013-01-01

Fragile sites are chromosomal loci with a propensity to form gaps or breaks during early mitosis, and their instability is implicated as being causative in certain neurological disorders and cancers. Recent work has demonstrated that the so-called common fragile sites (CFSs) often impair the fait......Fragile sites are chromosomal loci with a propensity to form gaps or breaks during early mitosis, and their instability is implicated as being causative in certain neurological disorders and cancers. Recent work has demonstrated that the so-called common fragile sites (CFSs) often impair...... the faithful disjunction of sister chromatids in mitosis. However, the mechanisms by which CFSs express their fragility, and the cellular factors required to suppress CFS instability, remain largely undefined. Here, we report that the DNA structure-specific nuclease MUS81-EME1 localizes to CFS loci in early...

ORF Alignment: NC_003103 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s] ref|NP_766317.1| caspase recruitment domain 4 ... [Mus musculus] gb|AAH42670.1| Caspase recruitment... domain ... 4 [Mus musculus] sp|Q8BHB0|CARD4_MOUSE Caspase ... recruitment domain protein 4 d

Columbia River wildlife mitigation habitat evaluation procedures report: Scotch Creek Wildlife Area, Berg Brothers, and Douglas County pygmy rabbit projects

International Nuclear Information System (INIS)

Ashley, P.R.; Ratassepp, J.; Berger, M.; Judd, S.L.

1997-01-01

This Habitat Evaluation Procedure study was conducted to determine baseline habitat units (HUs) on the Scotch Creek, Mineral Hill, Pogue Mountain, Chesaw and Tunk Valley Habitat Areas (collectively known as the Scotch Creek Wildlife Area) in Okanogan County, Sagebrush Flat and the Dormaler property in Douglas County, and the Berg Brothers ranch located in Okanogan County within the Colville Reservation. A HEP team comprised of individuals from the Washington Department of Fish and Wildlife, the Confederated Tribes of the Colville Reservation, and the Natural Resources Conservation Service (Appendix A) conducted baseline habitat surveys using the following HEP evaluation species: mule deer (Odocoileus hemionus), sharp-tailed grouse (Tympanuchus phasianellus), pygmy rabbit (Brachylagus idahoensis), white-tailed deer (Odocoileus virginiana), mink (Mustela vison), Canada goose (Branta canadensis), downy woodpecker (Picoides pubescens), Lewis woodpecker (Melanerpes lewis), and Yellow warbler (Dendroica petechia). Results of the HEP analysis are listed below. General ratings (poor, marginal, fair, etc.,) are described in Appendix B. Mule deer habitat was marginal lacking diversity and quantify of suitable browse species. Sharp-tailed grouse habitat was marginal lacking residual nesting cover and suitable winter habitat Pygmy rabbit habitat was in fair condition except for the Dormaier property which was rated marginal due to excessive shrub canopy closure at some sites. This report is an analysis of baseline habitat conditions on mitigation project lands and provides estimated habitat units for mitigation crediting purposes. In addition, information from this document could be used by wildlife habitat managers to develop management strategies for specific project sites

Columbia River Wildlife Mitigation Habitat Evaluation Procedures Report / Scotch Creek Wildlife Area, Berg Brothers, and Douglas County Pygmy Rabbit Projects.

Energy Technology Data Exchange (ETDEWEB)

Ashley, Paul R.

1997-01-01

This Habitat Evaluation Procedure study was conducted to determine baseline habitat units (HUs) on the Scotch Creek, Mineral Hill, Pogue Mountain, Chesaw and Tunk Valley Habitat Areas (collectively known as the Scotch Creek Wildlife Area) in Okanogan County, Sagebrush Flat and the Dormaler property in Douglas County, and the Berg Brothers ranch located in Okanogan County within the Colville Reservation. A HEP team comprised of individuals from the Washington Department of Fish and Wildlife, the Confederated Tribes of the Colville Reservation, and the Natural Resources Conservation Service (Appendix A) conducted baseline habitat surveys using the following HEP evaluation species: mule deer (Odocoileus hemionus), sharp-tailed grouse (Tympanuchus phasianellus), pygmy rabbit (Brachylagus idahoensis), white-tailed deer (Odocoileus virginiana), mink (Mustela vison), Canada goose (Branta canadensis), downy woodpecker (Picoides pubescens), Lewis woodpecker (Melanerpes lewis), and Yellow warbler (Dendroica petechia). Results of the HEP analysis are listed below. General ratings (poor, marginal, fair, etc.,) are described in Appendix B. Mule deer habitat was marginal lacking diversity and quantify of suitable browse species. Sharp-tailed grouse habitat was marginal lacking residual nesting cover and suitable winter habitat Pygmy rabbit habitat was in fair condition except for the Dormaier property which was rated marginal due to excessive shrub canopy closure at some sites. This report is an analysis of baseline habitat conditions on mitigation project lands and provides estimated habitat units for mitigation crediting purposes. In addition, information from this document could be used by wildlife habitat managers to develop management strategies for specific project sites.

Food preferences of wild house-mice (Mus musclus L).

Science.gov (United States)

Rowe, F P; Bradfield, A; Redfern, R

1974-12-01

The relative acceptance of various plain foods by wild house-mice (Mus musculus L.) was compared in laboratory choice tests. The palatability of glycerine and six oils, each included at 5% in pinhead oatmeal, was compared in a similar manner.The most favoured food was found to be whole canary seed (Phalaris canariensis). Pinhead oatmeal and wheat were also comparatively well accepted. Glycerine, corn oil, arachis oil and mineral oil were more palatable than either olive, linseed or cod-liver oils.The results of the choice tests are considered in relation to the use of poison baits for the control of free-living mice.

Food preferences of wild house-mice (Mus musculus L.)*

Science.gov (United States)

Rowe, F. P.; Bradfield, A.; Redfern, R.

1974-01-01

The relative acceptance of various plain foods by wild house-mice (Mus musculus L.) was compared in laboratory choice tests. The palatability of glycerine and six oils, each included at 5% in pinhead oatmeal, was compared in a similar manner. The most favoured food was found to be whole canary seed (Phalaris canariensis). Pinhead oatmeal and wheat were also comparatively well accepted. Glycerine, corn oil, arachis oil and mineral oil were more palatable than either olive, linseed or cod-liver oils. The results of the choice tests are considered in relation to the use of poison baits for the control of free-living mice. PMID:4531454

Srs2 and Mus81-Mms4 Prevent Accumulation of Toxic Inter-Homolog Recombination Intermediates.

Directory of Open Access Journals (Sweden)

Kenji Keyamura

2016-07-01

Full Text Available Homologous recombination is an evolutionally conserved mechanism that promotes genome stability through the faithful repair of double-strand breaks and single-strand gaps in DNA, and the recovery of stalled or collapsed replication forks. Saccharomyces cerevisiae ATP-dependent DNA helicase Srs2 (a member of the highly conserved UvrD family of helicases has multiple roles in regulating homologous recombination. A mutation (srs2K41A resulting in a helicase-dead mutant of Srs2 was found to be lethal in diploid, but not in haploid, cells. In diploid cells, Srs2K41A caused the accumulation of inter-homolog joint molecule intermediates, increased the levels of spontaneous Rad52 foci, and induced gross chromosomal rearrangements. Srs2K41A lethality and accumulation of joint molecules were suppressed by inactivating Rad51 or deleting the Rad51-interaction domain of Srs2, whereas phosphorylation and sumoylation of Srs2 and its interaction with sumoylated proliferating cell nuclear antigen (PCNA were not required for lethality. The structure-specific complex of crossover junction endonucleases Mus81 and Mms4 was also required for viability of diploid, but not haploid, SRS2 deletion mutants (srs2Δ, and diploid srs2Δ mus81Δ mutants accumulated joint molecule intermediates. Our data suggest that Srs2 and Mus81-Mms4 have critical roles in preventing the formation of (or in resolving toxic inter-homolog joint molecules, which could otherwise interfere with chromosome segregation and lead to genetic instability.

Sex reversal in the mouse (Mus musculus) is caused by a recurrent nonreciprocal crossover involving the x and an aberrant y chromosome.

Science.gov (United States)

Singh, L; Jones, K W

1982-02-01

Satellite DNA (Bkm) from the W sex-determining chromosome of snakes, which is related to sequences on the mouse Y chromosome, has been used to analyze the DNA and chromosomes of sex-reversed (Sxr) XXSxr male mice. Such mice exhibit a male-specific Southern blot Bkm hybridization pattern, consistent with the presence of Y-chromosome DNA. In situ hybridization of Bkm to chromosomes of XXSxr mice shows an aberrant concentration of related sequences on the distal terminus of a large mouse chromosome. The XYSxr carrier male, however, shows a pair of small chromosomes, which are presumed to be aberrant Y derivatives. Meiosis in the XYSxr mouse involves transfer of chromatin rich in Bkm-related DNA from the Y-Y1 complex to the X distal terminus. We suggest that this event is responsible for the transmission of the Sxr trait.

A novel adipokinetic peptide from the corpus cardiacum of the primitive caeliferan pygmy grasshopper Tetrix subulata (Caelifera, Tetrigidae).

Science.gov (United States)

Gäde, Gerd; Šimek, Petr; Marco, Heather G

2015-06-01

The basal caeliferan family Tetrigidae is investigated to identify neuropeptides belonging to the adipokinetic hormone (AKH) family. The pygmy grasshopper Tetrix subulata contains in its corpus cardiacum two octapeptides as revealed by liquid chromatography coupled to electrospray ionization mass spectrometry. The less abundant peptide is the well-known Schgr-AKH-II (pELNFSTGW amide) which is suggested to be the ancestral AKH of Caelifera and Ensifera. The second peptide, Tetsu-AKH (pEFNFTPGW amide), is novel and quite unusual with its third aromatic residue at position 2. It is thought to be autapomorphic for Caelifera. Tetsu-AKH has hyperlipemic activity in T. subulata and in Schistocerca gregaria. Copyright © 2015 Elsevier Inc. All rights reserved.

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-139 80% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0136 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0136 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-175 100% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2632 ref|NP_076136.2| non-imprinted in Prader-Willi/Angelman syndrome ...2 [Mus musculus] sp|Q9JJC8|NIPA2_MOUSE RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprinte...tein product [Mus musculus] tpg|DAA01178.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 2 [Mus ...musculus] dbj|BAE32806.1| unnamed protein product [Mus musculus] gb|EDL21872.1| non imprint...ed in Prader-Willi/Angelman syndrome 2 homolog (human), isoform CRA_a [Mus musculus] gb|EDL21874.1| non imprint

NCBI nr-aa BLAST: CBRC-OCUN-01-0645 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0645 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 3e-46 53% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0141 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-135 78% ...

Transcriptome markers of viral persistence in naturally-infected andes virus (bunyaviridae seropositive long-tailed pygmy rice rats.

Directory of Open Access Journals (Sweden)

Corey L Campbell

Full Text Available Long-tailed pygmy rice rats (Oligoryzomys longicaudatus are principal reservoir hosts of Andes virus (ANDV (Bunyaviridae, which causes most hantavirus cardiopulmonary syndrome cases in the Americas. To develop tools for the study of the ANDV-host interactions, we used RNA-Seq to generate a de novo transcriptome assembly. Splenic RNA from five rice rats captured in Chile, three of which were ANDV-infected, was used to generate an assembly of 66,173 annotated transcripts, including noncoding RNAs. Phylogenetic analysis of selected predicted proteins showed similarities to those of the North American deer mouse (Peromyscus maniculatus, the principal reservoir of Sin Nombre virus (SNV. One of the infected rice rats had about 50-fold more viral burden than the others, suggesting acute infection, whereas the remaining two had levels consistent with persistence. Differential expression analysis revealed distinct signatures among the infected rodents. The differences could be due to 1 variations in viral load, 2 dimorphic or reproductive differences in splenic homing of immune cells, or 3 factors of unknown etiology. In the two persistently infected rice rats, suppression of the JAK-STAT pathway at Stat5b and Ccnot1, elevation of Casp1, RIG-I pathway factors Ppp1cc and Mff, and increased FC receptor-like transcripts occurred. Caspase-1 and Stat5b activation pathways have been shown to stimulate T helper follicular cell (TFH development in other species. These data are also consistent with reports suggestive of TFH stimulation in deer mice experimentally infected with hantaviruses. In the remaining acutely infected rice rat, the apoptotic pathway marker Cox6a1 was elevated, and putative anti-viral factors Abcb1a, Fam46c, Spp1, Rxra, Rxrb, Trmp2 and Trim58 were modulated. Transcripts for preproenkephalin (Prenk were reduced, which may be predictive of an increased T cell activation threshold. Taken together, this transcriptome dataset will permit rigorous

Polygyny without wealth: popularity in gift games predicts polygyny in BaYaka Pygmies.

Science.gov (United States)

Chaudhary, Nikhil; Salali, Gul Deniz; Thompson, James; Dyble, Mark; Page, Abigail; Smith, Daniel; Mace, Ruth; Migliano, Andrea Bamberg

2015-05-01

The occurrence of polygynous marriage in hunter-gatherer societies, which do not accumulate wealth, remains largely unexplored since resource availability is dependent on male hunting capacity and limited by the lack of storage. Hunter-gatherer societies offer the greatest insight in to human evolution since they represent the majority of our species' evolutionary history. In order to elucidate the evolution of hunter-gatherer polygyny, we study marriage patterns of BaYaka Pygmies. We investigate (i) rates of polygyny among BaYaka hunter-gatherers; (ii) whether polygyny confers a fitness benefit to BaYaka men; (iii) in the absence of wealth inequalities, what are the alternative explanations for polygyny among the BaYaka. To understand the latter, we explore differences in phenotypic quality (height and strength), and social capital (popularity in gift games). We find polygynous men have increased reproductive fitness; and that social capital and popularity but not phenotypic quality might have been important mechanisms by which some male hunter-gatherers sustained polygynous marriages before the onset of agriculture and wealth accumulation.

AcEST: DK962347 [AcEST

Lifescience Database Archive (English)

Full Text Available ... 33 1.1 sp|Q7TSF1|DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus GN=Dsg1b... 31... 30 7.4 sp|Q61495|DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus GN=Dsg1... 30 7.4 sp|Q9SIB4|WOX3_ARATH WUSC...hia co... 30 9.6 sp|Q01550|TANA_XENLA Tanabin OS=Xenopus laevis PE=2 SV=1 30 9.6 sp|Q7TSF0|DSG1C_MOUSE Desmog...VAEYVTH 428 IVG WDE LP D V E+ E+V+H Sbjct: 322 IVGGNWDEVLPVDVRVPEEIQEFVSH 347 >sp|Q7TSF1|DSG1B_MOUSE Desmogl

Translocation and radio-telemetry monitoring of pygmy marmoset, Cebuella pygmaea (Spix, 1823, in the Brazilian Amazon

Directory of Open Access Journals (Sweden)

CAR. Dias

Full Text Available Two groups of pygmy marmoset (Cebuella pygmaea were rescued along the left bank of the Madeira River during the formation of Santo Antônio Hydroelectric Dam reservoir in the state of Rondônia, Northern Brazil. Reintroduction of both groups occurred in areas of open Tropical rainforest located within the project´s Permanent Preservation Area. A post-release monitoring was conducted for three months using radio-telemetry. Individuals of each group remained together and settled in stable home ranges near their respective release sites. The mortality rate of translocated animals was about 7%. This seems to be the first report documenting the complete group translocation of C. pygmaea and the first to successfully employ radio-telemetry techniques in monitoring this species. This study demonstrated the feasibility of translocation and the use of radio-telemetry in monitoring C. pygmaea.

Efficacy of drugs against Giardia muris in mice Mus musculus naturally infected/
Eficácia de drogas contra Giardia muris em camundongos Mus musculus naturalmente infectados

OpenAIRE

Silvia Gonzalez Monteiro; Régis Adriel Zanette; Camila Belmonte Oliveira; Marcos Kipper da Silva; Aleksandro Schafer da Silva

2008-01-01

This study aimed to evaluate the efficacy of metronidazole, fenbendazole and secnidazole against Giardia muris in mice naturally infected. Forty mice of the species Mus musculus were divided in four groups of ten each, being group A non treated, the control group and groups B, C and D treated with 4mg/ml of metronidazole, fenbendazole and secnidazole, respectively. Two feces collection, on day 0 and on day 10 after treatment, were done in order to evaluate the efficacy of the drugs. Samples w...

Disruption of SLX4-MUS81 Function Increases the Relative Biological Effectiveness of Proton Radiation

Energy Technology Data Exchange (ETDEWEB)

Liu, Qi [Laboratory of Cellular and Molecular Radiation Oncology, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Underwood, Tracy S.A.; Kung, Jong [Division of Radiation Physics, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Wang, Meng [Laboratory of Cellular and Molecular Radiation Oncology, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Lu, Hsiao-Ming; Paganetti, Harald [Division of Radiation Physics, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Held, Kathryn D.; Hong, Theodore S.; Efstathiou, Jason A. [Laboratory of Cellular and Molecular Radiation Oncology, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Willers, Henning, E-mail: hwillers@mgh.harvard.edu [Laboratory of Cellular and Molecular Radiation Oncology, Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States)

2016-05-01

Purpose: Clinical proton beam therapy has been based on the use of a generic relative biological effectiveness (RBE) of ∼1.1. However, emerging data have suggested that Fanconi anemia (FA) and homologous recombination pathway defects can lead to a variable RBE, at least in vitro. We investigated the role of SLX4 (FANCP), which acts as a docking platform for the assembly of multiple structure-specific endonucleases, in the response to proton irradiation. Methods and Materials: Isogenic cell pairs for the study of SLX4, XPF/ERCC1, MUS81, and SLX1 were irradiated at the mid-spread-out Bragg peak of a clinical proton beam (linear energy transfer 2.5 keV/μm) or with 250 kVp x-rays, and the clonogenic survival fractions were determined. To estimate the RBE of the protons relative to cobalt-60 photons (Co60Eq), we assigned a RBE(Co60Eq) of 1.1 to x-rays to correct the physical dose measured. Standard DNA repair foci assays were used to monitor the damage responses, and the cell cycle distributions were assessed by flow cytometry. The poly(ADP-ribose) polymerase inhibitor olaparib was used for comparison. Results: Loss of SLX4 function resulted in an enhanced proton RBE(Co60Eq) of 1.42 compared with 1.11 for wild-type cells (at a survival fraction of 0.1; P<.05), which correlated with increased persistent DNA double-strand breaks in cells in the S/G{sub 2} phase. Genetic analysis identified the SLX4-binding partner MUS81 as a mediator of resistance to proton radiation. Both proton irradiation and olaparib treatment resulted in a similar prolonged accumulation of RAD51 foci in SLX4/MUS81-deficient cells, suggesting a common defect in the repair of DNA replication fork-associated damage. Conclusions: A defect in the FA pathway at the level of SLX4 results in hypersensitivity to proton radiation, which is, at least in part, due to impaired MUS81-mediated processing of replication forks that stall at clustered DNA damage. In vivo and clinical studies are needed to

Methylation patterns of repetitive DNA sequences in germ cells of Mus musculus.

OpenAIRE

Sanford, J; Forrester, L; Chapman, V; Chandley, A; Hastie, N

1984-01-01

The major and the minor satellite sequences of Mus musculus were undermethylated in both sperm and oocyte DNAs relative to the amount of undermethylation observed in adult somatic tissue DNA. This hypomethylation was specific for satellite sequences in sperm DNA. Dispersed repetitive and low copy sequences show a high degree of methylation in sperm DNA; however, a dispersed repetitive sequence was undermethylated in oocyte DNA. This finding suggests a difference in the amount of total genomic...

NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-07-0067 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-12-0016 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0074 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1883 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-1734 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-10-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-10-0006 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1522 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-1020 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-GACU-18-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-18-0022 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1332 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-14-0023 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

Elevated expression of H19 and Igf2 in the female mouse eye.

Directory of Open Access Journals (Sweden)

Björn Reinius

Full Text Available The catalogue of genes expressed at different levels in the two sexes is growing, and the mechanisms underlying sex differences in regulation of the mammalian transcriptomes are being explored. Here we report that the expression of the imprinted non-protein-coding maternally expressed gene H19 was female-biased specifically in the female mouse eye (1.9-fold, p = 3.0E-6 while not being sex-biased in other somatic tissues. The female-to-male expression fold-change of H19 fell in the range expected from an effect of biallelic versus monoallelic expression. Recently, the possibility of sex-specific parent-of-origin allelic expression has been debated. This led us to hypothesize that H19 might express biallelically in the female mouse eye, thus escape its silencing imprint on the paternal allele specifically in this tissue. We therefore performed a sex-specific imprinting assay of H19 in female and male eye derived from a cross between Mus musculus and Mus spretus. However, this analysis demonstrated that H19 was exclusively expressed from the maternal gene copy, disproving the escape hypothesis. Instead, this supports that the female-biased expression of H19 is the result of upregulation of the single maternal. Furthermore, if H19 would have been expressed from both gene copies in the female eye, an associated downregulation of Insulin-like growth factor 2 (Igf2 was expected, since H19 and Igf2 compete for a common enhancer element located in the H19/Igf2 imprinted domain. On the contrary we found that also Igf2 was significantly upregulated in its expression in the female eye (1.2-fold, p = 6.1E-3, in further agreement with the conclusion that H19 is monoallelically elevated in females. The female-biased expression of H19 and Igf2 specifically in the eye may contribute to our understanding of sex differences in normal as well as abnormal eye physiology and processes.

AcEST: BP917594 [AcEST

Lifescience Database Archive (English)

Full Text Available I11|MDTH_CITK8 Multidrug resistance protein mdtH OS=Citrob... 30 9.4 >sp|Q80W93|HYDIN_MOUSE Hydrocephalus-in.........done Score E Sequences producing significant alignments: (bits) Value sp|Q80W93|HYDIN_MOUSE Hydrocep...(release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q80W93 Definition sp|Q80W93|HYDIN_MOUSE Hydroc...ephalus-inducing protein OS=Mus musculus Align length 89 Score (bit) 35.4 E-value 0...halus-inducing protein OS=Mus musc... 35 0.17 sp|Q726E5|Y3208_DESVH UPF0078 membran

Migratory movements of pygmy blue whales (Balaenoptera musculus brevicauda between Australia and Indonesia as revealed by satellite telemetry.

Directory of Open Access Journals (Sweden)

Michael C Double

Full Text Available In Australian waters during the austral summer, pygmy blue whales (Balaenoptera musculus brevicauda occur predictably in two distinct feeding areas off western and southern Australia. As with other blue whale subspecies, outside the austral summer their distribution and movements are poorly understood. In order to describe the migratory movements of these whales, we present the satellite telemetry derived movements of eleven individuals tagged off western Australia over two years. Whales were tracked from between 8 and 308 days covering an average distance of 3,009±892 km (mean ± se; range: 832 km-14,101 km at a rate of 21.94±0.74 km per day (0.09 km-455.80 km/day. Whales were tagged during March and April and ultimately migrated northwards post tag deployment with the exception of a single animal which remained in the vicinity of the Perth Canyon/Naturaliste Plateau for its eight day tracking period. The tagged whales travelled relatively near to the Australian coastline (100.0±1.7 km until reaching a prominent peninsula in the north-west of the state of Western Australia (North West Cape after which they travelled offshore (238.0±13.9 km. Whales reached the northern terminus of their migration and potential breeding grounds in Indonesian waters by June. One satellite tag relayed intermittent information to describe aspects of the southern migration from Indonesia with the animal departing around September to arrive in the subtropical frontal zone, south of western Australia in December. Throughout their migratory range, these whales are exposed to impacts associated with industry, fishing and vessel traffic. These movements therefore provide a valuable tool to industry when assessing potential interactions with pygmy blue whales and should be considered by conservation managers and regulators when mitigating impacts of development. This is particularly relevant for this species as it continues to recover from past exploitation.

Hyperelastic Material Properties of Mouse Skin under Compression.

Directory of Open Access Journals (Sweden)

Yuxiang Wang

Full Text Available The skin is a dynamic organ whose complex material properties are capable of withstanding continuous mechanical stress while accommodating insults and organism growth. Moreover, synchronized hair cycles, comprising waves of hair growth, regression and rest, are accompanied by dramatic fluctuations in skin thickness in mice. Whether such structural changes alter skin mechanics is unknown. Mouse models are extensively used to study skin biology and pathophysiology, including aging, UV-induced skin damage and somatosensory signaling. As the skin serves a pivotal role in the transfer function from sensory stimuli to neuronal signaling, we sought to define the mechanical properties of mouse skin over a range of normal physiological states. Skin thickness, stiffness and modulus were quantitatively surveyed in adult, female mice (Mus musculus. These measures were analyzed under uniaxial compression, which is relevant for touch reception and compression injuries, rather than tension, which is typically used to analyze skin mechanics. Compression tests were performed with 105 full-thickness, freshly isolated specimens from the hairy skin of the hind limb. Physiological variables included body weight, hair-cycle stage, maturity level, skin site and individual animal differences. Skin thickness and stiffness were dominated by hair-cycle stage at young (6-10 weeks and intermediate (13-19 weeks adult ages but by body weight in mature mice (26-34 weeks. Interestingly, stiffness varied inversely with thickness so that hyperelastic modulus was consistent across hair-cycle stages and body weights. By contrast, the mechanics of hairy skin differs markedly with anatomical location. In particular, skin containing fascial structures such as nerves and blood vessels showed significantly greater modulus than adjacent sites. Collectively, this systematic survey indicates that, although its structure changes dramatically throughout adult life, mouse skin at a given

Aspects of the biology of the pygmy ribbontail catshark Eridacnis radcliffei (Proscylliidae: Carcharhiniformes) from the south-west coast of India.

Science.gov (United States)

Akhilesh, K V; Bineesh, K K; White, W T; Pillai, N G K

2012-08-01

Biological data are presented for the pygmy ribbontail catshark Eridacnis radcliffei based on specimens collected from the by-catch of the commercial deep-sea shrimp trawl fishery operating in the Arabian Sea off the south-west coast of India. A total of 549 individuals, from 101 to 257 mm total length (L(T)) and 2·2 to 56 g, were collected. The L(T) at first maturity (L(T50)) of females and males was estimated at 183 and 170 mm, respectively, and analysis of stomach contents revealed that E. radcliffei feeds primarily on crustaceans. © 2012 The Authors. Journal of Fish Biology © 2012 The Fisheries Society of the British Isles.

NCBI nr-aa BLAST: CBRC-STRI-01-2305 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2305 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 8e-64 55% ...

NCBI nr-aa BLAST: CBRC-STRI-01-1937 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1937 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 2e-25 41% ...

Generation of competent bone marrow-derived antigen presenting cells from the deer mouse (Peromyscus maniculatus

Directory of Open Access Journals (Sweden)

Farrell Regina M

2004-09-01

Full Text Available Abstract Background Human infections with Sin Nombre virus (SNV and related New World hantaviruses often lead to hantavirus cardiopulmonary syndrome (HCPS, a sometimes fatal illness. Lungs of patients who die from HCPS exhibit cytokine-producing mononuclear infiltrates and pronounced pulmonary inflammation. Deer mice (Peromyscus maniculatus are the principal natural hosts of SNV, in which the virus establishes life-long persistence without conspicuous pathology. Little is known about the mechanisms SNV employs to evade the immune response of deer mice, and experimental examination of this question has been difficult because of a lack of methodologies for examining such responses during infection. One such deficiency is our inability to characterize T cell responses because susceptible syngeneic deer mice are not available. Results To solve this problem, we have developed an in vitro method of expanding and generating competent antigen presenting cells (APC from deer mouse bone marrow using commercially-available house mouse (Mus musculus granulocyte-macrophage colony stimulating factor. These cells are capable of processing and presenting soluble protein to antigen-specific autologous helper T cells in vitro. Inclusion of antigen-specific deer mouse antibody augments T cell stimulation, presumably through Fc receptor-mediated endocytosis. Conclusions The use of these APC has allowed us to dramatically expand deer mouse helper T cells in culture and should permit extensive characterization of T cell epitopes. Considering the evolutionary divergence between deer mice and house mice, it is probable that this method will be useful to other investigators using unconventional models of rodent-borne diseases.

X chromosome control of meiotic chromosome synapsis in mouse inter-subspecific hybrids.

Directory of Open Access Journals (Sweden)

Tanmoy Bhattacharyya

2014-02-01

Full Text Available Hybrid sterility (HS belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2(Mmm allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes.

X chromosome control of meiotic chromosome synapsis in mouse inter-subspecific hybrids.

Science.gov (United States)

Bhattacharyya, Tanmoy; Reifova, Radka; Gregorova, Sona; Simecek, Petr; Gergelits, Vaclav; Mistrik, Martin; Martincova, Iva; Pialek, Jaroslav; Forejt, Jiri

2014-02-01

Hybrid sterility (HS) belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X) harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2(Mmm) allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes.

X Chromosome Control of Meiotic Chromosome Synapsis in Mouse Inter-Subspecific Hybrids

Science.gov (United States)

Bhattacharyya, Tanmoy; Reifova, Radka; Gregorova, Sona; Simecek, Petr; Gergelits, Vaclav; Mistrik, Martin; Martincova, Iva; Pialek, Jaroslav; Forejt, Jiri

2014-01-01

Hybrid sterility (HS) belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X) harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2Mmm allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes. PMID:24516397

Detection experiments with humans implicate visual predation as a driver of colour polymorphism dynamics in pygmy grasshoppers

Science.gov (United States)

2013-01-01

Background Animal colour patterns offer good model systems for studies of biodiversity and evolution of local adaptations. An increasingly popular approach to study the role of selection for camouflage for evolutionary trajectories of animal colour patterns is to present images of prey on paper or computer screens to human ‘predators’. Yet, few attempts have been made to confirm that rates of detection by humans can predict patterns of selection and evolutionary modifications of prey colour patterns in nature. In this study, we first analyzed encounters between human ‘predators’ and images of natural black, grey and striped colour morphs of the polymorphic Tetrix subulata pygmy grasshoppers presented on background images of unburnt, intermediate or completely burnt natural habitats. Next, we compared detection rates with estimates of capture probabilities and survival of free-ranging grasshoppers, and with estimates of relative morph frequencies in natural populations. Results The proportion of grasshoppers that were detected and time to detection depended on both the colour pattern of the prey and on the type of visual background. Grasshoppers were detected more often and faster on unburnt backgrounds than on 50% and 100% burnt backgrounds. Striped prey were detected less often than grey or black prey on unburnt backgrounds; grey prey were detected more often than black or striped prey on 50% burnt backgrounds; and black prey were detected less often than grey prey on 100% burnt backgrounds. Rates of detection mirrored previously reported rates of capture by humans of free-ranging grasshoppers, as well as morph specific survival in the wild. Rates of detection were also correlated with frequencies of striped, black and grey morphs in samples of T. subulata from natural populations that occupied the three habitat types used for the detection experiment. Conclusions Our findings demonstrate that crypsis is background-dependent, and implicate visual predation

Isospin character of low-lying pygmy dipole states in 208Pb via inelastic scattering of 17O ions.

Science.gov (United States)

Crespi, F C L; Bracco, A; Nicolini, R; Mengoni, D; Pellegri, L; Lanza, E G; Leoni, S; Maj, A; Kmiecik, M; Avigo, R; Benzoni, G; Blasi, N; Boiano, C; Bottoni, S; Brambilla, S; Camera, F; Ceruti, S; Giaz, A; Million, B; Morales, A I; Vandone, V; Wieland, O; Bednarczyk, P; Ciemała, M; Grebosz, J; Krzysiek, M; Mazurek, K; Zieblinski, M; Bazzacco, D; Bellato, M; Birkenbach, B; Bortolato, D; Calore, E; Cederwall, B; Charles, L; de Angelis, G; Désesquelles, P; Eberth, J; Farnea, E; Gadea, A; Görgen, A; Gottardo, A; Isocrate, R; Jolie, J; Jungclaus, A; Karkour, N; Korten, W; Menegazzo, R; Michelagnoli, C; Molini, P; Napoli, D R; Pullia, A; Recchia, F; Reiter, P; Rosso, D; Sahin, E; Salsac, M D; Siebeck, B; Siem, S; Simpson, J; Söderström, P-A; Stezowski, O; Theisen, Ch; Ur, C; Valiente-Dobón, J J

2014-07-04

The properties of pygmy dipole states in 208Pb were investigated using the 208Pb(17O, 17O'γ) reaction at 340 MeV and measuring the γ decay with high resolution with the AGATA demonstrator array. Cross sections and angular distributions of the emitted γ rays and of the scattered particles were measured. The results are compared with (γ, γ') and (p, p') data. The data analysis with the distorted wave Born approximation approach gives a good description of the elastic scattering and of the inelastic excitation of the 2+ and 3- states. For the dipole transitions a form factor obtained by folding a microscopically calculated transition density was used for the first time. This has allowed us to extract the isoscalar component of the 1- excited states from 4 to 8 MeV.

Efficacy of drugs against Giardia muris in mice Mus musculus naturally infected/ Eficácia de drogas contra Giardia muris em camundongos Mus musculus naturalmente infectados

Directory of Open Access Journals (Sweden)

Silvia Gonzalez Monteiro

2008-08-01

Full Text Available This study aimed to evaluate the efficacy of metronidazole, fenbendazole and secnidazole against Giardia muris in mice naturally infected. Forty mice of the species Mus musculus were divided in four groups of ten each, being group A non treated, the control group and groups B, C and D treated with 4mg/ml of metronidazole, fenbendazole and secnidazole, respectively. Two feces collection, on day 0 and on day 10 after treatment, were done in order to evaluate the efficacy of the drugs. Samples were analyzed by the centrifugal-flotation method with zinc sulfate. Efficacy of 97,05% for metronidazole, 98,30% for fenbendazole and 100% for secnidazole were observed in the study. According to the results it was concluded that the tested drugs were effective for the treatment of mice parasitized by Giardia muris.Este estudo visou avaliar a eficácia do metronidazol, fenbendazole e secnidazol contra Giardia muris em camundongos naturalmente infectados. Foram utilizados 40 camundongos da espécie Mus musculus divididos em quatro grupos de 10 animais cada, sendo grupo A, grupo controle, não tratados, e grupos B, C e D tratados com 4mg/ml de metronidazol, fenbendazole e secnidazol, respectivamente. Para avaliar a eficácia dos medicamentos foram realizadas duas coletas de fezes uma no dia zero e outra 10 dias após tratamento. As amostras foram processadas e analisadas a partir do método de centrífugo-flutuação com sulfato de zinco. No estudo observou-se eficácia de 97,05% para metronidazol, 98,30% para fenbendazole e 100% para secnidazol no tratamento de giardiase murina. Com base nos resultados concluí-se que as drogas testadas apresentaram eficácia no tratamento de camundongos parasitados por Giardia muris.

NCBI nr-aa BLAST: CBRC-MMUS-06-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0131 ref|NP_444459.1| vomeronasal 1 receptor, B8 [Mus musculus] sp|Q9EQ45|VN1B8_MOUSE Vomeronas...al type-1 receptor B8 (Vomeronasal type-1 receptor A13) gb|AAG42088.1|AF291494_1 vomeronasa...l receptor V1RB8 [Mus musculus] dbj|BAB79220.1| vomeronasal receptor 1 A13 [Mus musculus] gb|AAI40252.1| Vomeronasa...l 1 receptor, B8 [synthetic construct] gb|EDK99274.1| vomeronasal ...1 receptor, B8 [Mus musculus] gb|AAI46525.1| Vomeronasal 1 receptor, B8 [synthetic construct] NP_444459.1 1e-175 100% ...

Nuclear Resonance Fluorescence off 54Cr: The Onset of the Pygmy Dipole Resonance

Science.gov (United States)

Ries, P. C.; Beck, T.; Beller, J.; Krishichayan; Gayer, U.; Isaak, J.; Löher, B.; Mertes, L.; Pai, H.; Pietralla, N.; Romig, C.; Savran, D.; Schilling, M.; Tornow, W.; Werner, V.; Zweidinger, M.

2016-06-01

Low-lying electric and magnetic dipole excitations (E1 and M1) below the neutron separation threshold, particularly the Pygmy Dipole Resonance (PDR), have drawn considerable attention in the last years. So far, mostly moderately heavy nuclei in the mass regions around A = 90 and A = 140 were examined with respect to the PDR. In the present work, the systematics of the PDR have been extended by measuring excitation strengths and parity quantum numbers of J = 1 states in lighter nuclei near A = 50 in order to gather information on the onset of the PDR. The nuclei 50,52,54Cr and 48,50Ti were examined via bremsstrahlung produced at the DArmstadt Superconducting electron Linear Accelerator (S-DALINAC) with photon energies up to 9.7 MeV with the method of nuclear resonance fluorescence. Numerous excited states were observed, many of which for the first time. The parity quantum numbers of these states have been determined at the High Intensity Gamma-ray Source (HIγS) of the Triangle Universities Nuclear Laboratory in Durham, NC, USA. Informations to the methods and the experimental setups will be provided and the results on 54Cr achieved will be discussed with respect to the onset of the PDR.

PENGARUH PEMBERIAN “KOMBUCHA” TEH ROSELLA TERHADAP PROFIL DARAH MENCIT (Mus musculus L)

OpenAIRE

Mukhani Dwi Hidayanti; Sussi Astuti; Maria Erna Kustyawati

2015-01-01

“Kombucha” rosella tea is a functional fermented beverage product solution from the petals of rosella tea and sugar using a microbial starter “Kombucha” (Acetobacter xylinum and several kind of yeast). The objective of the experiment was to determine the effect of “Kombucha” rosella tea on the blood profile of mice (Mus musculus L). The experiment compiled in a completely randomized design with 4 treatments dose “Kombucha” rosella tea was 0,73 ml/20 g BB mice (distilled water) (K), 0,36 ml...

NCBI nr-aa BLAST: CBRC-RNOR-04-0256 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0256 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0238 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0122 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0122 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-OCUN-01-1141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1141 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0259 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

Transgene mus som sygdomsmodeller

DEFF Research Database (Denmark)

Schuster, Mikkel Bruhn; Porse, Bo Torben

2003-01-01

Transgenic animal models have proven to be useful tools in understanding both basic biology and the events associated with disease. Recent technical advances in the area of genomic manipulation in combination with the availability of the human and murine genomic sequences now allow the precise...... tailoring of the mouse genome. In this review we describe a few systems in which transgenic animal models have been employed for the purpose of studying the etiology of human diseases. Udgivelsesdato: 2003-Feb-17...

Re-evaluation of the holotype of Mus ruber Jentink, 1880 (Rodentia: Muridae) from western New Guinea (Irian Jaya)

NARCIS (Netherlands)

Calaby, J.H.; Mary Taylor, J.

1980-01-01

INTRODUCTION The first rodent from the New Guinea region, now included in the genus Rattus, to be formally named, was Mus ruber Jentink, 1880. The name R. ruber is currently in widespread use (Lidicker, 1968, 1973; Lidicker & Ziegler, 1968; Misonne, 1969; Ziegler, 1971; Bulmer & Menzies, 1972, 1973;

Quelques espèces nouvelles d’hispides de Sumatra appartenant au Musée de Leyde

NARCIS (Netherlands)

Gestro, R.

1897-01-01

Sur le point d’entreprendre l’étude des Hispides recueillies à Sumatra par M. le Doct. E. Modigliani, j’ai demandé à M. Ritsema, le savant conservateur de la collection d’insectes du Musée de Leyde, la communication de quelques espèces dans le but de faciliter mon travail. Mon aimable collègue a

The genomic landscape shaped by selection on transposable elements across 18 mouse strains.

Science.gov (United States)

Nellåker, Christoffer; Keane, Thomas M; Yalcin, Binnaz; Wong, Kim; Agam, Avigail; Belgard, T Grant; Flint, Jonathan; Adams, David J; Frankel, Wayne N; Ponting, Chris P

2012-06-15

Transposable element (TE)-derived sequence dominates the landscape of mammalian genomes and can modulate gene function by dysregulating transcription and translation. Our current knowledge of TEs in laboratory mouse strains is limited primarily to those present in the C57BL/6J reference genome, with most mouse TEs being drawn from three distinct classes, namely short interspersed nuclear elements (SINEs), long interspersed nuclear elements (LINEs) and the endogenous retrovirus (ERV) superfamily. Despite their high prevalence, the different genomic and gene properties controlling whether TEs are preferentially purged from, or are retained by, genetic drift or positive selection in mammalian genomes remain poorly defined. Using whole genome sequencing data from 13 classical laboratory and 4 wild-derived mouse inbred strains, we developed a comprehensive catalogue of 103,798 polymorphic TE variants. We employ this extensive data set to characterize TE variants across the Mus lineage, and to infer neutral and selective processes that have acted over 2 million years. Our results indicate that the majority of TE variants are introduced though the male germline and that only a minority of TE variants exert detectable changes in gene expression. However, among genes with differential expression across the strains there are twice as many TE variants identified as being putative causal variants as expected. Most TE variants that cause gene expression changes appear to be purged rapidly by purifying selection. Our findings demonstrate that past TE insertions have often been highly deleterious, and help to prioritize TE variants according to their likely contribution to gene expression or phenotype variation.

The mouse hybrid zone in Central Europe: from morphology to molecules

Czech Academy of Sciences Publication Activity Database

Ďureje, Ľudovít; Macholán, Miloš; Baird, Stuart J. E.; Piálek, Jaroslav

2012-01-01

Roč. 61, 3-4 (2012), s. 308-318 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : geography * introgression * mtDNA * Mus musculus musculus * Mus musculus domesticus * X chromosome * Y chromosome Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

Burrow characteristics of the co-existing sibling species Mus booduga and Mus terricolor and the genetic basis of adaptation to hypoxic/hypercapnic stress

Directory of Open Access Journals (Sweden)

Narayan Gopeshwar

2009-04-01

Full Text Available Abstract Background The co-existing, sibling species Mus booduga and Mus terricolor show a difference in site-preference for burrows. The former build them in flat portion of the fields while the latter make burrows in earthen mounds raised for holding water in cultivated fields. In northern India which experiences great variation in climatic condition between summer and winter, M. booduga burrows have an average depth of 41 cm, as against 30 cm in southern India with less climatic fluctuation. M. terricolor burrows are about 20 cm deep everywhere. The three chromosomal species M. terricolor I, II and III have identical burrows, including location of the nest which is situated at the highest position. In contrast, in M. booduga burrows, the nest is at the lowest position. Results The nest chamber of M. booduga is located at greater depth than the nest chamber of M. terricolor. Also, in the burrows of M. booduga the exchange of air takes place only from one side (top surface in contrast to the burrows of M. terricolor where air exchange is through three sides. Hence, M. booduga lives in relatively more hypoxic and hypercapnic conditions than M. terricolor. We observed the fixation of alternative alleles in M. booduga and M. terricolor at Superoxide dismutase-1 (Sod-1, Transferrin (Trf and Hemoglobin beta chain (Hbb loci. All the three are directly or indirectly dependent on oxygen concentration for function. In addition to these, there are differences in burrow patterns and site-preference for burrows suggesting difference in probable adaptive strategy in these co-existing sibling species. Conclusion The burrow structure and depth of nest of the chromosomal species M. terricolor I, II and III are same everywhere probably due to the recency of their evolutionary divergence. Moreover, there is lack of competition for the well-adapted 'microhabitats' since they are non-overlapping in distribution. However, the co-existing sibling species M. booduga

EFEK ANTIFERTILITAS EKSTRAK AKAR SOM JAWA (Talinum paniculatum Gaertn. PADA MENCIT (Mus musculus L. JANTAN

Directory of Open Access Journals (Sweden)

Tetri Widiyani

2012-10-01

Full Text Available Talinum paniculatum Gaertn commonly is used as aphrodisiac herb. Phytosterol, saponin, flavonoid and tannin of the herb have a certain bioactivity and may affect to the body system. The objective of this research was to examine the antifertility effects of sam jawa (Talinum paniculatum Gaertn. root extract (SJRE on male mice (Mus musculus L.. Twenty male mice were divided into 4 groups randomly with 5 replications. SJRE was dissolved in aquadest and given orally everyday for 34 days. The treatment dosages were 0 (control, 100,200, and 300 mg/kg BW. At 35th day mice were sacrificed and sectioned to remove testes and epididymis spermatozoas. Testes were sectioned using paraffin method and stained using Haematoxyllin-Eosin. Spermatogenic cells in each seminiferous tubule were counted to investigated spermatogenesis activity of testes. Epididymis sperm suspension was used to investigate sperm quality i.e: morphology, velocity and motility. Quantitatives data were analized using ANOVA and continued DMRT on 5% significance level. The result showed SJRE had antifertility effects on male mice (Mus musculus L. could inhibit spermatogenesis (decrease the spermatogenic cells count and decrease the sperm quality (increase percentage of abnormal sperm, decrease sperm motility and also decrease sperm velocity.

NCBI nr-aa BLAST: CBRC-STRI-01-1973 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1973 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9E...Q46|VN1B7_MOUSE RecName: Full=Vomeronasal type-1 receptor B7; AltName: Full=Vomeronasal type-1 receptor A11 ...gb|AAG42087.1|AF291493_1 vomeronasal receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A1...1 [Mus musculus] gb|AAI41627.1| Vomeronasal 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-1277 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1277 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2495 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2495 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2240 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2240 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2627 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2627 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

AcEST: DK959903 [AcEST

Lifescience Database Archive (English)

Full Text Available 5|Q8K2E5_MOUSE Budding uninhibited by benzimidazoles 1 h... 102 3e-20 tr|Q3UZD6|Q...3UZD6_MOUSE Putative uncharacterized protein OS=Mus m... 102 3e-20 tr|A2ARS1|A2ARS1_MOUSE Budding uninhibited by benzimidazoles

GAMBARAN HEMATOLOGI MENCIT (Mus musculus MODEL TOKSISITAS SUBKRONIS

Directory of Open Access Journals (Sweden)

Ita Nur Eka Pujiastuti

2017-06-01

Full Text Available Garlic commonly is consumed as medicine to prevent or heal illness or to maintain someone's health. Many societies prefer garlic (Allium sativum among other herbal remedies for cholesterol treatment. It consists of several types, and one of them is single bulb garlic used to treat hypertension. There has been, however, no published research reporting the toxicological properties of single bulb garlic. The purpose of this study was to determine subchronic toxic effects of single bulb garlic administered to mice using hematological parameters. The experiment parameters were hemoglobin and hematocrit levels, the number of erythrocytes and leukocytes. Male mice (Mus musculus strain Balb-C were treated with single bulb garlic extract for 28 days with dosage levels of 0% (N , 0.25% (P1 , 0.5% (P2 , 1% (P3 , and 2% (P4 . Single bulb garlic showed no effect on hemoglobin and hematocrit levels but increased the number of erythrocyte and leucocyte. We concluded that single bulb garlic did not cause subchronic toxic effects.

NCBI nr-aa BLAST: CBRC-PABE-21-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-21-0006 sp|P97714|ADA1D_MOUSE Alpha-1D adrenergic receptor (Alpha 1D-adre...noceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic receptor) gb|AAB47042.1| alpha 1d-adrenergic recept...or [Mus sp.] dbj|BAA90312.1| alpha 1D adrenergic receptor [Mus musculus] P97714 0.0 78% ...

AcEST: DK955384 [AcEST

Lifescience Database Archive (English)

Full Text Available >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...OUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 5...XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score = 5

AcEST: DK953370 [AcEST

Lifescience Database Archive (English)

Full Text Available PS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Scor...NA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Leng...FDPEIPQTLRLEFAKANTK 104 >sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms

AcEST: BP913064 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE Experimental autoimmune prostatitis antige... 31 5.2 sp|Q9NVV0|TM38B_HUMAN...|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis antigen 2 OS=Mus musculus GN=Eapa2 PE=2 SV=1 Length

Polymorphism in hybrid male sterility in wild-derived Mus musculus musculus strains on proximal chromosome 17.

Science.gov (United States)

Vyskocilová, Martina; Prazanová, Gabriela; Piálek, Jaroslav

2009-02-01

The hybrid sterility-1 (Hst1) locus at Chr 17 causes male sterility in crosses between the house mouse subspecies Mus musculus domesticus (Mmd) and M. m. musculus (Mmm). This locus has been defined by its polymorphic variants in two laboratory strains (Mmd genome) when mated to PWD/Ph mice (Mmm genome): C57BL/10 (carrying the sterile allele) and C3H (fertile allele). The occurrence of sterile and/or fertile (wild Mmm x C57BL)F1 males is evidence that polymorphism for this trait also exists in natural populations of Mmm; however, the nature of this polymorphism remains unclear. Therefore, we derived two wild-origin Mmm strains, STUS and STUF, that produce sterile and fertile males, respectively, in crosses with C57BL mice. To determine the genetic basis underlying male fertility, the (STUS x STUF)F1 females were mated to C57BL/10 J males. About one-third of resulting hybrid males (33.8%) had a significantly smaller epididymis and testes than parental animals and lacked spermatozoa due to meiotic arrest. A further one-fifth of males (20.3%) also had anomalous reproductive traits but produced some spermatozoa. The remaining fertile males (45.9%) displayed no deviation from values found in parental individuals. QTL analysis of the progeny revealed strong associations of male fitness components with the proximal end of Chr 17, and a significant effect of the central section of Chr X on testes mass. The data suggest that genetic incompatibilities associated with male sterility have evolved independently at the proximal end of Chr 17 and are polymorphic within both Mmd and Mmm genomes.

Transformative Poetry : A Case Study of W.H. Auden's Musée des Beaux Arts And General Conclusions

NARCIS (Netherlands)

Sarot, Marcel

2016-01-01

This article situates Auden’s poem Musée des Beaux Arts in the process of his conversion to Christianity. The author argues for the layered intertextuality of the poem, in which allusions to Bruegel’s Landscape with the Fall of Icarus, The Census at Jerusalem, and The Massacre of the Innocents can

La stratégie numérique du musée de la Civilisation

OpenAIRE

Baz, Ana-Laura

2016-01-01

Après une description des orientations déployées dans la mise en œuvre de la stratégie numérique du musée de la Civilisation à Québec, l’auteur dresse un premier bilan de l’opération, de ses succès et de ses échecs, constatant que beaucoup reste à faire pour mesurer les retombées de cette stratégie sur la participation citoyenne et le comportement des internautes.

Corrected placement of Mus-Rattus fossil calibration forces precision in the molecular tree of rodents

OpenAIRE

Kimura, Yuri; Hawkins, Melissa T. R.; McDonough, Molly M.; Jacobs, Louis L.; Flynn, Lawrence J.

2015-01-01

Time calibration derived from the fossil record is essential for molecular phylogenetic and evolutionary studies. Fossil mice and rats, discovered in the Siwalik Group of Pakistan, have served as one of the best-known fossil calibration points in molecular phylogenic studies. Although these fossils have been widely used as the 12 Ma date for the Mus/Rattus split or a more basal split, conclusive paleontological evidence for the nodal assignments has been absent. This study analyzes newly reco...

The effect of electron beam radiations on testicular damage in mice, Mus musculus

International Nuclear Information System (INIS)

Vikram, S.; Nair, Vijay Mala Grover

2013-01-01

Adult male Swiss albino mice, Mus musculus (8-10 weeks old) weighing 28±2.5 gm were exposed to varying doses (2-12 Gy) of electron beam radiations and maintained in animal house at 26-28 C. The animals were sacrificed following 35 and 60 days following exposure to electron beam radiations. The LD-50 value, change in the weight and histological details of the testis, sperm count, sperm shape abnormalities and sperm motility were recorded. The data suggests that electron beam radiations is a potential inducer to cause reproductive system dysfunctions which probably may be responsible leading to infertility. (author)

The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

International Nuclear Information System (INIS)

Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E.

2000-03-01

The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied (α=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

Energy Technology Data Exchange (ETDEWEB)

Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E

2000-03-01

The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied ({alpha}=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

Several classical mouse inbred strains, including DBA/2, NOD/Lt, FVB/N, and SJL/J, carry a putative loss-of-function allele of Gpr84.

Science.gov (United States)

Perez, Carlos J; Dumas, Aline; Vallières, Luc; Guénet, Jean-Louis; Benavides, Fernando

2013-01-01

G protein-coupled receptor 84 (GPR84) is a 7-transmembrane protein expressed on myeloid cells that can bind to medium-chain free fatty acids in vitro. Here, we report the discovery of a 2-bp frameshift deletion in the second exon of the Gpr84 gene in several classical mouse inbred strains. This deletion generates a premature stop codon predicted to result in a truncated protein lacking the transmembrane domains 4-7. We sequenced Gpr84 exon 2 from 58 strains representing different groups in the mouse family tree and found that 14 strains are homozygous for the deletion. Some of these strains are DBA/1J, DBA/2J, FVB/NJ, LG/J, MRL/MpJ, NOD/LtJ, and SJL/J. However, the deletion was not found in any of the wild-derived inbred strains analyzed. Haplotype analysis suggested that the deletion originates from a unique mutation event that occurred more than 100 years ago, preceding the development of the first inbred strain (DBA), from a Mus musculus domesticus source. As GPR84 ostensibly plays a role in the biology of myeloid cells, it could be relevant 1) to consider the existence of this Gpr84 nonsense mutation in several mouse strains when choosing a mouse model to study immune processes and 2) to consider reevaluating data obtained using such strains.

Methylation patterns of repetitive DNA sequences in germ cells of Mus musculus.

Science.gov (United States)

Sanford, J; Forrester, L; Chapman, V; Chandley, A; Hastie, N

1984-03-26

The major and the minor satellite sequences of Mus musculus were undermethylated in both sperm and oocyte DNAs relative to the amount of undermethylation observed in adult somatic tissue DNA. This hypomethylation was specific for satellite sequences in sperm DNA. Dispersed repetitive and low copy sequences show a high degree of methylation in sperm DNA; however, a dispersed repetitive sequence was undermethylated in oocyte DNA. This finding suggests a difference in the amount of total genomic DNA methylation between sperm and oocyte DNA. The methylation levels of the minor satellite sequences did not change during spermiogenesis, and were not associated with the onset of meiosis or a specific stage in sperm development.

NCBI nr-aa BLAST: CBRC-OCUN-01-0928 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0928 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 1e-81 52% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0428 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 2e-82 51% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 7e-78 52% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0143 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0143 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 4e-85 55% ...

Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš; Baird, S. J. E.; Munclinger, P.; Dufková, Petra; Bímová, Barbora; Piálek, Jaroslav

2008-01-01

Roč. 8, - (2008), s. 271-284 ISSN 1471-2148 R&D Projects: GA ČR GA206/06/0707; GA ČR GA206/06/0955; GA AV ČR IAA600930506; GA ČR GA206/08/0640 Grant - others:GA ČR(CZ) GP206/03/D148 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z60930519 Keywords : Mus musculus musculus * Mus musculus domesticus Subject RIV: EG - Zoology Impact factor: 4.050, year: 2008

A new chromosomal race of the house mouse, Mus musculus domesticus, in the Vulcano Island-Aeolian Archipelago, Italy.

Science.gov (United States)

Solano, Emanuela; Castiglia, Riccardo; Corti, Marco

2007-07-01

In this paper we describe a new Robertsonian (Rb) race of the house mouse from Vulcano (Aeolian archipelago) through the identification of the metacentric chromosomes. We analysed fifteen mice. All the specimens were found to have the same karyotype 2n=26. This karyotype is characterized by Rb(1.2), Rb(3.9), Rb(4.13), Rb(5.14), Rb(8.12), Rb(10.16) and Rb(15.17). The differences between the race of Vulcano and the races in a neighbour island (Lipari) consist in the presence of Rb(10.16) and Rb(15.17) in the former and Rb(6.16) and Rb(10.15) in the latter. We discuss the possible hypotheses regarding the origin between these two races including the possible occurrence of a whole arm reciprocal translocation (WART) on the Vulcano island.

A geometric morphometric analysis of the shape of the first upper molar in mice of the genus Mus (Muridae, Rodentia)

Czech Academy of Sciences Publication Activity Database

Macholán, Miloš

2006-01-01

Roč. 270, č. 4 (2006), s. 672-681 ISSN 0952-8369 R&D Projects: GA AV ČR IAA6045307 Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus * geometric morphometrics * thin-plate spline Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.413, year: 2006

Aspects of the life history of Muspicea borreli (Nematoda: Muspiceidae, parasite of the house mouse (Mus domesticus in Australia

Directory of Open Access Journals (Sweden)

Spratt D.M.

2002-09-01

Full Text Available Prevalence of Muspicea borreli (Nematoda infection in wild populations of Mus domesticus in forests in southeastern New South Wales and in rural Canberra, Australia was variable, relatively low and the parasite occurred predominantly in male mice. Experimental infection of BALB/c mice occurred only via subcutaneous inoculation but was achieved using i adults containing embryonating eggs, ii adults containing active larvae and iii active larvae dissected from the uterus of female worms. Experimental infection was not established using adults containing unembryonated eggs and was not established via intraperitoneal, percutaneous nor oral routes. Evidence indicates that larvae develop to the infective stage in the uterus of the adult worm, suggests that an obligate developmental phase on the host skin does not occur and that autoinfection is possible. Experimental infection predominated in males; females rarely became infected. When male BALB/c mice were inoculated subcutaneously with M. borreli, immediately paired with an uninoculated female and permitted to breed for 90 days, infection was found in male and female offspring only of the second and subsequent litters or in the breeding female partner. Transmission to the young occurred within 21 days of birth and fifth-stage M. borreli were found in offspring of the second and subsequent litters only after 35 or more days. However, when a male was inoculated but mating delayed for 23 days, infection was found in progeny of the first and second litters. The life cycle is direct and the prepatent period in BALB/c mice is estimated at 50-60 days. The precise mode of transmission of the parasite in breeding pairs of mice was not determined but larvae remained active for approximately an hour in balanced saline solutions (pH = 7.2 and in human saliva but died under conditions emulating free-living (tap water pH = 7.1 and stomach (pepsin solution pH = 2 environments. Transmission was not effected by

NCBI nr-aa BLAST: CBRC-PTRO-04-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-04-0004 sp|Q8VBS7|VN1A6_MOUSE Vomeronasal type-1 receptor A6 (Vomeronasal... type-1 receptor A3) (Vomeronasal type-1 receptor A1) (Vomeronasal type-1 receptor A10) dbj|BAB79209.1| vomeronasa...l receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasal receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasa

AcEST: DK950692 [AcEST

Lifescience Database Archive (English)

Full Text Available |Q8VC52|RBPS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length ...ultiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Length = 197 Score = 77.0 bits (188), Expect = 8e-14 Ide...S_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score =

AcEST: DK958175 [AcEST

Lifescience Database Archive (English)

Full Text Available USE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 36...>sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Lengt... EEVRTLFVSGLPIDIKPRELYLLFRPFKGYE 47 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms

Trends and tactics of mouse predation on Tristan Albatross Diomedea dabbenena chicks at Gough Island, South Atlantic Ocean

Directory of Open Access Journals (Sweden)

Delia Davies

2015-06-01

Full Text Available The critically endangered Tristan Albatross Diomedea dabbenena breeds almost exclusively on Gough Island, in the central South Atlantic, where breeding success is much lower than other great albatrosses (Diomedea spp. worldwide. Most breeding failures occur during the chick-rearing stage, when other great albatrosses suffer few failures. This unusual pattern of breeding failure is assumed to be largely due to predation by introduced house mice Mus musculus, but there have been few direct observations of mouse attacks. We closely monitored the fates of 20 chicks in the Gonydale study colony (123 chicks in 2014 using motion-activated cameras to determine the causes of chick mortality. Only 5 of 20 chicks survived to fledge, and of the 15 failures, 14 (93% were due to mouse predation. One mouse-wounded chick was killed by a Southern Giant Petrel Macronectes giganteus; the rest died outright from their wounds within 3.9 ± 1.2 days of the first attack. Despite this high impact, most chicks were attacked by only 1-2 mice at once (maximum 9. The remaining 103 chicks in the study colony were checked less frequently, but the timing of failures was broadly similar to the 20 closely monitored nests, and the presence of mouse wounds on other chicks strongly suggests that mice were responsible for most chick deaths. Breeding success in the Gonydale study colony averages 28% from 2001 to 2014; far lower than the normal range of breeding success of Diomedea species occurring on islands free from introduced predators. Island-wide breeding success fell below 10% for the first time in 2014, making it even more urgent to eradicate mice from Gough Island.

Teratogenic effect of yogurt in mice fetus (Mus musculus

Directory of Open Access Journals (Sweden)

Dwisari Dillasamola

2018-04-01

Full Text Available Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control, 0.52 yogurt (D1, 1.04  yogurt (D2, and 2.08 g yogurt (D3. Data were analyzed using one-way ANOVA followed by Duncan multiple range test. Results showed that administration of yogurt during pregnancy could affect mother body weight of mice (P 0,05. Observations with Alizarin solution did not show skeletal defects in comparison to the control group. Observations with Bouin’s solution showed defective visceral cleft palate in fetal mice yogurt group D3. This study conclude that yogurt is safe to consume in groups D1 and D2. Yogurt has the potential to cause fetal teratogenic in group D3

AcEST: BP916012 [AcEST

Lifescience Database Archive (English)

Full Text Available ne... 29 6.4 sp|P07335|KCRB_RAT Creatine kinase B-type OS=Rattus norvegicus G... 29 6.4 sp|Q04447|KCRB_MOUSE Creatine... kinase B-type OS=Mus musculus GN=C... 29 6.4 sp|P05122|KCRB_CHICK Creatine kinase B-type OS=Gallu...N=ARSH... 29 6.4 sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Sch... 29 8.3 sp|P24722|KCRT_ONCMY Creatine...6 LESGFDAQSRTKLSDLS 36 +ES +D +++ D+S Sbjct: 119 IESKYDVHTKSVTVDVS 135 >sp|P07335|KCRB_RAT Creatine...DGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPV 198 >sp|Q04447|KCRB_MOUSE Creatine kinase B-type OS=Mus musculus GN=Ckb PE

Le corps numérique des données The Digital Body of Data: the Transfer of Artefact Fact Sheets from the Museum of Man to the Musée du quai Branly

Directory of Open Access Journals (Sweden)

Tiziana Nicoletta Beltrame

2012-05-01

Full Text Available Le transfert des collections extra-européennes du musée de l’Homme au musée du quai Branly implique le déplacement des informations documentaires sur les objets. Des différentes fiches en papier (de collection ou d’inventaire, descriptive de l’objet, méthodique créées et classées au sein des départements du musée de l’Homme, on passe à la fiche informatique « TMS objets » au musée du quai Branly. L’information ne change pas simplement de place et de matière, elle est reconfigurée dans de nouvelles articulations du savoir sur les collections. L’inventaire muséal est ici conçu comme le système qui matérialise un savoir structuré. Pour pouvoir analyser ce système, il faut mettre en relation les propriétés des documents et les modalités de leur classement dans un espace créé ad hoc. La matérialité des supports, les multiples possibilités de rangements et de création de liens (la mise en relations entre rubriques de la fiche informatique agissent sur le contenu des données et ouvrent ainsi de nouvelles voies pour la construction du savoir.The transfer of extra-European collections from the Museum of Man to the Musée du quai Branly involves the displacement of documentary information on the artefacts. The various paper files (on collections or inventory, descriptive of the object, methodological created and classified within different departments of the Museum of Man are being replaced by digital files, or “TMS objects”, at the Musée du quai Branly. The information is not simply changing its location and material, it is being reconfigured within new interconnections of knowledge on the collections. The museum inventory is here conceived as the system that materialises a structured knowledge. To be able to analyse this system, it is necessary to link the documents’ properties to the methods used to classify them in an ad hoc space. The materiality of the media, the multiple possibilities for

Test of Fruit Extract Pare (Momordica charantia L.) to Quality of Ejaculated Spermatozoa Mice (Mus musculus L.)

Science.gov (United States)

Fifendy, M.; Indriati, G.

2018-04-01

Pare (Momordica charantia L.) can be used in the treatment of various diseases, such as influenza, cancer, anti-inflammatory, anti-HIV, antimitotic and antifertilitas. This study aimed to determine the effect of the herbal bitter (Momordica charantia L.) to ejaculated sperm quality mice (Mus musculus L.). This research was conducted using Completely Randomized Design (CRD) with 4 treatments and 6 replications, water and fed adlibitum. First treatment is given solvent extract. Second treatments extract were given 0.2 gram, third treatment were given 0.4 gram of extracts and fourth treatment were treated exstrac 0.6 gram were orally for 30 days. After the mice decapitated, dissected and take sperm from vas deferens. Then, the sperm preparation determined using the improved Neubauer. Data were analyzed by ANOVA (Analysis of Varians). The results shoured at doses of 0,2 gram, the average sperm count was 19.89. decrease significant when compared with the control in which the average number of sperm 29.13. So with this research the effective doses to decrease sperm count and can be used as a contraception medication dosage was 0,2 gram. It can be conclude that the extract of bitter (Momordica charantia L.) can decrease the quality of the ejaculated sperm of mice (Mus musculus L.)

Mus musculus bone fluoride concentration as a useful biomarker for risk assessment of skeletal fluorosis in volcanic areas.

Science.gov (United States)

Linhares, Diana; Camarinho, Ricardo; Garcia, Patrícia Ventura; Rodrigues, Armindo Dos Santos

2018-08-01

Fluoride is often found in elevated concentrations in volcanic areas due to the release of magmatic fluorine as hydrogen fluorine through volcanic degassing. The exposure to high levels of fluoride can affect the processes of bone formation and resorption causing skeletal fluorosis, a pathology that can easily be mistaken for other skeletal diseases. In this study, we aimed to determine if fluoride concentration in the femoral bone of wild populations of the house mouse (Mus musculus) is a good biomarker of exposure to active volcanic environments naturally enriched in fluoride, allowing their use in biomonitoring programs. The fluoride concentration of the whole femoral bone of 9 mice from Furnas (5 males and 4 females) and 33 mice from Rabo de Peixe (16 males and 17 females) was measured by the potentiometric method with a fluoride ion selective electrode. Fluoride in bones was significantly higher in the mice from Furnas when compared with the mice from Rabo de Peixe (616.5 ± 129.3 μg F/g vs. 253.8 ± 10.5 μg F/g). Accumulation rates were also significantly higher in the mice collected in Furnas when compared with Rabo de Peixe individuals (3.84 ± 0.52 μg F/day vs. 1.22 ± 0.06 μg F/day). The results demonstrate a significant association between exposure to fluoride in the active volcanic environment and fluoride content in bone, revealing that bone fluoride concentration is a suitable biomarker of chronic environmental exposure to fluoride. Copyright © 2018 Elsevier Ltd. All rights reserved.

Mottled Neuherberg (Mo sup(N)), a new male-lethal coat colour mutation of the house mouse (Mus musculus)

International Nuclear Information System (INIS)

Schroeder, J.H.

1975-01-01

A new semidominant X-chromosomal mutation, Mottled Neuherberg (Mo sup(N)), which causes coat colour variegation is described. Mo sup(N) arose in the second postirradiation generation after 2 x 200 R of X-rays (24 hours apart) to oocytes of X/O mice. Heterozygous Mo sup(N) females have irregular patches of fully and lightly coloured fur over the whole coat with curly vibrissae. Their viability is reduced, about 3% of the heterozygotes dying prenatally and 6 to 28% dying postnatally before weaning. Survivors are fertile without externally visible abnormalities. Hemizygous Mo sup(N) males die in utero after implantation. The recombination frequency between Mo sup(N) and tabby (Ta) was 3.65 +- 3.16% (with 95% -confidence limits). Therefore, it is suggested that Mo sup(N) is a new allele of the mottled (Mo) locus of the house mouse. Mo sup(N)-bearing ova seem to have a lower chance of becoming fertilized by wild-type spermatozoa than by Ta-bearing spermatozoa. (orig.) [de

AcEST: DK950341 [AcEST

Lifescience Database Archive (English)

Full Text Available FSCB_MOUSE Fibrous sheath CABYR-binding protein OS=Mus... 33 1.3 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin... OS=... 33 1.7 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.7 s

AcEST: DK944957 [AcEST

Lifescience Database Archive (English)

Full Text Available ant alignments: (bits) Value sp|Q82Y15|ORN_NITEU Oligoribonuclease OS=Nitrosomonas europaea G... 31 1.7 sp|Q9JLC8|SACS_MOUSE Sacsi...LVVTDAQLNTLAEAPVLVVHQPDDI 54 >sp|Q9JLC8|SACS_MOUSE Sacsin OS=Mus musculus GN=Sacs PE=1 SV=2 Length = 4582 Sc

Transformative Poetry. A Case Study of W. H. Auden’s Musée Des Beaux Arts and General Conclusions

Directory of Open Access Journals (Sweden)

Sarot Marcel

2016-10-01

Full Text Available This article situates Auden’s poem Musée des Beaux Arts in the process of his conversion to Christianity. The author argues for the layered intertextuality of the poem, in which allusions to Bruegel’s Landscape with the Fall of Icarus, The Census at Jerusalem, and The Massacre of the Innocents can be recognised. Moreover, Philippe de Champaigne’s Presentation in the Temple and Peter Paul Rubens’s The Martyrdom of St Livinus (in the same museum in Brussels seem also to have influenced the poem. Finally, there is reason to suppose that John Singer Sargent’s Crashed Aeroplane influenced Auden. In an analysis of the structure of the poem, the author argues that there is a clear structure hidden under the surface of day-to-day language. He connects this hidden structure with Auden’s poem The Hidden Law, and suggests that Auden wished to claim that even though we cannot understand suffering, it has a hidden meaning known only to God. This hidden meaning connects our suffering with the self-emptying of Christ, a connection which the author demonstrates is in fact also made in Musée des Beaux Arts.

AcEST: DK956743 [AcEST

Lifescience Database Archive (English)

Full Text Available p|A1EGX6|FSCB_MOUSE Fibrous sheath CABYR-binding protein OS=Mus... 33 1.0 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synovioli...n OS=... 33 1.3 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=...

AcEST: DK957523 [AcEST

Lifescience Database Archive (English)

Full Text Available th CABYR-binding protein OS=Mus... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=...... 33 1.4 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Den

UniProt search blastx result: AK288448 [KOME

Lifescience Database Archive (English)

Full Text Available AK288448 J090034N14 P48545|IRK5_MOUSE G protein-activated inward rectifier potassiu...m channel 4 (GIRK4) (Potassium channel, inwardly rectifying subfamily J member 5) (Inward rectifier K(+) cha...nnel Kir3.4) (Heart KATP channel) (KATP-1) (Cardiac inward rectifier) (CIR) - Mus musculus (Mouse) 0 ...

Evolution of pygmy angelfishes: Recent divergences, introgression, and the usefulness of color in taxonomy

KAUST Repository

Gaither, Michelle R.

2014-05-01

The pygmy angelfishes (genus Centropyge, family Pomacanthidae) are brightly colored species that occupy reef habitats in every tropical ocean. Some species are rarely observed because they occur below conventional scuba depths. Their striking coloration can command thousands of U.S. dollars in the aquarium trade, and closely related species are often distinguished only by coloration. These factors have impeded phylogenetic resolution, and every phylogeographic survey to date has reported discordance between coloration, taxonomy, and genetic partitions. Here we report a phylogenetic survey of 29 of the 34 recognized species (N= 94 plus 23 outgroups), based on two mtDNA and three nuclear loci, totaling 2272. bp. The resulting ML and Baysian trees are highly concordant and indicate that the genus Centropyge is paraphyletic, consistent with a previous analysis of the family Pomacanthidae. Two recognized genera (Apolemichthys and Genicanthus) nest within Centropyge, and two subgenera (Xiphypops and Paracentropyge) comprise monophyletic lineages that should be elevated to genus level. Based on an age estimate of 38. Ma for the family Pomacanthidae, Centropyge diverged from the closest extant genus Pygoplites about 33. Ma, three deep lineages within Centropyge diverged about 18-28. Ma, and four species complexes diverged 3-12. Ma. However, in 11 of 13 cases, putative species in these complexes are indistinguishable based on morphology and genetics, being defined solely by coloration. These cases indicate either emerging species or excessive taxonomic splitting based on brightly colored variants. © 2014 Elsevier Inc.

Embryo quality of mice (“Mus musculus” fed royal jelly Qualidade embrionária de camundongos ("Mus musculus" suplementados com geléia real

Directory of Open Access Journals (Sweden)

Bruno Edésio dos Santos Melo

2009-03-01

Full Text Available The study was carried out to verify the effect of feeding royal jelly associated to follicle growth induction on number and quality of mice (Mus musculus embryos. Sixty Swiss females ageing from eight to ten weeks were distributed into three treatments: the first one, composed by animals fed 0.2 mL of physiological solution intraperitoneal (control group, n=20; the second and third ones, composed by females fed 0.5 and 1.0 mg of royal jelly diluted in 0.2 mL of physiological solution (n=20, respectively. Royal jelly was administered during 15 days, followed by the follicular growth induction process. Embryos were collected 68 hours after mating, by uterine flushing. No treatment effects on the number of females that answered to superovulatory process, the number of total recovery structures, the number of viable and non viable structures and the morphological quality of viable embryos (P>0.05 were observed. Therefore, royal jelly doses used were not efficient to increase the number of embryos and to improve the quality recovery from superovulated mice.Objetivou-se verificar a influência da geléia real, associada ao tratamento de indução de crescimento folicular, no número e na qualidade de embriões de camundongos (Mus musculus. Foram utilizadas 60 fêmeas da linhagem Suíço albino com idade entre oito e dez semanas, distribuídas em três tratamentos: o primeiro, composto por animais que receberam 0,2 mL de solução fisiológica, via intraperitonial (grupo controle, n=20; o segundo e terceiro, compostos de fêmeas que receberam 0,5 e 1 mg de geléia real diluídos em 0,2 mL de solução fisiológica via intraperitonial (n=20, respectivamente. Foi administrada geléia real por um período de 15 dias, segundo o processo de indução do crescimento folicular. As coletas dos embriões ocorreram 68 horas após a cobertura, utilizando-se o método da lavagem uterina. Não houve diferença no número de fêmeas que responderam ao tratamento

AcEST: DK951433 [AcEST

Lifescience Database Archive (English)

Full Text Available 6e-22 sp|Q9LM18|FB303_ARATH F-box protein At1g22220 OS=Arabidopsis tha... 100 1e-20 sp|O35902|DSG3_MOUSE Desmog...VGDCMYGEAVVALLKCKKNALEMNSF 314 >sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 Length =

denV gene of bacteriophage T4 restores DNA excision repair to mei-9 and mus201 mutants of Drosophila melanogaster

International Nuclear Information System (INIS)

Banga, S.S.; Boyd, J.B.; Valerie, K.; Harris, P.V.; Kurz, E.M.; de Riel, J.K.

1989-01-01

The denV gene of bacteriophage T4 was fused to a Drosophila hsp70 (70-kDa heat shock protein) promoter and introduced into the germ line of Drosophila by P-element-mediated transformation. The protein product of that gene (endonuclease V) was detected in extracts of heat-shocked transformants with both enzymological and immunoblotting procedures. That protein restores both excision repair and UV resistance to mei-9 and mus201 mutants of this organism. These results reveal that the denV gene can compensate for excision-repair defects in two very different eukayotic mutants, in that the mus201 mutants are typical of excision-deficient mutants in other organisms, whereas the mei-9 mutants exhibit a broad pleiotropism that includes a strong meiotic deficiency. This study permits an extension of the molecular analysis of DNA repair to the germ line of higher eukaryotes. It also provides a model system for future investigations of other well-characterized microbial repair genes on DNA damage in the germ line of this metazoan organism

[Musical Inactivity - A Risk Factor? A Short Questionnaire to Assess Musical Activity (MusA)].

Science.gov (United States)

Fernholz, Isabel; Menzel, Juliane; Jabusch, Hans-Christian; Gembris, Heiner; Fischer, Felix; Kendel, Friederike; Kreutz, Gunter; Schmidt, Alexander; Willich, Stefan N; Weikert, Cornelia

2018-02-27

There is only a limited number of studies on associations between musical activity and health issues. It seems that musical activity has physiological and psychological benefits, as well as effects on the mental capacity, but this has been studied only in a few clinical and epidemiological studies. One reason might be that no appropriate survey instrument assessing musical activity is available. Here we provide an overview of survey instruments that assess musicality and musical activity. One focus is the presentation of a newly developed German questionnaire (MusA), which assesses musical activity (active music making and music reception) and was specifically developed for the "German National Cohort", a German health study. Through literature research, questionnaires were identified that assess musicality and / or musical activity. A new German questionnaire was developed from a panel of experts and tested in a small study (n=121, women and men age 18-70 years). In the literature research, 3 questionnaires were identified which focus on musicality and musical activity with different aspects (Gold-MSI, MUSE, MEQ). All 3 instruments may be characterized as large psychometric scales, which especially assess aspects of musicality in the English language. The Gold-MSI is additionally available in German. None of the existing questionnaires covers musical activities in detail. A new short German questionnaire consisting of 9 questions with a maximum filling time of 3-5 min has been developed. There are few questionnaires available for assessing musicality and musical activity with different aspects. The newly developed MusA in the German language focuses on the assessment of musical activity and is intended to be used in larger, population-based as well as clinical studies, to examine music activities and listening to music as independent factors in connection with prevention and therapy of chronic diseases. © Georg Thieme Verlag KG Stuttgart · New York.

Mouse consomic strains: Exploiting genetic divergence between Mus m. musculus and Mus m. domesticus subspecies

Czech Academy of Sciences Publication Activity Database

Gregorová, Soňa; Divina, Petr; Storchová, Radka; Trachtulec, Zdeněk; Fotopulosová, Vladana; Svenson, K.L.; Donahue, K.L.; Paigen, B.; Forejt, Jiří

2008-01-01

Roč. 18, č. 3 (2008), s. 509-515 ISSN 1088-9051 R&D Projects: GA MŠk(CZ) 1M0520; GA ČR(CZ) GA301/07/1264 Grant - others:HHMI(US) HHMI55000306; NIH(US) 1R01HG00318; EC(XE) AnEUploidy 037627 Institutional research plan: CEZ:AV0Z50520514 Keywords : complex trait loci (QTLs) * chromosome substitution strains * PWD/Ph Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 10.176, year: 2008

NCBI nr-aa BLAST: CBRC-STRI-01-2691 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2691 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-74 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2568 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2568 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-49 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2291 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2291 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-79 50% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0474 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0474 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-81 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0722 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0722 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-65 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2741 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2741 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-83 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2574 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2574 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 2e-85 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0161 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0161 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 3e-84 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2502 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2502 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-70 49% ...

The loss of imprinted DNA methylation in mouse blastocysts is inflicted to a similar extent by in vitro follicle culture and ovulation induction.

Science.gov (United States)

Saenz-de-Juano, M D; Billooye, K; Smitz, J; Anckaert, E

2016-06-01

Does in vitro follicle culture (IFC) have an effect on maintenance of imprinted DNA methylation in preimplantation mouse embryos? We report similar alterations in the methylation pattern of H19 imprinted maternally expressed transcript (H19), small nuclear ribonucleoprotein polypeptide N (Snrpn) and mesoderm specific transcript (Mest) imprinted genes in mouse blastocysts obtained after ovulation induction and IFC. Furthermore, we observed no differences in the gene expression of maternal effect proteins related with imprinting maintenance between superovulated in vivo grown or IFC oocytes. Assisted reproductive technology is associated with adverse post-natal outcomes such as increased risk of premature birth, altered birthweight, congenital anomalies and genomic imprinting syndromes in human and in animal models. Previous studies have shown that ovulation induction allowed normal imprinting establishment in mouse oocytes, but interfered with imprinting maintenance during preimplantation . Normal imprinting establishment was also observed in mouse oocytes derived from a standardized IFC from the early pre-antral follicle stage. The methylation profiles of differentially methylated regions (DMRs) of three key imprinted genes (H19, Snrpn and Mest) were compared at hatched blastocyst stage between embryos obtained from IFC or superovulated oocytes, each subjected to IVF and preimplantation in vitro culture (IVC); in non-manipulated in vivo produced late blastocyst (control) and in in vivo produced 2-cell embryos that were in vitro cultured until the hatched blastocyst stage (to assess the effect of IVC). Two different mice strains (Mus musculus C57BL/6J X CBA/Ca and Mus musculus B6 (CAST7)) were used to discriminate between maternal and paternal alleles of imprinted genes. Additionally, a limiting-dilution bisulfite-sequencing technique was carried out on individual embryos in order to avoid amplification bias. To assess whether IFC and ovulation induction

Two Predicted Transmembrane Domains Exclude Very Long Chain Fatty acyl-CoAs from the Active Site of Mouse Wax Synthase.

Directory of Open Access Journals (Sweden)

Steffen Kawelke

Full Text Available Wax esters are used as coatings or storage lipids in all kingdoms of life. They are synthesized from a fatty alcohol and an acyl-CoA by wax synthases. In order to get insights into the structure-function relationships of a wax synthase from Mus musculus, a domain swap experiment between the mouse acyl-CoA:wax alcohol acyltransferase (AWAT2 and the homologous mouse acyl-CoA:diacylglycerol O-acyltransferase 2 (DGAT2 was performed. This showed that the substrate specificity of AWAT2 is partially determined by two predicted transmembrane domains near the amino terminus of AWAT2. Upon exchange of the two domains for the respective part of DGAT2, the resulting chimeric enzyme was capable of incorporating up to 20% of very long acyl chains in the wax esters upon expression in S. cerevisiae strain H1246. The amount of very long acyl chains in wax esters synthesized by wild type AWAT2 was negligible. The effect was narrowed down to a single amino acid position within one of the predicted membrane domains, the AWAT2 N36R variant. Taken together, we provide first evidence that two predicted transmembrane domains in AWAT2 are involved in determining its acyl chain length specificity.

INFRARED SPECTROSCOPY OF SYMBIOTIC STARS. XI. ORBITS FOR SOUTHERN S-TYPE SYSTEMS: HEN 3-461, SY MUS, HEN 3-828, AND AR PAV

International Nuclear Information System (INIS)

Fekel, Francis C.; Hinkle, Kenneth H.; Joyce, Richard R.; Wood, Peter R.

2017-01-01

Employing new infrared radial velocities, we have computed spectroscopic orbits of the cool giants in four southern S-type symbiotic systems. The orbits for two of the systems, Hen 3-461 and Hen 3-828, have been determined for the first time, while orbits of the other two, SY Mus and AR Pav, have previously been determined. For the latter two systems, we compare our results with those in the literature. The low mass of the secondary of SY Mus suggests that it has gone through a common envelope phase. Hen 3-461 has an orbital period of 2271 days, one of the longest currently known for S-type symbiotic systems. That period is very different from the orbital period proposed previously from its photometric variations. The other three binaries have periods between 600 and 700 day, values that are typical for S-type symbiotic orbits. Basic properties of the M giant components and the distance to each system are determined.

NCBI nr-aa BLAST: CBRC-RNOR-08-0336 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-08-0336 ref|NP_666341.1| dynein cytoplasmic 1 light intermediate chain 1 ...[Mus musculus] sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 (Dynein light intermedia...te chain 1, cytosolic) (Dynein light chain A) (DLC-A) gb|AAH23347.1| Dynein cytoplasmic 1 light intermediat...b|EDL09299.1| dynein cytoplasmic 1 light intermediate chain 1 [Mus musculus] NP_666341.1 1e-137 63% ...

The Effect of Curry Leaves (Murayya Koenigii L. on Blood Glucose Levels In Alloxan Diabetic Mice (Mus Musculus

Directory of Open Access Journals (Sweden)

Fauziah Fauziah

2014-07-01

Full Text Available This study was conducted to determine the effect of ethanol extract of curry leaves (Murraya koenigii L. on blood glucose levels in alloxan diabetic mice (Mus musculus. The diabetic conditions were made by giving alloxan 75 mg/kg body weight (BW and the hypoglycemic effects of extract of curry leaves given with various doses.   This study used 24 male mice strain Balb/c in four groups of treatment with six replications, namely the negative control group, the ethanol extract of curry leaf tree 50% mL/10g body weight group, 70% mL/10g body weight group and 90% mL/10g body weight group. The treatment was given orally by using a gastric sonde for 14 days. Blood samples were taken through the sinus caudalis using a scissors. Blood glucose level was measured at 1st , the 8th and the 24th of treatment using blood glucose test strips and Nesco® Multicheck apparatus. Blood glucose data were analyzed by one way ANOVA (Analysis of Variants and followed by Tuckey test at significance level of 5%. The result showed that treatment of ethanol extract of curry leaves (Murraya koenigii at various doses significantly affected the decrease on blood glucose levels of mice (Mus musculus alloxan diabetic.

PRDM9 drives evolutionary erosion of hotspots in Mus musculus through haplotype-specific initiation of meiotic recombination.

Science.gov (United States)

Baker, Christopher L; Kajita, Shimpei; Walker, Michael; Saxl, Ruth L; Raghupathy, Narayanan; Choi, Kwangbom; Petkov, Petko M; Paigen, Kenneth

2015-01-01

Meiotic recombination generates new genetic variation and assures the proper segregation of chromosomes in gametes. PRDM9, a zinc finger protein with histone methyltransferase activity, initiates meiotic recombination by binding DNA at recombination hotspots and directing the position of DNA double-strand breaks (DSB). The DSB repair mechanism suggests that hotspots should eventually self-destruct, yet genome-wide recombination levels remain constant, a conundrum known as the hotspot paradox. To test if PRDM9 drives this evolutionary erosion, we measured activity of the Prdm9Cst allele in two Mus musculus subspecies, M.m. castaneus, in which Prdm9Cst arose, and M.m. domesticus, into which Prdm9Cst was introduced experimentally. Comparing these two strains, we find that haplotype differences at hotspots lead to qualitative and quantitative changes in PRDM9 binding and activity. Using Mus spretus as an outlier, we found most variants affecting PRDM9Cst binding arose and were fixed in M.m. castaneus, suppressing hotspot activity. Furthermore, M.m. castaneus×M.m. domesticus F1 hybrids exhibit novel hotspots, with large haplotype biases in both PRDM9 binding and chromatin modification. These novel hotspots represent sites of historic evolutionary erosion that become activated in hybrids due to crosstalk between one parent's Prdm9 allele and the opposite parent's chromosome. Together these data support a model where haplotype-specific PRDM9 binding directs biased gene conversion at hotspots, ultimately leading to hotspot erosion.

Study of the Pygmy Dipole Resonance in 124Sn by means of the (α,α'γ) reaction

International Nuclear Information System (INIS)

Endres, J.; Zilges, A.; Pietralla, N.; Savran, D.; Sonnabend, K.; Harakeh, M. N.; Stoica, V.; Woertche, H.; Butler, P.; Herzberg, R. D.; Scheck, M.; Kruecken, R.; Popescu, L.; Harissopulos, S.; Lagoyannis, A.

2009-01-01

In recent years α-γ coincidence experiments at 136 MeV incident energy on 48 Ca, 140 Ce, 138 Ba and 124 Sn were performed at the KVI in Groningen to study the isospin character of electric dipole excitations below the particle threshold, frequently called Pygmy Dipole Resonance (PDR). An array of HPGe γ-detectors has been used in coincidence with the Big-Bite Spectrometer (BBS) and a resolution of about 10 keV in the γ-ray energy has been achieved. The results show that the excitation patterns of the PDR in the (α,α') reaction seem to differ significantly from results obtained in Nuclear Resonance Fluorescence (NRF)(γ,γ') measurements. The PDR, which until now has been assigned to one excitation mode, splits up into two parts: One that is excited in (α,α'γ) and (γ,γ') reactions (denoting a dominant isoscalar character), and one that is only excited in (γ,γ')(denoting a dominant isovector character). This indicates that two different excitation mechanisms produce these low-lying E1 excitations [1], The preliminary results of the latest measurements on the N = 82 nucleus 138 Ba and the Z = 50 nucleus 124 Sn show that this break up into two parts is a common feature of the PDR in semi-magic nuclei.

Experiment list: SRX655691 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblast || ge...notype/variation=MED23 knockout || chip antibody=H2Bub http://dbarchive.bioscienc

Experiment list: SRX191071 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available Mus musculus; ChIP-Seq source_name=Kdm2b knockdown mouse ES cells || chip antibody=Flag || antibody manufact... || cell type=embryonbic stem cells || genotype=Kdm2b knockdown http://dbarchive.

Where are the wormy mice? A re-examination of hybrid parasitism in the European house mouse hybrid zone

Czech Academy of Sciences Publication Activity Database

Baird, Stuart J. E.; Ribas, Alexis; Macholán, Miloš; Albrecht, Tomáš; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

2012-01-01

Roč. 66, č. 9 (2012), s. 2757-2772 ISSN 0014-3820 R&D Projects: GA ČR GA206/08/0640 Institutional support : RVO:68081766 ; RVO:67985904 Keywords : helminths * Mus musculus domesticus * Mus musculus musculus * resistance * immune gene transitive compatibility Subject RIV: EG - Zoology Impact factor: 4.864, year: 2012

The Sycp1 loci of the mouse genome: successive retropositions of a meiotic gene during the recent evolution of the genus.

Science.gov (United States)

Sage, J; Yuan, L; Martin, L; Mattei, M G; Guénet, J L; Liu, J G; Hoög, C; Rassoulzadegan, M; Cuzin, F

1997-08-15

The murine Sycp1 gene is expressed at the early stages of meiosis. We show that it is composed of a number of small exons and localized on mouse chromosome 3. In the laboratory strains, two retrogenes were also identified. The first one (Sycp1-ps1), on chromosome 7, has accumulated point mutations and deletions and is not transcribed. A second retrogene (Sycp1-ps2), on chromosome 8, is inserted within the continuity of a moderately repeated element, in an intron of another gene (Cad11). The two retroposition events can be dated to distinct periods in the evolution of the Muridae. Sycp1-ps2 has kept features indicative of a relatively recent origin, namely a nearly intact coding region, a poly(A) tail, and 14-bp terminal repeats. Its recent origin was confirmed by the fact that it is found in all the laboratory strains of mice, but neither in a recent isolate from Mus musculus domesticus wild stocks nor in the closely related subspecies M. musculus musculus, M. m. molossinus, M. m. castaneus, and M. m. bactrianus. Appearance of the more ancient Sycp1-ps1 retrogene is concomitant with the radiation of the genus. It is present in various Mus species (M. spretus, M. spicilegus, M. macedonicus, and M. cookii), but neither in the rat nor in the more closely related Pyromis genus. Transposition of retrotranscripts during meiosis and their hereditary establishment thus appear to occur relatively frequently. They may, therefore, play a significant role in the evolutionary process.

Experiment list: SRX655693 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ut KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fib...roblast || genotype/variation=MED23 knockout http://dbarchive.biosciencedbc.jp/ky

Combinatorial regulation of meiotic holliday junction resolution in C. elegans by HIM-6 (BLM) helicase, SLX-4, and the SLX-1, MUS-81 and XPF-1 nucleases.

Science.gov (United States)

Agostinho, Ana; Meier, Bettina; Sonneville, Remi; Jagut, Marlène; Woglar, Alexander; Blow, Julian; Jantsch, Verena; Gartner, Anton

2013-01-01

Holliday junctions (HJs) are cruciform DNA structures that are created during recombination events. It is a matter of considerable importance to determine the resolvase(s) that promote resolution of these structures. We previously reported that C. elegans GEN-1 is a symmetrically cleaving HJ resolving enzyme required for recombinational repair, but we could not find an overt role in meiotic recombination. Here we identify C. elegans proteins involved in resolving meiotic HJs. We found no evidence for a redundant meiotic function of GEN-1. In contrast, we discovered two redundant HJ resolution pathways likely coordinated by the SLX-4 scaffold protein and also involving the HIM-6/BLM helicase. SLX-4 associates with the SLX-1, MUS-81 and XPF-1 nucleases and has been implicated in meiotic recombination in C. elegans. We found that C. elegans [mus-81; xpf-1], [slx-1; xpf-1], [mus-81; him-6] and [slx-1; him-6] double mutants showed a similar reduction in survival rates as slx-4. Analysis of meiotic diakinesis chromosomes revealed a distinct phenotype in these double mutants. Instead of wild-type bivalent chromosomes, pairs of "univalents" linked by chromatin bridges occur. These linkages depend on the conserved meiosis-specific transesterase SPO-11 and can be restored by ionizing radiation, suggesting that they represent unresolved meiotic HJs. This suggests the existence of two major resolvase activities, one provided by XPF-1 and HIM-6, the other by SLX-1 and MUS-81. In all double mutants crossover (CO) recombination is reduced but not abolished, indicative of further redundancy in meiotic HJ resolution. Real time imaging revealed extensive chromatin bridges during the first meiotic division that appear to be eventually resolved in meiosis II, suggesting back-up resolution activities acting at or after anaphase I. We also show that in HJ resolution mutants, the restructuring of chromosome arms distal and proximal to the CO still occurs, suggesting that CO initiation

Model of chromosome associations in Mus domesticus spermatocytes

Directory of Open Access Journals (Sweden)

Soledad Berríos

2010-01-01

Full Text Available Understanding the spatial organization of the chromosomes in meiotic nuclei is crucial to our knowledge of the genome's functional regulation, stability and evolution. This study examined the nuclear architecture of Mus domesticus 2n=40 pachytene spermatocytes, analyzing the associations among autosomal bivalents via their Centromere Telomere Complexes (CTC. The study developed a nuclear model in which each CTC was represented as a 3D computer object. The probability of a given combination of associations among CTC was estimated by simulating a random distribution of 19 indistinguishable CTC over n indistinguishable "cells" on the nuclear envelope. The estimated association frequencies resulting from this numerical approach were similar to those obtained by quantifying actual associations in pachytene spermatocyte spreads. The nuclear localization and associations of CTC through the meiotic prophase in well-preserved nuclei were also analyzed. We concluded that throughout the meiotic prophase: 1 the CTC of autosomal bivalents are not randomly distributed in the nuclear space; 2 the CTC associate amongst themselves, probably at random, over a small surface of the nuclear envelope, at the beginning of the meiotic prophase; 3 the initial aggregation of centromere regions occurring in lepto-zygotene likely resolves into several smaller aggregates according to patterns of preferential partitioning; 4 these smaller aggregates spread over the inner face of the nuclear envelope, remaining stable until advanced stages of the meiotic prophase or even until the first meiotic division.

Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

Science.gov (United States)

Flachs, Petr; Bhattacharyya, Tanmoy; Mihola, Ondřej; Piálek, Jaroslav; Forejt, Jiří; Trachtulec, Zdenek

2014-01-01

PR-domain 9 (Prdm9) is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain) and the Hstx2 region of chromosome (Chr) X from M. m. musculus (Mmm; the PWD strain) participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6)F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6)F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6)F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6)F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

Directory of Open Access Journals (Sweden)

Petr Flachs

Full Text Available PR-domain 9 (Prdm9 is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain and the Hstx2 region of chromosome (Chr X from M. m. musculus (Mmm; the PWD strain participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

NCBI nr-aa BLAST: CBRC-STRI-01-2626 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2626 sp|Q8VBS7|VN1A6_MOUSE RecName: Full=Vomeronasal type-1 receptor A...6; AltName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A1; AltName: Full=Vomeronasa...l type-1 receptor A10 dbj|BAB79209.1| vomeronasal receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasa...l receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasal receptor V1RA10

Age-associated metabolic and morphologic changes in mitochondria of individual mouse and hamster oocytes.

Directory of Open Access Journals (Sweden)

Fatma Simsek-Duran

Full Text Available BACKGROUND: In human oocytes, as in other mammalian ova, there is a significant variation in the pregnancy potential, with approximately 20% of oocyte-sperm meetings resulting in pregnancies. This frequency of successful fertilization decreases as the oocytes age. This low proportion of fruitful couplings appears to be influenced by changes in mitochondrial structure and function. In this study, we have examined mitochondrial biogenesis in both hamster (Mesocricetus auratus and mouse (Mus musculus ova as models for understanding the effects of aging on mitochondrial structure and energy production within the mammalian oocyte. METHODOLOGY/PRINCIPAL FINDINGS: Individual metaphase II oocytes from a total of 25 young and old mice and hamsters were collected from ovarian follicles after hormone stimulation and prepared for biochemical or structural analysis. Adenosine triphosphate levels and mitochondrial DNA number were determined within individual oocytes from young and old animals. In aged hamsters, oocyte adenosine triphosphate levels and mitochondrial DNA molecules were reduced 35.4% and 51.8%, respectively. Reductions of 38.4% and 44% in adenosine triphosphate and mitochondrial genomes, respectively, were also seen in aged mouse oocytes. Transmission electron microscopic (TEM analysis showed that aged rodent oocytes had significant alterations in mitochondrial and cytoplasmic lamellae structure. CONCLUSIONS/SIGNIFICANCE: In both mice and hamsters, decreased adenosine triphosphate in aged oocytes is correlated with a similar decrease in mtDNA molecules and number of mitochondria. Mitochondria in mice and hamsters undergo significant morphological change with aging including mitochondrial vacuolization, cristae alterations, and changes in cytoplasmic lamellae.

Pembentukan Pronukleus Jantan dan Betina pada Mencit (Mus musculus setelah Terjadinya Fertilisasi

Directory of Open Access Journals (Sweden)

SYAHRUDDIN SAID

2005-11-01

Full Text Available Pronuclei are nuclei from male or female before syngami. The information about time of fertilization in vivo in animals was limited, especially in formation of pronuclei. This study have purpose to know the timing of sperm and egg nuclei changes at the time in vivo fertilization until formed male and female pronuclei. The female mouse DDY age 6-8 weeks were super ovulated through injection 5 IU PMSG and hCG (48 h after PMSG per mouse intraperitoneally. The female mouse was mated with male from same species in proportion male: female = 1:1. The eggs were collected on 4, 6, 8, and 10 h after fertilization with 0 h is 12 h after hCG injection with shallow cut of fertilization bladder of female mouse tuba Fallopian. The shallow cut was treated in PBS media supplemented by 3% BSA and 0.1% hyaluronidase; the eggs were washed in same media without hyaluronidase. The eggs were fixed with glutaraldehyde 2.5% in PBS, the eggs were drawn in neutral formalin 10%, dehydration with ethanol 95% and stained with lacmoid 0.25% in acetic acid 45%, the eggs were washed with using acetoglycerol and then observation about development of sperm and egg nuclei morphology. Development of mouse egg nuclei achieve to female pronuclei phase 185 (95%+6 was occur on 8 h after in vivo fertilization, development of mouse sperm nuclei achieve to male pronuclei phase 185 (96%+4 was occur on 8 h after in vivo fertilization. In the present study, we found some of eggs like unfertile eggs, polysperm, and parthenogenesis at the fertilization in vivo.

Parâmetros morfofisiológicos testiculares de camundongos (Mus musculus suplementados com geleia real Morphophysiological parameters of mice (Mus musculus testicles supplemented with royal jelly

Directory of Open Access Journals (Sweden)

A.C.T. Morais

2009-02-01

Full Text Available Avaliaram-se os efeitos da geleia real sobre os parâmetros morfofisiológicos testiculares de camundongos (Mus musculus. Utilizaram-se 57 machos Swiss, com quatro meses de idade, distribuídos aleatoriamente em seis tratamentos: T1: solução fisiológica, via intraperitoneal; T2: 0,1mg de geleia real, via intraperitoneal; T3: 0,2mg de geleia real, via intraperitoneal; T4: água destilada, via oral; T5: 0,1mg de geleia real, via oral; e T6: 0,2mg de geleia real, via oral. Após 45 dias de suplementação com geleia real, os animais sacrificados e pesados tiveram seus testículos coletados, incluídos em parafina e corados com hematoxilina/eosina. Não houve diferença entre os tratamentos quanto aos: pesos corporal e testicular, índice gonadossomático, diâmetro tubular, altura do epitélio, comprimento total dos túbulos seminíferos, comprimento tubular por grama de testículo, índices tubulossomático e leydigossomático e valores de proporção volumétrica referentes à túnica própria, epitélio seminífero, vaso sanguíneo e vaso linfático. Foi encontrada diferença entre T1 e T3 em relação aos túbulos seminíferos e ao espaço intertubular.The effects of royal jelly on the morphophysiological parameters of mice (Mus musculus testicles were studied. Fifty-eight male Swiss mice were evaluated. They were four-month old and were randomly distributed in six treatments: T1: physiological solution, intraperitonial route; T2: 0.1mg of royal jelly, intraperitonial route; T3: 0.2mg of royal jelly, intraperitonial route; T4: distilled water, orally; T5: 0.1mg of royal jelly, orally; and T6: 0.2mg of royal jelly, orally. After 45 days of supplementation with royal jelly, the animals were weighted, slaughtered, and the testicles collected, included in paraffin, and stained with haematoxylin-eosin. No differences among treatments were observed for: body and testicular weights, gonadossomatic index, tubular diameter, epithelial height, total

Transgressive segregation in a behavioural trait? Explorative strategies in two house mouse subspecies and their hybrids

Czech Academy of Sciences Publication Activity Database

Hiadlovská, Zuzana; Vošlajerová Bímová, Barbora; Mikula, Ondřej; Piálek, Jaroslav; Macholán, Miloš

2013-01-01

Roč. 108, č. 1 (2013), s. 225-235 ISSN 0024-4066 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792; GA AV ČR KJB600930701 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersion * exploration * hybridization * Mus musculus domesticus * Mus musculus musculus * open field test Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 2.535, year: 2013

Experiment list: SRX655689 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 8698: pol2 KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embry...onic fibroblast || genotype/variation=MED23 knockout || chip antibody=Pol II http

Experiment list: SRX1121725 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblas...t || genotype/variation=MED23 knockout || chip antibody=H3K4me3 http://dbarchive.

AcEST: DK954018 [AcEST

Lifescience Database Archive (English)

Full Text Available I8 Definition sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus Align length 152 Score (b...ignments: (bits) Value sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musc... 142 1e-33 sp|A4FV84|MRT4_BOVIN mRNA turnov...er protein 4 homolog OS=Bos taur... 142 1e-33 sp|Q9UKD2|MRT4_HUMAN mRNA turnover... protein 4 homolog OS=Homo sap... 140 5e-33 sp|Q86HD3|MRT4_DICDI mRNA turnover prote...in 4 homolog OS=Dictyost... 127 3e-29 sp|Q9USZ6|MRT4_SCHPO mRNA turnover protein 4 homolog OS=Schizosa... 10

NCBI nr-aa BLAST: CBRC-CPOR-01-1147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1147 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0130 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0130 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-PABE-04-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-04-0003 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-OCUN-01-1001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1001 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0137 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0137 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-04-0241 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0241 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-1167 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1167 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0138 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0138 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0124 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0124 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

Novel arenavirus sequences in Hylomyscus sp. and Mus (Nannomys setulosus from Côte d'Ivoire: implications for evolution of arenaviruses in Africa.

Directory of Open Access Journals (Sweden)

David Coulibaly-N'Golo

Full Text Available This study aimed to identify new arenaviruses and gather insights in the evolution of arenaviruses in Africa. During 2003 through 2005, 1,228 small mammals representing 14 different genera were trapped in 9 villages in south, east, and middle west of Côte d'Ivoire. Specimens were screened by pan-Old World arenavirus RT-PCRs targeting S and L RNA segments as well as immunofluorescence assay. Sequences of two novel tentative species of the family Arenaviridae, Menekre and Gbagroube virus, were detected in Hylomyscus sp. and Mus (Nannomys setulosus, respectively. Arenavirus infection of Mus (Nannomys setulosus was also demonstrated by serological testing. Lassa virus was not found, although 60% of the captured animals were Mastomys natalensis. Complete S RNA and partial L RNA sequences of the novel viruses were recovered from the rodent specimens and subjected to phylogenetic analysis. Gbagroube virus is a closely related sister taxon of Lassa virus, while Menekre virus clusters with the Ippy/Mobala/Mopeia virus complex. Reconstruction of possible virus-host co-phylogeny scenarios suggests that, within the African continent, signatures of co-evolution might have been obliterated by multiple host-switching events.

Reflexões sobre a arte "primitiva": o caso do Musée Branly

Directory of Open Access Journals (Sweden)

Ilana Goldstein

2008-06-01

Full Text Available Na época das descobertas ultramarinas, os europeus acumulavam fragmentos das novas realidades que encontravam em suas viagens, nos chamados gabinetes de curiosidades. Os colecionadores se especializaram e, a partir do século XVIII, surgiram os primeiros museus científicos. No final do século XIX, as exposições universais expunham a "barbárie" dos povos colonizados. Já as vanguardas do século XX redescobriram a arte "primitiva" enquanto fonte de renovação. Este artigo recupera tais formas de apreensão da cultura material de sociedades tradicionais ao longo do tempo, para chegar à inauguração do Musée Branly, em 2006. A partir desse museu, podem-se repensar algumas questões fundamentais acerca da arte "primitiva", como a dicotomia entre tratar os artefatos como testemunhos etnográficos ou como criações estéticas; as relações de poder envolvidas na aquisição dos objetos; o problema da autenticidade, numa era em que se multiplicam os souvenirs étnicos "neotradicionais".In the epoch of overseas discoveries, Europeans accumulated fragments of the realities they found in cabinets of curiosities. The private collectors specialized in different branches of "natural history" and this led to the emergence of scientific museums in the 18th century. At the end of the 19th century, universal exhibitions displayed "primitive" artifacts side by side with Western technologies, suggesting the "barbarism" of colonized peoples. But, at the beginning of the 20th century, the avant-gardes rediscovered the art nègre, using it as a source of artistic renovation. This article begins by describing these various forms of dealing with the cultural expressions of others, in order to understand the meaning of the recently opened Musée Branly. The French museum, devoted to non-occidental societies, provides an opportunity to reconsider some fundamental issues. Should we exhibit these artifacts as ethnographic testimonies or works of art? Can we

Dicty_cDB: Contig-U05216-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 064701 ) WNEL14b1 Wheat EST endosperm library Triticum aes... 40 0.032 2 ( AC200123 ) Zea mays chromosome 4 ... CF-24-HW fat cDNA... 36 0.055 2 ( EG551033 ) MM04K05_RP Sugar Beet germination cDNA library Be... 36 0.055 2 ( AG332587 ) Mus muscul...7 2 ( AZ506962 ) 1M0348D20F Mouse 10kb plasmid UUGC1M library Mus ... 40 0.057 2 ( BB898919 ) Macaca fascicul...V968176 ) GC06167 Gracilaria changii cDNA library Gracilari... 46 0.014 2 ( AG430324 ) Mus musculus molossin..._IpSto_12_p10 Stomach cDNA library Ictalurus p... 32 0.76 2 ( DX535456 ) GH_MBb0065G22f GH_MBb Gossypium hirsutum genomic

Population genetic structure in a Robertsonian race of house mice: evidence from microsatellite polymorphism

NARCIS (Netherlands)

Dallas, J.F.; Bonhomme, F.; Boursot, P.; Britton-Davidian, J.; Bauchau, V.

1998-01-01

Genetic evidence was assessed for inbreeding and population subdivision in a Robertsonian fusion (Rb) race of the western European form of house mouse, Mus musculus domesticus, in central Belgium. Inbreeding, and the factors responsible for subdivision (genetic drift and extinction-recolonization)

Fellow travellers

DEFF Research Database (Denmark)

Jones, E. P.; Skirnisson, K.; McGovern, T. H.

2012-01-01

Background: House mice (Mus musculus) are commensals of humans and therefore their phylogeography can reflect human colonization and settlement patterns. Previous studies have linked the distribution of house mouse mitochondrial (mt) DNA clades to areas formerly occupied by the Norwegian Vikings ...

PENGARUH TRITERPEN TOTAL PEGAGAN (Centella asiatica (L Urban TERHADAP FUNGSI KOGNITIF BELAJAR DAN MENGINGAT PADA MENCIT JANTAN ALBINO (Mus musculus YANG DIHAMBAT DENGAN SKOPOLAMIN

Directory of Open Access Journals (Sweden)

Herlina

2010-11-01

Full Text Available Pegagan (Centella asiatica (L Urban has been described to posses CNS effects such as improving cognitive function, learning and memory. The aim of the research was to evaluate the effects of total triterpen’s pegagan extract on cognitive functions as the learning and memory performance in male albino mice (Mus musculus inhibited by scopolamine. The research design was Complete Randomized Design (RAL – factorial on thirty six mice divided into 4 groups. One control group received only aquabidest (negative control. Three treatment groups received total triterpen 16 mg/kg BW, 32 mg/kg BW orally and piracetam 500 mg/kg BW by intra peritoneally (positive control for 21 days. Data indicating learning and memory process of all subjects were obtained from one-trial passive avoidance test. Data were analyzed by two way ANOVA and BNT (p0,05. In conclusion, total triterpen from pegagan (Centella asiatica (L Urban improved learning ability and memory of male albino mice (Mus musculus even though, it was inhibited by scopolamine.

SEM study of Anisakis brevispiculata Dollfus, 1966 and Pseudoterranova ceticola (Deardoff and Overstreet, 1981 (Nematoda: Anisakidae, parasites of the pygmy sperm whale Kogia breviceps

Directory of Open Access Journals (Sweden)

Elvira Abollo

2002-09-01

Full Text Available Scanning Electron Microscopy (SEM was used to study different topo-morphological characteristics of the architecture (cuticle, excretory pore, lips and adjacent structures, number and distribution patterns of caudal papillae and papillae-like structures of the anisakid nematodes Anisakis brevispiculata and Pseudoterranova ceticola, parasites in the stomach of the pygmy sperm whale Kogia breviceps. SEM micrographs herein help to accurately define the above surface topographical features by adding a more adequate 3-D picture to the original descriptions of both parasitic species. In A. brevispiculata the entire body cuticle structure, well-differentiated paracloacal papillae and the wrinkle cuticle of the papillae are clear examples that enhance the above differentiation of structures as seen by LM or SEM. Similarly, in P. ceticola the cuticle striations, bulky cloacal lips, rectangular distribution pattern of distal papillae and the absence of a groove separating paracloacal papillae which are obliquely arranged are all different to those features previously described.

The influence of air-filled structures on wave propagation and beam formation of a pygmy sperm whale (Kogia breviceps) in horizontal and vertical planes.

Science.gov (United States)

Song, Zhongchang; Zhang, Yu; Thornton, Steven W; Li, Songhai; Dong, Jianchen

2017-10-01

The wave propagation, sound field, and transmission beam pattern of a pygmy sperm whale (Kogia breviceps) were investigated in both the horizontal and vertical planes. Results suggested that the signals obtained at both planes were similarly characterized with a high peak frequency and a relatively narrow bandwidth, close to the ones recorded from live animals. The sound beam measured outside the head in the vertical plane was narrower than that of the horizontal one. Cases with different combinations of air-filled structures in both planes were used to study the respective roles in controlling wave propagation and beam formation. The wave propagations and beam patterns in the horizontal and vertical planes elucidated the important reflection effect of the spermaceti and vocal chambers on sound waves, which was highly significant in forming intensive forward sound beams. The air-filled structures, the forehead soft tissues and skull structures formed wave guides in these two planes for emitted sounds to propagate forward.

Rendez-vous avec les oeuvres du Musée: le speed dating au MAH : quinze minutes pour convaincre

OpenAIRE

Matthey, David

2015-01-01

Tiré du site internet du blog des Musées d'art et d'histoire (http://blog.mahgeneve.ch): "Lors des soirées Afterwork tenues au MAH durant les mois d'octobre et de novembre, les séances de speed dating – un commentaire d'une quinzaine de minutes consacré à une oeuvre ou à un ensemble d'oeuvres – ont remporté un franc succès. Cet engouement nous conforte dans l'idée d'en faire le fil rouge de nos futures manifestations de fin de journée ! Mais pourquoi cette formule?".

Chromosomal variation in the house mouse

Czech Academy of Sciences Publication Activity Database

Piálek, Jaroslav; Hauffe, H. C.; Searle, J. B.

2005-01-01

Roč. 84, č. 3 (2005), s. 535-563 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA AV ČR IAA6045601 Institutional research plan: CEZ:AV0Z6093917 Keywords : chromosomal evolution * hybrid zone * Robertsonian fusions Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

Rapid bursts of androgen-binding protein (Abp) gene duplication occurred independently in diverse mammals.

Science.gov (United States)

Laukaitis, Christina M; Heger, Andreas; Blakley, Tyler D; Munclinger, Pavel; Ponting, Chris P; Karn, Robert C

2008-02-12

The draft mouse (Mus musculus) genome sequence revealed an unexpected proliferation of gene duplicates encoding a family of secretoglobin proteins including the androgen-binding protein (ABP) alpha, beta and gamma subunits. Further investigation of 14 alpha-like (Abpa) and 13 beta- or gamma-like (Abpbg) undisrupted gene sequences revealed a rich diversity of developmental stage-, sex- and tissue-specific expression. Despite these studies, our understanding of the evolution of this gene family remains incomplete. Questions arise from imperfections in the initial mouse genome assembly and a dearth of information about the gene family structure in other rodents and mammals. Here, we interrogate the latest 'finished' mouse (Mus musculus) genome sequence assembly to show that the Abp gene repertoire is, in fact, twice as large as reported previously, with 30 Abpa and 34 Abpbg genes and pseudogenes. All of these have arisen since the last common ancestor with rat (Rattus norvegicus). We then demonstrate, by sequencing homologs from species within the Mus genus, that this burst of gene duplication occurred very recently, within the past seven million years. Finally, we survey Abp orthologs in genomes from across the mammalian clade and show that bursts of Abp gene duplications are not specific to the murid rodents; they also occurred recently in the lagomorph (rabbit, Oryctolagus cuniculus) and ruminant (cattle, Bos taurus) lineages, although not in other mammalian taxa. We conclude that Abp genes have undergone repeated bursts of gene duplication and adaptive sequence diversification driven by these genes' participation in chemosensation and/or sexual identification.

AcEST: BP911457 [AcEST

Lifescience Database Archive (English)

Full Text Available D K YR G++ + N +G Sbjct: 192 WLKPEGFPHQEIRQYSLTRKPDGKGYRIAVKREEGGQVSNWLHNHANVG 240 >sp|Q5TIS6|NOTO_MOUSE Homeobox protein notochord...=h... 32 2.1 sp|Q7ABK6|HMP_ECO57 Flavohemoprotein OS=Escherichia coli O157:H7... 32 2.1 sp|Q5TIS6|NOTO_MOUSE Homeobox protein notocho...rd OS=Mus musculus ... 31 2.8 sp|Q9BYQ7|KRA41_HUMAN Kera

Of mice and (Viking?) men: phylogeography of British and Irish house mice

OpenAIRE

Searle, Jeremy B.; Jones, Catherine S.; Gündüz, İslam; Scascitelli, Moira; Jones, Eleanor P.; Herman, Jeremy S.; Rambau, R. Victor; Noble, Leslie R.; Berry, R.J.; Giménez, Mabel D.; Jóhannesdóttir, Fríða

2008-01-01

The west European subspecies of house mouse (Mus musculus domesticus) has gained much of its current widespread distribution through commensalism with humans. This means that the phylogeography of M. m. domesticus should reflect patterns of human movements. We studied restriction fragment length polymorphism (RFLP) and DNA sequence variations in mouse mitochondrial (mt) DNA throughout the British Isles (328 mice from 105 localities, including previously published data). There is a major mtDNA...

Experiment list: SRX471838 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available : ChIPseq GS WT Bmi1; Mus musculus; ChIP-Seq source_name=Cultured germline stem cells || genotype/variation=...Wild-type || strain=CD1 x C57BL/6 || cell type=Cultured germline stem cells || chip antibody=Mouse anti-Bmi1

REVIEW - Thermal Physiology of Laboratory Mice: Defining Thermoneutrality

Science.gov (United States)

In terms of total number of publications, the laboratory mouse (Mus musculus) has emerged as the most popular test subject in biomedical research. Mice are used as models to study obesity, diabetes, eNS diseases and variety of other pathologies. Mice are classified as homeotherms...

Detection of quantitative trait loci causing abnormal spermatogenesis and reduced testis weight in the small testis (Smt) mutant mouse.

Science.gov (United States)

Bolor, Hasbaira; Wakasugi, Noboru; Zhao, Wei Dong; Ishikawa, Akira

2006-04-01

The small testis (Smt) mutant mouse is characterized by a small testis of one third to one half the size of a normal testis, and its spermatogenesis is mostly arrested at early stages of meiosis, although a small number of spermatocytes at the late prophase of meiosis and a few spermatids can sometimes be seen. We performed quantitative trait locus (QTL) analysis of these spermatogenic traits and testis weight using 221 F2 males obtained from a cross between Smt and MOM (Mus musculus molossinus) mice. At the genome-wide 5% level, we detected two QTLs affecting meiosis on chromosomes 4 and 13, and two QTLs for paired testis weight as a percentage of body weight on chromosomes 4 and X. In addition, we found several QTLs for degenerated germ cells and multinuclear giant cells on chromosomes 4, 7 and 13. Interestingly, for cell degeneration, the QTL on chromosome 13 interacted epistatically with the QTL on chromosome 4. These results reveal polygenic participation in the abnormal spermatogenesis and small testis size in the Smt mutant.

Centralized mouse repositories.

Science.gov (United States)

Donahue, Leah Rae; Hrabe de Angelis, Martin; Hagn, Michael; Franklin, Craig; Lloyd, K C Kent; Magnuson, Terry; McKerlie, Colin; Nakagata, Naomi; Obata, Yuichi; Read, Stuart; Wurst, Wolfgang; Hörlein, Andreas; Davisson, Muriel T

2012-10-01

Because the mouse is used so widely for biomedical research and the number of mouse models being generated is increasing rapidly, centralized repositories are essential if the valuable mouse strains and models that have been developed are to be securely preserved and fully exploited. Ensuring the ongoing availability of these mouse strains preserves the investment made in creating and characterizing them and creates a global resource of enormous value. The establishment of centralized mouse repositories around the world for distributing and archiving these resources has provided critical access to and preservation of these strains. This article describes the common and specialized activities provided by major mouse repositories around the world.

Drosophila mutations at the mei-9 and mus(2)201 loci which block excision of thymine dimers also block induction of unscheluded DNA synthesis by methyl methanesulfonate, ethyl methanesulfonate, N-methyl-N-nitrosourea, UV light and X-rays

International Nuclear Information System (INIS)

Dusenbery, R.L.; McCormick, S.C.; Smith, P.D.

1983-01-01

The mei-9 and mus(2)201 mutants of Drosophila melanogaster were identified as mutagen-sensitive mutants on the basis of larval hypersensitivity to methyl methanesulfonate and characterized as excision repair-deficient on the basis of a greatly reduced capacity to excise thymine dimers from cellular DNA. The high degree of larval cytotoxicity observed with a variety of other chemical and physical agents indicated that these mutants may be unable to excise other important classes of DNA adducts. We have measured the ability of the single mutants and the double mutant combination mei-9;mus(2)201 to perform the resynthesis step in excision repair by means of an autoradiographic analysis of unscheduled DNA synthesis (UDS) induced in a mixed population of primary cells in culture. The 3 strains exhibit no detectable UDS activity in response to applied doses of 1.5-6.0 mM methyl methanesulfonate, 1.0-4.5 nM N-methyl-N-nitrosourea or 10-40 J/m 2 254-nm UV light, dose ranges in which control cells exhibit a strong dose-dependent UDS response. The mei-9 and mei-9;mus(2)201 mutants also have no detectable UDS response to X-ray doses of 300-1.800 rad, whereas the mus(2)201 mutant exhibits a reduced, but dose-dependent, response over this range. These data correlate well with the degree of larval hypersensitivity of the strains and suggest that mutations at both loci block the excision repair of a wide variety of DNA damage prior to the resynthesis step. (orig.)

AcEST: DK956080 [AcEST

Lifescience Database Archive (English)

Full Text Available ABYR-binding protein OS=Mus... 33 0.85 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin... OS=... 33 1.1 sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.1

Experiment list: SRX897943 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 153,97.9,13.9,15440 GSM1624628: ChIP seq Renilla Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

NCBI nr-aa BLAST: CBRC-CINT-01-0064 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CINT-01-0064 sp|Q9QY96|CASR_MOUSE Extracellular calcium-sensing receptor precu...rsor (CaSR) (Parathyroid Cell calcium-sensing receptor) gb|AAD28371.1|AF110178_1 calcium-sensing receptor [Mus musculus] Q9QY96 0.0 41% ...

AcEST: BP920102 [AcEST

Lifescience Database Archive (English)

Full Text Available DC04|RGS3_MOUSE Regulator of G-protein signaling 3 OS=Mus m... 32 1.9 sp|P87245|KMS1_SCHPO Karyoga...PAGQESTSQDPLLSQE 569 Query: 327 SP 332 P Sbjct: 570 PP 571 >sp|P87245|KMS1_SCHPO Karyogamy meiotic segregati

Pygmy and core polarization dipole modes in 206Pb: Connecting nuclear structure to stellar nucleosynthesis

Science.gov (United States)

Tonchev, A. P.; Tsoneva, N.; Bhatia, C.; Arnold, C. W.; Goriely, S.; Hammond, S. L.; Kelley, J. H.; Kwan, E.; Lenske, H.; Piekarewicz, J.; Raut, R.; Rusev, G.; Shizuma, T.; Tornow, W.

2017-10-01

A high-resolution study of the electromagnetic response of 206Pb below the neutron separation energy is performed using a (γ → ,γ‧) experiment at the HI γ → S facility. Nuclear resonance fluorescence with 100% linearly polarized photon beams is used to measure spins, parities, branching ratios, and decay widths of excited states in 206Pb from 4.9 to 8.1 MeV. The extracted ΣB (E 1) ↑ and ΣB (M 1) ↑ values for the total electric and magnetic dipole strength below the neutron separation energy are 0.9 ± 0.2 e2fm2 and 8.3 ± 2.0 μN2, respectively. These measurements are found to be in very good agreement with the predictions from an energy-density functional (EDF) plus quasiparticle phonon model (QPM). Such a detailed theoretical analysis allows to separate the pygmy dipole resonance from both the tail of the giant dipole resonance and multi-phonon excitations. Combined with earlier photonuclear experiments above the neutron separation energy, one extracts a value for the electric dipole polarizability of 206Pb of αD = 122 ± 10 mb /MeV. When compared to predictions from both the EDF+QPM and accurately calibrated relativistic EDFs, one deduces a range for the neutron-skin thickness of Rskin206 = 0.12- 0.19 fm and a corresponding range for the slope of the symmetry energy of L = 48- 60 MeV. This newly obtained information is also used to estimate the Maxwellian-averaged radiative cross section 205Pb (n , γ)206Pb at 30 keV to be σ = 130 ± 25 mb. The astrophysical impact of this measurement-on both the s-process in stellar nucleosynthesis and on the equation of state of neutron-rich matter-is discussed.

A role for ultrasonic vocalisation in social communication and divergence of natural populations of the house mouse (Mus musculus domesticus.

Directory of Open Access Journals (Sweden)

Sophie von Merten

Full Text Available It has long been known that rodents emit signals in the ultrasonic range, but their role in social communication and mating is still under active exploration. While inbred strains of house mice have emerged as a favourite model to study ultrasonic vocalisation (USV patterns, studies in wild animals and natural situations are still rare. We focus here on two wild derived mouse populations. We recorded them in dyadic encounters for extended periods of time to assess possible roles of USVs and their divergence between allopatric populations. We have analysed song frequency and duration, as well as spectral features of songs and syllables. We show that the populations have indeed diverged in several of these aspects and that USV patterns emitted in a mating context differ from those emitted in same sex encounters. We find that females vocalize not less, in encounters with another female even more than males. This implies that the current focus of USVs being emitted mainly by males within the mating context needs to be reconsidered. Using a statistical syntax analysis we find complex temporal sequencing patterns that could suggest that the syntax conveys meaningful information to the receivers. We conclude that wild mice use USV for complex social interactions and that USV patterns can diverge fast between populations.

Behavioral and other phenotypes in a cytoplasmic Dynein light intermediate chain 1 mutant mouse.

Science.gov (United States)

Banks, Gareth T; Haas, Matilda A; Line, Samantha; Shepherd, Hazel L; Alqatari, Mona; Stewart, Sammy; Rishal, Ida; Philpott, Amelia; Kalmar, Bernadett; Kuta, Anna; Groves, Michael; Parkinson, Nicholas; Acevedo-Arozena, Abraham; Brandner, Sebastian; Bannerman, David; Greensmith, Linda; Hafezparast, Majid; Koltzenburg, Martin; Deacon, Robert; Fainzilber, Mike; Fisher, Elizabeth M C

2011-04-06

The cytoplasmic dynein complex is fundamentally important to all eukaryotic cells for transporting a variety of essential cargoes along microtubules within the cell. This complex also plays more specialized roles in neurons. The complex consists of 11 types of protein that interact with each other and with external adaptors, regulators and cargoes. Despite the importance of the cytoplasmic dynein complex, we know comparatively little of the roles of each component protein, and in mammals few mutants exist that allow us to explore the effects of defects in dynein-controlled processes in the context of the whole organism. Here we have taken a genotype-driven approach in mouse (Mus musculus) to analyze the role of one subunit, the dynein light intermediate chain 1 (Dync1li1). We find that, surprisingly, an N235Y point mutation in this protein results in altered neuronal development, as shown from in vivo studies in the developing cortex, and analyses of electrophysiological function. Moreover, mutant mice display increased anxiety, thus linking dynein functions to a behavioral phenotype in mammals for the first time. These results demonstrate the important role that dynein-controlled processes play in the correct development and function of the mammalian nervous system.

Peroral Echinococcus multilocularis egg inoculation in Myodes glareolus, Mesocricetus auratus and Mus musculus (CD-1 IGS and C57BL/6j)

DEFF Research Database (Denmark)

Woolsey, Ian David; Jensen, Per Moestrup; Deplazes, Peter

2016-01-01

Echinococcus multilocularis transmission predominantly occurs in Europe between the red fox (Vulpes vulpes) and various species of rodent intermediate hosts. We infected 3 species of rodent, Myodes glareolus (n = 47), Mesocricetus auratus (n = 11) and outbred Mus musculus (CD-1 IGS) (n = 9...

Catchment-scale conservation units identified for the threatened Yarra pygmy perch (Nannoperca obscura) in highly modified river systems.

Science.gov (United States)

Brauer, Chris J; Unmack, Peter J; Hammer, Michael P; Adams, Mark; Beheregaray, Luciano B

2013-01-01

Habitat fragmentation caused by human activities alters metapopulation dynamics and decreases biological connectivity through reduced migration and gene flow, leading to lowered levels of population genetic diversity and to local extinctions. The threatened Yarra pygmy perch, Nannoperca obscura, is a poor disperser found in small, isolated populations in wetlands and streams of southeastern Australia. Modifications to natural flow regimes in anthropogenically-impacted river systems have recently reduced the amount of habitat for this species and likely further limited its opportunity to disperse. We employed highly resolving microsatellite DNA markers to assess genetic variation, population structure and the spatial scale that dispersal takes place across the distribution of this freshwater fish and used this information to identify conservation units for management. The levels of genetic variation found for N. obscura are amongst the lowest reported for a fish species (mean heterozygosity of 0.318 and mean allelic richness of 1.92). We identified very strong population genetic structure, nil to little evidence of recent migration among demes and a minimum of 11 units for conservation management, hierarchically nested within four major genetic lineages. A combination of spatial analytical methods revealed hierarchical genetic structure corresponding with catchment boundaries and also demonstrated significant isolation by riverine distance. Our findings have implications for the national recovery plan of this species by demonstrating that N. obscura populations should be managed at a catchment level and highlighting the need to restore habitat and avoid further alteration of the natural hydrology.

On the determination of Toxoplasma gondii virulence in mice

Science.gov (United States)

Toxoplasma gondii is one of the most successful pathogens on earth, capable of infecting mammals and birds. Numerous papers and reports are published on isolation of T .gondii from various natural sources worldwide. The house mouse (Mus musculus) has been used as the laboratory animal model to deter...

Experiment list: SRX897941 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available 081,98.0,12.4,11292 GSM1624626: ChIP seq Chaf1a.166 Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

NCBI nr-aa BLAST: CBRC-XTRO-01-3247 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3247 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 69% ...

NCBI nr-aa BLAST: CBRC-MMUS-14-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-14-0085 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 99% ...

AcEST: BP917335 [AcEST

Lifescience Database Archive (English)

Full Text Available _MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 Length = 993 Score = 42.4 bits (98),...THGEYTSAAE 635 >tr|Q9EQN5|Q9EQN5_RAT Antifreeze-enhancer binding protein AEP OS=Rattus norvegicus GN=Ighmbp2

The murine retinoblastoma homolog maps to chromosome 14 near Es-10

NARCIS (Netherlands)

Stone, J.C.; Crosby, J.J.; Kozak, C.A.; Schievella, A.R.; Bernards, R.A.; Nadeau, J.H.

1989-01-01

Restriction fragment length variants have been exploited to map genetically Rb-1, the murine homolog of the human retinoblastoma gene. Rb-1 localized to mouse chromosome 14 on the basis of results from analysis of somatic cell hybrids. In an interspecific backcross involving Mus spretus, Rb-1 and

How Random Is Social Behaviour? Disentangling Social Complexity through the Study of a Wild House Mouse Population

Science.gov (United States)

Perony, Nicolas; Tessone, Claudio J.; König, Barbara; Schweitzer, Frank

2012-01-01

Out of all the complex phenomena displayed in the behaviour of animal groups, many are thought to be emergent properties of rather simple decisions at the individual level. Some of these phenomena may also be explained by random processes only. Here we investigate to what extent the interaction dynamics of a population of wild house mice (Mus domesticus) in their natural environment can be explained by a simple stochastic model. We first introduce the notion of perceptual landscape, a novel tool used here to describe the utilisation of space by the mouse colony based on the sampling of individuals in discrete locations. We then implement the behavioural assumptions of the perceptual landscape in a multi-agent simulation to verify their accuracy in the reproduction of observed social patterns. We find that many high-level features – with the exception of territoriality – of our behavioural dataset can be accounted for at the population level through the use of this simplified representation. Our findings underline the potential importance of random factors in the apparent complexity of the mice's social structure. These results resonate in the general context of adaptive behaviour versus elementary environmental interactions. PMID:23209394

A pronounced evolutionary shift of the pseudoautosomal region boundary in house mice.

Science.gov (United States)

White, Michael A; Ikeda, Akihiro; Payseur, Bret A

2012-08-01

The pseudoautosomal region (PAR) is essential for the accurate pairing and segregation of the X and Y chromosomes during meiosis. Despite its functional significance, the PAR shows substantial evolutionary divergence in structure and sequence between mammalian species. An instructive example of PAR evolution is the house mouse Mus musculus domesticus (represented by the C57BL/6J strain), which has the smallest PAR among those that have been mapped. In C57BL/6J, the PAR boundary is located just ~700 kb from the distal end of the X chromosome, whereas the boundary is found at a more proximal position in Mus spretus, a species that diverged from house mice 2-4 million years ago. In this study we used a combination of genetic and physical mapping to document a pronounced shift in the PAR boundary in a second house mouse subspecies, Mus musculus castaneus (represented by the CAST/EiJ strain), ~430 kb proximal of the M. m. domesticus boundary. We demonstrate molecular evolutionary consequences of this shift, including a marked lineage-specific increase in sequence divergence within Mid1, a gene that resides entirely within the M. m. castaneus PAR but straddles the boundary in other subspecies. Our results extend observations of structural divergence in the PAR to closely related subspecies, pointing to major evolutionary changes in this functionally important genomic region over a short time period.

Hubungan Hiperglikemia dengan Prothrombin Time pada Mencit (Mus musculus yang Diinduksi Aloksan

Directory of Open Access Journals (Sweden)

Muhammad Ibnu Malik

2015-01-01

. Endothelial disfungtion can be detected by activated partial thromboplastin time (APTT and prothrombin time (PT. The objective of this studi was to determine the correlation between hyperglycemia and prothrombin time in mice (Mus musculus induced with aloxan. The design of this research was a post test only control group design conducted in October 2013 until February 2014 in Central Laboratory RS Dr. M. Djamil Padang. The subject were white mice (Mus musculus who have met the inclusion and exclusion criteria. The subject were divided as hyperglycemia group (induced with aloxan and control group. After seven days of adaptation, the aloxan was injected and measurenment of blood glucose and body weight had been done, one time in every four days. Then in day 30th the termination of mice had been done to meassure the prothrombin time. The result showed the prothrombin time between group was shortened with the average prothrombin time of the control group was 7,96 second and the hiperglicemia group was 8,12 second. The result showing no correlation between hyperglycemia and prothrombin time with the degree of signification is (p 0,7 (p > 0,05.Keywords: hyperglycemia, diabetes mellitus, prothrombin time,

Passive Immunization of Anti bZP3 (Zone Pellucida3 in Wistar Rat (Rattus novergicus and Mouse (Mus musculus

Directory of Open Access Journals (Sweden)

Y. Pantiwati

2012-12-01

Full Text Available This study was aimed at comparing the influence of anti bZP3’s passive immunization on anti-anti bZP3’s titer and pregnancy level on Wistar rats and mice. This study employed factorial design experiment with completely randomized design. The first factor was immunogenic type. The treated rats were immunized with 100 L anti bZP3 in 100 L Complete Freund’s Adjuvant (CFA, while the treated mice were injected with 50 L anti bZP3 in 50 L CFA. Control Wistar rats and mice were immunized with CFA and Incomplete Freund’s Adjuvant (IFA without anti bZP3. The second factor was animal type. The third factor was the length of serum incubation, i.e. 38, 49, 63, 86, 100, and 126 d. Dot blot on the treated Wistar rats and mice showed positive response proven by blue gradation; pre-immune mice as well as control Wistar rats and mice showed negative response proven by white gradation. The highest antibody titer in treated mouse serum was shown in 63 d incubation. The pregnancy on treated mice, control mice and Wistar rat occurred 100% until day 126; while the failure percentage on the treated mice was 4.5%. The pregnancy on treated mice occurred in 86 d incubation (1 rat, 100 d incubation (1 rat, and 126 d incubation (3 rats. Effective passive immunization on similar hospes occurred until day 63; while different hospes was ineffective. Antibodi anti-bZP3 was potential as a contraception through passive immunization on similar hospes.

Epigenetic interplay between mouse endogenous retroviruses and host genes.

Science.gov (United States)

Rebollo, Rita; Miceli-Royer, Katharine; Zhang, Ying; Farivar, Sharareh; Gagnier, Liane; Mager, Dixie L

2012-10-03

Transposable elements are often the targets of repressive epigenetic modifications such as DNA methylation that, in theory, have the potential to spread toward nearby genes and induce epigenetic silencing. To better understand the role of DNA methylation in the relationship between transposable elements and genes, we assessed the methylation state of mouse endogenous retroviruses (ERVs) located near genes. We found that ERVs of the ETn/MusD family show decreased DNA methylation when near transcription start sites in tissues where the nearby gene is expressed. ERVs belonging to the IAP family, however, are generally heavily methylated, regardless of the genomic environment and the tissue studied. Furthermore, we found full-length ETn and IAP copies that display differential DNA methylation between their two long terminal repeats (LTRs), suggesting that the environment surrounding gene promoters can prevent methylation of the nearby LTR. Spreading from methylated ERV copies to nearby genes was rarely observed, with the regions between the ERVs and genes apparently acting as a boundary, enriched in H3K4me3 and CTCF, which possibly protects the unmethylated gene promoter. Furthermore, the flanking regions of unmethylated ERV copies harbor H3K4me3, consistent with spreading of euchromatin from the host gene toward ERV insertions. We have shown that spreading of DNA methylation from ERV copies toward active gene promoters is rare. We provide evidence that genes can be protected from ERV-induced heterochromatin spreading by either blocking the invasion of repressive marks or by spreading euchromatin toward the ERV copy.

Environmental Impact Statement. Disposal and Reuse of Wurtsmith Air Force Base, Michigan

Science.gov (United States)

1993-09-01

Mephitis mephitis Meadow vole Microtus pennsy/vanicus House mouse Mus musculus Long-tailed weasel Mustela frenata Mink Mustela vison Little brown bat...fuels, such as coal and oil, are burned. SO2 is the main pollutant involved in the formation of acid rain. SO also can irritate the upper respiratory

Experiment list: SRX218536 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available strain=C57Bl/6 || age/gender=2-3 month old males || chip antibody=Santa Cruz Tech. rIgG (sc-2027) http://db....7,16.5,1194 GSM1067409: Rabbit IgG mouse liver ChIP-seq; Mus musculus; ChIP-Seq GEO Accession=GSM1067409 ||

Mouse allergen exposure and immunologic responses: IgE-mediated mouse sensitization and mouse specific IgG and IgG4 levels

NARCIS (Netherlands)

Matsui, Elizabeth C.; Krop, Esmeralda J. M.; Diette, Gregory B.; Aalberse, Rob C.; Smith, Abigail L.; Eggleston, Peyton A.

2004-01-01

Although there is evidence that contact with mice is associated with IgE-mediated mouse sensitization and mouse specific antibody responses, the exposure-response relationships remain unclear. To determine whether IgE-mediated mouse sensitization and mouse specific IgG (mIgG) and mIgG4 levels

Onset and progress of meiotic prophase in the oocytes in the B6.YTIR sex-reversed mouse ovary.

Science.gov (United States)

Park, E-H; Taketo, T

2003-12-01

When the Y chromosome of a Mus musculus domesticus male mouse (caught in Tirano, Italy) is placed on a C57BL/6J genetic background, approximately half of the XY (B6.YTIR) progeny develop into normal-appearing but infertile females. We have previously reported that the primary cause of infertility can be attributed to their oocytes. To identify the primary defect in the XY oocyte, we examined the onset and progress of meiotic prophase in the B6.YTIR fetal ovary. Using bromo-deoxyuridine incorporation and culture, we determined that the germ cells began to enter meiosis at the developmental ages and in numbers comparable to those in the control XX ovary. Furthermore, the meiotic prophase appeared to progress normally until the late zygotene stage. However, the oocytes that entered meiosis early in the XY ovary failed to complete the meiotic prophase. On the other hand, a considerable number of oocytes entered meiosis at late developmental stages and completed the meiotic prophase in the XY ovary. We propose that the timing of entry into meiosis and the XY chromosomal composition influence the survival of oocytes during meiotic prophase in the fetal ovary.

Interspecies Variation in the Susceptibility of a Wild-Derived Colony of Mice to Pinworms (Aspiculuris tetraptera).

Science.gov (United States)

Curtis, Ryan C; Murray, Jill K; Campbell, Polly; Nagamori, Yoko; Molnar, Adam; Jackson, Todd A

2017-01-01

Pinworms are common parasites in wild and laboratory rodents. Despite their relative nonpathogenicity in immunocompetent models, pinworm infections add an unwanted variable and may confound some types of research. For this reason, health monitoring programs and biosecurity measures aim to minimize the spread of pinworm infections into colonies free from the organisms. Wild-derived and laboratory strains of mice have shown varied susceptibility to infection with Aspiculuris tetraptera, the most commonly found murine pinworm. In particular, susceptibility is increased in wild-derived mice, young animals, and males. Routine surveillance at our institution revealed pinworm infection (A. tetraptera only) within a colony of multiple, wild-derived species of Mus, although only specific species showed positive results during initial sampling. To assess whether species-associated differences in susceptibility were present, we analyzed fecal egg counts of A. tetraptera in every cage of the colony. Our results revealed significant differences in susceptibility between various species and subspecies of Mus. Egg counts were significantly higher in Mus spicilegus than Mus m. domesticus (WSB/EiJ) and Mus macedonicus. Mus spretus had higher egg counts than M. m. domesticus (WSB/EiJ), M. m. musculus (PWK/PhJ), and M. macedonicus. Egg counts did not differ in regard to age, sex, or number of mice per cage. As wild-derived mouse models continue to compliment research largely based on laboratory strains, it will be important to understand host-parasite interactions and their effects on research, particularly studies evaluating immune responses, behavior, growth, and other physiologic parameters.

La Morue Normande, de la conserverie au musée

Directory of Open Access Journals (Sweden)

Florence Levert

2007-03-01

Full Text Available L’usine de La Morue Normande de Fécamp est mise en service en 1950. Initialement pensée pour sécher la morue débarquée par centaines de tonnes, elle connaîtra jusqu’à sa fermeture en 1995, une large diversification. Les adaptations successives seront facilitées par la souplesse de la structure poteaux-poutres. La multiplicité des expériences qui s’y sont déroulées paraît aujourd’hui symptomatique du déclin de la pêche industrielle fécampoise. Alors qu’à l’heure actuelle coexistent une industrie de transformation qui a quitté la zone portuaire et une pêche côtière n’entretenant plus aucun lien, l’immeuble désaffecté de La Morue Normande abritera bientôt le nouveau musée de Fécamp.In Fécamp, the factory of La Morue Normande opened in 1950. Initially created to dry cods brought by hundreds of tons, it will undergo many changes until its closing. Thank to its post-beam structure, an easy adaptation is provided. This diversification seems to be symptomatic of the decline of Fécamp industrial fishing. Nowadays, while a processing industry which left the port area a few years ago and the coastal fishing do not relate to each other anymore, the building of La Morue Normande will be soon the location of the new museum of Fécamp.

On Rhizomys sumatrensis

NARCIS (Netherlands)

Jentink, F.A.

1897-01-01

It perhaps will for ever remain an insolvable puzzle why Sir Raffles described under the name Mus sumatrensis a Mouse (after a drawing and a specimen) not from Sumatra, as the name should give reason to believe, but from Malacca, an animal after Major Farquhar not uncommon there and perhaps to be

NCBI nr-aa BLAST: CBRC-CFAM-23-0010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-23-0010 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 0.0 91% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-3057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-3057 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 0.0 90% ...

Nesting behavior of house mice (Mus domesticus) selected for increased wheel-running activity.

Science.gov (United States)

Carter, P A; Swallow, J G; Davis, S J; Garland, T

2000-03-01

Nest building was measured in "active" (housed with access to running wheels) and "sedentary" (without wheel access) mice (Mus domesticus) from four replicate lines selected for 10 generations for high voluntary wheel-running behavior, and from four randombred control lines. Based on previous studies of mice bidirectionally selected for thermoregulatory nest building, it was hypothesized that nest building would show a negative correlated response to selection on wheel-running. Such a response could constrain the evolution of high voluntary activity because nesting has also been shown to be positively genetically correlated with successful production of weaned pups. With wheel access, selected mice of both sexes built significantly smaller nests than did control mice. Without wheel access, selected females also built significantly smaller nests than did control females, but only when body mass was excluded from the statistical model, suggesting that body mass mediated this correlated response to selection. Total distance run and mean running speed on wheels was significantly higher in selected mice than in controls, but no differences in amount of time spent running were measured, indicating a complex cause of the response of nesting to selection for voluntary wheel running.

Diseño de una compañía exportadora de banano y otras musáceas para el mercado ruso

OpenAIRE

Játiva Murillo, Henry Isaac

2013-01-01

El proyecto tiene la finalidad de mostrar los aspectos legales, estratégicos y comerciales para la exportación de banano al mercado ruso, aprovechando la demanda creciente del país y la gran riqueza de producción de la fruta en el Ecuador. También se analizará agregar otros productos musáceos al mismo mercado ruso, aprovechando las operaciones logísticas y comerciales que la nueva empresa tendrá en el país europeo. Se determinará el nombre de la empresa, los aspectos legales, el capi...

Mouse adhalin

DEFF Research Database (Denmark)

Liu, L; Vachon, P H; Kuang, W

1997-01-01

. To analyze the biological roles of adhalin, we cloned the mouse adhalin cDNA, raised peptide-specific antibodies to its cytoplasmic domain, and examined its expression and localization in vivo and in vitro. The mouse adhalin sequence was 80% identical to that of human, rabbit, and hamster. Adhalin...... was specifically expressed in striated muscle cells and their immediate precursors, and absent in many other cell types. Adhalin expression in embryonic mouse muscle was coincident with primary myogenesis. Its expression was found to be up-regulated at mRNA and protein levels during myogenic differentiation...

Comments on the recent changes in taxonomy of pygmy unicorns, with description of a new species of Metopomystrum from Brazil (Insecta, Tetrigidae, Cleostratini, Miriatrini

Directory of Open Access Journals (Sweden)

Daniela Santos Martins Silva

2017-09-01

Full Text Available The tribe Cleostratini Bolívar, 1887 sensu Storozhenko, 2016 does not represent a monophyletic taxon because it gathers various Tetrigidae genera with various types of horn and prolongation of frons or vertex. Prolongation of these structures is present in morphologically and biogeographically distant groups. We do not regard Miriatrini Cadena-Castañeda & Cardona, 2015 synonymous with Cleostratini because the genus Miriatra Bolívar, 1906 belongs to a group of genera distant from Cleostratus Stål, 1877. There is no adequate diagnosis for proposed groups of genera forming tribes Cleostratini or Miriatrini. Miriatrini stat. resurr. are monotypic and include only Miriatra, Cleostratini are monotypic as well. Apteromystrum Storozhenko, 2016 syn. n. is regarded synonymous with Metopomystrum, M. apterum comb. resurr., M. amazoniensis comb. resurr. and Miriatra brevifastigiata (Cadena-Castañeda & Cardona, 2015, comb. n. are not Metopomystrum member. Herein a new species of pygmy unicorn, Metopomystrum muriciense Silva & Skejo, sp. n., is described from Atlantic Forest remnants in northeast of Brazil, collected on the Estação Serra do Ouro (municipality of Murici, Alagoas state. Distribution data, morphological characterization, and an identification key to Metopomystrum species are also presented.

Comments on the recent changes in taxonomy of pygmy unicorns, with description of a new species of Metopomystrum from Brazil (Insecta, Tetrigidae, Cleostratini, Miriatrini).

Science.gov (United States)

Silva, Daniela Santos Martins; Skejo, Josip; Pereira, Marcelo Ribeiro; Domenico, Fernando Campos De; Sperber, Carlos Frankl

2017-01-01

The tribe Cleostratini Bolívar, 1887 sensu Storozhenko, 2016 does not represent a monophyletic taxon because it gathers various Tetrigidae genera with various types of horn and prolongation of frons or vertex. Prolongation of these structures is present in morphologically and biogeographically distant groups. We do not regard Miriatrini Cadena-Castañeda & Cardona, 2015 synonymous with Cleostratini because the genus Miriatra Bolívar, 1906 belongs to a group of genera distant from Cleostratus Stål, 1877. There is no adequate diagnosis for proposed groups of genera forming tribes Cleostratini or Miriatrini. Miriatrini stat. resurr. are monotypic and include only Miriatra , Cleostratini are monotypic as well. Apteromystrum Storozhenko, 2016 syn. n. is regarded synonymous with Metopomystrum , M. apterum comb. resurr. , M. amazoniensis comb. resurr. and Miriatra brevifastigiata (Cadena-Castañeda & Cardona, 2015), comb. n. are not Metopomystrum member. Herein a new species of pygmy unicorn, Metopomystrum muriciense Silva & Skejo, sp. n. , is described from Atlantic Forest remnants in northeast of Brazil, collected on the Estação Serra do Ouro (municipality of Murici, Alagoas state). Distribution data, morphological characterization, and an identification key to Metopomystrum species are also presented.

Comments on the recent changes in taxonomy of pygmy unicorns, with description of a new species of Metopomystrum from Brazil (Insecta, Tetrigidae, Cleostratini, Miriatrini)

Science.gov (United States)

Silva, Daniela Santos Martins; Skejo, Josip; Pereira, Marcelo Ribeiro; Domenico, Fernando Campos De; Sperber, Carlos Frankl

2017-01-01

Abstract The tribe Cleostratini Bolívar, 1887 sensu Storozhenko, 2016 does not represent a monophyletic taxon because it gathers various Tetrigidae genera with various types of horn and prolongation of frons or vertex. Prolongation of these structures is present in morphologically and biogeographically distant groups. We do not regard Miriatrini Cadena-Castañeda & Cardona, 2015 synonymous with Cleostratini because the genus Miriatra Bolívar, 1906 belongs to a group of genera distant from Cleostratus Stål, 1877. There is no adequate diagnosis for proposed groups of genera forming tribes Cleostratini or Miriatrini. Miriatrini stat. resurr. are monotypic and include only Miriatra, Cleostratini are monotypic as well. Apteromystrum Storozhenko, 2016 syn. n. is regarded synonymous with Metopomystrum, M. apterum comb. resurr., M. amazoniensis comb. resurr. and Miriatra brevifastigiata (Cadena-Castañeda & Cardona, 2015), comb. n. are not Metopomystrum member. Herein a new species of pygmy unicorn, Metopomystrum muriciense Silva & Skejo, sp. n., is described from Atlantic Forest remnants in northeast of Brazil, collected on the Estação Serra do Ouro (municipality of Murici, Alagoas state). Distribution data, morphological characterization, and an identification key to Metopomystrum species are also presented. PMID:29118597

AcEST: BP919884 [AcEST

Lifescience Database Archive (English)

Full Text Available |OVGP1_PIG Oviduct-specific glycoprotein OS=Sus scrofa ... 35 0.17 sp|Q5EIC4|EAP1_RAT Enhanced at puberty pr...otein 1 OS=Rattus norve... 35 0.17 sp|Q8K3X4|EAP1_MOUSE Enhanced at puberty protein 1 OS=Mus muscul... 35 0.

A Survey of Toxoplasma gondii and Neospora caninum Infecting House Mice from a Hybrid Zone

Czech Academy of Sciences Publication Activity Database

Hůrková-Hofmannová, L.; Qablan, M. A.; Juránková, J.; Modrý, David; Piálek, Jaroslav

2014-01-01

Roč. 100, č. 1 (2014), s. 139-141 ISSN 0022-3395 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:60077344 ; RVO:68081766 Keywords : mouse Mus musculus * feral rodents * wild rodents Subject RIV: EB - Genetics ; Molecular Biology; EB - Genetics ; Molecular Biology (UBO-W) Impact factor: 1.227, year: 2014

NCBI nr-aa BLAST: CBRC-GACU-23-0054 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-23-0054 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 4e-55 36% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-3489 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3489 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 1e-151 78% ...

NCBI nr-aa BLAST: CBRC-PMAR-01-0530 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PMAR-01-0530 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 6e-69 42% ...

NCBI nr-aa BLAST: CBRC-OLAT-26-0036 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OLAT-26-0036 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 1e-55 36% ...

NCBI nr-aa BLAST: CBRC-DRER-07-0075 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DRER-07-0075 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 9e-57 36% ...

Predictive validity of a non-induced mouse model of compulsive-like behavior

NARCIS (Netherlands)

Greene-Schloesser, D. M.; Van der Zee, E. A.; Sheppard, D. K.; Castillo, M. R.; Gregg, K. A.; Burrow, T.; Foltz, H.; Slater, M.; Bult-Ito, A.

2011-01-01

A key to advancing the understanding of obsessive-compulsive disorder (OCD)-like symptoms is the development of spontaneous animal models. Over 55 generations of bidirectional selection for nest-building behavior in house mice, Mus musculus, resulted in a 40-fold difference in the amount of cotton

Mouse lipocalins (MUP, OBP, LCN) are co-expressed in tissues involved in chemical communication

Czech Academy of Sciences Publication Activity Database

Stopková, R.; Vinkler, D.; Kuntová, B.; Šedo, O.; Albrecht, T.; Suchan, J.; Dvořáková-Hortová, Kateřina; Zdráhal, Z.; Stopka, P.

2016-01-01

Roč. 47, č. 4 (2016), s. 1-11 ISSN 2296-701X Institutional support: RVO:86652036 Keywords : lipocalin * odorant * chemical communication * Mus musculus * olfaction Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology

Reference: 453 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ctor. We demonstrate that this protein functions as a transcriptional repressor in vivo. The express...ion of all members of the CYCLINA2 (CYCA2) family was reduced in an ILP1 overexpressing l...ine, and the mouse (Mus musculus) homolog of ILP1 repressed cyclin A2 expression in mouse NIH3T3 cells. T-DN...A insertion mutants of ILP1 showed reduced polyploidy and upregulated all CYCA2 express...ion. Furthermore, loss of CYCA2;1 expression induces an increase in polyploidy in Arabidopsis. We demo

National flow cytometry and sorting research resource. Annual progress report, July, 1, 1994--June 30, 1995, Year 12

Energy Technology Data Exchange (ETDEWEB)

Jett, J.H.

1995-04-27

Research progress utilizing flow cytometry is described. Topics include: rapid kinetics flow cytometry; characterization of size determinations for small DNA fragments; statistical analysis; energy transfer measurements of molecular confirmation in micelles; and enrichment of Mus spretus chromosomes by dual parameter flow sorting and identification of sorted fractions by fluorescence in-situ hybridization onto G-banded mouse metaphase spreads.

AcEST: BP917290 [AcEST

Lifescience Database Archive (English)

Full Text Available 7DTG3|SRTD4_MOUSE SERTA domain-containing protein 4 OS=Mus m... 31 3.7 sp|O41174|POLG_PEV9U Genome polyprotein OS=Porcine enterovirus...1DP68_NEOFI Putative uncharacterized protein OS=Neosa... 33 5.7 tr|Q68T42|Q68T42_9ENTO Polyprotein OS=Human enterovirus

Unigene BLAST: CBRC-OANA-01-0960 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.46 51% ...

Unigene BLAST: CBRC-OANA-01-1936 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.002 58% ...

Unigene BLAST: CBRC-OANA-01-0549 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 3e-08 75% ...

Unigene BLAST: CBRC-OANA-01-0647 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.002 58% ...

Unigene BLAST: CBRC-OANA-01-0028 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.016 60% ...

Unigene BLAST: CBRC-OANA-01-1804 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.095 92% ...

Unigene BLAST: CBRC-OANA-01-0223 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.001 36% ...

Unigene BLAST: CBRC-OANA-01-1479 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.21 86% ...

Unigene BLAST: CBRC-OANA-01-0659 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2.3 66% ...

Unigene BLAST: CBRC-OANA-01-1908 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.011 60% ...

Unigene BLAST: CBRC-OANA-01-0589 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 4.1 73% ...

Unigene BLAST: CBRC-OANA-01-1022 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.023 61% ...

Unigene BLAST: CBRC-OANA-01-1841 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.001 50% ...

Unigene BLAST: CBRC-OANA-01-1244 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-04 85% ...

Unigene BLAST: CBRC-OANA-01-0600 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 8e-07 77% ...

Unigene BLAST: CBRC-OANA-01-2064 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.023 75% ...

Unigene BLAST: CBRC-OANA-01-1611 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2.4 35% ...

Unigene BLAST: CBRC-OANA-01-1036 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 4.9 57% ...

Unigene BLAST: CBRC-OANA-01-0526 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 5e-05 70% ...

Unigene BLAST: CBRC-OANA-01-0189 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.002 60% ...

Unigene BLAST: CBRC-OANA-01-0741 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 1e-04 58% ...

Unigene BLAST: CBRC-OANA-01-1451 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.82 40% ...

Unigene BLAST: CBRC-OANA-01-2183 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 8.1 29% ...

Unigene BLAST: CBRC-OANA-01-1282 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.078 56% ...

Unigene BLAST: CBRC-OANA-01-2061 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-07 54% ...

Unigene BLAST: CBRC-OANA-01-0687 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.046 66% ...

Unigene BLAST: CBRC-OANA-01-0778 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 6.2 81% ...

Unigene BLAST: CBRC-OANA-01-0704 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.23 50% ...

Unigene BLAST: CBRC-OANA-01-1002 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.23 50% ...

Unigene BLAST: CBRC-OANA-01-1628 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.001 68% ...

Unigene BLAST: CBRC-OANA-01-2049 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.81 45% ...

Unigene BLAST: CBRC-OANA-01-1887 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 1.0 91% ...

Unigene BLAST: CBRC-OANA-01-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.018 75% ...

Unigene BLAST: CBRC-OANA-01-0361 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.022 40% ...

Unigene BLAST: CBRC-OANA-01-1584 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-05 56% ...

Unigene BLAST: CBRC-OANA-01-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 3e-05 76% ...

Unigene BLAST: CBRC-OANA-01-0376 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 3.4 41% ...

Unigene BLAST: CBRC-OANA-01-2204 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 8e-08 62% ...

Unigene BLAST: CBRC-OANA-01-1901 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 1e-06 75% ...

Unigene BLAST: CBRC-OANA-01-1731 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.83 35% ...

Unigene BLAST: CBRC-OANA-01-2210 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 3e-11 90% ...

Unigene BLAST: CBRC-OANA-01-0889 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 5.4 58% ...

Unigene BLAST: CBRC-OANA-01-0287 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-09 80% ...

Unigene BLAST: CBRC-OANA-01-0232 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 3e-05 64% ...

Unigene BLAST: CBRC-OANA-01-1313 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.006 41% ...

Unigene BLAST: CBRC-OANA-01-1434 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.039 55% ...

Unigene BLAST: CBRC-OANA-01-0030 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 3e-05 49% ...

Unigene BLAST: CBRC-OANA-01-0921 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 1.2 76% ...

Unigene BLAST: CBRC-OANA-01-1227 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.005 33% ...

Unigene BLAST: CBRC-OANA-01-0688 [SEVENS

Lifescience Database Archive (English)

Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-07 66% ...

NCBI nr-aa BLAST: CBRC-MDOM-07-0106 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-07-0106 sp|Q6TCG2|PAQR9_MOUSE RecName: Full=Progestin and adipoQ receptor... family member 9; AltName: Full=Progestin and adipoQ receptor family member IX gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 0.0 88% ...

NCBI nr-aa BLAST: CBRC-TTRU-01-1190 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-1190 sp|Q6TCG2|PAQR9_MOUSE RecName: Full=Progestin and adipoQ receptor... family member 9; AltName: Full=Progestin and adipoQ receptor family member IX gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 0.0 91% ...

NCBI nr-aa BLAST: CBRC-MLUC-01-0485 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MLUC-01-0485 sp|Q6TCG2|PAQR9_MOUSE RecName: Full=Progestin and adipoQ receptor... family member 9; AltName: Full=Progestin and adipoQ receptor family member IX gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 0.0 91% ...

NCBI nr-aa BLAST: CBRC-PVAM-01-1010 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PVAM-01-1010 sp|Q6TCG2|PAQR9_MOUSE RecName: Full=Progestin and adipoQ receptor... family member 9; AltName: Full=Progestin and adipoQ receptor family member IX gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 0.0 90% ...

FBH1 co-operates with MUS81 in inducing DNA double-strand breaks and cell death following replication stress

DEFF Research Database (Denmark)

Fugger, Kasper; Chu, Wai Kit; Haahr, Peter

2013-01-01

The molecular events occurring following the disruption of DNA replication forks are poorly characterized, despite extensive use of replication inhibitors such as hydroxyurea in the treatment of malignancies. Here, we identify a key role for the FBH1 helicase in mediating DNA double-strand break...... formation following replication inhibition. We show that FBH1-deficient cells are resistant to killing by hydroxyurea, and exhibit impaired activation of the pro-apoptotic factor p53, consistent with decreased DNA double-strand break formation. Similar findings were obtained in murine ES cells carrying...... of replication stress. Our data suggest that FBH1 helicase activity is required to eliminate cells with excessive replication stress through the generation of MUS81-induced DNA double-strand breaks....

The French Muséum national d'histoire naturelle vascular plant herbarium collection dataset

Science.gov (United States)

Le Bras, Gwenaël; Pignal, Marc; Jeanson, Marc L.; Muller, Serge; Aupic, Cécile; Carré, Benoît; Flament, Grégoire; Gaudeul, Myriam; Gonçalves, Claudia; Invernón, Vanessa R.; Jabbour, Florian; Lerat, Elodie; Lowry, Porter P.; Offroy, Bérangère; Pimparé, Eva Pérez; Poncy, Odile; Rouhan, Germinal; Haevermans, Thomas

2017-02-01

We provide a quantitative description of the French national herbarium vascular plants collection dataset. Held at the Muséum national d'histoire naturelle, Paris, it currently comprises records for 5,400,000 specimens, representing 90% of the estimated total of specimens. Ninety nine percent of the specimen entries are linked to one or more images and 16% have field-collecting information available. This major botanical collection represents the results of over three centuries of exploration and study. The sources of the collection are global, with a strong representation for France, including overseas territories, and former French colonies. The compilation of this dataset was made possible through numerous national and international projects, the most important of which was linked to the renovation of the herbarium building. The vascular plant collection is actively expanding today, hence the continuous growth exhibited by the dataset, which can be fully accessed through the GBIF portal or the MNHN database portal (available at: https://science.mnhn.fr/institution/mnhn/collection/p/item/search/form). This dataset is a major source of data for systematics, global plants macroecological studies or conservation assessments.

The French Muséum national d’histoire naturelle vascular plant herbarium collection dataset

Science.gov (United States)

Le Bras, Gwenaël; Pignal, Marc; Jeanson, Marc L.; Muller, Serge; Aupic, Cécile; Carré, Benoît; Flament, Grégoire; Gaudeul, Myriam; Gonçalves, Claudia; Invernón, Vanessa R.; Jabbour, Florian; Lerat, Elodie; Lowry, Porter P.; Offroy, Bérangère; Pimparé, Eva Pérez; Poncy, Odile; Rouhan, Germinal; Haevermans, Thomas

2017-01-01

We provide a quantitative description of the French national herbarium vascular plants collection dataset. Held at the Muséum national d’histoire naturelle, Paris, it currently comprises records for 5,400,000 specimens, representing 90% of the estimated total of specimens. Ninety nine percent of the specimen entries are linked to one or more images and 16% have field-collecting information available. This major botanical collection represents the results of over three centuries of exploration and study. The sources of the collection are global, with a strong representation for France, including overseas territories, and former French colonies. The compilation of this dataset was made possible through numerous national and international projects, the most important of which was linked to the renovation of the herbarium building. The vascular plant collection is actively expanding today, hence the continuous growth exhibited by the dataset, which can be fully accessed through the GBIF portal or the MNHN database portal (available at: https://science.mnhn.fr/institution/mnhn/collection/p/item/search/form). This dataset is a major source of data for systematics, global plants macroecological studies or conservation assessments. PMID:28195585

Penelitian Pendahuluan Pengaruh Daun Manggis sebagai Rodentisida Nabati pada Mencit Mus musculus Strain Balepsi

Directory of Open Access Journals (Sweden)

Agus Kardinan

2000-07-01

Full Text Available Research has been conducted at Pest and Disease Laboratory, Research Institute for Spices and Medicinal Crops, Bogor, during 1997-1998. The objective was to evaluate the possibility of Mangosteen (Garcinia mangostana leaves to be used as botanical rodenticide which is tested to reproduction ability of mice Mus musculus. Eight to ten weeks old mice with the average weight of 25 gram were obtained from Research Institute for Livestock, Ciawi. Research was arranged at randomized block design, 8 treatments and 4 replications. Data was analyzed by determining the average value and their standard deviation values. Observations were done to the weight of testis, weight of embryo, number of embryo, volume of extracts drank by mice and mice behavior during experiment. Result revealed that there was no indication that the leaves extract affected the weight of testis, but it affected the number and weight of embryo. There was indication that mangosteen leaves acted as antifertility on mice. Giving leaves extract increased the total volume of extract drink. There was no abnormality at the activity of mice during experiment, included sex activity, poisonous symptoms and others.

Seven harmonic susceptibility in oxygen and hydrogen loading of sintered YBCO by {mu}s pulsed electrolysis in an aqueous solution at room temperature

Energy Technology Data Exchange (ETDEWEB)

Tripodi, P.; Di Gioacchino, D.; Celani, F. [Istituto Nazionale di Fisica Nucleare, Frascati (Italy). Lab. Nazionale di Frascati

1996-09-01

The complex AC susceptibility of high T{sub c} superconducting materials has been described in terms of the first seven harmonic component of Fourier series. Has been measured the {chi}{sub n} (n=1,7) of sintered YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO) bulk oxygen and hydrogen loaded samples versus amplitude and frequency of AC magnetic field at fixed temperature. The sample have been loaded by {mu}s current pulses electrolysis in an aqueous solution (0.3N LiOH+H{sub 2}O) at room temperature. In addition to the simplicity of the experimental setup, this procedure allows to obtain extremely high equivalent hydrogen/oxygen gas pressure on the surface of the electrodes. The YBCO electrode is polarized by short pulse width (0.5-10 {mu}s) and high power (120 W) peaks with a variable repetition rate (0.1-10000 Hz). The pulses are obtained by an home.made pulse generator. The difference in the behavior of the susceptibilities harmonic component between the deficiency and oxygen or hydrogen loaded samples give us the possibility to connect the susceptibilities with variations of the flux pinning in respect to normal losses in the superconducting materials. The loading can be a good probe to have information on the mechanism of the processes that sustain the critical current density Jc in this situation these affects appear strongly dependent on the loading conditions. By comparison of this measurements has been observed drastic change in behavior of susceptibility.

AcEST: DK952111 [AcEST

Lifescience Database Archive (English)

Full Text Available P1254_THEMA Phosphorylated carbohydrates phosphatase T... 33 0.91 sp|P97347|RPTN_MOUSE Repetin OS=Mus muscul...----RPGVEAYLNAAKDLGLKIGL 106 Query: 582 CSTSNELAVS 611 S+S+ VS Sbjct: 107 ASSSDYKWVS 116 >sp|Q9X0Y1|P1254_THEMA Phosphorylated carboh...ydrates phosphatase TM_1254 OS=Thermotoga maritima GN=TM_1254 PE=1 SV=1 Length = 21

The Mouse Genome Database (MGD): facilitating mouse as a model for human biology and disease.

Science.gov (United States)

Eppig, Janan T; Blake, Judith A; Bult, Carol J; Kadin, James A; Richardson, Joel E

2015-01-01

The Mouse Genome Database (MGD, http://www.informatics.jax.org) serves the international biomedical research community as the central resource for integrated genomic, genetic and biological data on the laboratory mouse. To facilitate use of mouse as a model in translational studies, MGD maintains a core of high-quality curated data and integrates experimentally and computationally generated data sets. MGD maintains a unified catalog of genes and genome features, including functional RNAs, QTL and phenotypic loci. MGD curates and provides functional and phenotype annotations for mouse genes using the Gene Ontology and Mammalian Phenotype Ontology. MGD integrates phenotype data and associates mouse genotypes to human diseases, providing critical mouse-human relationships and access to repositories holding mouse models. MGD is the authoritative source of nomenclature for genes, genome features, alleles and strains following guidelines of the International Committee on Standardized Genetic Nomenclature for Mice. A new addition to MGD, the Human-Mouse: Disease Connection, allows users to explore gene-phenotype-disease relationships between human and mouse. MGD has also updated search paradigms for phenotypic allele attributes, incorporated incidental mutation data, added a module for display and exploration of genes and microRNA interactions and adopted the JBrowse genome browser. MGD resources are freely available to the scientific community. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

Optimization of the virtual mouse HeadMouse to foster its classroom use by children with physical disabilities

Directory of Open Access Journals (Sweden)

Merce TEIXIDO

2014-03-01

Full Text Available This paper presents the optimization of a virtual mouse called HeadMouse in order to foster its classroom use by children with physical disabilities. HeadMouse is an absolute virtual mouse that converts head movements in cursor displacement and facial gestures in click actions. The virtual mouse combines different image processing algorithms: face detection, pattern matching and optical flow in order to emulate the behaviour of a conventional computer mouse. The original implementation of HeadMouse requires large computational power and this paper proposes specific optimizations in order to enable its use by children with disabilities in standard low cost classroom computers.

A Deconvolution Protocol for ChIP-Seq Reveals Analogous Enhancer Structures on the Mouse and Human Ribosomal RNA Genes

Directory of Open Access Journals (Sweden)

Jean-Clement Mars

2018-01-01

Full Text Available The combination of Chromatin Immunoprecipitation and Massively Parallel Sequencing, or ChIP-Seq, has greatly advanced our genome-wide understanding of chromatin and enhancer structures. However, its resolution at any given genetic locus is limited by several factors. In applying ChIP-Seq to the study of the ribosomal RNA genes, we found that a major limitation to resolution was imposed by the underlying variability in sequence coverage that very often dominates the protein–DNA interaction profiles. Here, we describe a simple numerical deconvolution approach that, in large part, corrects for this variability, and significantly improves both the resolution and quantitation of protein–DNA interaction maps deduced from ChIP-Seq data. This approach has allowed us to determine the in vivo organization of the RNA polymerase I preinitiation complexes that form at the promoters and enhancers of the mouse (Mus musculus and human (Homo sapiens ribosomal RNA genes, and to reveal a phased binding of the HMG-box factor UBF across the rDNA. The data identify and map a “Spacer Promoter” and associated stalled polymerase in the intergenic spacer of the human ribosomal RNA genes, and reveal a very similar enhancer structure to that found in rodents and lower vertebrates.

Camouflage effects of various colour-marking morphs against different microhabitat backgrounds in a polymorphic pygmy grasshopper Tetrix japonica.

Science.gov (United States)

Tsurui, Kaori; Honma, Atsushi; Nishida, Takayoshi

2010-07-06

Colour-marking polymorphism is widely distributed among cryptic species. To account for the adaptive significance of such polymorphisms, several hypotheses have been proposed to date. Although these hypotheses argue over the degree of camouflage effects of marking morphs (and the interactions between morphs and their microhabitat backgrounds), as far as we know, most empirical evidence has been provided under unnatural conditions (i.e., using artificial prey). Tetrix japonica, a pygmy grasshopper, is highly polymorphic in colour-markings and occurs in both sand and grass microhabitats. Even within a microhabitat, T. japonica is highly polymorphic. Using humans as dummy predators and printed photographs in which various morphs of grasshoppers were placed against different backgrounds, we addressed three questions to test the neutral, background heterogeneity, and differential crypsis hypotheses in four marking-type morphs: 1) do the morphs differ in the degree of crypsis in each microhabitat, 2) are different morphs most cryptic in specific backgrounds of the microhabitats, and 3) does the morph frequency reflect the degree of crypsis? The degree of camouflage differed among the four morphs; therefore, the neutral hypothesis was rejected. Furthermore, the order of camouflage advantage among morphs differed depending on the two types of backgrounds (sand and grass), although the grass background consistently provided greater camouflage effects. Thus, based on our results, we could not reject the background heterogeneity hypothesis. Under field conditions, the more cryptic morphs comprised a minority of the population. Overall, our results demonstrate that the different morphs were not equivalent in the degree of crypsis, but the degree of camouflage of the morphs was not consistent with the morph frequency. These findings suggest that trade-offs exist between the camouflage benefit of body colouration and other fitness components, providing a better understanding of

Camouflage effects of various colour-marking morphs against different microhabitat backgrounds in a polymorphic pygmy grasshopper Tetrix japonica.

Directory of Open Access Journals (Sweden)

Kaori Tsurui

2010-07-01

Full Text Available Colour-marking polymorphism is widely distributed among cryptic species. To account for the adaptive significance of such polymorphisms, several hypotheses have been proposed to date. Although these hypotheses argue over the degree of camouflage effects of marking morphs (and the interactions between morphs and their microhabitat backgrounds, as far as we know, most empirical evidence has been provided under unnatural conditions (i.e., using artificial prey.Tetrix japonica, a pygmy grasshopper, is highly polymorphic in colour-markings and occurs in both sand and grass microhabitats. Even within a microhabitat, T. japonica is highly polymorphic. Using humans as dummy predators and printed photographs in which various morphs of grasshoppers were placed against different backgrounds, we addressed three questions to test the neutral, background heterogeneity, and differential crypsis hypotheses in four marking-type morphs: 1 do the morphs differ in the degree of crypsis in each microhabitat, 2 are different morphs most cryptic in specific backgrounds of the microhabitats, and 3 does the morph frequency reflect the degree of crypsis?The degree of camouflage differed among the four morphs; therefore, the neutral hypothesis was rejected. Furthermore, the order of camouflage advantage among morphs differed depending on the two types of backgrounds (sand and grass, although the grass background consistently provided greater camouflage effects. Thus, based on our results, we could not reject the background heterogeneity hypothesis. Under field conditions, the more cryptic morphs comprised a minority of the population. Overall, our results demonstrate that the different morphs were not equivalent in the degree of crypsis, but the degree of camouflage of the morphs was not consistent with the morph frequency. These findings suggest that trade-offs exist between the camouflage benefit of body colouration and other fitness components, providing a better

Efficacy of a combination of 10% imidacloprid and 1% moxidectin against Caparinia tripilis in African pygmy hedgehog (Atelerix albiventris

Directory of Open Access Journals (Sweden)

Kim Kyu-Rim

2012-08-01

Full Text Available Abstract Background The efficacy and safety of a combination formulation of 10% imidacloprid + 1.0% moxidectin spot-on (Advocate® for Cats, Bayer Animal Health GmbH, Leverkusen, Germany was tested in 40 African pygmy hedgehogs (Atelerix albiventris naturally infested with Caparinia tripilis. Methods The optimal dosage level of the combination for hedgehogs was determined by assigning 20 hedgehogs into three treatment groups (0.1, 0.4 and 1.6 ml/Kg b.w., and one untreated control group of 5 hedgehogs each. Twenty naturally infested hedgehogs were then randomly assigned to either treatment or control group with 10 animals each, and the number of live mites was counted from 13 body regions on day 0, 3, 9, 16, and 30 after single treatment at the dosage level of 0.1 ml/Kg. Results Before the chemotherapy, the highest density of mite was observed in external ear canals followed by the dorsal and the lowest in the ventral regions of the body surface. The dosage level of 0.1 ml/Kg, which corresponded to the recommended dosage level for cats, containing 10 mg imidacloprid and 1 mg moxidectin was also the optimal dosage level for hedgehogs. No hedgehogs in the treatment group showed live mites from day 3 post treatment. Side effects such as ataxia, depression, nausea, and weight fluctuation were not observed during the whole period of study. Conclusions This report suggests that a combination formulation of 0.1 ml/Kg of 10% imidacloprid + 1% moxidectin spot-on for cats is also useful for the control of Caparinia tripilis infestation in hedgehogs.

Isolation and characterization of a pseudoautosomal region-specific genetic marker in C57BL/6 mice using genomic representational difference analysis.

Science.gov (United States)

Kalcheva, I D; Matsuda, Y; Plass, C; Chapman, V M

1995-12-19

Representational difference analysis was used to identify strain-specific differences in the pseudoautosomal region (PAR) of mouse X and Y chromosomes. One second generation (C57BL/6 x Mus spretus) x Mus spretus interspecific backcross male carrying the C57BL/6 (B6) PAR was used for tester DNA. DNA from five backcross males from the same generation that were M. spretus-type for the PAR was pooled for the driver. A cloned probe designated B6-38 was recovered that is B6-specific in Southern analysis. Analysis of genomic DNA from several inbred strains of laboratory mice and diverse Mus species and subspecies identified a characteristic Pst I pattern of fragment sizes that is present only in the C57BL family of strains. Hybridization was observed with sequences in DBA/2J and to a limited extent with Mus musculus (PWK strain) and Mus castaneus DNA. No hybridization was observed in DNA of different Mus species, M. spretus, M. hortulanus, and M. caroli. Genetic analyses of B6-38 was conducted using C57BL congenic males that carry M. spretus alleles for distal X chromosome loci and the PAR and outcrosses of heterozygous congenic females with M. spretus. These analyses demonstrated that the B6-38 sequences were inherited with both the X and Y chromosome. B6-38 sequences were genetically mapped as a locus within the PAR using two interspecific backcrosses. The locus defined by B6-38 is designated DXYRp1. Preliminary analyses of recombination between the distal X chromosome gene amelogenin (Amg) and the PAR loci for either TelXY or sex chromosome association (Sxa) suggest that the locus DXYRp1 maps to the distal portion of the PAR.

No evidence for punishment in communally nursing female house mice (Mus musculus domesticus).

Science.gov (United States)

Ferrari, Manuela; König, Barbara

2017-01-01

Punishment is claimed as an important mechanism to stabilise costly cooperation in humans, but its importance in social animals has been questioned recently due to both conceptual considerations and a lack of empirical evidence (only few published studies). We empirically tested whether there is evidence for punishment in communally nursing house mice (Mus musculus domesticus, direct descendants of "wild" animals). Communally breeding females pool their litters and raise all offspring together, indiscriminately caring for own and other offspring. Such a situation resembles a public good and provides scope for exploitation if females vary in their relative contributions to the joint nest (offspring number). We allowed two females to communally breed and conducted removal experiments both in the presence and absence of pups. We aimed to test whether reduced investment by one of the females (induced through separation from the partner and their combined offspring for 4 or 12 hours) leads to increased aggression by the other female after the reunion. We found no evidence for punishment, on the contrary, females increased socio-positive behaviours. The costs of losing a partner in a communally breeding species might be too high and hinder the evolution of punishment. Our findings add to a growing list of examples questioning the role of punishment in cooperating non-human animals and emphasise the importance of empirical testing of its assumptions and predictions.

Development of mPMab-1, a Mouse-Rat Chimeric Antibody Against Mouse Podoplanin.

Science.gov (United States)

Yamada, Shinji; Kaneko, Mika K; Nakamura, Takuro; Ichii, Osamu; Konnai, Satoru; Kato, Yukinari

2017-04-01

Podoplanin (PDPN), the ligand of C-type lectin-like receptor-2, is used as a lymphatic endothelial marker. We previously established clone PMab-1 of rat IgG 2a as a specific monoclonal antibody (mAb) against mouse PDPN. PMab-1 is also very sensitive in immunohistochemical analysis; however, rat mAbs seem to be unfavorable for pathologists because anti-mouse IgG and anti-rabbit IgG are usually used as secondary antibodies in commercially available kits for immunohistochemical analysis. In this study, we develop a mouse-rat chimeric antibody, mPMab-1 of mouse IgG 2a , which was derived from rat PMab-1 mAb. Immunohistochemical analysis shows that mPMab-1 detects podocytes of the kidney, lymphatic endothelial cells of the colon, and type I alveolar cells of the lung. Importantly, mPMab-1 is more sensitive than PMab-1. This conversion strategy from rat mAb to mouse mAb could be applicable to other mAbs.

Gaze beats mouse

DEFF Research Database (Denmark)

Mateo, Julio C.; San Agustin, Javier; Hansen, John Paulin

2008-01-01

Facial EMG for selection is fast, easy and, combined with gaze pointing, it can provide completely hands-free interaction. In this pilot study, 5 participants performed a simple point-and-select task using mouse or gaze for pointing and a mouse button or a facial-EMG switch for selection. Gaze...

Les vélins du Muséum national d’histoire naturelle : une collection mise en lumière

OpenAIRE

Cardinal, Catherine

2018-01-01

Une exposition unique au Cabinet d’histoire du Jardin des plantes Très rarement, le public a pu voir la collection d’images de fleurs, de plantes, d’oiseaux et de mammifères, déposée à la bibliothèque centrale du Musée national d’histoire naturelle. La fragilité des peintures sur vélin au contact de l’air humide et de la lumière explique les précautions prises à leur égard. L’exposition d’environ cent cinquante pièces au sein du Cabinet d’histoire, d’octobre 2016 à janvier 2017, a donc consti...

Dicty_cDB: Contig-U03911-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) lag90e01.y1 Colon epithelia progenitors cDNA Mus ... 64 3e-13 2 ( AV452059 ) Mus musculus cDNA, Abe mouse ES cell cDNA library..... 64 8e-14 2 ( DT212191 ) N124_F10 Non embryogenic SSH library Cichorium in... 46 1e-13 4 ( DJ025875 ) Geno...eatus... 66 7e-12 2 ( AW739394 ) gb41d01.y1 Moss EST library PPN Physcomitrella pa... ...78 1e-11 2 ( BI741051 ) gc93a05.y1 Moss EST library PPN Physcomitrella pa... 78 1...10 2 ( BI741781 ) gc90g06.y1 Moss EST library PPN Physcomitrella pa... 74 2e-10 2 ( BU965247 ) sat08a12.y1 G

76 FR 20706 - South Farallon Islands Nonnative Mouse Eradication Project; Farallon National Wildlife Refuge...

Science.gov (United States)

2011-04-13

... Noonday Rock. In 1969 the Refuge was expanded to include the South Farallon Islands and is still managed... eradicate nonnative mice from the South Farallon Islands, part of the Farallon National Wildlife Refuge off... eradicate nonnative house mice (Mus musculus) from the South Farallon Islands. The purpose of this project...

Assessment of plasminogen synthesis in vitro by mouse tumor cells using a competition radioimmunoassay for mouse plasminogen

International Nuclear Information System (INIS)

Roblin, R.O.; Bell, T.E.; Young, P.L.

1978-01-01

A sensitive, specific competition radioimmunoassay for mouse plasmin(ogen) has been developed in order to determine whether mouse tumor cells can synthesize plasminogen in vitro. The rabbit anti-BALB/c mouse plasminogen antibodies used in the assay react with the plasminogen present in serum from BALB/c, C3H, AKR and C57BL/6 mice, and also recognized mouse plasmin. The competition radiommunoassay can detect as little as 50 ng of mouse plasminogen. No competition was observed with preparations of fetal calf, human and rabbit plasminogens. A variety of virus-transformed and mouse tumor cell lines were all found to contain less than 100 ng mouse plasminogen/mg of cell extract protein. Thus, if the plasminogen activator/plasmin system is important in the growth or movement of this group of tumor cells, the cells will be dependent upon the circulatory system of the host for their plasminogen supply. (Auth.)

[Autoantibody formation against the antigens of the synaptonemal complex in the syngeneic immunization of male Mus musculus].

Science.gov (United States)

Dadashev, S Ia; Gorach, G G; Kolomiets, O L

1994-01-01

Male mice were immunized with the suspension of synaptonemal complexes (SC) isolated from mouse spermatocytes nuclei. The indirect immunofluorescent analysis showed the active binding of sera obtained from immunized mice to SC of mouse spermatocyte spreads. At early and mid-pachytene, SC can be clearly identified in 19 autosome bivalents and in sex chromosome bivalent. According to the electron microscopic analysis, all structural elements of SC bind antibodies. Metaphase chromosomes were not stained with the immune sera. Specificity of interaction between SC components and antibodies was confirmed in a series of control experiments. Analysis of sera obtained from mice after their syngeneic immunization with isolated SC fraction suggested that certain mouse SC components induce the formation of autoantibodies. This, in turn, suggests that these SC components are meiosis-specific.

Genetic localization and phenotypic expression of X-linked cataract (Xcat) in Mus musculus.

Science.gov (United States)

Favor, J; Pretsch, W

1990-01-01

Linkage data relative to the markers tabby and glucose-6-phosphate dehydrogenase are presented to locate X-linked cataract (Xcat) in the distal portion of the mouse X-chromosome between jimpy and hypophosphatemia. The human X-linked cataract-dental syndrome, Nance-Horan Syndrome, also maps closely to human hypophosphatemia and would suggest homology between mouse Xcat and human Nance-Horan Syndrome genes. In hemizygous males and homozygous females penetrance is complete with only slight variation in the degree of expression. Phenotypic expression in Xcat heterozygous females ranges from totally clear to totally opaque lenses. The phenotypic expression between the two lenses of a heterozygous individual could also vary between totally clear and totally opaque lenses. However, a correlation in the degree of expression between the eyes of an individual was observed. A variegated pattern of lens opacity was evident in female heterozygotes. Based on these observations, the site of gene action for the Xcat locus is suggested to be endogenous to the lens cells and the precursor cell population of the lens is concluded to be small. The identification of an X-linked cataract locus is an important contribution to the estimate of the number of mutable loci resulting in cataract, an estimate required so that dominant cataract mutagenesis results may be expressed on a per locus basis. The Xcat mutation may be a useful marker for a distal region of the mouse X-chromosome which is relatively sparsely marked and the X-linked cataract mutation may be employed in gene expression and lens development studies.

Presencia de los géneros invasores Mus y Rattus en áreas naturales de Chile: un riesgo ambiental y epidemiológico Presence of the invasive genera Mus and Rattus in natural areas in Chile: an environmental and epidemiological risk

Directory of Open Access Journals (Sweden)

GABRIEL LOBOS

2005-03-01

Full Text Available Realizamos un estudio que incluyó muestreos y prospecciones en un gradiente latitudinal en Chile continental para determinar la presencia y ausencia de roedores murinos introducidos, particularmente Mus musculus, Rattus rattus y R. norvegicus en áreas naturales o silvestres a lo largo de Chile. Además se analizó el riesgo epidemiológico que representan estas especies en el marco de un estudio sobre el virus Hanta. Los resultados mostraron que M. musculus rara vez es recolectado en áreas naturales. Sin embargo, las dos especies de Rattus han invadido ampliamente la región mediterránea chilena. Las regiones desérticas, los ambientes de alturas y las regiones australes, serían biótopos restringidos para estos invasores. Desde una perspectiva epidemiológica, la presencia del virus Hanta (variedades Andes y Seoul en Rattus es un elemento que demuestra que las especies invasoras además de generar impactos ecológicos, pueden ocasionar problemas económicos y de salud pública. La fragilidad de los ecosistemas mediterráneos determina que la presencia de especies exóticas constituya un elemento de alto riesgo para la conservación del patrimonio natural del país. Probablemente, la conservación de áreas naturales constituye la mejor herramienta para enfrentar a estas especies exóticasWe conducted a latitudinal study in natural areas of continental Chile to evaluate the occurrence of the introduced murine rodents Mus musculus, Rattus rattus and R. norvegicus. Furthermore, we evaluated the epidemiological risk of these species as part of an ongoing study on Hantavirus. The results allowed us to conclude that M. musculus occurs rarely in natural environments. However, the two species of Rattus have widely invaded the mediterranean region of Chile. Desert, altitudinal and high latitude regions seem to be restricted areas for these invasive rodents. From an epidemiological perspective, the occurrence of Hantavirus in Rattus (Andes and Seoul

The Mouse Tumor Biology Database: A Comprehensive Resource for Mouse Models of Human Cancer.

Science.gov (United States)

Krupke, Debra M; Begley, Dale A; Sundberg, John P; Richardson, Joel E; Neuhauser, Steven B; Bult, Carol J

2017-11-01

Research using laboratory mice has led to fundamental insights into the molecular genetic processes that govern cancer initiation, progression, and treatment response. Although thousands of scientific articles have been published about mouse models of human cancer, collating information and data for a specific model is hampered by the fact that many authors do not adhere to existing annotation standards when describing models. The interpretation of experimental results in mouse models can also be confounded when researchers do not factor in the effect of genetic background on tumor biology. The Mouse Tumor Biology (MTB) database is an expertly curated, comprehensive compendium of mouse models of human cancer. Through the enforcement of nomenclature and related annotation standards, MTB supports aggregation of data about a cancer model from diverse sources and assessment of how genetic background of a mouse strain influences the biological properties of a specific tumor type and model utility. Cancer Res; 77(21); e67-70. ©2017 AACR . ©2017 American Association for Cancer Research.

Mechanistic basis of infertility of mouse intersubspecific hybrids

Science.gov (United States)

Bhattacharyya, Tanmoy; Gregorova, Sona; Mihola, Ondrej; Anger, Martin; Sebestova, Jaroslava; Denny, Paul; Simecek, Petr; Forejt, Jiri

2013-01-01

According to the Dobzhansky–Muller model, hybrid sterility is a consequence of the independent evolution of related taxa resulting in incompatible genomic interactions of their hybrids. The model implies that the incompatibilities evolve randomly, unless a particular gene or nongenic sequence diverges much faster than the rest of the genome. Here we propose that asynapsis of heterospecific chromosomes in meiotic prophase provides a recurrently evolving trigger for the meiotic arrest of interspecific F1 hybrids. We observed extensive asynapsis of chromosomes and disturbance of the sex body in >95% of pachynemas of Mus m. musculus × Mus m. domesticus sterile F1 males. Asynapsis was not preceded by a failure of double-strand break induction, and the rate of meiotic crossing over was not affected in synapsed chromosomes. DNA double-strand break repair was delayed or failed in unsynapsed autosomes, and misexpression of chromosome X and chromosome Y genes was detected in single pachynemas and by genome-wide expression profiling. Oocytes of F1 hybrid females showed the same kind of synaptic problems but with the incidence reduced to half. Most of the oocytes with pachytene asynapsis were eliminated before birth. We propose the heterospecific pairing of homologous chromosomes as a preexisting condition of asynapsis in interspecific hybrids. The asynapsis may represent a universal mechanistic basis of F1 hybrid sterility manifested by pachytene arrest. It is tempting to speculate that a fast-evolving subset of the noncoding genomic sequence important for chromosome pairing and synapsis may be the culprit. PMID:23329330

Acute Radiation Syndrome Severity Score System in Mouse Total-Body Irradiation Model.

Science.gov (United States)

Ossetrova, Natalia I; Ney, Patrick H; Condliffe, Donald P; Krasnopolsky, Katya; Hieber, Kevin P

2016-08-01

Radiation accidents or terrorist attacks can result in serious consequences for the civilian population and for military personnel responding to such emergencies. The early medical management situation requires quantitative indications for early initiation of cytokine therapy in individuals exposed to life-threatening radiation doses and effective triage tools for first responders in mass-casualty radiological incidents. Previously established animal (Mus musculus, Macaca mulatta) total-body irradiation (γ-exposure) models have evaluated a panel of radiation-responsive proteins that, together with peripheral blood cell counts, create a multiparametic dose-predictive algorithm with a threshold for detection of ~1 Gy from 1 to 7 d after exposure as well as demonstrate the acute radiation syndrome severity score systems created similar to the Medical Treatment Protocols for Radiation Accident Victims developed by Fliedner and colleagues. The authors present a further demonstration of the acute radiation sickness severity score system in a mouse (CD2F1, males) TBI model (1-14 Gy, Co γ-rays at 0.6 Gy min) based on multiple biodosimetric endpoints. This includes the acute radiation sickness severity Observational Grading System, survival rate, weight changes, temperature, peripheral blood cell counts and radiation-responsive protein expression profile: Flt-3 ligand, interleukin 6, granulocyte-colony stimulating factor, thrombopoietin, erythropoietin, and serum amyloid A. Results show that use of the multiple-parameter severity score system facilitates identification of animals requiring enhanced monitoring after irradiation and that proteomics are a complementary approach to conventional biodosimetry for early assessment of radiation exposure, enhancing accuracy and discrimination index for acute radiation sickness response categories and early prediction of outcome.

Effect of Physalis peruviana "tomatillo" fruit extract in Mus musculus var. swis with induced hyperlipidemi.

Directory of Open Access Journals (Sweden)

Julio Campos Florián

2011-06-01

Full Text Available The objective of this research was to determine the hypolipidemic activity of the fruit of Physalis peruviana "tomatillo" in a model of acute hyperlipidemia induced by triton. Mus musculus var. swis males as experimental animals. We worked with four groups of mice, the white group received distilled water orally and saline intraperitoneally, the control group received distilled water orally and intraperitoneally triton, the problem group 1 received orally 0.05g/100g Physalis peruviana extract intraperitoneally and triton and the problem group 2 received orally 0.2g/100g extract of Physalis peruviana and triton intraperitoneally. After 24 hours of administering the treatments were performed measurements of serum cholesterol and triglycerides. Mean levels of cholesterol (mg/dL were: 58.87 ± 11.54 (white, 121.71 ± 15.00 (control, 58.08 ± 9.21 (Problem 1 and 66 78 ± 16.77 (Problem 2. Average levels of triglycerides (g /L were: 0.48 ± 0.07 (white, 1.84 ± 0.18 (control, 0.34 ± 0.10 (Problem 1 and 0.94 ± 0.25 (Problem 2. We found significant reductions (p <0.000 concentrations of both cholesterol and triglycerides in relation to those obtained in the group treated only with Triton.

The Mouse That Soared

Science.gov (United States)

2004-09-01

Astronomers have used an X-ray image to make the first detailed study of the behavior of high-energy particles around a fast moving pulsar. The image, from NASA's Chandra X-ray Observatory, shows the shock wave created as a pulsar plows supersonically through interstellar space. These results will provide insight into theories for the production of powerful winds of matter and antimatter by pulsars. Chandra's image of the glowing cloud, known as the Mouse, shows a stubby bright column of high-energy particles, about four light years in length, swept back by the pulsar's interaction with interstellar gas. The intense source at the head of the X-ray column is the pulsar, estimated to be moving through space at about 1.3 million miles per hour. VLA Radio Image of the Mouse, Full Field VLA Radio Image of the Mouse, Full Field A cone-shaped cloud of radio-wave-emitting particles envelopes the X-ray column. The Mouse, a.k.a. G359.23-0.82, was discovered in 1987 by radio astronomers using the National Science Foundation's Very Large Array in New Mexico. It gets its name from its appearance in radio images that show a compact snout, a bulbous body, and a remarkable long, narrow, tail that extends for about 55 light years. "A few dozen pulsar wind nebulae are known, including the spectacular Crab Nebula, but none have the Mouse's combination of relatively young age and incredibly rapid motion through interstellar space," said Bryan Gaensler of the Harvard-Smithsonian Center for Astrophysics and lead author of a paper on the Mouse that will appear in an upcoming issue of The Astrophysical Journal. "We effectively are seeing a supersonic cosmic wind tunnel, in which we can study the effects of a pulsar's motion on its pulsar wind nebula, and test current theories." Illustration of the Mouse System Illustration of the Mouse System Pulsars are known to be rapidly spinning, highly magnetized neutron stars -- objects so dense that a mass equal to that of the Sun is packed into a

Burn mouse models

DEFF Research Database (Denmark)

Calum, Henrik; Høiby, Niels; Moser, Claus

2014-01-01

Severe thermal injury induces immunosuppression, involving all parts of the immune system, especially when large fractions of the total body surface area are affected. An animal model was established to characterize the burn-induced immunosuppression. In our novel mouse model a 6 % third-degree b......Severe thermal injury induces immunosuppression, involving all parts of the immune system, especially when large fractions of the total body surface area are affected. An animal model was established to characterize the burn-induced immunosuppression. In our novel mouse model a 6 % third...... with infected burn wound compared with the burn wound only group. The burn mouse model resembles the clinical situation and provides an opportunity to examine or develop new strategies like new antibiotics and immune therapy, in handling burn wound victims much....

A Transgenic Tri-Modality Reporter Mouse

OpenAIRE

Yan, Xinrui; Ray, Pritha; Paulmurugan, Ramasamy; Tong, Ricky; Gong, Yongquan; Sathirachinda, Ataya; Wu, Joseph C.; Gambhir, Sanjiv S.

2013-01-01

Transgenic mouse with a stably integrated reporter gene(s) can be a valuable resource for obtaining uniformly labeled stem cells, tissues, and organs for various applications. We have generated a transgenic mouse model that ubiquitously expresses a tri-fusion reporter gene (fluc2-tdTomato-ttk) driven by a constitutive chicken β-actin promoter. This "Tri-Modality Reporter Mouse" system allows one to isolate most cells from this donor mouse and image them for bioluminescent (fluc2), fluorescent...