WorldWideScience

Sample records for pvd

  1. Morphology of PVD films

    International Nuclear Information System (INIS)

    Carr, M.J.; Grotzky, V.K.; Helms, C.J.; Johns, W.L.; Naimon, E.R.; Rafalski, A.L.; Smith, C.J.

    1982-01-01

    Experimental data show that the morphology of PVD chromium coatings is dependent on substrate temperature, deposition rate, and the oxygen content of the chromium source material. For chromium containing about 700-ppM oxygen, a variety of morphologies can form depending on substrate temperature and deposition rate. For chromium contaning 1000 to 2000 ppM of oxygen, porous coatings of the Type IV variety are produced over essentially the full range of temperatures and rates possible with current coating equipment. For chromium containing less than about 400 ppM of oxygen, dense coatings of the Type I variety are produced over the range of temperatures and rates investigated

  2. High speed PVD thermal barrier coatings

    Energy Technology Data Exchange (ETDEWEB)

    Beele, W. [Sulzer Metco Coatings BV (Netherlands); Eschendorff, G. [Sulzer Metco Coatings BV (Netherlands); Eldim BV (Netherlands)

    2006-07-15

    The high speed PVD process (HS-PVD) combines gas phase coating synthesis with high deposition rates. The process has been demonstrated for high purity YSZ deposited as a chemically bonded top thermal barrier with columnar structure of EB-PVD features. The process can manufacture EB-PVD like coatings that match in regards to their TGO-formation and columnar structure. Coatings with a columnar structure formed by individual columns of 1/4 of the diameter of a classical EB-PVD type TBC have been deposited. These coatings have the potential to prove a significant reduction in thermal conductivity and in erosion performance. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  3. High speed PVD thermal barrier coatings

    International Nuclear Information System (INIS)

    Beele, W.; Eschendorff, G.

    2006-01-01

    The high speed PVD process (HS-PVD) combines gas phase coating synthesis with high deposition rates. The process has been demonstrated for high purity YSZ deposited as a chemically bonded top thermal barrier with columnar structure of EB-PVD features. The process can manufacture EB-PVD like coatings that match in regards to their TGO-formation and columnar structure. Coatings with a columnar structure formed by individual columns of 1/4 of the diameter of a classical EB-PVD type TBC have been deposited. These coatings have the potential to prove a significant reduction in thermal conductivity and in erosion performance. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  4. Surface coatings deposited by CVD and PVD

    International Nuclear Information System (INIS)

    Gabriel, H.M.

    1982-01-01

    The demand for wear and corrosion protective coatings is increasing due to economic facts. Deposition processes in gas atmospheres like the CVD and PVD processes attained a tremendous importance especially in the field of the deposition of thin hard refractory and ceramic coatings. CVD and PVD processes are reviewed in detail. Some examples of coating installations are shown and numerous applications are given to demonstrate the present state of the art. (orig.) [de

  5. Latest Developments in PVD Coatings for Tooling

    Directory of Open Access Journals (Sweden)

    Gabriela Strnad

    2010-06-01

    Full Text Available The paper presents the recent developments in the field of PVD coating for manufacturing tools. A review of monoblock, multilayer, nanocomposite, DLC and oxinitride coatings is discussed, with the emphasis on coatings which enables the manufacturers to implement high productivity processes such as high speed cutting and dry speed machining.

  6. PVD TBC experience on GE aircraft engines

    Science.gov (United States)

    Maricocchi, Antonio; Bartz, Andi; Wortman, David

    1995-01-01

    The higher performance levels of modern gas turbine engines present significant challenges in the reliability of materials in the turbine. The increased engine temperatures required to achieve the higher performance levels reduce the strength of the materials used in the turbine sections of the engine. Various forms of thermal barrier coatings (TBC's) have been used for many years to increase the reliability of gas turbine engine components. Recent experience with the physical vapor deposition (PVD) process using ceramic material has demonstrated success in extending the service life of turbine blades and nozzles. Engine test results of turbine components with a 125 micron (0.005 in) PVD TBC have demonstrated component operating temperatures of 56-83 C (100-150 F) lower than non-PVD TBC components. Engine testing has also revealed the TBC is susceptible to high angle particle impact damage. Sand particles and other engine debris impact the TBC surface at the leading edge of airfoils and fracture the PVD columns. As the impacting continues, the TBC erodes away in local areas. Analysis of the eroded areas has shown a slight increase in temperature over a fully coated area, however a significant temperature reduction was realized over an airfoil without TBC.

  7. New PVD Technologies for New Ordnance Coatings

    Science.gov (United States)

    2012-04-01

    characteristics using a Tantalum and a Chrome target; 4) Deposition of Ta coatings and reactive deposition of CrN; 5) Deposition parameters affecting film...Vapor Deposition (PVD); High Power Impulse Magnetron Sputtering (HIPIMS); Modulated Pulsed Power (MPP); Tantalum; Chrome ; Ta coatings; CrN; coating...The pre-production chemicals and acids are hazardous and hexavalent Cr is a known carcinogen. Significant annual expenditures are necessary to

  8. Ordered metal nanotube arrays fabricated by PVD.

    Science.gov (United States)

    Marquez, F; Morant, C; Campo, T; Sanz, J M; Elizalde, E

    2010-02-01

    In this work we report a simple method to fabricate ordered arrays of metal nanotubes. This method is based on the deposition of a metal by PVD onto an anodized aluminum oxide (AAO) template. The dimensions of the synthesized nanotubes depend both on the AAO template and on the deposited metal. In fact, it is observed that the aspect ratios of the nanotubes clearly depend significantly on the metal, ranging from 0.6 (Fe) to at least 3 (Zr).

  9. Structure and corrosion properties of PVD Cr-N coatings

    CERN Document Server

    Liu, C; Ziegele, H; Leyland, A; Matthews, A

    2002-01-01

    PVD Cr-N coatings produced by physical vapor deposition (PVD) are increasingly used for mechanical and tribological applications in various industrial sectors. These coatings are particularly attractive for their excellent corrosion resistance, which further enhances the lifetime and service quality of coated components. PVD Cr-N coated steels in an aqueous solution are usually corroded by galvanic attack via through-coating 'permeable' defects (e.g., pores). Therefore, the corrosion performance of Cr-N coated steel is determined by a number of variables of the coating properties and corrosive environment. These variables include: (i) surface continuity and uniformity; (ii) through-coating porosity; (iii) film density and chemical stability; (iv) growth stresses; (v) interfacial and intermediate layers; (vi) coating thickness; (vii) coating composition; and (viii) substrate properties. In this article, PVD Cr-N coatings were prepared, by electron-beam PVD and sputter deposition, with different compositions, t...

  10. Corrosion behaviour of Arc-PVD coatings and hybrid systems

    International Nuclear Information System (INIS)

    Reichel, K.

    1992-01-01

    To achieve a comprehensive protective effect against corrosion and wear stresses, coating systems are increasingly being developed, in which there is a separation of the tasks of the coating materials regarding the protective effect. On the one hand, pure PVD coating systems are used, on the other hand hybrid coatings are examined, where galvanic processes are combined with PVD technique. The results of experiments introduced in this article were determined on Arc-PVD coatings. By this process, titanium nitride and chromium nitride coatings are both deposited directly on the basic material and are also deposited as combination coatings of Ti/TiN and chemical nickel/TiN. (orig.) [de

  11. Overview of PVD wear resistant coatings

    International Nuclear Information System (INIS)

    Teeter, F.J.

    1999-01-01

    The combined functionality of wear-resistant and low-friction multilayer coatings has widened application possibilities for a new generation of coated tools. For the first time tool wear mechanisms are comprehensively addressed both at the cutting edge and contact areas away from the edge where chip evacuation is facilitated. Since its recent market introduction a combined TiA1N and WC/C PVD coating has been proven to increase cutting performance in various metal cutting operations, notably drilling and tapping of steels and aluminum alloys. Significant improvements have been obtained under dry as well as with coolant conditions. The results of laboratory metal cutting tests and field trials to date will be described. Correlations between chip formation / wear mechanisms and coating properties are given to explain the effectiveness of this coating. (author)

  12. Antibacterial Functionalization of PVD Coatings on Ceramics

    Directory of Open Access Journals (Sweden)

    Javier Osés

    2018-05-01

    Full Text Available The application of surface treatments that incorporate silver or copper as antibacterial elements has become a common practice for a wide variety of medical devices and materials because of their effective activity against nosocomial infections. Ceramic tiles are choice materials for cladding the floors and walls of operation rooms and other hospital spaces. This study is focused on the deposition of biocide physical vapor deposition (PVD coatings on glazed ceramic tiles. The objective was to provide antibacterial activity to the surfaces without worsening their mechanical properties. Silver and copper-doped chromium nitride (CrN and titanium nitride (TiN coatings were deposited on samples of tiles. A complete characterization was carried out in order to determine the composition and structure of the coatings, as well as their topographical and mechanical properties. The distribution of Ag and Cu within the coating was analyzed using glow discharge optical emission spectrometry (GD-OES and field emission scanning electron microscope (FE-SEM. Roughness, microhardness, and scratch resistance were measured for all of the combinations of coatings and dopants, as well as their wettability. Finally, tests of antibacterial efficacy against Staphylococcus aureus and Escherichia coli were carried out, showing that all of the doped coatings had pronounced biocide activity.

  13. Iron-regulated transcription of the pvdA gene in Pseudomonas aeruginosa: effect of Fur and PvdS on promoter activity.

    OpenAIRE

    Leoni, L; Ciervo, A; Orsi, N; Visca, P

    1996-01-01

    The pvdA gene, encoding the enzyme L-ornithine N5-oxygenase, catalyzes a key step of the pyoverdin biosynthetic pathway in Pseudomonas aeruginosa. Expression studies with a promoter probe vector made it possible to identify three tightly iron-regulated promoter regions in the 5.9-kb DNA fragment upstream of pvdA. The promoter governing pvdA expression was located within the 154-bp sequence upstream of the pvdA translation start site. RNA analysis showed that expression of PvdA is iron regulat...

  14. Structure And Properties Of PVD Coatings Deposited On Cermets

    Directory of Open Access Journals (Sweden)

    Żukowska L.

    2015-06-01

    Full Text Available The main aim of the research is the investigation of the structure and properties of single-layer and gradient coatings of the type (Ti,AlN and Ti(C,N deposited by physical vapour deposition technology (PVD on the cermets substrate.

  15. A chemically stable PVD multilayer encapsulation for lithium microbatteries

    International Nuclear Information System (INIS)

    Ribeiro, J F; Sousa, R; Cunha, D J; Vieira, E M F; Goncalves, L M; Silva, M M; Dupont, L

    2015-01-01

    A multilayer physical vapour deposition (PVD) thin-film encapsulation method for lithium microbatteries is presented. Lithium microbatteries with a lithium cobalt oxide (LiCoO 2 ) cathode, a lithium phosphorous oxynitride (LiPON) electrolyte and a metallic lithium anode are under development, using PVD deposition techniques. Metallic lithium film is still the most common anode on this battery technology; however, it presents a huge challenge in terms of material encapsulation (lithium reacts with almost any materials deposited on top and almost instantly begins oxidizing in contact with atmosphere). To prove the encapsulation concept and perform all the experiments, lithium films were deposited by thermal evaporation technique on top of a glass substrate, with previously patterned Al/Ti contacts. Three distinct materials, in a multilayer combination, were tested to prevent lithium from reacting with protection materials and atmosphere. These multilayer films were deposited by RF sputtering and were composed of lithium phosphorous oxide (LiPO), LiPON and silicon nitride (Si 3 N 4 ). To complete the long-term encapsulation after breaking the vacuum, an epoxy was applied on top of the PVD multilayer. In order to evaluate oxidation state of lithium films, the lithium resistance was measured in a four probe setup (cancelling wires/contact resistances) and resistivity calculated, considering physical dimensions. A lithium resistivity of 0.16 Ω μm was maintained for more than a week. This PVD multilayer exonerates the use of chemical vapour deposition (CVD), glove-box chambers and sample manipulation between them, significantly reducing the fabrication cost, since battery and its encapsulation are fabricated in the same PVD chamber. (paper)

  16. A chemically stable PVD multilayer encapsulation for lithium microbatteries

    Science.gov (United States)

    Ribeiro, J. F.; Sousa, R.; Cunha, D. J.; Vieira, E. M. F.; Silva, M. M.; Dupont, L.; Goncalves, L. M.

    2015-10-01

    A multilayer physical vapour deposition (PVD) thin-film encapsulation method for lithium microbatteries is presented. Lithium microbatteries with a lithium cobalt oxide (LiCoO2) cathode, a lithium phosphorous oxynitride (LiPON) electrolyte and a metallic lithium anode are under development, using PVD deposition techniques. Metallic lithium film is still the most common anode on this battery technology; however, it presents a huge challenge in terms of material encapsulation (lithium reacts with almost any materials deposited on top and almost instantly begins oxidizing in contact with atmosphere). To prove the encapsulation concept and perform all the experiments, lithium films were deposited by thermal evaporation technique on top of a glass substrate, with previously patterned Al/Ti contacts. Three distinct materials, in a multilayer combination, were tested to prevent lithium from reacting with protection materials and atmosphere. These multilayer films were deposited by RF sputtering and were composed of lithium phosphorous oxide (LiPO), LiPON and silicon nitride (Si3N4). To complete the long-term encapsulation after breaking the vacuum, an epoxy was applied on top of the PVD multilayer. In order to evaluate oxidation state of lithium films, the lithium resistance was measured in a four probe setup (cancelling wires/contact resistances) and resistivity calculated, considering physical dimensions. A lithium resistivity of 0.16 Ω μm was maintained for more than a week. This PVD multilayer exonerates the use of chemical vapour deposition (CVD), glove-box chambers and sample manipulation between them, significantly reducing the fabrication cost, since battery and its encapsulation are fabricated in the same PVD chamber.

  17. Recubrimientos por PVD decorativos sobre cerámicas

    Directory of Open Access Journals (Sweden)

    García, J. A.

    2006-08-01

    Full Text Available During the last years PVD coatings has been used for decorative purposes on ceramics and other substrates. Standards layers like TiN, CrN, TiCN, etc, give us the possibly of obtaining a wide range of colours, with a good mechanical, chemical properties. This paper gathers the works carried out in the Center of Advance Surface engineering of AIN during the three last years in the field of the decorative coatings. Different layer have been deposited by means of a METAPLAS 232 PVD equipment. A complete chemical and mechanical characterisation have been carried out on the different deposited layers like ultramicroindentation, scratch tests, wear resistance and GDOES.

    En los últimos años se ha venido estudiado la aplicabilidad de las técnicas de depósitos mediante métodos físicos en fase vapor (PVD, para la realización de recubrimientos sobre cerámicas y otros substratos con fines decorativos. Los recubrimientos estándar por PVD como el TiN, CrN, TiCN, etc, ofrecen la posibilidad de conseguir acabados de apariencia metálica, de una amplia gama de colores, y con buenas propiedades mecánicas y químicas, como resistencia a la abrasión, estabilidad térmica, o resistencia a la corrosión. En este trabajo se recogen las experiencias realizadas en el recubrimiento y caracterización de cerámicas decorativas, durante los tres últimos años, en el Centro de Ingeniería de Superficies de la Asociación de la Industria Navarra. Los distintos tipos de recubrimientos se han realizado mediante un equipo de PVD modelo METAPLAS 232, con seis evaporadores de arco eléctrico y sistema de limpieza iónica patentado AEGD. Los recubrimientos han sido caracterizados, tanto química como mecánicamente, empleando las más modernas técnicas tribológicas (ultramicrodureza, scrascth tests, resistencia al desgaste... y espectroscópicas óptica por descarga luminiscente (GDOES. Los resultados obtenidos muestran que las técnicas de PVD son una

  18. Structure and corrosion properties of PVD Cr-N coatings

    International Nuclear Information System (INIS)

    Liu, C.; Bi, Q.; Ziegele, H.; Leyland, A.; Matthews, A.

    2002-01-01

    PVD Cr-N coatings produced by physical vapor deposition (PVD) are increasingly used for mechanical and tribological applications in various industrial sectors. These coatings are particularly attractive for their excellent corrosion resistance, which further enhances the lifetime and service quality of coated components. PVD Cr-N coated steels in an aqueous solution are usually corroded by galvanic attack via through-coating 'permeable' defects (e.g., pores). Therefore, the corrosion performance of Cr-N coated steel is determined by a number of variables of the coating properties and corrosive environment. These variables include: (i) surface continuity and uniformity; (ii) through-coating porosity; (iii) film density and chemical stability; (iv) growth stresses; (v) interfacial and intermediate layers; (vi) coating thickness; (vii) coating composition; and (viii) substrate properties. In this article, PVD Cr-N coatings were prepared, by electron-beam PVD and sputter deposition, with different compositions, thicknesses, and surface roughnesses, by changing the N 2 flow rate, applying multilayering techniques and changing the substrate finish prior to coating. The microstructure of such coatings is investigated by various analytical techniques such as glancing angle x-ray diffraction and scanning electron microscopy, which are also correlated with the corrosion performance of the coated steel. Both dc polarization and ac impedance spectroscopy were employed to investigate the corrosion resistance of Cr-N coated steel in a 0.5N NaCl solution. It has been found that the N 2 flow rate during reactive deposition strongly determines the microstructure of Cr-N coatings (due to the changing nitrogen content in the film) and can thus affect the corrosion resistance of coated systems. The surface finish of the steel substrate also affects the uniformity and coverage of PVD coatings; grooves and inclusions on the original substrate can raise the susceptibility of coated

  19. Development of environmentally compatible tribosystems with PVD-technology

    International Nuclear Information System (INIS)

    Lugscheider, E.; Hornig, T.; Kienitz, S.; Klocke, F.; Krieg, T.

    2001-01-01

    PVD coatings offer a wide variety of applications. The focal point of this work is the development of an advanced type of PVD-hardcoating which allows machining with environmentally compatible lubricants. Representative examples for the investigations are the tribological systems 'turning of quenched and tempered steel 42CrMo4 V' and 'austenitic stainless steel X5CrNi18-10'. Ti-Hf-Cr-N and TiAlN/Al 2 O 3 were deposited by AIP- and H.I.S. TM - process respectively. These coating systems showed best results concerning oxidation wear and abrasive wear in former investigations. This was necessary because main cutting-edge life criterias are oxidation wear and abrasive wear at the minor cutting edge. Consequently, a high oxidation stability and a high hardness at high temperatures are required. (author)

  20. PVD Ti coatings on Sm-Co magnets

    International Nuclear Information System (INIS)

    Bovda, O.M.; Bovda, V.O.; Garkusha, I.E.; Leonov, S.O.; Onishchenko, L.V.; Tereshin, V.I.; Totrika, O.S.; Chen, C.H.

    2008-01-01

    The combination of conventional ion-plasma deposition (PVD) and pulsed plasma technologies (PPT) has been applied for rare-earth Sm-Co based magnets, to provide them with enhanced corrosion resistance. The influence of pulsed plasma treatment on Sm-Co magnets with deposited titanium PVD coatings has been investigated. It was revealed that thickness of modified layer significantly depends on the thickness of initial titanium film and plasma treatment regimes. As a result of plasma treatment with energy density of 30 J/cm 2 and pulse duration of ∼ 5 μs fine-grained layer with the thickness of 70 microns has been formed on the Sm-Co magnet with pure titanium film of 50 micron. According to SEM analyses considerable diffusion of titanium to the bulk of the magnet, on the depth of 20 microns, took place. Such reaction enhances strong bonding between the coating and the magnet

  1. Thermal conductivity issues of EB-PVD thermal barrier coatings

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, U.; Raetzer-Scheibe, H.J.; Saruhan, B. [DLR - German Aerospace Center, Institute of Materials Research, 51170 Cologne (Germany); Renteria, A.F. [BTU, Physical Metallurgy and Materials Technology, Cottbus (Germany)

    2007-09-15

    The thermal conductivity of electron-beam physical vapor deposited (EB-PVD) thermal barrier coatings (TBCs) was investigated by the Laser Flash technique. Sample type and methodology of data analyses as well as atmosphere during the measurement have some influence on the data. A large variation of the thermal conductivity was found by changes in TBC microstructure. Exposure at high temperature caused sintering of the porous microstructure that finally increased thermal conductivity up to 30 %. EB-PVD TBCs show a distinct thickness dependence of the thermal conductivity due to the anisotropic microstructure in thickness direction. Thin TBCs had a 20 % lower thermal conductivity than thick coatings. New compositions of the ceramic top layer offer the largest potential to lower thermal conductivity. Values down to 0.8W/(mK) have been already demonstrated with virgin coatings of pyrochlore compositions. (Abstract Copyright [2007], Wiley Periodicals, Inc.) [German] Die Waermeleitfaehigkeit von elektronenstrahl-aufgedampften (EB-PVD) Waermedaemmschichten (TBCs) wurde mittels Laser-Flash untersucht. Probentyp, Messmethodik und die Atmosphaere waehrend der Messung haben einen Einfluss auf die Ergebnisse. Aenderungen in der Mikrostruktur der TBC fuehrten zu grossen Unterschieden der Waermeleitfaehigkeit. Eine Hochtemperaturbelastung verursachte Sintervorgaenge in der poroesen Mikrostruktur, was die Waermeleitfaehigkeit um bis zu 30 % ansteigen liess. EB-PVD TBCs zeigen eine deutliche Dickenabhaengigkeit der Waermeleitfaehigkeit durch die Anisotropie der Mikrostruktur in dieser Richtung. Duenne TBCs haben eine um 20 % geringere Waermeleitfaehigkeit als dicke Schichten. Neue Zusammensetzungen der keramischen Deckschicht bieten die groessten Moeglichkeiten fuer eine Reduktion der Waermeleitfaehigkeit. Werte bis zu 0,8 W/(mK) wurden damit bereits erreicht. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

  2. PVD following plasmin but not hyaluronidase: implications for combination pharmacologic vitreolysis therapy.

    Science.gov (United States)

    Wang, Zhi-Liang; Zhang, Xi; Xu, Xun; Sun, Xiao-Dong; Wang, Fang

    2005-01-01

    To study whether intravitreal injection of plasmin + hyaluronidase safely induces posterior vitreous detachment (PVD). Rabbits were randomized into three groups: (A) 20 rabbits, intravitreal injection of plasmin 1 U + hyaluronidase 20 U in balanced salt solution (BSS) 0.1 mL into one eye; (B) 12 rabbits, plasmin alone; (C) 12 rabbits, hyaluronidase alone. The fellow eye of each rabbit was injected BSS 0.1 mL. In Group A, scanning electron microscopy (SEM) was done in four rabbits at 0.5 hour and in four rabbits at 1 hour. After 7 days, all the remaining 36 rabbits received electroretinography, SEM was examined in eight of each group, and immunohistochemistry was done in four of each group. SEM disclosed the eyes of Group A had complete PVD (8/8), Group B partial PVD (7/8), and Group C (8/8) and all the control eyes (24/24) no PVD after 7 days. Partial PVD was found in 4/4 at 0.5 hour and complete PVD was seen in 3/4 at 1 hour in Group A. Immunohistochemistry showed that the amounts of laminin and fibronectin in the vitreoretinal interface were decreased in Group A and B versus the control eyes (P 0.05). Electroretinography showed no changes in any group (P >0.05). Vitreous injection of plasmin + hyaluronidase induced complete PVD with no obvious toxicity. Plasmin induced partial PVD, but hyaluronidase had no effects.

  3. Wear of Shaped Surfaces of PVD Coated Dies for Clinching

    Directory of Open Access Journals (Sweden)

    Miroslav Džupon

    2017-11-01

    Full Text Available A clinching method that uses a simple toolset consisting of a punch and a die, is utilized for joining lightweight materials. This paper is aimed at investigating the wear of the die cavity of a clinching tool. A clinching tool with a specially shaped cavity was used for joining thin hot-dip galvanized steel sheets. Various types of physical vapour deposition (PVD coatings such as ZrN, CrN and TiCN were deposited on the shaped surface of the die using Lateral Rotating Arc-Cathodes technology. Hot-dip galvanized steel sheets were used for testing the clinching tool. The material properties of PVD coatings that were deposited on the shaped part of the clinching die were evaluated. Finite Element Analysis was used to localize the area of the shaped part of the die and the part of surface area of the cylindrical die cavity of ϕ 5.0 mm, in which high contact pressure values were predicted. The prediction of the start of the wear cycle was verified experimentally by the clinching of 300 samples of hot-dip galvanized steel sheets. Unlike the CrN and ZrN coatings, the TiCN coating remained intact on the entire surface of the die.

  4. Raman microscopic studies of PVD deposited hard ceramic coatings

    International Nuclear Information System (INIS)

    Constable, C.P.

    2000-01-01

    PVD hard ceramic coatings grown via the combined cathodic arc/unbalance magnetron deposition process were studied using Raman microscopy. Characteristic spectra from binary, multicomponent, multilayered and superlattice coatings were acquired to gain knowledge of the solid-state physics associated with Raman scattering from polycrystalline PVD coatings and to compile a comprehensive spectral database. Defect-induced first order scattering mechanisms were observed which gave rise to two pronounced groups of bands related to the acoustical (150- 300cm -1 ) and optical (400-7 50cm -1 ) parts of the phonon spectrum. Evidence was gathered to support the theory that the optic modes were mainly due to the vibrations of the lighter elements and the acoustic modes due to the vibrations of the heavier elements within the lattice. A study into the deformation and disordering on the Raman spectral bands of PVD coatings was performed. TiAIN and TiZrN coatings were intentionally damaged via scratching methods. These scratches were then analysed by Raman mapping, both across and along, and a detailed spectral interpretation performed. Band broadening occurred which was related to 'phonon relaxation mechanisms' as a direct result of the breaking up of coating grains resulting in a larger proportion of grain boundaries per-unit-volume. A direct correlation of the amount of damage with band width was observed. Band shifts were also found to occur which were due to the stresses caused by the scratching process. These shifts were found to be the largest at the edges of scratches. The Raman mapping of 'droplets', a defect inherent to PVD deposition processes, found that higher compressive stresses and large amounts of disorder occurred for coating growth onto droplets. Strategies designed to evaluate the ability of Raman microscopy to monitor the extent of real wear on cutting tools were evaluated. The removal of a coating layer and subsequent detection of a base layer proved

  5. Adhesion and interface problems of EB-PVD thermal barrier coatings; Grenzschichtproblematik und Haftung von EB-PVD-Waermedaemmschichtsystemen

    Energy Technology Data Exchange (ETDEWEB)

    Fritscher, K.; Leyens, C. [Deutsche Forschungsanstalt fuer Luft- und Raumfahrt e.V. (DLR), Koeln (Germany). Inst. fuer Werkstoff-Forschung

    1996-12-31

    Loss of adhesion in thermal insulation layers produced by EB-PVD may be caused by surface morphologies or oxide phases resulting from previous process stages, e.g. shot peening, or inappropriate annealing conditions. These undesirable oxide phases are mostly spinels and silicates which pose mechanical problems. Annealing and densification must be modified in order to promote the formation of {alpha}-Al{sub 2}O{sub 3} layers. It may also be possible to avoid certain categories of flaws by changing one material partner (e.g. by using {beta}-NiAl-free adhesive layers). [Deutsch] Die Ursachen der Einbussen der Haftung in WDS-Systemen aus EB-PVD-Fertigung liegen oft in der Ausbildung von Oberflaechenmorphologien oder von Oxidphasen begruendet, die aus den der WDS-Beschichtung vorangehenden Verfahrensschritten wie z.B. des Glasperlstrahlens und von unangemessenen Gluehbedingungen herruehren koennen. Bei diesen unerwuenschten Oxidphasen handelt es sich u.a. um Spinelle und Silikate, die in mechanischer Hinsicht problematisch sind. Glueh- und Verdichtungsroutinen sind entsprechend zu modifizieren, um die Bildung von {alpha}-Al{sub 2}O{sub 3}-Schichten zu foerdern. Moeglicherweise sind gewisse Fehlerkategorien bereits dadurch zu umgehen, dass ein Materialpartner geaendert wird (Beispiel: {beta}-NiAl-freie Haftschichten anwenden). (orig.)

  6. Analysis of influence of different pressure and different depth of pvd on soft foundation treatment

    Science.gov (United States)

    Li, Bin; Wang, XueKui

    2018-02-01

    According to the depth of plastic vertical drainage (pvd), the arrangement mode and the loading mode to analyze the influence of Vacuum preloading near the existing road. An arrangement mode of vacuum preloading to reduce the impact was put forward. The combination of different depth of pvd and loading modes are used to analyze the effect of vacuum preloading treatment and its influence range. The calculations show that the deformation and the influence distance are smaller by using the 40kPa vacuum loading and 41kPa surcharge load preloading. Reducing the depth of the pvd and vacuum combined surcharge preloading can weaken the influence to the existing highway.

  7. Simultaneous Co-deposition of Zn-Mg Alloy Layers on Steel Strip by PVD Process

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Tae Yeob [POSCO Technical Research Laboratories, Gwangyang (Korea, Republic of); Goodenough, Mark [Strategic Marketing, Tata Steel, Warwickshire (United Kingdom)

    2011-12-15

    This is the first release of an interim report on the development of coating technology of Zn-Mg alloy layers on steel strip by EML-PVD (electromagnetic levitation - physical vapor deposition) process in an air-to-air type continuous PVD pilot plant. It intends to introduce a basic principle of the EML-PVD process together with the high speed PVD pilot plant built in Posco. Due to the agitation effect provided by the high frequency induction coil, simultaneous evaporation of Zn and Mg from a droplet could produce alloy coating layers with Mg content of 6% to 12% depending on the composition of the droplet inside the coil. For its superior corrosion resistance, Zn-Mg alloy coated steel would be a very promising material for automotive, electrical appliances, and construction applications.

  8. Simultaneous Co-deposition of Zn-Mg Alloy Layers on Steel Strip by PVD Process

    International Nuclear Information System (INIS)

    Kim, Tae Yeob; Goodenough, Mark

    2011-01-01

    This is the first release of an interim report on the development of coating technology of Zn-Mg alloy layers on steel strip by EML-PVD (electromagnetic levitation - physical vapor deposition) process in an air-to-air type continuous PVD pilot plant. It intends to introduce a basic principle of the EML-PVD process together with the high speed PVD pilot plant built in Posco. Due to the agitation effect provided by the high frequency induction coil, simultaneous evaporation of Zn and Mg from a droplet could produce alloy coating layers with Mg content of 6% to 12% depending on the composition of the droplet inside the coil. For its superior corrosion resistance, Zn-Mg alloy coated steel would be a very promising material for automotive, electrical appliances, and construction applications

  9. Nanograined Net-Shaped Fabrication of Rhenium Components by EB-PVD

    International Nuclear Information System (INIS)

    Singh, Jogender; Wolfe, Douglas E.

    2004-01-01

    Cost-effective net-shaped forming components have brought considerable interest into DoD, NASA and DoE. Electron beam physical vapor deposition (EB-PVD) offers flexibility in forming net-shaped components with tailored microstructure and chemistry. High purity rhenium (Re) components including rhenium-coated graphite balls, Re- plates and tubes have been successfully manufactured by EB-PVD. EB-PVD Re components exhibited sub-micron and nano-sized grains with high hardness and strength as compared to CVD. It is estimated that the cost of Re components manufactured by EB-PVD would be less than the current CVD and powder-HIP Technologies

  10. Prevalence of early and late stages of physiologic PVD in emmetropic elderly population.

    Science.gov (United States)

    Schwab, Christoph; Ivastinovic, Domagoj; Borkenstein, Andreas; Lackner, Eva-Maria; Wedrich, Andreas; Velikay-Parel, Michaela

    2012-05-01

    To investigate the early and late stages of posterior vitreous detachment (PVD) in the foveal area in correlation with age and gender. Three hundred and thirty-five emmetropic eyes of 271 Caucasian patients (216 women/119 men) were examined by optical coherence tomography (OCT) and ultrasound (US). Eyes were classified into groups according to the patients age (up to 69.9; 70-74.9; 75-79.9; over 80 years) and to the clinical findings [Vitreous state: Detached in US; Detached in OCT; Foveal adhesion (FA); Attached vitreous]. The mean age was 76 ± 8 ranging from 44 to 89 years in female and 72 ± 10 ranging from 46 to 87 years in male subjects. The vitreous was attached in 32% of all eyes, 18.5% had FA, 18.5% were detached in OCT and 68% were detached in US. While prevalence of FA decreases with increasing age, OCT-diagnosed detachments did not change significantly with age. Between the ages of 70 and 75, an increase in PVD rates occurred. The prevalence of PVD was similar in both genders. Women were significantly older than men in the late-stage PVD in the eyes. The use of OCT and US enabled us to detect a partial or total PVD in 80% of the eyes. A sudden increase in late-stage PVD between the ages of 70 and 75 was observed, correlating with the reported age prevalence of various macular diseases. In contrast to myopics, both genders of elderly emmetropics have a similar prevalence of PVD. © 2011 The Authors. Acta Ophthalmologica © 2011 Acta Ophthalmologica Scandinavica Foundation.

  11. Adaptive PVD Steganography Using Horizontal, Vertical, and Diagonal Edges in Six-Pixel Blocks

    Directory of Open Access Journals (Sweden)

    Anita Pradhan

    2017-01-01

    Full Text Available The traditional pixel value differencing (PVD steganographical schemes are easily detected by pixel difference histogram (PDH analysis. This problem could be addressed by adding two tricks: (i utilizing horizontal, vertical, and diagonal edges and (ii using adaptive quantization ranges. This paper presents an adaptive PVD technique using 6-pixel blocks. There are two variants. The proposed adaptive PVD for 2×3-pixel blocks is known as variant 1, and the proposed adaptive PVD for 3×2-pixel blocks is known as variant 2. For every block in variant 1, the four corner pixels are used to hide data bits using the middle column pixels for detecting the horizontal and diagonal edges. Similarly, for every block in variant 2, the four corner pixels are used to hide data bits using the middle row pixels for detecting the vertical and diagonal edges. The quantization ranges are adaptive and are calculated using the correlation of the two middle column/row pixels with the four corner pixels. The technique performs better as compared to the existing adaptive PVD techniques by possessing higher hiding capacity and lesser distortion. Furthermore, it has been proven that the PDH steganalysis and RS steganalysis cannot detect this proposed technique.

  12. 7YSZ coating prepared by PS-PVD based on heterogeneous nucleation

    Directory of Open Access Journals (Sweden)

    Ziqian DENG

    2018-04-01

    Full Text Available Plasma spray-physical vapor deposition (PS-PVD as a novel coating process based on low-pressure plasma spray (LPPS has been significantly used for thermal barrier coatings (TBCs. A coating can be deposited from liquid splats, nano-sized clusters, and the vapor phase forming different structured coatings, which shows obvious advantages in contrast to conventional technologies like atmospheric plasma spray (APS and electron beam-physical vapor deposition (EB-PVD. In addition, it can be used to produce thin, dense, and porous ceramic coatings for special applications because of its special characteristics, such as high power, very low pressure, etc. These provide new opportunities to obtain different advanced microstructures, thus to meet the growing requirements of modern functional coatings. In this work, focusing on exploiting the potential of gas-phase deposition from PS-PVD, a series of 7YSZ coating experiments with various process conditions was performed in order to better understand the deposition process in PS-PVD, where coatings were deposited on different substrates including graphite and zirconia. Meanwhile, various substrate temperatures were investigated for the same substrate. As a result, a deposition mechanism of heterogeneous nucleation has been presented showing that surface energy is an important influencing factor for coating structures. Besides, undercooling of the interface between substrate and vapor phase plays an important role in coating structures. Keywords: 7YSZ, Deposition mechanism, Heterogeneous nucleation, PS-PVD, TBC

  13. Comparative study of dlc coatings by pvd against cvd technique on textile dents

    International Nuclear Information System (INIS)

    Malik, M.; Alam, S.; Iftikhar, F.

    2007-01-01

    Diamond like Carbon (DLC) film is a hard amorphous carbon hydride film formed by Physical or Chemical vapor deposition (PVD or CVD) techniques. Due to its unique properties especially high hardness, lower coefficient of friction and lubricious nature, these coatings are not only used to extend the life of cutting tools but also for non cutting applications such as for forming dies, molds and on many functional parts of textile. In the present work two techniques were employed i.e. PVD and CVD for deposition of diamond like carbon film on textile dents. These dents are used as thread guider in high speed weaving machine. The measurement of coating thickness, adhesion, hardness and roughness values indicates that overall properties of DLC coating developed by PVD LARC technology reduces abrasion and increases the workability and durability of textile dents as well as suppress the need of lubricants. (author)

  14. Life assessment of PVD based hard coatings by linear sweep voltammetry for high performance industrial application

    International Nuclear Information System (INIS)

    Malik, M.; Alam, S.; Irfan, M.; Hassan, Z.

    2006-01-01

    PVD based hard coatings have remarkable achievements in order to improve Tribological and surface properties of coating tools and dies. As PVD based hard coatings have a wide range of industrial applications especially in aerospace and automobile parts where they met different chemical attacks and in order to improve industrial performance these coatings must provide an excellent resistance against corrosion, high temperature oxidation and chemical reaction. This paper focuses on study of behaviour of PVD based hard coatings under different corrosive environments like as H/sub 2/SO/sub 4/, HCl, NaCl, KCl, NaOH etc. Corrosion rate was calculate under linear sweep voltammetry method where the Tafel extrapolation curves used for continuously monitoring the corrosion rate. The results show that these coatings have an excellent resistance against chemical attack. (author)

  15. Interfacial fatigue stress in PVD TiN coated tool steels under rolling contact fatigue conditions

    OpenAIRE

    Carvalho, N.J.M.; Huis in ’t Veld, A.J.; Hosson, J.Th. De

    1998-01-01

    Titanium–nitrogen (TiN) films were Physical Vapour Deposited (PVD) on tool steel substrates with different hardness and surface roughness, in a Bai 640R unit using a triode ion plating (e-gun) with a high plasma density. The coated substrates were submitted to a rolling contact fatigue test technique (modified pin-on-ring test) to obtain some clarifications of the mechanism of interfacial failure. Tests were run using PVD-coated rings finished by polishing or grinding to produce different sur...

  16. PVD processes of thin films deposition using Hall-current discharge

    International Nuclear Information System (INIS)

    Svadkovskij, I.V.

    2007-01-01

    Results of research and developments in the field of PVD processes of thin films deposition using Hall-current discharge have been summarized. Effects of interaction of ions with surface during deposition have been considered. Also features of application and prospects of devices based on ion beam and magnetron sputtering systems in thin films technologies have been analyzed. The aspects in the field plasma physics, technology and equipment plasma PVD processes of thin films deposition have been systematized, on the base of investigations made by author and other scientists. (authors)

  17. Properties of Pd nanograins in C-Pd composite films obtained by PVD method

    Directory of Open Access Journals (Sweden)

    Kozłowski M.

    2015-09-01

    Full Text Available Properties of palladium nanograins obtained by sedimentation of a soluted C-Pd film prepared by PVD method are presented. These properties were studied using SEM and TEM methods. Dissolved films were prepared by PVD method and after dissolving, they were fractionated to obtain different parts classified with palladium nanograins diameters. Several classes of diameters were determined: below 20 nm, between 20 and 100 nm and above 100 nm. The defects and triple junction were observed. Multishell carbonaceous structures were found in the big and medium size Pd nanograins.

  18. Challenging metastatic breast cancer with the natural defensin PvD1.

    Science.gov (United States)

    Figueira, Tiago N; Oliveira, Filipa D; Almeida, Inês; Mello, Érica O; Gomes, Valdirene M; Castanho, Miguel A R B; Gaspar, Diana

    2017-11-09

    Metastatic breast cancer is a very serious life threatening condition that poses many challenges for the pharmaceutical development of effective chemotherapeutics. As the therapeutics targeted to the localized masses in breast improve, metastatic lesions in the brain slowly increase in their incidence compromising successful treatment outcomes overall. The blood-brain-barrier (BBB) is one important obstacle for the management of breast cancer brain metastases. New therapeutic approaches are in demand for overcoming the BBB's breaching by breast tumor cells. In this work we demonstrate the potential dual role of a natural antimicrobial plant defensin, PvD 1 : it interferes with the formation of solid tumors in the breast and concomitantly controls adhesion of breast cancer cells to human brain endothelial cells. We have used a combination of techniques that probe PvD 1 's effect at the single cell level and reveal that this peptide can effectively damage breast tumor cells, leaving healthy breast and brain cells unaffected. Results suggest that PvD1 quickly internalizes in cancer cells but remains located in the membrane of normal cells with no significant damage to its structure and biomechanical properties. These interactions in turn modulate cell adhesiveness between tumor and BBB cells. PvD 1 is a potential template for the design of innovative pharmacological approaches for metastatic breast cancer treatment: the manipulation of the biomechanical properties of tumor cells that ultimately prevent their attachment to the BBB.

  19. Interfacial fatigue stress in PVD TiN coated tool steels under rolling contact fatigue conditions

    NARCIS (Netherlands)

    Carvalho, N.J.M.; Huis in 't Veld, A.J.; Hosson, J.T. de

    1998-01-01

    Titanium-nitrogen (TiN) films were Physical Vapour Deposited (PVD) on tool steel substrates with different hardness and surface roughness, in a Bai 640R unit using a triode ion plating (e-gun) with a high plasma density. The coated substrates were submitted to a rolling contact fatigue test

  20. Interfacial fatigue stress in PVD TiN coated tool steels under rolling contact fatigue conditions

    NARCIS (Netherlands)

    Carvalho, N.J.M.; Huis in ’t Veld, A.J.; Hosson, J.Th. De

    1998-01-01

    Titanium–nitrogen (TiN) films were Physical Vapour Deposited (PVD) on tool steel substrates with different hardness and surface roughness, in a Bai 640R unit using a triode ion plating (e-gun) with a high plasma density. The coated substrates were submitted to a rolling contact fatigue test

  1. Microstructural investigations of interfaces in PVD TiN coated tool steels

    NARCIS (Netherlands)

    Carvalho, NJM; in't Veld, AJH; De Hosson, JTM; Lejcek, P; Paidar,

    1999-01-01

    The microstructure of PVD TiN coated tools steels composites has been investigated by scanning electron microscopy (SEM) and transmission electron microscopy (TEM). It was found that the microstructure of the coatings consists of a dense fibrous structure typical of a zone T structure. When the

  2. Thermocyclic behaviour of microstructurally modified EB-PVD thermal barrier coatings

    International Nuclear Information System (INIS)

    Schulz, U.; Fritscher, K.; Raetzer-Scheibe, H.-J.; Kaysser, W.A.; Peters, M.

    1997-01-01

    This paper focuses on the combined effects of substrate temperature and rotation during electron-beam physical vapor deposition (EB-PVD) on the columnar microstructure of yttria partially stabilized zirconia (YPSZ) thermal barrier coatings. Diameter and degree of ordering of the columns and the density of the coatings are sensitive to the processing parameters. Results are discussed in the frame of common structural zone models for PVD processes. The models are extended to consider the rotational effect. EB-PVD YPSZ TBCs of different column diameters were deposited on top of an EB-PVD NiCoCrAlY bondcoat on IN 100 superalloy test bars. The performance of the TBCs was investigated in a cyclic oxidation furnace test rig between 1100 C and 130 C and in a burner rig under hot gas corrosion conditions at a maximum temperature of 900 C. Results showed a correlation between cyclic lifetime and the various microstructures of the TBCs. Samples having a non-regular arrangement of columns performed best in both tests. (orig.)

  3. EB-PVD process management for highly productive zirconia thermal barrier coating of turbine blades

    International Nuclear Information System (INIS)

    Reinhold, E.; Botzler, P.; Deus, C.

    1999-01-01

    Zirconia thermal barrier coatings are well used in the turbine manufacturing industry because they ensure extended lifetimes of turbine blades. Compared with other techniques, EB-PVD processes are best suited for the deposition on turbine blades with regard to the layer properties. Therefore EB-PVD coaters for turbine blades are becoming increasingly interesting. The coating costs per component are mainly dependent on a highly productive solution for the deposition task. Thus the EB-PVD process management has to be optimized in order to meet the productivity requirements of the manufacturers. This includes the requirement of high deposition rates, large deposition areas, long time stable production cycles as well as a matched duration of preheating, deposition and cooling down per charge. Modern EB-PVD solutions to be introduced allow deposition rates on blades up to 7 μm/min. The consequences for the technological process management and plant design concerning long time stable coating cycles with high productivity will be discussed. (orig.)

  4. Crack resistance of pvd coatings : Influence of surface treatment prior to deposition

    NARCIS (Netherlands)

    Zoestbergen, E; de Hosson, J.T.M.

    The crack resistance of three different PVD coatings, TiN, Ti(C,N), and a multilayer system of alternating TiN and TiAlN, have been investigated. The three coating systems were deposited onto substrates with a different surface roughness to study the influence of this pretreatment on the crack

  5. Performance of a dual-process PVD/PS tungsten coating structure under deuterium ion irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyunmyung; Lee, Ho Jung; Kim, Sung Hwan [Department of Nuclear and Quantum Engineering, KAIST, Daejeon (Korea, Republic of); Song, Jae-Min [Department of Nuclear Engineering, Seoul National University, Seoul (Korea, Republic of); Jang, Changheui, E-mail: chjang@kaist.ac.kr [Department of Nuclear and Quantum Engineering, KAIST, Daejeon (Korea, Republic of)

    2016-11-01

    Highlights: • D{sup +} irradiation performance of a dual-process PVD/PS W coating was evaluated. • Low-energy plasmas exposure of 100 eV D{sup +} with 1.17 × 10{sup 21} D/s{sup −1} m{sup 2} flux was applied. • After D ion irradiation, flakes were observed on the surface of the simple PS coating. • While, sub-μm size protrusions were observed for dual-process PVD/PS W coating. • Height of D spike in depth profile was lower for dual-process PVD/PS W coating. - Abstract: A dual-process coating structure was developed on a graphite substrate to improve the performance of the coating structure under anticipated operating condition of fusion devices. A thin multilayer W/Mo coating (6 μm) was deposited by physical vapor deposition (PVD) method with a variation of Mo interlayer thickness on plasma spray (PS) W coating (160 μm) of a graphite substrate panel. The dual-process PVD/PS W coatings then were exposed to 3.08 × 10{sup 24} D m{sup −2} of 100 eV D ions with a flux of 1.71 × 10{sup 21} D m{sup −2} s{sup −1} in an electron cyclotron resonance (ECR) chamber. After irradiation, surface morphology and D depth profiles of the dual-process coating were analyzed and compared to those of the simple PS W coating. Both changes in surface morphology and D retention were strongly dependent on the microstructure of surface coating. Meanwhile, the existence of Mo interlayer seemed to have no significant effect on the retention of deuterium.

  6. Production of AlN films: ion nitriding versus PVD coating

    International Nuclear Information System (INIS)

    Figueroa, U.; Salas, O.; Oseguera, J.

    2004-01-01

    The properties of AlN render this material very attractive for optical, electronic, and tribological applications; thus, a great interest exists for the production of thin AlN films on a variety of substrates. Many methods have been developed for this purpose where two processes stand out: plasma-assisted nitriding (PAN) and PVD coating. In the present paper, we compare the processing advantages and disadvantages of both methods in terms of the characteristics of the layers formed. AlN production by ion nitriding is very sensitive to presputtering cleaning and working pressure. Layers several micrometers thick can be produced in a few hours, which are formed by a fine mixture of Al+AlN. The surface morphology of the layers is rather rough. On the other hand, formation of PVD AlN coatings by DC reactive magnetron sputtering is more readily performed and better controlled than in ion nitriding. PVD results in macroscopically smoother AlN films and with similar thickness than the ion nitrided layers but produced in shorter processing times. The morphology of the PVD AlN layers is columnar with a fairly flat surface. Mechanisms for the formation of both types of AlN layers are proposed. One of the main differences between the two processes that explain the different AlN layer morphologies is the energy of the particles that arrive at the substrate. Considering only the processing advantages and the morphology of the AlN layers formed, PVD performs better than PAN processing

  7. Microstructural, mechanical and oxidation features of NiCoCrAlY coating produced by plasma activated EB-PVD

    International Nuclear Information System (INIS)

    He, Jian; Guo, Hongbo; Peng, Hui; Gong, Shengkai

    2013-01-01

    NiCoCrAlY coatings produced by electron beam-physical vapor deposition (EB-PVD) have been extensively used as the oxidation resistance coatings or suitable bond coats in thermal barrier coating (TBC) system. However, the inherent imperfections caused by EB-PVD process degrade the oxidation resistance of the coatings. In the present work, NiCoCrAlY coatings were creatively produced by plasma activated electron beam-physical vapor deposition (PA EB-PVD). The novel coatings showed a terraced substructure on the surface of each grain due to the increased energy of metal ions and enhanced mobility of adatoms. Also a strong (1 1 1) crystallographic texture of γ/γ′ grains was observed. The toughness of the coatings got remarkably improved compared with the coatings deposited by conventional EB-PVD and the oxidation behavior at 1373 K showed that the novel coatings had excellent oxidation resistance. The possible mechanism was finally discussed.

  8. Thermal Conductivity of EB-PVD Thermal Barrier Coatings Evaluated by a Steady-State Laser Heat Flux Technique

    Science.gov (United States)

    Zhu, Dongming; Miller, Robert A.; Nagaraj, Ben A.; Bruce, Robert W.

    2000-01-01

    The thermal conductivity of electron beam-physical vapor deposited (EB-PVD) Zr02-8wt%Y2O3 thermal barrier coatings was determined by a steady-state heat flux laser technique. Thermal conductivity change kinetics of the EB-PVD ceramic coatings were also obtained in real time, at high temperatures, under the laser high heat flux, long term test conditions. The thermal conductivity increase due to micro-pore sintering and the decrease due to coating micro-delaminations in the EB-PVD coatings were evaluated for grooved and non-grooved EB-PVD coating systems under isothermal and thermal cycling conditions. The coating failure modes under the high heat flux test conditions were also investigated. The test technique provides a viable means for obtaining coating thermal conductivity data for use in design, development, and life prediction for engine applications.

  9. Identification of residues of FpvA involved in the different steps of Pvd-Fe uptake in Pseudomonas aeruginosa.

    Science.gov (United States)

    Nader, Mirella; Dobbelaere, Wim; Vincent, Michel; Journet, Laure; Adams, Hendrik; Cobessi, David; Gallay, Jacques; Schalk, Isabelle J

    2007-10-23

    FpvA is an outer membrane transporter involved in iron uptake by the siderophore pyoverdine (Pvd) in Pseudomonas aeruginosa. This transporter, like all other proteins of the same family, consists of a transmembrane 22 beta-stranded barrel occluded by a plug domain. The beta-strands of the barrel are connected by large extracellular loops and short periplasmic turns. Site-directed mutagenesis was carried out on FpvA to identify the extracellular loops or parts of these loops involved in the various stages of Pvd-Fe uptake. The G286C, W362C, and W434C mutations in loops L1, L3, and L4, respectively, disturbed the binding of the apo siderophore, as shown by time-resolved fluorescence spectroscopy. Iron uptake experiments followed by fluorescence resonance energy transfer (FRET) or using 55Fe indicated that residues W434 and G701 and, therefore, loops L4 and L9 must be involved in Pvd-Fe uptake by FpvA. The two corresponding mutants incorporated smaller than normal amounts of 55Fe into cells, and no Pvd recycling on FpvA was observed after iron release. Surprisingly, the S603C mutation in loop L7 increased the amount of Pvd-Fe transported. Our results suggest that W434 (L4), S603 (L7), and G701 (L9) are involved in the mechanism of Pvd-Fe uptake.

  10. Thermal cycling behaviour of lanthanum zirconate as EB-PVD thermal barrier coating

    International Nuclear Information System (INIS)

    Bobzin, K.; Lugscheider, E.; Bagcivan, N.

    2006-01-01

    Thermal cycling tests with two different EB-PVD thermal barrier coatings (TBC) were performed in a furnace cycle test. The results of these tests showed an increase of endurable cycle number when pyrochloric La 2 Zr 2 O 7 was used as TBC. 1865 cycles were reached with La 2 Zr 2 O 7 and 1380 cycles with 7 weigth-% yttria stabilised zirconia (YSZ) EB-PVD TBC. Additional investigation was made with scanning electron microscope (SEM) to investigate morphology and to determine chemical composition by electron dispersive x-ray spectroscopy (EDS) analysis. X-Ray diffraction was performed to analyze structural constitution of deposited coatings. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  11. Depth-resolved X-ray residual stress analysis in PVD (Ti, Cr) N hard coatings

    CERN Document Server

    Genzel, C

    2003-01-01

    Physical vapour deposition (PVD) of thin hard coatings on TiN basis is usually performed at rather low temperatures (T sub D < 500 C) far from thermal equilibrium, which leads to high intrinsic residual stresses in the growing film. In contrast to the extrinsic thermal residual stresses which can easily be estimated from the difference of the coefficients of thermal expansion between the substrate and the coating, a theoretical prediction of the intrinsic residual stresses is difficult, because their amount as well as their distribution within the film depend in a very complex way on the deposition kinetics. By the example of strongly fibre-textured PVD (Ti, Cr)N coatings which have been prepared under defined variation of the deposition parameters in order to adjust the residual stress distribution within the coatings, the paper compares different X-ray diffraction techniques with respect to their applicability for detecting residual stresses which are non-uniform over the coating thickness. (orig.)

  12. Electrospun PVdF-based fibrous polymer electrolytes for lithium ion polymer batteries

    International Nuclear Information System (INIS)

    Kim, Jeong Rae; Choi, Sung Won; Jo, Seong Mu; Lee, Wha Seop; Kim, Byung Chul

    2004-01-01

    This paper discusses the preparation of microporous fibrous membranes from PVdF solutions with different polymer contents, using the electrospinning technique. Electrospun PVdF-based fibrous membranes with average fiber diameters (AFD's) of 0.45-1.38 μm have an apparent porosity and a mean pore size (MPS) of 80-89% and 1.1-4.3 μm, respectively. They exhibited a high uptake of the electrolyte solution (320-350%) and a high ionic conductivity of above 1 x 10 -3 s/cm at room temperature. Their ionic conductivity increased with the decrease in the AFD of the fibrous membrane due to its high electrolyte uptake. The interaction between the electrolyte molecules and the PVdF with a high crystalline content may have had a minor effect on the lithium ion transfer in the fibrous polymer electrolyte, unlike in a nanoporous gel polymer electrolyte. The fibrous polymer electrolyte that contained a 1 M LiPF 6 -EC/DMC/DEC (1/1/1 by weight) solution showed a high electrochemical stability of above 5.0 V, which increased with the decrease in the AFD The interfacial resistance (R i ) between the polymer electrolyte and the lithium electrode slightly increased with the storage time, compared with the higher increase in the interfacial resistance of other gel polymer electrolytes. The prototype cell (MCMB/PVdF-based fibrous electrolyte/LiCoO 2 ) showed a very stable charge-discharge behavior with a slight capacity loss under constant current and voltage conditions at the C/2-rate of 20 and 60 deg. C

  13. Sintering and microstructure evolution of columnar nickel-based superalloy sheets prepared by EB-PVD

    International Nuclear Information System (INIS)

    Chen, S.; Qu, S.J.; Liang, J.; Han, J.C.

    2010-01-01

    Research highlights: → EB-PVD technology is commonly used to deposit thermal barrier coatings (TBCs) and columnar structure is commonly seen in EB-PVD condensates. The unique columnar structure can provide outstanding resistance against thermal shock and mechanical strains for TBCs. However, a number of researchers have found that the columnar structure can affect the mechanical properties of EB-PVD alloy thin sheet significantly. As yet, works on how to reduce this kind of effects are seldom done. In the present article, we tried to reveal the sintering effects on microstructure evolution and mechanical properties of columnar Ni-based superalloy sheet. The results suggests that after sintering, the columnar structure degrades. Degradation depends on sintering temperature and time. Both the ultimate tensile strength and the elongation percentage are effectively improved after sintering. - Abstract: A ∼0.15 mm-thick columnar nickel-based superalloy sheet was obtained by electron beam physical vapor deposition (EB-PVD). The as-deposited alloy sheet was sintered at different conditions. The microstructure of the specimens before and after sintering was characterized by using scanning electron microscopy. An X'Pert texture facility was used to determine the crystallographic orientation of the as-deposited alloy sheet. The phase transformation was investigated by X-ray diffraction. Tensile tests were conducted at room temperature on as-deposited and sintered specimens. The results show that the as-deposited sheet is composed of typical columnar structures. After sintering, however, the columnar structure degrades. The degradation depends on sintering temperature and time. Both the ultimate tensile strength and the elongation percentage are effectively improved after sintering.

  14. The effect of PVD coatings on the corrosion behaviour of AZ91 magnesium alloy

    International Nuclear Information System (INIS)

    Altun, Hikmet; Sen, Sadri

    2006-01-01

    In this study, multilayered AlN (AlN + AlN + AlN) and AlN + TiN were coated on AZ91 magnesium alloy using physical vapour deposition (PVD) technique of DC magnetron sputtering, and the influence of the coatings on the corrosion behaviour of the AZ91 alloy was examined. A PVD system for coating processes, a potentiostat for electrochemical corrosion tests, X-ray difractometer for compositional analysis of the coatings, and scanning electron microscopy for surface examinations were used. It was determined that PVD coatings deposited on AZ91 magnesium alloy increased the corrosion resistance of the alloy, and AlN + AlN + AlN coating increased the corrosion resistance much more than AlN + TiN coating. However, it was observed that, in the coating layers, small structural defects e.g., pores, pinholes, cracks that could arise from the coating process or substrate and get the ability of protection from corrosion worsened were present

  15. PEGDA/PVdF/F127 gel type polymer electrolyte membranes for lithium secondary batteries

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yan-Jie; Kim, Dukjoon [Department of Chemical Engineering, Polymer Technology Institute, Sungkyunkwan University, Suwon, Kyunggi 440-746 (Korea)

    2007-03-30

    A novel porous gel polymer electrolyte (GPE) membrane based on poly(ethylene glycol) diacrylate (PEGDA), poly(vinylidene fluoride) (PVdF), and polyethylene oxide-co-polypropylene oxide-co-polyethylene oxide (PEO-PPO-PEO, F127) was fabricated by a phase inversion technique. The PEGDA cross-linking oligomer could be randomly mixed with unraveled PVdF polymer chains to form the interpenetrating polymer network (IPN) structure. Several experimental techniques including infrared (IR) spectra, differential scanning calorimetry (DSC), thermogravimetric analyzer (TGA), scanning electron microscopy (SEM), electrochemical impedance spectroscopy (EIS) and potentiostat/galvanostat were employed to investigate the characteristics of the polymer membranes. PEGDA and F127 influenced the porous size and structure. The mechanical strength and flexibility of the membrane were controlled by its composition. The membrane with the composition of PEGDA/PVdF/F127 (0/4/4) showed the highest electrolyte uptake of 152.6% and the maximum ionic conductivity of 2.0 x 10{sup -3} S cm{sup -1} at room temperature. All GPEs prepared in this study were electrochemically stable up to 4.5 V. (author)

  16. Additional ion bombardment in PVD processes generated by a superimposed pulse bias voltage

    International Nuclear Information System (INIS)

    Olbrich, W.; Kampschulte, G.

    1993-01-01

    The superimposed pulse bias voltage is a tool to apply an additional ion bombardment during deposition in physical vapour deposition (PVD) processes. It is generated by the combination of a d.c. ground voltage and a higher d.c. pulse voltage. Using a superimposed pulse bias voltage in ion-assisted PVD processes effects an additional all-around ion bombardment on the surface with ions of higher energy. Both metal and reactive or inert-gas ions are accelerated to the surface. The basic principles and important characteristics of this newly developed process such as ion fluxes or deposition rates are shown. Because of pulsing the high voltage, the deposition temperature does not increase much. The adhesion, structure, morphology and internal stresses are influenced by these additional ion impacts. The columnar growth of the deposited films could be suppressed by using the superimposed pulse bias voltage without increasing the deposition temperature. Different metallizations (Cr and Cu) produced by arc and sputter ion plating are investigated. Carbon-fibre-reinforced epoxy are coated with PVD copper films for further treatment in electrochemical processes. (orig.)

  17. Plasma Spray-Physical Vapor Deposition (PS-PVD) of Ceramics for Protective Coatings

    Science.gov (United States)

    Harder, Bryan J.; Zhu, Dongming

    2011-01-01

    In order to generate advanced multilayer thermal and environmental protection systems, a new deposition process is needed to bridge the gap between conventional plasma spray, which produces relatively thick coatings on the order of 125-250 microns, and conventional vapor phase processes such as electron beam physical vapor deposition (EB-PVD) which are limited by relatively slow deposition rates, high investment costs, and coating material vapor pressure requirements. The use of Plasma Spray - Physical Vapor Deposition (PS-PVD) processing fills this gap and allows thin (deposited and multilayer coatings of less than 100 microns to be generated with the flexibility to tailor microstructures by changing processing conditions. Coatings of yttria-stabilized zirconia (YSZ) were applied to NiCrAlY bond coated superalloy substrates using the PS-PVD coater at NASA Glenn Research Center. A design-of-experiments was used to examine the effects of process variables (Ar/He plasma gas ratio, the total plasma gas flow, and the torch current) on chamber pressure and torch power. Coating thickness, phase and microstructure were evaluated for each set of deposition conditions. Low chamber pressures and high power were shown to increase coating thickness and create columnar-like structures. Likewise, high chamber pressures and low power had lower growth rates, but resulted in flatter, more homogeneous layers

  18. Controlling Dielectric and Magnetic Properties of PVdF/Magnetite Nanocomposite Fibre Webs

    Directory of Open Access Journals (Sweden)

    A. P. Venugopal

    2014-01-01

    Full Text Available The ability of filtration and separation media containing fibres to remove impurities from oil, water, and blood can be enhanced using magnetic fields. The ability to regulate the dielectric and magnetic behaviour of fibrous webs in terms of superparamagnetic or ferromagnetic properties by adjusting material composition is fundamental to meeting end-use requirements. Electrospun fibres were produced from PVdF (polyvinylidene fluoride and nanomagnetite (Fe3O4 nanoparticles from solutions of PVdF in dimethylacetamide containing Fe3O4 nanoparticle contents ranging from 3 to 10 wt%. Fibre dimensions, morphology, and nanoparticle agglomeration were characterised by environmental scanning electron microscopy (ESEM and field emission gun transmission electron microscopy (FEGTEM. Dielectric behaviour of the fibre webs was influenced by web porosity and the Fe3O4 nanoparticle content. Impedance analysis of the webs indicated an increase in dielectric constant of ∼80% by the addition of 10 wt% Fe3O4 nanoparticles compared to 100 wt% PVdF. The dielectric constants of the webs were compared with those obtained from the theoretical mixing models of Maxwell and Lichtenecker. Vibrating sample magnetometer (VSM magnetisation measurements indicated a blocking temperature above 300 K suggesting ferrimagnetic rather than superparamagnetic behaviour as a result of Fe3O4 nanoparticle agglomeration within fibres.

  19. Hybrid diffusive/PVD treatments to improve the tribological resistance of Ti-6Al-4V.

    Science.gov (United States)

    Marin, E; Offoiach, R; Lanzutti, A; Regis, M; Fusi, S; Fedrizzi, L

    2014-01-01

    Titanium alloys are nowadays used for a wide range of biomedical applications thanks to their combination of high mechanical resistance, high corrosion resistance and biocompatibility. Nevertheless, the applicability of titanium alloys is sometimes limited due to their low microhardness and tribological resistance. Thus the titanium alloys cannot be successfully applied to prosthetic joint couplings. A wide range of surface treatments, in particular PVD coatings such as CrN and TiN, have been used in order to improve the tribological behaviour of titanium alloys. However, the low microhardness of the titanium substrate often results in coating failure due to cracks and delamination. For this reason, hybrid technologies based on diffusive treatments and subsequent PVD coatings may improve the overall coating resistance. In this work, conventional PVD coatings of CrN or TiCN, deposited on Titanium Grade 5, were characterized and then combined with a standard thermal diffusive nitriding treatment in order to improve the tribological resistance of the titanium alloys and avoid coating delamination. The different treatments were studied by means of scanning electron microscopy both on the sample surface and in cross-section. In-depth composition profiles were obtained using glow discharge optical emission spectrometry (GDOES) and localized energy dispersive X-ray diffraction on linear scan-lines. The microhardness and adhesion properties of the different treatments were evaluated using Vickers microhardness tests at different load conditions. The indentations were observed by means of SEM in order to evaluate delaminated areas and the crack's shape and density. The tribological behaviour of the different treatments was tested in dry conditions and in solution, in alternate pin-on-flat configuration, with a frequency of 0.5 Hz. After testing, the surface was investigated by means of stylus profilometry and SEM both on the surface and in cross-section. The standalone PVD

  20. Clinical use of Malay Version of Vertigo Symptom Scale (MWSS) in patients with peripheral vestibular disorder (PVD).

    Science.gov (United States)

    Zainun, Zuraida; Zakaria, Mohd Normani; Sidek, Dinsuhaimi; Ismail, Zalina

    2012-08-01

    The Vertigo symptom scale (VSS) is a well established tool for the evaluation of vestibular disorders and the associated symptoms of autonomic arousal and somatosensation. By using a validated Malay version of vertigo symptom scale (MVVSS) questionnaire, the severity of the vertigo from patients' perspective can be determined and rated. Before MVVSS can be applied clinically among Malaysians, it was of interest to determine its clinical value in identifying vestibular disorders. Forty normal and 65 PVD subjects participated in this cross-sectional study. Normal subjects were recruited amongst Universiti Sains Malaysia (USM) staff and students who had no history of ear and vestibular disorders. Mean total score of MVVSS in normal and PVD subjects were 13.9 +/- 11.1 and 30.1 +/- 20.9, respectively. When the total scores of normal and PVD group were compared, the Mann-Whitney U test showed that there was a significant difference between the two groups (p PVD [benign paroxymal positional vertigo (BPPV), Meniere's disease, labyrinthitis and unknown] have different MVVSS results. However, analysis of variance (ANOVA) found no significant difference in term of outcomes of MVVSS among the different PVD pathologies. Using receiver operating characteristic curve (ROC) method, the sensitivity and specificity of MVVSS were 71% and 60%, respectively. MVVSS is able to discriminate clinically among the normal and PVD subjects. However, it is not a good indicator for differential diagnosis of PVD subtypes, at least in this study. Its sensitivity and specificity in clinical diagnosis are reasonably high. Perhaps a bigger sample size would be useful to further study the clinical usefulness of MVVSS.

  1. Pain, psychological distress and motor pattern in women with provoked vestibulodynia (PVD) - symptom characteristics and therapy suggestions.

    Science.gov (United States)

    Haugstad, Gro Killi; Wojniusz, Slawomir; Kirste, Unni Merete; Kirschner, Rolf Steinar; Lilleheie, Ingvild; Haugstad, Tor Sigbjørn

    2018-04-25

    Provoked vestibulodynia (PVD) represent a longstanding pain syndrome that affects large numbers of women worldwide. However, no standardized guidelines for PVD treatment exist. In a cross-sectional pilot study we examined 30 PVD patients on multidimensional parameters including pain, psychological distress and quality of movement, in order to obtain a broader understanding of the somatic and psychological symptoms in PVD, and for the future to develop better interventions. Additionally, we compare the findings to previously published results regarding the same parameters in women with chronic pelvic pain (CPP). Thirty women with PVD recruited from a tertiary care university clinic of gynecology were assessed for demographic data, pain intensity (VAS), psychological distress (GHQ-30 and Tampa scale of Kinesophobia) and quality of movement (standardized Mensendieck test, SMT). Average age of the PVD women was 24.7±3.60 years, 60% of them were in permanent relationships, all were nulliparous, none had been subjected to surgical procedures, 100% were working full or part time and 90% were educated to at least undergraduate level. Mean VAS score was 7.77±1.97 (mean±SD), kinesiophobia 24.4±3.95 and anxiety domain of GHQ-30 9.73±4.06. SMT scores were particularly low for the domains of respiration and gait (less than 50% of optimal scores). PVD women display reduced quality of movement, especially for gait and respiration patterns, increased level of anxiety and high average pain scores. These findings are similar to what we have previously reported in CPP patients. However, in contrast to CPP group, PVD women are on average younger, have higher work participation, higher education level and have not been subjected to surgical procedures. Since PVD women display similar, although somewhat less severe, symptom profile than CPP, we suggest that a multidimensional approach to treatment, such as "somatocognitive therapy" should be investigated in this group as it has

  2. Protection of yttria-stabilized zirconia for dental applications by oxidic PVD coating.

    Science.gov (United States)

    Hübsch, C; Dellinger, P; Maier, H J; Stemme, F; Bruns, M; Stiesch, M; Borchers, L

    2015-01-01

    In this study, the application of transparent physical vapor deposition (PVD) coatings on zirconia ceramics was examined as an approach to retard the low-temperature degradation of zirconia for dental applications. Transparent monolayers of titanium oxide (TixOy) and multilayers consisting of titanium oxide-alumina-titanium oxide (TixOy-AlxOy-TixOy) were deposited onto standardized discs of 3Y-TZP using magnetron sputtering. Using X-ray photospectroscopy and time-of-flight secondary-ion mass spectrometry, the compositions of the coatings were verified, and an approximate thickness of 50 nm for each type of coating was ascertained. After aging the coated and uncoated samples in water vapor at 134°C and 3 bar for 4, 8, 16, 32, 64 and 128 h, the monoclinic phase content was determined using X-ray diffraction, and its impact on mechanical properties was assessed in biaxial flexural strength tests. In addition, the depth of the transformation zone was measured from scanning electron microscopy images of the fracture surfaces of hydrothermally aged samples. The results revealed that the tetragonal-to-monoclinic phase transformation of the zirconia ceramic was retarded by the application of PVD coatings. During the first stages of aging, the coated samples exhibited a significantly lower monoclinic phase content than the uncoated samples and, after 128 h of aging, showed a transformation zone which was only ∼12-15 μm thick compared to ∼30 μm in the control group. Biaxial flexural strength decreased by ∼10% during aging and was not influenced by the application of a PVD coating. Copyright © 2014 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  3. NiCoCrAl/YSZ laminate composites fabricated by EB-PVD

    International Nuclear Information System (INIS)

    Shi Guodong; Wang Zhi; Liang Jun; Wu Zhanjun

    2011-01-01

    Highlights: → The metal-ceramic laminate composites were fabricated by EB-PVD. → Both metal and ceramic layers consisted of straight columns with banded structures. → Columnar grain size was limited by the periodic layer interfaces in the laminates. → Effect of columns on fracture property was decreased by limiting layer thickness. → Laminates showed greater specific strength than monolithic metal foil. - Abstract: Two NiCoCrAl/YSZ laminate composites (A and B) with different metal-layer thickness (∼35 μm and 14 μm, respectively) were fabricated by electron beam physical vapor deposition (EB-PVD). Their microstructure was examined and their mechanical properties were compared with the 289 μm thick NiCoCrAl monolithic foil produced by EB-PVD. Both the YSZ and NiCoCrAl layers of the laminate composites had columnar grain structure. But the periodic layer interfaces limited the columnar grain size. Some pores between the columns were also observed. It was found that the strength of the laminate A was equal approximately to that of the NiCoCrAl monolithic foil, and that laminate B had the greater strength. Moreover, the density of the foils decreased with the increasing thickness ratio of YSZ/NiCoCrAl layers and the increasing the layer number. Thus, comparing with the NiCoCrAl monolithic foil, the NiCoCrAl/YSZ laminate composites not only had the equal or greater strength, but also had the much greater specific strength.

  4. The properties of B-Sb thin films prepared by molecular flow region PVD process

    International Nuclear Information System (INIS)

    Kumashiro, Y.; Nakamura, K.; Sato, K.; Ohtsuka, M.; Ohishi, Y.; Nakano, M.; Doi, Y.

    2004-01-01

    The present paper is the first description on the electrical and thermoelectric properties of amorphous PVD B 12 Sb 2 films prepared using the reaction of decaborane gas with evaporated antimony gas on Si (1900 A) / SiO x (3700 A) / Si (100) (625 μm) substrate at the temperature 350 deg. C. Ohmic metals contacts of the film were examined by making evaporated Al, followed by annealing at 200 deg. C. The comparatively high mobility of ∼100 cm 2 /V s and high thermoelectric figures-of-merit of ∼10 -4 /K were confirmed

  5. Growth Mechanism for Low Temperature PVD Graphene Synthesis on Copper Using Amorphous Carbon

    Science.gov (United States)

    Narula, Udit; Tan, Cher Ming; Lai, Chao Sung

    2017-03-01

    Growth mechanism for synthesizing PVD based Graphene using Amorphous Carbon, catalyzed by Copper is investigated in this work. Different experiments with respect to Amorphous Carbon film thickness, annealing time and temperature are performed for the investigation. Copper film stress and its effect on hydrogen diffusion through the film grain boundaries are found to be the key factors for the growth mechanism, and supported by our Finite Element Modeling. Low temperature growth of Graphene is achieved and the proposed growth mechanism is found to remain valid at low temperatures.

  6. Structural characterisation of oxygen diffusion hardened alpha-tantalum PVD-coatings on titanium.

    Science.gov (United States)

    Hertl, C; Koll, L; Schmitz, T; Werner, E; Gbureck, U

    2014-08-01

    Titanium substrates were coated with tantalum layers of 5 μm thickness using physical vapour deposition (PVD). The tantalum layers showed a (110)-preferred orientation. The coated samples were hardened by oxygen diffusion. Using X-ray diffraction the crystallographic structure of the tantalum coatings was characterised, comparing untreated and diffusion hardened specimen conditions. Oxygen depth profiles were determined by glow discharge spectrometry. The hardening effect of the heat treatment was examined by Vickers microhardness testing. The increase of surface hardness caused by oxygen diffusion was at least 50%. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Multilayered and composite PVD-CVD coatings in cemented carbides manufacture

    International Nuclear Information System (INIS)

    Glushkov, V.N.; Anikeev, A.I.; Anikin, V.N.; Vereshchaka, A.S.

    2001-01-01

    Carbide cutting tools with wear-resistant coatings deposited by CVD process are widely employed in mechanical engineering to ensure a substantially longer service life of tool systems. However, the relatively high temperature and long time of the process make the substrate decarburise and, as a result, the bend strength and performance characteristics of a tool decrease. The present study suggests the problem of deteriorated strength of CVD-coated carbide tools be solved by the development of a technology that combines arc-PVD and CVD processes to deposit multilayered coatings of titanium and aluminium compounds. (author)

  8. An apparatus for sequential pulsed plasma beam treatment in combination with Arc PVD deposition

    International Nuclear Information System (INIS)

    Stanislawski, J.; Werner, Z.; Piekoszewski, J.; Richter, E.

    2002-01-01

    A hybrid type of apparatus is described which enables one to form a thin multi-layer film on the surface of any kind of solid substrate. In one process, the surface is treated with a high intensity pulse plasma beam which introduces the chosen kind of atoms into the near-surface layer of the substrate. In the second process, following the first without breaking the vacuum, the coating is formed by arc PVD (physics vapour deposition) process. Two examples of coatings formed on metallic and ceramic substrates are presented. (author)

  9. Frozen-in vacancies in PVD-Cu films with improved high-pressure reflowability studied using a slow positron beam

    Energy Technology Data Exchange (ETDEWEB)

    Yabuuchi, A; Kubo, D; Mizuno, M; Araki, H [Division of Materials and Manufacturing Science, Graduate School of Engineering, Osaka University, 2-1 Yamadaoka, Suita, Osaka 565-0871 (Japan); Onishi, T [Materials Research Laboratory, Kobe Steel Ltd., 5-5 Takatsukadai 1-chome, Nishi-ku, Kobe, Hyogo 651-2271 (Japan); Shirai, Y [Department of Materials Science and Engineering, Graduate School of Engineering, Kyoto University, Yoshida-Honmachi, Sakyo-ku, Kyoto 606-8501 (Japan)], E-mail: atsushi.yabuuchi@mat.eng.osaka-u.ac.jp

    2009-05-01

    Recently, a new process has been proposed for fabricating a LSI interconnection; filling trenches and via holes with Cu using high-pressure annealing treatment. It is already known that a Cu film produced by physical vapor deposition (PVD) has a lower reflowability compared to a Cu film produced by electrochemical deposition (ECD). Additionally, it has also been recognized that the addition of Sb to the PVD-Cu film improves the reflowability. However, the factors responsible for the reflowability of Cu films have not yet been studied. In this work, we evaluated a PVD pure-Cu film and a PVD Cu-0.5at%Sb film by using a slow positron beam. Addition of Sb led to the introduction of lattice defects in the as-deposited film. These defects that were observed in the PVD-CuSb dilute alloy film were identified as frozen-in vacancies that were produced during deposition.

  10. Frozen-in vacancies in PVD-Cu films with improved high-pressure reflowability studied using a slow positron beam

    International Nuclear Information System (INIS)

    Yabuuchi, A; Kubo, D; Mizuno, M; Araki, H; Onishi, T; Shirai, Y

    2009-01-01

    Recently, a new process has been proposed for fabricating a LSI interconnection; filling trenches and via holes with Cu using high-pressure annealing treatment. It is already known that a Cu film produced by physical vapor deposition (PVD) has a lower reflowability compared to a Cu film produced by electrochemical deposition (ECD). Additionally, it has also been recognized that the addition of Sb to the PVD-Cu film improves the reflowability. However, the factors responsible for the reflowability of Cu films have not yet been studied. In this work, we evaluated a PVD pure-Cu film and a PVD Cu-0.5at%Sb film by using a slow positron beam. Addition of Sb led to the introduction of lattice defects in the as-deposited film. These defects that were observed in the PVD-CuSb dilute alloy film were identified as frozen-in vacancies that were produced during deposition.

  11. The Role of SiO2 Gas in the Operation of Anti-Corrosion Coating Produced by PVD

    Directory of Open Access Journals (Sweden)

    Meysam Zarchi

    2015-09-01

    Full Text Available This study examined theSiO2 gas present in the coatings used in corrosion industry.These layers have been created by physical vapor deposition (PVD, with an appropriate performance. Sublimation of SiO2is used to protect PVD aluminum flakes from water corrosionand to generate highly porous SiO2 flakes with holes in the nanometer range. SiOx/Al/SiOx sandwiches were made as well as Ag loaded porous SiO2 as antimicrobial filler.

  12. Development and characterization of nano structured hard coatings for high performance tools by using PVD technique

    International Nuclear Information System (INIS)

    Irfan, M.; Alam, S.; Hassan, Z.; Iftikhar, F.; Khadim, S.

    2006-01-01

    No doubt hard coatings nave major applications in high performance cutting tools in order to improve tribological and mechanical properties of these tools since last years. The actual top development in this regard is the development of PVD based AlTiN coatings and their supplementation with nano. layers. In present these nano coatings are replaced by nano composites along with an additional development of Multilayer Nano structured coatings. This PVD based nano structured coating development optimized by process parameters, crystalline structure and deposition in multilayer. These coating are definitely produced by combination of ARC and Sputtering with filtration of arc droplets. It is studied that the properties like oxidation resistance, wear resistance and resistance against chemical reaction may be obtained by alloying additions of different elements. This paper presents different development stages and Process parameters for- producing high performance Nanostructure coatings and including adhesion test by using Kalomax system for determination of adhesion strength of these coatings and coating thickness measurements by using image analyzer system. Results and conclusions are showing the optimum values for better coatings for different applications. (author)

  13. A study on the high velocity impact behavior of titanium alloy by PVD method

    International Nuclear Information System (INIS)

    Sohn, Se Won; Lee, Doo Sung; Hong, Sung Hee

    2001-01-01

    In order to investigate the fracture behaviors(penetration modes) and resistance to penetration during ballistic impact of titanium alloy laminates and nitrified titanium alloy laminates which were treated by PVD(Physical Vapor Deposition) method, ballistic tests were conducted. Evaporation, sputtering, and ion plating are three kinds of PVD method. In this research, ion plating was used to achieve higher surface hardness and surface hardness test were conducted using a micro Vicker's hardness tester. Resistance to penetration is determined by the protection ballistic limit(V 50 ), a statistical velocity with 50% probability for complete penetration. Fracture behaviors and ballistic tolerance, described by penetration modes, are respectfully observed at and above ballistic limit velocities, as a result of V 50 test and Projectile Through Plates(PTP) test methods. PTP tests were conducted with 0 .deg. obliquity at room temperature using 5.56mm ball projectile. V 50 tests with 0 .deg. obliquity at room temperature were conducted with projectiles that were able to achieve near or complete penetration during PTP tests. Surface hardness, resistance to penetration, and penetration modes of titanium alloy laminates are compared to those of nitrified titanium alloy laminates

  14. Effects of synchrotron x-rays on PVD deposited and ion implanted α-Si

    International Nuclear Information System (INIS)

    Yu, K.M.; Wang, L.; Walukiewicz, W.; Muto, S.; McCormick, S.; Abelson, J.R.

    1997-01-01

    The authors have studied the effects of intense X-ray irradiation on the structure of amorphous Si films. The films were obtained by either physical vapor deposition or by implantation of high energy ions into crystalline Si. They were exposed to different total doses of synchrotron X-rays. From the EXAFS and EXELFS measurements they find that an exposure to X-rays increases the Si coordination number. Also in the PVD films a prolonged X-ray exposure enlarges, by about 2%, the Si-Si bond length. Raman spectroscopy shows that Si amorphized with high energy ions contains small residual amounts of crystalline material. Irradiation of such films with X-rays annihilates those crystallites resulting in homogeneously amorphous layer with a close to four-fold coordination of Si atoms. This rearrangement of the local structure has a pronounced effect on the crystallization process of the amorphous films. Thermal annealing of X-ray irradiated ion amorphized films leads to nearly defect free solid phase epitaxy at 500 C. Also they observe a delay in the onset of the crystallization process in X-ray irradiated PVD films. They associate this with a reduced concentration of nucleation centers in the x-ray treated materials

  15. Metallic Conductive Nanowires Elaborated by PVD Metal Deposition on Suspended DNA Bundles.

    Science.gov (United States)

    Brun, Christophe; Elchinger, Pierre-Henri; Nonglaton, Guillaume; Tidiane-Diagne, Cheikh; Tiron, Raluca; Thuaire, Aurélie; Gasparutto, Didier; Baillin, Xavier

    2017-09-01

    Metallic conductive nanowires (NWs) with DNA bundle core are achieved, thanks to an original process relying on double-stranded DNA alignment and physical vapor deposition (PVD) metallization steps involving a silicon substrate. First, bundles of DNA are suspended with a repeatable process between 2 µm high parallel electrodes with separating gaps ranging from 800 nm to 2 µm. The process consists in the drop deposition of a DNA lambda-phage solution on the electrodes followed by a naturally evaporation step. The deposition process is controlled by the DNA concentration within the buffer solution, the drop volume, and the electrode hydrophobicity. The suspended bundles are finally metallized with various thicknesses of titanium and gold by a PVD e-beam evaporation process. The achieved NWs have a width ranging from a few nanometers up to 100 nm. The electrical behavior of the achieved 60 and 80 nm width metallic NWs is shown to be Ohmic and their intrinsic resistance is estimated according to different geometrical models of the NW section area. For the 80 nm width NWs, a resistance of about few ohms is established, opening exploration fields for applications in microelectronics. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Ion irradiation-induced stress relaxation in thin films and multilayers deposited using energetic PVD techniques

    International Nuclear Information System (INIS)

    Abadias, Gregory; Michel, Anny; Debelle, Aurelien; Jaouen, Christiane; Djemia Philippe

    2009-01-01

    The aim of the present work is to understand the stress build-up during energetic PVD film growth and the stress relaxation during subsequent ion irradiation at low dose (typically in the range 0.1-1.0 displacement per atom). Monolithic Mo thin films and Mo/Ni multilayers were grown using Dual Ion Beam Sputtering and Magnetron Sputtering at room temperature. Due to the high energy of incoming species (sputtered atoms, backscattered Ar), growth defects of interstitial-type are created during growth. The defect density can reach up to 1.4 % (far from equilibrium) in these Mo refractory layers. These defects act as misfitting particles, inducing a hydrostatic stress component and an associated in-plane compressive stress component. However, after Ar ion irradiation at low dose (∼0.2 dpa), most of the stress is relieved, showing that the growth induced defects are highly unstable. For Ni layers, the compressive stress is much lower due to the higher bulk atom mobility in this metal, making annihilation of defects more effective. An intermixing occurring mainly at the Mo/Ni interfaces is revealed from a complete strain-stress analysis using X-ray Diffraction. The magnitude of this interfacial alloying is found to increase with the energetics of the PVD process and is at the origin of the huge softening of the C 4 4 elastic constant, as measured using Brillouin light scattering. (authors)

  17. Stress analysis and microstructure of PVD monolayer TiN and multilayer TiN/(Ti,Al)N coatings

    NARCIS (Netherlands)

    Carvalho, NJM; Zoestbergen, E; Kooi, BJ; De Hosson, JTM

    2003-01-01

    Two PVD titanium nitride based coatings; monolayer TiN and multilayer resulting from the stacking of TiN and (Ti,Al)N layers were evaluated with respect to their stress state and microstructure. The TiN was deposited by triode evaporation ion plating, whereas the TiN/(Ti,AI)N was deposited using a

  18. Partial sulfonation of PVdF-co-HFP: A preliminary study and characterization for application in direct methanol fuel cell

    International Nuclear Information System (INIS)

    Das, Suparna; Kumar, Piyush; Dutta, Kingshuk; Kundu, Patit Paban

    2014-01-01

    Highlights: • Synthesis of sulfonated PVdF-co-HFP by reacting with chlorosulfonic acid. • Maximum degree of sulfonation and best properties were obtained for 7 h reaction. • A maximum water uptake value of 20% was obtained. • A maximum IEC value of 0.42 meq g −1 was obtained. • A methanol permeability of 2.44 × 10 −7 cm 2 s −1 was obtained. - Abstract: Sulfonation of PVdF-co-HFP was conducted by treating the copolymer with chlorosulfonic acid. The efficiency of this sulfonated copolymer towards application as a polymer electrolyte membrane in direct methanol fuel cell (DMFC) was evaluated. For this purpose, we determined the thermal stability, water uptake, ion exchange capacity (IEC), methanol crossover, and proton conductivity of the prepared membranes as functions of duration and degree of sulfonation. The characteristic aromatic peaks obtained in the FT-IR spectra confirmed the successful sulfonation of PVdF-co-HFP. The effect of sulfonation on the semi-crystalline nature of pure PVdF-co-HFP was determined from XRD analysis. Water uptake results indicated that a sulfonation time of 7 h produced maximum water uptake value of about 20%, with a corresponding IEC and proton conductivity values of about 0.42 meq g −1 and 0.00375 S cm −1 respectively. The maximum current density was recorded to be 30 mA cm −2 at 0.2 V potential

  19. [Efficacy of PVD regimen combined with IMRT for early-stage extranodal nasal NK/T-cell lymphoma].

    Science.gov (United States)

    Zhang, Y; Huang, Y H; Hu, Y F; Liu, Q L; Wu, T

    2017-07-11

    Objective: To evaluate the efficacy of PVD chemo-regimen (Pegaspargase, vincristine and dexamethasone) combined with intensity-modulated radiotherapy (IMRT) for patients with early-stage extranodal nasal NK/T-cell lymphoma (ENKL). Methods: Clinical data of 52 patients with early-stage ENKL were collected during May 2010 and June 2015 in Department of Lymphoma, Cancer Hospital of Guizhou Medical University, and these patients firstly received a concurrent chemoradiotherapy of two-cycle of PVD and IMRT (gross tumor volume primary: 12.6-59.4 Gy) and then 2 to 4 cycles of PVD as subsequent chemotherapy, the efficacy and adverse responses were retrospectively analyzed and observed. Results: Follow-up stopped until December 2015, complete remission was seen in 44 cases (84.6%) and partial remission 7 cases (13.5%), out of 52 cases. A total of 1 case died of progression disease during treatment and within 1 year after treatment, 1 case died of pulmonary infection within 1 week after treatment, 2 cases survived with tumor; so the objective response rate and clinical benefit rate were both 98.1%, 1-year, 2-year and 3-year overall survival rates and progression free survival rates were all 93.6%, 1-year and 2-year disease free survival rates were both 90.3%; the correlation analysis showed that the radiotherapy dose was related to the curative effect ( P PVD regimen and IMRT have a good therapeutic effect and adverse response can be tolerated.

  20. Mechanical properties of EB-PVD ZrO{sub 2} thermal barrier coatings; Mechanische Eigenschaften von EB-PVD ZrO{sub 2} Waermedaemmschichten

    Energy Technology Data Exchange (ETDEWEB)

    Held, Carolin

    2014-08-29

    In this work, the elastic properties of thermal barrier coatings which were produced by electron-beam enhanced physical vapour deposition were investigated, as well as the dependency of the properties on the sample microstructure, the thermal treatment and the test method. For this purpose, not only commercial coatings were characterized, but also special sample material was used which consists of a 1 mm thick layer of EB-PVD TBC. This material was isothermally heat treated for different times at 950 C, 1100 C and 1200 C and then tested in a specially developed miniaturized bend test and by dynamic mechanical analysis. The sample material was tested by nanoindentation in order to measure the Young's modulus on a local scale, and the porosity of the samples was determined by microstructure analysis and porosimetry. The decrease of porosity could be connected with sintering and subsequent stiffening of the material. The test results are dependent on the tested volume. A small test volume leads to larger measured Young's moduli, while a large test volume yields lower values. The test volume also has an influence on the increase of stiffness during thermal exposure. With a small tested volume, a quicker increase of the Young's modulus was registered, which could be associated to the sintering of local structures.

  1. Mechanical properties of EB-PVD ZrO{sub 2} thermal barrier coatings; Mechanische Eigenschaften von EB-PVD ZrO{sub 2} Waermedaemmschichten

    Energy Technology Data Exchange (ETDEWEB)

    Held, Carolin

    2014-08-29

    In this work, the elastic properties of thermal barrier coatings which were produced by electron-beam enhanced physical vapour deposition were investigated, as well as the dependency of the properties on the sample microstructure, the thermal treatment and the test method. For this purpose, not only commercial coatings were characterized, but also special sample material was used which consists of a 1 mm thick layer of EB-PVD TBC. This material was isothermally heat treated for different times at 950 C, 1100 C and 1200 C and then tested in a specially developed miniaturized bend test and by dynamic mechanical analysis. The sample material was tested by nanoindentation in order to measure the Young's modulus on a local scale, and the porosity of the samples was determined by microstructure analysis and porosimetry. The decrease of porosity could be connected with sintering and subsequent stiffening of the material. The test results are dependent on the tested volume. A small test volume leads to larger measured Young's moduli, while a large test volume yields lower values. The test volume also has an influence on the increase of stiffness during thermal exposure. With a small tested volume, a quicker increase of the Young's modulus was registered, which could be associated to the sintering of local structures.

  2. Methods to improve the PVD coatability of brass by using diffusion barriers

    Science.gov (United States)

    Langer, Bernd

    Previous work involving PVD coatings on brass has used a combination of multilayers consisting of electroplated films like nickel or chromium and deposited decorative PVD coatings like TiN, TiAIN or ZrN systems. The disadvantages of these systems are the combination of wet electrochemistry and high tech vacuum processes. Furthermore the allergic reaction to nickel and the toxic nature of Cr(VI) must be considered.There is a need for intermediate layers to 'seal-off the brass in order to avoid the evaporation of zinc in vacuum using a diffusion barrier. Furthermore the intermediate layers are required to act as a corrosion barrier.This thesis reports on the development of PVD coatings on heat sensitive brass substrate materials utilising ABS technology with Al, CuAl8 and Nb targets as vapour sources.The brass pretreatment includes careful grinding, polishing and cleaning steps as well as steered arc metal ion etching using the above target materials. The coatings are produced at temperatures between 100 and 250°C in the unbalanced magnetron mode, including layers made from Al, Al-Nb, CuA18, CuAl8-Nb and Nb.Scratch adhesion and Rockwell indentation tests are found not to be directly applicable to the system of soft brass and ductile coating(s). Therefore a new classification for both scratch and indentation tests was defined. The best adhesion was shown by the CuA18 coatings on brass. Corrosion tests showed good results for the Al coatings and poor results for the pure Nb coatings directly applied on brass. The best corrosion result was obtained with a CuAl8-Nb layer system. This layer system also offers very good barrier behaviour concerning Zn diffusion.Other investigations like Glow Discharge Optical Emission Spectroscopy (GDOES), Scanning Electron Microscopy (SEM) imaging, Transmission Electron Microscopy (TEM) and X-ray Diffraction (XRD) were undertaken to characterise the new coating systems for brass.

  3. Prediction of the properties of PVD/CVD coatings with the use of FEM analysis

    International Nuclear Information System (INIS)

    Śliwa, Agata; Mikuła, Jarosław; Gołombek, Klaudiusz; Tański, Tomasz; Kwaśny, Waldemar; Bonek, Mirosław; Brytan, Zbigniew

    2016-01-01

    Highlights: • Prediction of the properties of PVD/CVD coatings with the use of (FEM) analysis. • Stress distribution in multilayer Ti/Ti(C,N)/CrN, Ti/Ti(C,N)/(Ti,Al)N coatings. • The experimental values of stresses were determined on X-ray diffraction patterns. • An FEM model was established for the purpose of building a computer simulation. - Abstract: The aim of this paper is to present the results of the prediction of the properties of PVD/CVD coatings with the use of finite element method (FEM) analysis. The possibility of employing the FEM in the evaluation of stress distribution in multilayer Ti/Ti(C,N)/CrN, Ti/Ti(C,N)/(Ti,Al)N, Ti/(Ti,Si)N/(Ti,Si)N, and Ti/DLC/DLC coatings by taking into account their deposition conditions on magnesium alloys has been discussed in the paper. The difference in internal stresses in the zone between the coating and the substrate is caused by, first of all, the difference between the mechanical and thermal properties of the substrate and the coating, and also by the structural changes that occur in these materials during the fabrication process, especially during the cooling process following PVD and CVD treatment. The experimental values of stresses were determined based on X-ray diffraction patterns that correspond to the modelled values, which in turn can be used to confirm the correctness of the accepted mathematical model for testing the problem. An FEM model was established for the purpose of building a computer simulation of the internal stresses in the coatings. The accuracy of the FEM model was verified by comparing the results of the computer simulation of the stresses with experimental results. A computer simulation of the stresses was carried out in the ANSYS environment using the FEM method. Structure observations, chemical composition measurements, and mechanical property characterisations of the investigated materials has been carried out to give a background for the discussion of the results that were

  4. Prediction of the properties of PVD/CVD coatings with the use of FEM analysis

    Energy Technology Data Exchange (ETDEWEB)

    Śliwa, Agata; Mikuła, Jarosław; Gołombek, Klaudiusz; Tański, Tomasz; Kwaśny, Waldemar; Bonek, Mirosław, E-mail: miroslaw.bonek@polsl.pl; Brytan, Zbigniew

    2016-12-01

    Highlights: • Prediction of the properties of PVD/CVD coatings with the use of (FEM) analysis. • Stress distribution in multilayer Ti/Ti(C,N)/CrN, Ti/Ti(C,N)/(Ti,Al)N coatings. • The experimental values of stresses were determined on X-ray diffraction patterns. • An FEM model was established for the purpose of building a computer simulation. - Abstract: The aim of this paper is to present the results of the prediction of the properties of PVD/CVD coatings with the use of finite element method (FEM) analysis. The possibility of employing the FEM in the evaluation of stress distribution in multilayer Ti/Ti(C,N)/CrN, Ti/Ti(C,N)/(Ti,Al)N, Ti/(Ti,Si)N/(Ti,Si)N, and Ti/DLC/DLC coatings by taking into account their deposition conditions on magnesium alloys has been discussed in the paper. The difference in internal stresses in the zone between the coating and the substrate is caused by, first of all, the difference between the mechanical and thermal properties of the substrate and the coating, and also by the structural changes that occur in these materials during the fabrication process, especially during the cooling process following PVD and CVD treatment. The experimental values of stresses were determined based on X-ray diffraction patterns that correspond to the modelled values, which in turn can be used to confirm the correctness of the accepted mathematical model for testing the problem. An FEM model was established for the purpose of building a computer simulation of the internal stresses in the coatings. The accuracy of the FEM model was verified by comparing the results of the computer simulation of the stresses with experimental results. A computer simulation of the stresses was carried out in the ANSYS environment using the FEM method. Structure observations, chemical composition measurements, and mechanical property characterisations of the investigated materials has been carried out to give a background for the discussion of the results that were

  5. Woman and partner-perceived partner responses predict pain and sexual satisfaction in provoked vestibulodynia (PVD) couples.

    Science.gov (United States)

    Rosen, Natalie O; Bergeron, Sophie; Leclerc, Bianca; Lambert, Bernard; Steben, Marc

    2010-11-01

    Provoked vestibulodynia (PVD) is a highly prevalent vulvovaginal pain condition that results in significant sexual dysfunction, psychological distress, and reduced quality of life. Although some intra-individual psychological factors have been associated with PVD, studies to date have neglected the interpersonal context of this condition. We examined whether partner responses to women's pain experience-from the perspective of both the woman and her partner-are associated with pain intensity, sexual function, and sexual satisfaction. One hundred ninety-one couples (M age for women=33.28, standard deviation [SD]=12.07, M age for men=35.79, SD=12.44) in which the woman suffered from PVD completed the spouse response scale of the Multidimensional Pain Inventory, assessing perceptions of partners' responses to the pain. Women with PVD also completed measures of pain, sexual function, sexual satisfaction, depression, and dyadic adjustment. Dependent measures were women's responses to: (i) a horizontal analog scale assessing the intensity of their pain during intercourse; (ii) the Female Sexual Function Index; and (iii) the Global Measure of Sexual Satisfaction Scale. Controlling for depression, higher solicitous partner responses were associated with higher levels of women's vulvovaginal pain intensity. This association was significant for partner-perceived responses (β=0.29, Psexual function and dyadic adjustment, woman-perceived greater solicitous partner responses (β=0.16, P=0.02) predicted greater sexual satisfaction. Partner-perceived responses did not predict women's sexual satisfaction. Partner responses were not associated with women's sexual function. Findings support the integration of dyadic processes in the conceptualization and treatment of PVD by suggesting that partner responses to pain affect pain intensity and sexual satisfaction in affected women. © 2010 International Society for Sexual Medicine.

  6. Effect of PbI2 deposition rate on two-step PVD/CVD all-vacuum prepared perovskite

    International Nuclear Information System (INIS)

    Ioakeimidis, Apostolos; Christodoulou, Christos; Lux-Steiner, Martha; Fostiropoulos, Konstantinos

    2016-01-01

    In this work we fabricate all-vacuum processed methyl ammonium lead halide perovskite by a sequence of physical vapour deposition of PbI 2 and chemical vapour deposition (CVD) of CH 3 NH 3 I under a static atmosphere. We demonstrate that for higher deposition rate the (001) planes of PbI 2 film show a higher degree of alignment parallel to the sample's surface. From X-ray diffraction data of the resulted perovskite film we derive that the intercalation rate of CH 3 NH 3 I is fostered for PbI 2 films with higher degree of (001) planes alignment. The stoichiometry of the produced perovskite film is also studied by Hard X-ray photoelectron spectroscopy measurements. Complete all-vacuum perovskite solar cells were fabricated on glass/ITO substrates coated by an ultra-thin (5 nm) Zn-phthalocyanine film as hole selective layer. A dependence of residual PbI 2 on the solar cells performance is displayed, while photovoltaic devices with efficiency up to η=11.6% were achieved. - Graphical abstract: A two-step PVD/CVD processed perovskite film with the CVD intercalation rate of CH 3 NCH 3 molecules been fostered by increasing the PVD rate of PbI 2 and prolonging the CVD time. - Highlights: • A simple PVD/CVD process for perovskite film production. • Increased PVD rate yields better alignment of the PbI 2 (001) crystallite planes. • CH 3 NH 3 I intercalation process fostered by increased PbI 2 PVD rate. • Stoichiometric CH 3 NH 3 PbI 3 suitable as absorber in photovoltaic applications • Reduced PbI 2 residue at the bottom of CH 3 NH 3 PbI 3 improves device performance.

  7. Non-classical crystallization of thin films and nanostructures in CVD and PVD processes

    CERN Document Server

    Hwang, Nong Moon

    2016-01-01

    This book provides a comprehensive introduction to a recently-developed approach to the growth mechanism of thin films and nanostructures via chemical vapour deposition (CVD). Starting from the underlying principles of the low pressure synthesis of diamond films, it is shown that diamond growth occurs not by individual atoms but by charged nanoparticles. This newly-discovered growth mechanism turns out to be general to many CVD and some physical vapor deposition (PVD) processes. This non-classical crystallization is a new paradigm of crystal growth, with active research taking place on growth in solution, especially in biomineralization processes. Established understanding of the growth of thin films and nanostructures is based around processes involving individual atoms or molecules. According to the author’s research over the last two decades, however, the generation of charged gas phase nuclei is shown to be the rule rather than the exception in the CVD process, and charged gas phase nuclei are actively ...

  8. Characterization and evaluation of EB-PVD thermal barrier coatings by impedance spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Chunxia; Liu Fushun; Gong Shengkai; Xu Huibin [School of Materials Science and Engineering, Beihang Univ., Beijing, BJ (China)

    2005-07-01

    Two layer thermal barrier coatings (TBCs) were prepared by EB-PVD (electron beam-physical vapor deposition) at different substrate temperatures in the range of 823 to 1123 K, and their microstructure was investigated with SEM and AC impedance as a function of substrate temperature and thermal cycling time. YSZ layer of all TBCs samples is in column structure, but the grain size and growth orientation are different with substrate. In this research, impedance spectra (IS) was measured as a function of thermal cycling between 1323 K and 298 K for these thermal barrier coatings. Grain boundary and bulk can be distinguished from analysis of AC impedance spectroa to provide information about the relation between microstructure and electric properties. The change in IS until failure was found to be related with the thickness, microcracks and macrocracks of TGO and the change in the interfacial of TGO/YSZ. (orig.)

  9. Double Pulse LIBS of Titanium-Based PVD-Coatings with Submicron Resolution

    Directory of Open Access Journals (Sweden)

    K. Ermalitskaia

    2016-01-01

    Full Text Available The possibility for double pulse LIBS in the process of a direct layer-by-layer analysis of the titanium-based PVD-coatings on polished flat blank samples of steel and silicon and also of the TiAlN/TiN-coating on a milling cutter is considered. A method is proposed to control thickness of the radiation evaporated layer by defocusing the laser beam with respect to the surface, making it possible to attain the depth resolution of 0.1 μm. The Ti and Ti-Zr-coatings produced using the ion-assisted condensation method and subjected to streams of the nitrogen plasma in a magnetic-plasma compressor are studied.

  10. Investigations on PVdF- HFP - PEMA polymer blend electrolytes doped with different lithium salts

    Science.gov (United States)

    Manojkumar Ubarhande, Radha; Bhattacharya, Shreya; Usha Rani, M.; Shanker Babu, Ravi; Krishnaveni, S.

    2017-11-01

    Plasticized polymer blend electrolytes were prepared by incorporating poly (vinylidenefluoride-co-hexafluoropropylene)(PVdF-HFP) and poly(ethylmethacrylate) (PEMA) complexed with plasticizer (PC) and different lithium salts such as LiClO4, LiBF4, LiCF3SO3 and LiN (CF3SO2)2) using solution-casting technique. X-ray diffraction and Fourier transform infra-red techniques confirms the structural characters and complex formation of the polymer electrolytes respectively. AC impedance analysis was carried out for all the samples in the range303-373K. The results suggest that among the various lithium salts, LiN (CF3SO2)2) based electrolytes exhibited the highest ionic conductivity (3.17 × 10-3 Scm-1).

  11. Synthesis and electrochemical properties of composite galvanic Ni with carbon nanomaterials and PVD Mo coatings

    International Nuclear Information System (INIS)

    Drozdovich, V.B.; Chayeuski, V.V.; Zhdanok, S.A.; Barkovskaya, M.M.

    2011-01-01

    Double layer coatings Ni – Mo were obtained by electrolytic deposition of galvanic Ni and following arc PVD deposition of molybdenum. The ion plating coatings Mo on Ni foil and composition electrolytic Ni coatings with carbon nanomaterials (CNM) deposited on mild steel has been also investigated. Composite galvanic Ni coatings with CNM and ion plating coatings Mo contain separately obtained cubic α-Mo phase as well as fragmentary solid solution Mo in Ni. Such coatings exclude hydrogenation of Ni foundation in alkaline solution and possess enlarged electrocatalytic properties while emitting hydrogen and oxygen. Availability of carbon based nanomaterials in combined coatings is cause of an active absorption hydrogen after cathodic polarization. A formation on the surface layer of nanostructure solid solution (Ni, Mo) after compression plasma flows treatment with fixed parameters of patterns Mo/Ni/ mild steel take place. (authors)

  12. Structure and functionality of PVdF/PAN based, composite proton conducting membranes

    International Nuclear Information System (INIS)

    Martinelli, A.; Navarra, M.A.; Matic, A.; Panero, S.; Jacobsson, P.; Boerjesson, L.; Scrosati, B.

    2005-01-01

    We have investigated new poly-vinylidene fluoride/poly-acrylonitrile (PVdF/PAN) based proton conducting membranes by means of vibrational spectroscopy. We find that a complete phase inversion occurs during the preparation procedure, when the gelling solvents are replaced by an acidic solution, providing the proton conducting property. The uptake of acid is promoted both by the presence of PAN and the ceramic filler, Al 2 O 3 . No particular interaction between the polymer matrix and the acidic solution could be detected, supporting the picture of an inert matrix entrapping a liquid component. However, the dissociation degree of the acid is decreased due to the spatial confinement in the membrane. By comparing the dissociation degree and the actual amount of acid in the membrane to the conductivity, we conclude that the limiting factor for the conductivity is the long-range mobility of the protons, which is governed by the morphology of the membrane

  13. Investigation of the Effect of Residual Stress Gradient on the Wear Behavior of PVD Thin Films

    Science.gov (United States)

    Tlili, B.; Nouveau, C.; Guillemot, G.; Besnard, A.; Barkaoui, A.

    2018-02-01

    The control of residual stresses has been seldom investigated in multilayer coatings dedicated to improvement of wear behavior. Here, we report the preparation and characterization of superposed structures composed of Cr, CrN and CrAlN layers. Nano-multilayers CrN/CrAlN and Cr/CrN/CrAlN were deposited by Physical Vapor Deposition (PVD) onto Si (100) and AISI4140 steel substrates. The Cr, CrN and CrAlN monolayers were developed with an innovative approach in PVD coatings technologies corresponding to deposition with different residual stresses levels. Composition and wear tracks morphologies of the coatings were characterized by scanning electron microscopy, high-resolution transmission electron microscopy, atomic force microscopy, x-ray photoelectron spectroscopy, energy-dispersive x-ray spectroscopy, x-ray diffraction and 3D-surface analyzer. The mechanical properties (hardness, residual stresses and wear) were investigated by nanoindentation, interferometry and micro-tribometry (fretting-wear tests). Observations suggest that multilayer coatings are composed mostly of nanocrystalline. The residual stresses level in the films has practically affected all the physicochemical and mechanical properties as well as the wear behavior. Consequently, it is demonstrated that the coating containing moderate stresses has a better wear behavior compared to the coating developed with higher residual stresses. The friction contact between coated samples and alumina balls shows also a large variety of wear mechanisms. In particular, the abrasive wear of the coatings was a combination of plastic deformation, fine microcracking and microspallation. The application of these multilayers will be wood machining of green wood.

  14. Injection moulding of optical functional micro structures using laser structured, PVD-coated mould inserts

    Energy Technology Data Exchange (ETDEWEB)

    Hopmann, Ch.; Weber, M.; Schöngart, M.; Schäfer, C., E-mail: weber@ikv-aachen.de [Institute of Plastics Processing (IKV) at RWTH Aachen University (Germany); Bobzin, K.; Bagcivan, N.; Brögelmann, T.; Theiß, S.; Münstermann, T. [Surface Engineering Institute (IOT), RWTH Aachen University, Aachen (Germany); Steger, M. [Fraunhofer Institute for Laser Technology (ILT), Aachen (Germany)

    2015-05-22

    Micro structured optical plastics components are intensively used i. e. in consumer electronics, for optical sensors in metrology, innovative LED-lighting or laser technology. Injection moulding has proven to be successful for the large-scale production of those parts. However, the production of those parts still causes difficulties due to challenges in the moulding and demoulding of plastics parts created with laser structured mould inserts. A complete moulding of the structures often leads to increased demoulding forces, which then cause a breaking of the structures and a clogging of the mould. An innovative approach is to combine PVD-coated (physical vapour deposition), laser structured inserts and a variothermal moulding process to create functional mic8iüro structures in a one-step process. Therefore, a PVD-coating is applied after the laser structuring process in order to improve the wear resistance and the anti-adhesive properties against the plastics melt. In a series of moulding trials with polycarbonate (PC) and polymethylmethacrylate (PMMA) using different coated moulds, the mould temperature during injection was varied in the range of the glass transition and the melt temperature of the polymers. Subsequently, the surface topography of the moulded parts is evaluated by digital 3D laser-scanning microscopy. The influence of the moulding parameters and the coating of the mould insert on the moulding accuracy and the demoulding behaviour are being analysed. It is shown that micro structures created by ultra-short pulse laser ablation can be successfully replicated in a variothermal moulding process. Due to the mould coating, significant improvements could be achieved in producing micro structured optical plastics components.

  15. Prediction of the properties of PVD/CVD coatings with the use of FEM analysis

    Science.gov (United States)

    Śliwa, Agata; Mikuła, Jarosław; Gołombek, Klaudiusz; Tański, Tomasz; Kwaśny, Waldemar; Bonek, Mirosław; Brytan, Zbigniew

    2016-12-01

    The aim of this paper is to present the results of the prediction of the properties of PVD/CVD coatings with the use of finite element method (FEM) analysis. The possibility of employing the FEM in the evaluation of stress distribution in multilayer Ti/Ti(C,N)/CrN, Ti/Ti(C,N)/(Ti,Al)N, Ti/(Ti,Si)N/(Ti,Si)N, and Ti/DLC/DLC coatings by taking into account their deposition conditions on magnesium alloys has been discussed in the paper. The difference in internal stresses in the zone between the coating and the substrate is caused by, first of all, the difference between the mechanical and thermal properties of the substrate and the coating, and also by the structural changes that occur in these materials during the fabrication process, especially during the cooling process following PVD and CVD treatment. The experimental values of stresses were determined based on X-ray diffraction patterns that correspond to the modelled values, which in turn can be used to confirm the correctness of the accepted mathematical model for testing the problem. An FEM model was established for the purpose of building a computer simulation of the internal stresses in the coatings. The accuracy of the FEM model was verified by comparing the results of the computer simulation of the stresses with experimental results. A computer simulation of the stresses was carried out in the ANSYS environment using the FEM method. Structure observations, chemical composition measurements, and mechanical property characterisations of the investigated materials has been carried out to give a background for the discussion of the results that were recorded during the modelling process.

  16. Tribological and Wear Performance of Nanocomposite PVD Hard Coatings Deposited on Aluminum Die Casting Tool

    Directory of Open Access Journals (Sweden)

    Jose Mario Paiva

    2018-02-01

    Full Text Available In the aluminum die casting process, erosion, corrosion, soldering, and die sticking have a significant influence on tool life and product quality. A number of coatings such as TiN, CrN, and (Cr,AlN deposited by physical vapor deposition (PVD have been employed to act as protective coatings due to their high hardness and chemical stability. In this study, the wear performance of two nanocomposite AlTiN and AlCrN coatings with different structures were evaluated. These coatings were deposited on aluminum die casting mold tool substrates (AISI H13 hot work steel by PVD using pulsed cathodic arc evaporation, equipped with three lateral arc-rotating cathodes (LARC and one central rotating cathode (CERC. The research was performed in two stages: in the first stage, the outlined coatings were characterized regarding their chemical composition, morphology, and structure using glow discharge optical emission spectroscopy (GDOES, scanning electron microscopy (SEM, and X-ray diffraction (XRD, respectively. Surface morphology and mechanical properties were evaluated by atomic force microscopy (AFM and nanoindentation. The coating adhesion was studied using Mersedes test and scratch testing. During the second stage, industrial tests were carried out for coated die casting molds. In parallel, tribological tests were also performed in order to determine if a correlation between laboratory and industrial tests can be drawn. All of the results were compared with a benchmark monolayer AlCrN coating. The data obtained show that the best performance was achieved for the AlCrN/Si3N4 nanocomposite coating that displays an optimum combination of hardness, adhesion, soldering behavior, oxidation resistance, and stress state. These characteristics are essential for improving the die mold service life. Therefore, this coating emerges as a novelty to be used to protect aluminum die casting molds.

  17. Tribological and Wear Performance of Nanocomposite PVD Hard Coatings Deposited on Aluminum Die Casting Tool.

    Science.gov (United States)

    Paiva, Jose Mario; Fox-Rabinovich, German; Locks Junior, Edinei; Stolf, Pietro; Seid Ahmed, Yassmin; Matos Martins, Marcelo; Bork, Carlos; Veldhuis, Stephen

    2018-02-28

    In the aluminum die casting process, erosion, corrosion, soldering, and die sticking have a significant influence on tool life and product quality. A number of coatings such as TiN, CrN, and (Cr,Al)N deposited by physical vapor deposition (PVD) have been employed to act as protective coatings due to their high hardness and chemical stability. In this study, the wear performance of two nanocomposite AlTiN and AlCrN coatings with different structures were evaluated. These coatings were deposited on aluminum die casting mold tool substrates (AISI H13 hot work steel) by PVD using pulsed cathodic arc evaporation, equipped with three lateral arc-rotating cathodes (LARC) and one central rotating cathode (CERC). The research was performed in two stages: in the first stage, the outlined coatings were characterized regarding their chemical composition, morphology, and structure using glow discharge optical emission spectroscopy (GDOES), scanning electron microscopy (SEM), and X-ray diffraction (XRD), respectively. Surface morphology and mechanical properties were evaluated by atomic force microscopy (AFM) and nanoindentation. The coating adhesion was studied using Mersedes test and scratch testing. During the second stage, industrial tests were carried out for coated die casting molds. In parallel, tribological tests were also performed in order to determine if a correlation between laboratory and industrial tests can be drawn. All of the results were compared with a benchmark monolayer AlCrN coating. The data obtained show that the best performance was achieved for the AlCrN/Si₃N₄ nanocomposite coating that displays an optimum combination of hardness, adhesion, soldering behavior, oxidation resistance, and stress state. These characteristics are essential for improving the die mold service life. Therefore, this coating emerges as a novelty to be used to protect aluminum die casting molds.

  18. Effect of Hexagonal Phase Content on Wear Behaviour of AlTiN Arc PVD Coatings

    Directory of Open Access Journals (Sweden)

    Joern Kohlscheen

    2018-02-01

    Full Text Available In this study, the effect of increasing aluminum content and magnetic steering field strength on the structure and wear behavior of arc PVD AlTiN coatings is discussed. Deposition was done by means of an industrial-scale PVD unit for tool coating. The aluminium content in the AlTi source material was increased from 67 to 73 at.%. We applied two settings of the magnetic field that steers the arc across the cathode surface thereby evaporating the AlTi alloy differently. The resulting coating thickness ranged from 3.5 to about 7 µm. Cemented tungsten carbide was used as substrate material. Coating properties like hardness, adhesion, and crystal phases were analyzed by indentation and X-ray diffraction, respectively. The wear behaviour of the different AlTiN hard coatings were investigated in two ways. In a first idealized test, cyclic impacting was done applying a constant force. The resulting wear pattern was quantified by an Alicona multi-focus microscope. A second wear test was done by metal cutting under realistic conditions. Fly milling of ductile cast iron (EN-GJS-700 was performed with regular interruptions in order to measure the increasing wear mark. As expected, aluminium contents above 67 at.% (in the metal fraction of the coating lead to a decreased wear resistance as the soft hexagonal phase exceeds values of a few vol.%. However, it was found that the formation of the hexagonal phase can be effectively influenced and delayed by increasing the magnetic steering field at the cathode. The wear behavior observed in cyclic impact testing corresponds well to results obtained with the more complex loading situation encountered in milling.

  19. Prefabricated Vertical Drain (PVD) and Deep Cement Mixing (DCM)/Stiffened DCM (SDCM) techniques for soft ground improvement

    Science.gov (United States)

    Bergado, D. T.; Long, P. V.; Chaiyaput, S.; Balasubramaniam, A. S.

    2018-04-01

    Soft ground improvement techniques have become most practical and popular methods to increase soil strength, soil stiffness and reduce soil compressibility including the soft Bangkok clay. This paper focuses on comparative performances of prefabricated vertical drain (PVD) using surcharge, vacuum and heat preloading as well as the cement-admixed clay of Deep Cement Mixing (DCM) and Stiffened DCM (SDCM) methods. The Vacuum-PVD can increase the horizontal coefficient of consolidation, Ch, resulting in faster rate of settlement at the same magnitudes of settlement compared to Conventional PVD. Several field methods of applying vacuum preloading are also compared. Moreover, the Thermal PVD and Thermal Vacuum PVD can increase further the coefficient of horizontal consolidation, Ch, with the associated reduction of kh/ks values by reducing the drainage retardation effects in the smear zone around the PVD which resulted in faster rates of consolidation and higher magnitudes of settlements. Furthermore, the equivalent smear effect due to non-uniform consolidation is also discussed in addition to the smear due to the mechanical installation of PVDs. In addition, a new kind of reinforced deep mixing method, namely Stiffened Deep Cement Mixing (SDCM) pile is introduced to improve the flexural resistance, improve the field quality control, and prevent unexpected failures of the Deep Cement Mixing (DCM) pile. The SDCM pile consists of DCM pile reinforced with the insertion of precast reinforced concrete (RC) core. The full scale test embankment on soft clay improved by SDCM and DCM piles was also analysed. Numerical simulations using the 3D PLAXIS Foundation finite element software have been done to understand the behavior of SDCM and DCM piles. The simulation results indicated that the surface settlements decreased with increasing lengths of the RC cores, and, at lesser extent, increasing sectional areas of the RC cores in the SDCM piles. In addition, the lateral movements

  20. Evaluation of interfacial mechanical properties under shear loading in EB-PVD TBCs by the pushout method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sang-Seok [Research Center for Advanced Science and Technology, University of Tokyo, Tokyo 153-8904 (Japan); Liu Yufu [Research Center for Advanced Science and Technology, University of Tokyo, Tokyo 153-8904 (Japan); Kagawa, Yutaka [Research Center for Advanced Science and Technology, University of Tokyo, Tokyo 153-8904 (Japan)]. E-mail: kagawa@iis.u-tokyo.ac.jp

    2007-06-15

    A new simple pushout technique for evaluation of interfacial shear mechanical properties in thermal barrier coatings has been developed. The technique is similar to the pushout test of fiber-reinforced ceramics, except for the specimen shape and support method. The technique has been applied to evaluation of interfacial delamination toughness, {gamma} {sub i}, of the electron beam physical vapor deposition (EB-PVD) ZrO{sub 2} thermal barrier coating (TBC) system. The change of {gamma} {sub i} in the EB-PVD system with thermal exposure is measured and discussed in terms of microstructural change and delamination crack path. The measured delamination toughness varied from {gamma} {sub i} = 10 to 115 J/m{sup 2}. The delamination path and TGO growth were found to be closely related. The delamination toughness significantly decreases due to the formation and growth of a spinel phase in the TGO layer. The relation between delamination toughness and delamination behavior is discussed.

  1. Advanced neutron and X-ray techniques for insights into the microstructure of EB-PVD thermal barrier coatings

    Energy Technology Data Exchange (ETDEWEB)

    Kulkarni, Anand [State University of New York, Stony Brook, NY 11794 (United States); Goland, Allen [State University of New York, Stony Brook, NY 11794 (United States); Herman, Herbert [State University of New York, Stony Brook, NY 11794 (United States)]. E-mail: hherman@ms.cc.sunysb.edu; Allen, Andrew J. [National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States); Dobbins, Tabbetha [National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States); DeCarlo, Francesco [Argonne National Laboratory, Argonne, IL 60439 (United States); Ilavsky, Jan [Argonne National Laboratory, Argonne, IL 60439 (United States); Long, Gabrielle G. [Argonne National Laboratory, Argonne, IL 60439 (United States); Fang, Stacy [Chromalloy Gas Turbine Corporation, Orangeburg, NY 10962 (United States); Lawton, Paul [Chromalloy Gas Turbine Corporation, Orangeburg, NY 10962 (United States)

    2006-06-25

    The ongoing quest to increase gas turbine efficiency and performance (increased thrust) provides a driving force for materials development. While improved engine design and usage of novel materials provide solutions for increased engine operating temperatures, and hence fuel efficiency, reliability issues remain. Thermal barrier coatings (TBCs), deposited onto turbine components using the electron-beam physical vapor deposition (EB-PVD) process, exhibit unique pore architectures capable of bridging the technological gap between insulation/life extension and prime reliance. This article explores the potential of advanced X-ray and neutron techniques for comprehension of an EB-PVD TBC coating microstructure. While conventional microscopy reveals a hierarchy of voids, complementary advanced techniques allow quantification of these voids in terms of component porosities, anisotropy, size and gradient through the coating thickness. In addition, the derived microstructural parameters obtained both further knowledge of the nature and architecture of the porosity, and help establish its influence on the resultant thermal and mechanical properties.

  2. PVD Silicon Carbide as a Thin Film Packaging Technology for Antennas on LCP Substrates for Harsh Environments

    Science.gov (United States)

    Scardelletti, Maximilian C.; Stanton, John W.; Ponchak, George E.; Jordan, Jennifer L.; Zorman, Christian A.

    2010-01-01

    This paper describes an effort to develop a thin film packaging technology for microfabricated planar antennas on polymeric substrates based on silicon carbide (SiC) films deposited by physical vapor deposition (PVD). The antennas are coplanar waveguide fed dual frequency folded slot antennas fabricated on liquid crystal polymer (LCP) substrates. The PVD SiC thin films were deposited directly onto the antennas by RF sputtering at room temperature at a chamber pressure of 30 mTorr and a power level of 300 W. The SiC film thickness is 450 nm. The return loss and radiation patterns were measured before and after the SiC-coated antennas were submerged into perchloric acid for 1 hour. No degradation in RF performance or physical integrity of the antenna was observed.

  3. Industrial inline PVD metallization for silicon solar cells with laser fired contacts leading to 21.8% efficiency

    OpenAIRE

    Nekarda, J.; Reinwand, D.; Hartmann, P.; Preu, R.

    2010-01-01

    In this contribution we present the latest results of our experiments in regard to an industrially feasible inline physical vapor deposition (PVD) metallization method for the rear side of passivated solar cells. In an earlier publication, the quality of such processed layers and the feasibility of the tool was already shown and compared with a commonly used laboratory process based on electron beam evaporation. Since then a difference in the Voc potential in the range of ~ 4 mV between both ...

  4. Development of a PVD-based manufacturing process of monolithic LEU irradiation targets for {sup 99}Mo production

    Energy Technology Data Exchange (ETDEWEB)

    Hollmer, Tobias

    2015-08-03

    {sup 99}Mo is the most important radioisotope in nuclear medicine. It is produced by fission of uranium in irradiation targets. The usage of cylindrical monolithic targets can ensure a safe supply of {sup 99}Mo and at the same reduce the amount of highly radioactive waste generated during production. To manufacture these targets, a novel PVD-based technique was developed. Both the feasibility and the high efficiency of this process were demonstrated in a prototype apparatus.

  5. Studies of steered arc motion and macroparticle production in PVD processing

    International Nuclear Information System (INIS)

    Craven, A.L.

    2000-03-01

    During the past decade the production industry has constantly strived to improve performance and cut costs, this has been aided by the development of high performance tools. The advancement of these tools has been accomplished by the application of hard wearing, low friction, coatings. A key process in the production of such coatings is Physical Vapour Deposition (PVD). Interest in such thin films has led to much research effort, both academic and industrial, being devoted to the area. In order that these advancements in technology continue, research into the fundamental aspects of PVD is required. This thesis describes research and experimental studies which have been performed to study the effect of 'steering' an electric arc on various aspects of its behaviour. 'Steering' of the arc is achieved by applying external magnetic fields which allow the guidance of the path of the arc. Work by earlier authors has aimed to control the arc more fully. The research presented here is based of a novel electromagnetic three coil steering array of cylindrical geometry. With such coils it is possible to vary the field profiles to a greater degree than has been previously achieved, permitting a greater range of steering arrangements/fields to be applied. The research presented is divided into two distinct areas: Firstly a number of experiments were performed to assess the effectiveness of the new steering coils on the motion of the arc. A personal computer was used here along with new arc motion monitoring electronics. This enabled the simultaneous measurement of the orbital transit times and also the degree of travel perpendicular to the steered direction of motion of the arc, as it traversed the surface of the cathode. Such information was then used to produce values for standard deviation of the arc from its steered path, velocity of the arc and a diffusion constant related to the motion of the are. Such values then allowed evaluation of the stochastic model of arc motion

  6. Optimization of hybrid polymer electrolytes with the effect of lithium salt concentration in PEO/PVdF-HFP blends

    Energy Technology Data Exchange (ETDEWEB)

    Pradeepa, P.; Edwin raj, S.; Sowmya, G.; Kalaiselvimary, J.; Ramesh Prabhu, M., E-mail: mkram83@gmail.com

    2016-03-15

    Highlights: • Polymer blends based on PVdF-HFP/PEO were prepared for Li-ion battery applications. • Structural and electrochemical studies were carried out on prepared electrolytes. • The electrolytes can be used as electrolyte in the possible device fabrications. - Abstract: Poly(ethylene oxide) (PEO) 6.25 wt%/poly(vinylidene fluoride-co-hexafluoropropylene) [P(VdF-HFP)] 18.75 wt% blend based electrolyte films containing different concentrations (2–10) wt% of lithium salt were prepared. The miscibility studies have been performed by using X-ray diffraction and Fourier transform infrared spectroscopy. The role of interaction between polymer hosts on conductivity is discussed using the results of a.c. impedance studies. A room temperature conductivity of 2.3912 × 10{sup −4} S cm{sup −1} has been obtained for PEO (6.25)–PVdF-HFP (18.75)–LiClO{sub 4} (8)–PC (67) polymer complex. The temperature dependence of the conductivity of polymer electrolyte seems to obey VTF relation. Electrochemical stability (3.3 V) was observed in the prepared polymer electrolyte. Reduction process and oxidation process of the prepared electrolyte system have also been evaluated by means of cyclic voltammetry. Thermogravimetric analysis results indicate thermal stability of PEO/PVdF-HFP lithium salt complexes. Roughness parameter of the sample having maximum ionic conductivity was studied by AFM. The morphology of the polymer complex is investigated by using SEM.

  7. Cutting Performance of Low Stress Thick TiAlN PVD Coatings during Machining of Compacted Graphite Cast Iron (CGI

    Directory of Open Access Journals (Sweden)

    Kenji Yamamoto

    2018-01-01

    Full Text Available A new family of physical vapor deposited (PVD coatings is presented in this paper. These coatings are deposited by a superfine cathode (SFC using the arc method. They combine a smooth surface, high hardness, and low residual stresses. This allows the production of PVD coatings as thick as 15 µm. In some applications, in particular for machining of such hard to cut material as compacted graphite iron (CGI, such coatings have shown better tool life compared to the conventional PVD coatings that have a lower thickness in the range of up to 5 μm. Finite element modeling of the temperature/stress profiles was done for the SFC coatings to present the temperature/stress profiles during cutting. Comprehensive characterization of the coatings was performed using XRD, TEM, SEM/EDS studies, nano-hardness, nano-impact measurements, and residual stress measurements. Application of the coating with this set of characteristics reduces the intensity of buildup edge formation during turning of CGI, leading to longer tool life. Optimization of the TiAlN-based coatings composition (Ti/Al ratio, architecture (mono vs. multilayer, and thickness were performed. Application of the optimized coating resulted in a 40–60% improvement in the cutting tool life under finishing turning of CGI.

  8. Investigations on Wear Mechanisms of PVD Coatings on Carbides and Sialons

    Directory of Open Access Journals (Sweden)

    Staszuk M.

    2017-12-01

    Full Text Available The paper presents the results on the wear resistance of PVD coatings on cutting inserts made from sintered carbide and sialon ceramics. The exploitative properties of coatings in technological cutting trials were defined in the paper, which also examined the adhesion of coatings to the substrate, the thickness of the coating, and the microhardness. As a result, it was found that isomorphic coating with AlN-h phase of covalent interatomic bonds exhibits much better adhesion to the sialon substrate than isomorphic coating with titanium nitride TiN. These coatings assure the high wear resistance of the coated tools, and the high adhesion combined with the high microhardness and fine-grained structure assure an increase in the exploitative life of the coated tools. In the case of coatings on substrate made from sintered carbide, there was a significant influence on the properties of the tools coated with them as concerns the existence of the diffusion zone between the substrate and the coating.

  9. Evaluation of Osseous Integration of PVD-Silver-Coated Hip Prostheses in a Canine Model

    Directory of Open Access Journals (Sweden)

    Gregor Hauschild

    2015-01-01

    Full Text Available Infection associated with biomaterials used for orthopedic prostheses remains a serious complication in orthopedics, especially tumor surgery. Silver-coating of orthopedic (megaprostheses proved its efficiency in reducing infections but has been limited to surface areas exposed to soft tissues due to concerns of silver inhibiting osseous integration of cementless stems. To close this gap in the bactericidal capacity of silver-coated orthopedic prostheses extension of the silver-coating on surface areas intended for osseous integration seems to be inevitable. Our study reports about a PVD- (physical-vapor-deposition- silver-coated cementless stem in a canine model for the first time and showed osseous integration of a silver-coated titanium surface in vivo. Radiological, histological, and biomechanical analysis revealed a stable osseous integration of four of nine stems implanted. Silver trace elemental concentrations in serum did not exceed 1.82 parts per billion (ppb and can be considered as nontoxic. Changes in liver and kidney functions associated with the silver-coating could be excluded by blood chemistry analysis. This was in accordance with very limited metal displacement from coated surfaces observed by laser ablation inductively coupled plasma-mass spectrometry (LA-ICP-MS 12 months after implantation. In conclusion our results represent a step towards complete bactericidal silver-coating of orthopedic prostheses.

  10. Wear of different PVD coatings at industrial fine-blanking field tests

    Directory of Open Access Journals (Sweden)

    Liina Lind

    2015-09-01

    Full Text Available Thin hard physical vapor deposited (PVD coatings play significant role on wear performance of fine-blanking punches in the presence of extremely high contact stresses. Nevertheless it seems that in blanking or fine-blanking the coatings are selected based on coincidence, trial-error-method or latest trends. There is limited information about planning and conducting the fine-blanking industrial field tests and measuring the wear of different coatings. In the present study a set of fine-blanking punches and laboratory specimens were prepared with three coatings – TiCN, nACRo and nACo. As substrate material Böhler S390 Microclean high speed steel was used. Coating mechanical properties (modulus of elasticity and nanohardness were measured and wear rate with alumina ball was determined using the reciprocating sliding test. Wear of coatings was measured from punches after industrial use. All of the tested coatings showed high variance of wear. However coatings nACo and nACRo have better average wear resistance in fine-blanking compared with the well-known TiCN. Industrial field tests show correlation to the ratio elastic strain to failure H/E.DOI: http://dx.doi.org/10.5755/j01.ms.21.3.7249

  11. The effect of MEVVA ion implantation on the tribological properties of PVD-TiN films

    International Nuclear Information System (INIS)

    Manory, R.; Mollica, S.

    1998-01-01

    The present work is the first study in which the effects of metal evaporation vacuum (MEVVA) implantation are studied on TiN of the PVD type which is commercially available in Australia. The MEVVA ion implanter differs from the 'conventional' type of ion implanter in the fact that it has a high throughput of metal ions which are not mass analysed and therefore has more potential for industrial non-electronic applications. TiN-coated steel samples have been implanted with two types of species - one light and one heavy - C + and W + respectively. The samples were analysed by Rutherford backscattering (RBS) and x-ray diffraction (XRD). The tribological performance was assessed by pin-on-disc and microhardness. The results show that carbon implantation was very effective in improving the friction coefficient by the formation of a carbonaceous layer on the surface. XRD also shows formation of TiC in the near surface region. W implantation does not improve the friction coefficient but improves the lifetime of the coating. Unimplanted films fail in the pin-on-disk test after 7000 cycles, whereas implanted films are still well adhered after 18000 cycles

  12. Multilayer stacks obtained by ion assisted EB PVD aimed at thermal barrier coating

    Energy Technology Data Exchange (ETDEWEB)

    Roos, E.; Maile, K.; Lyutovich, A. [Stuttgart Univ. (DE). Materialpruefungsanstalt (MPA)

    2010-07-01

    Thermal Barrier Coating (TBC) using Electron Beam Physical Vapour Deposition (EB PVD) is widely implemented, especially for aero-engine turbine blades. Generally, multilayer stacks are used for these aims. For the additional improvement of intermediate layers with graded transitions to the initial Ni-based alloy, the use of accelerated ions in the EBPVD-process is advantageous. The effect of the substrate bias potential, ion current density and deposition temperature on the structure and properties of Ti and Zr intermediate layers are investigated. The morphology of the films is studied using optical microscopy, scanning electron microscopy (SEM) and atomic force microscopy (AFM). It is found that the surface morphology becomes smoother with rising bias potential and decreasing ion current density. Measurements of Vicker's micro-hardness performed on these coatings have shown its increase with higher values of the bias and its reduction with the growing temperature. This effect is caused by the observed decrease in grain size and higher porosity of the films. A multilayer coating system Ni (based substrate)-Si-Si{sub x}Al{sub y}-Al with graded transitions between the layers is obtained using ion assisted EBPVD. Architecture of a multilayer stack for TBC with graded transitions is proposed. (orig.)

  13. Computer Simulation of the Relationship between Selected Properties of PVD Coatings

    Directory of Open Access Journals (Sweden)

    Śliwa A.

    2016-06-01

    Full Text Available The possibility to apply the Finite Element Method to calculate internal stresses which occur in Ti+TiN, Ti+Ti(CxN1-x and Ti+TiC coatings obtained in the magnetron PVD process on the sintered high-speed steel of the PM HS6-5-3-8 type. For the purpose of computer simulation of internal stresses in coatings with the use of MES, the correct model of analyzed specimens was worked out and then it was experimentally verified by comparison of calculation results with the results of computer simulation. Accurate analysis of correlations indicated especially strong dependence between internal stresses and microhardness and between microhardness and erosion resistance what created conditions for establishing the dependence between internal stresses obtained in the result of computer simulation and erosion resistance as basic functional quality of coating. It has essential practical meaning because it allows to estimate predictable erosion resistance of coating exclusively on the base of the results of computer simulation for used parameters in the process of coating manufacturing.

  14. Performance of PVD-Coated Carbide Tools When Turning Inconel 718 in Dry Machining

    Directory of Open Access Journals (Sweden)

    Gusri Akhyar Ibrahim

    2011-01-01

    Full Text Available Inconel 718 has found its niche in many industries, owing to its unique properties such as high oxidation resistance and corrosion resistance even at very high temperatures. Coated carbide tool with hard layer of PVD TiAlN is used to turn Inconel 718. Taguchi method with the orthogonal array L9 is applied in this experiment with the parameter cutting speed of 60–80 m/min, feed rate of 0.2–0.3 mm/rev, and depth of cut of 0.3–0.5 mm. The results show that depth of cut is a significant influence to the tool life. Cutting speed of 60 m/min, feed rate of 0.2 mm/rev, and depth of cut of 0.3 mm are the optimum parameters. The flank wear, crater wear, notch wear, and nose wear are the wear mechanisms on the carbide tool. Through the SEM, abrasion, attrition, and adhesion are the wear mechanisms which can be seen on the cutting tool.

  15. Tweedracht maakt macht. De PvdA, de doorbraak en de ontluikende polarisatiestrategie (1946-1966

    Directory of Open Access Journals (Sweden)

    B. Mellink

    2011-01-01

    Full Text Available Divide and Rule: The Dutch Labour Party (PvdA, the Breakthrough and the Emerging Polarisation Strategy (1946-1966In 1966, after a lengthy debate in the Dutch parliament, the Cals cabinet came to a sudden end. As a motion proposed by Norbert Schmelzer, the parliamentary leader of the prime minister’s own Catholic party precipitated the cabinet’s fall, ‘Schmelzer’s Night’ received an iconic status in Dutch political history. Many historians have interpreted Schmelzer’s Night as the birth of a Social Democratic ‘polarisation strategy’: differences between Left and Right were exaggerated in order to divide the confessional parties along ideological lines. Established analyses ascribe the development of this polarisation strategy to the ascendancy of a younger generation in Dutch politics. This article argues instead that the polarisation strategy of the late 1960s was not so much caused by a new generation, but rather emerged as a consequence of postwar Social Democrats’ efforts to abolish pillarisation (verzuiling in Dutch society.

  16. Mechanical properties of EB-PVD ZrO2 thermal barrier coatings

    International Nuclear Information System (INIS)

    Held, Carolin

    2014-01-01

    In this work, the elastic properties of thermal barrier coatings which were produced by electron-beam enhanced physical vapour deposition were investigated, as well as the dependency of the properties on the sample microstructure, the thermal treatment and the test method. For this purpose, not only commercial coatings were characterized, but also special sample material was used which consists of a 1 mm thick layer of EB-PVD TBC. This material was isothermally heat treated for different times at 950 C, 1100 C and 1200 C and then tested in a specially developed miniaturized bend test and by dynamic mechanical analysis. The sample material was tested by nanoindentation in order to measure the Young's modulus on a local scale, and the porosity of the samples was determined by microstructure analysis and porosimetry. The decrease of porosity could be connected with sintering and subsequent stiffening of the material. The test results are dependent on the tested volume. A small test volume leads to larger measured Young's moduli, while a large test volume yields lower values. The test volume also has an influence on the increase of stiffness during thermal exposure. With a small tested volume, a quicker increase of the Young's modulus was registered, which could be associated to the sintering of local structures.

  17. Evaluation of osseous integration of PVD-silver-coated hip prostheses in a canine model.

    Science.gov (United States)

    Hauschild, Gregor; Hardes, Jendrik; Gosheger, Georg; Stoeppeler, Sandra; Ahrens, Helmut; Blaske, Franziska; Wehe, Christoph; Karst, Uwe; Höll, Steffen

    2015-01-01

    Infection associated with biomaterials used for orthopedic prostheses remains a serious complication in orthopedics, especially tumor surgery. Silver-coating of orthopedic (mega)prostheses proved its efficiency in reducing infections but has been limited to surface areas exposed to soft tissues due to concerns of silver inhibiting osseous integration of cementless stems. To close this gap in the bactericidal capacity of silver-coated orthopedic prostheses extension of the silver-coating on surface areas intended for osseous integration seems to be inevitable. Our study reports about a PVD- (physical-vapor-deposition-) silver-coated cementless stem in a canine model for the first time and showed osseous integration of a silver-coated titanium surface in vivo. Radiological, histological, and biomechanical analysis revealed a stable osseous integration of four of nine stems implanted. Silver trace elemental concentrations in serum did not exceed 1.82 parts per billion (ppb) and can be considered as nontoxic. Changes in liver and kidney functions associated with the silver-coating could be excluded by blood chemistry analysis. This was in accordance with very limited metal displacement from coated surfaces observed by laser ablation inductively coupled plasma-mass spectrometry (LA-ICP-MS) 12 months after implantation. In conclusion our results represent a step towards complete bactericidal silver-coating of orthopedic prostheses.

  18. Impedance study on the corrosion of PVD and CVD titanium nitride coatings

    International Nuclear Information System (INIS)

    Elsener, B.; Rota, A.; Boehni, H.

    1989-01-01

    Titanium nitride (TiN) coatings, produced by physical (PVD) or chemical (CVD) vapor deposition techniques are used routinely to improve the wear and corrosion resistance of a surface. The main problem in using TiN as a protective coating in aggressive environements are pores and pinholes in the coating where the substrate is exposed to the electrolyte. In this work, the electrochemical and corrosion behaviour of TiN films on quartz glass, carbon steel, 304 and 316 stainless steel is studied by polarization curves and electrochemical impedance spectroscopy (EIS) in hydrochloric acid. It is shown that the TiN coating can be used successfully only on substrates that passivate easily. On mild steel rapid corrosion takes place at pores in the coating due to the very noble steady state potential of the TiN coating. The interaction of the metallic substrate with the TiN coating is discussed for the two limiting cases mild steel (active) and 316SS (passive). It is shown that the determination of the coating porosity is possible for the active substrate only. On the passive substrate the occurence of an additional time constant in the high frequency region of the spectrum qualitatively indicates the presence of pores. A quality control of the coatings based on this fact might be possible. (author) 15 refs., 6 figs., 2 tabs

  19. Enhanced Corrosion Resistance of PVD-CrN Coatings by ALD Sealing Layers

    Science.gov (United States)

    Wan; Zhang, Teng Fei; Ding, Ji Cheng; Kim, Chang-Min; Park, So-Won; Yang, Yang; Kim, Kwang-Ho; Kwon, Se-Hun

    2017-04-01

    Multilayered hard coatings with a CrN matrix and an Al2O3, TiO2, or nanolaminate-Al2O3/TiO2 sealing layer were designed by a hybrid deposition process combined with physical vapor deposition (PVD) and atomic layer deposition (ALD). The strategy was to utilize ALD thin films as pinhole-free barriers to seal the intrinsic defects to protect the CrN matrix. The influences of the different sealing layers added in the coatings on the microstructure, surface roughness, and corrosion behaviors were investigated. The results indicated that the sealing layer added by ALD significantly decreased the average grain size and improved the corrosion resistance of the CrN coatings. The insertion of the nanolaminate-Al2O3/TiO2 sealing layers resulted in a further increase in corrosion resistance, which was attributed to the synergistic effect of Al2O3 and TiO2, both acting as excellent passivation barriers to the diffusion of corrosive substances.

  20. Effect of Hf Additions to Pt Aluminide Bond Coats on EB-PVD TBC Life

    Science.gov (United States)

    Nesbitt, James; Nagaraj, Ben; Williams, Jeffrey

    2000-01-01

    Small Hf additions were incorporated into a Pt aluminide coating during chemical vapor deposition (CVD) on single crystal RENE N5 substrates. Standard yttria-stabilized zirconia top coats were subsequently deposited onto the coated substrates by electron beam-physical vapor deposition (EB-PVD). The coated substrates underwent accelerated thermal cycle testing in a furnace at a temperature in excess of 1121 C (2050 F) (45 minute hot exposure, 15 minute cool to approximately 121 C (250 F)) until the thermal barrier coating (TBC) failed by spallation. Incorporating Hf in the bond coat increased the TBC life by slightly more than three times that of a baseline coating without added Hf. Scanning electron microscopy of the spalled surfaces indicated that the presence of the Hf increased the adherence of the thermally grown alumina to the Pt aluminide bond coat. The presence of oxide pegs growing into the coating from the thermally grown alumina may also partially account for the improved TBC life by creating a near-surface layer with a graded coefficient of thermal expansion.

  1. Plasma thermal performance of a dual-process PVD/PS tungsten coating on carbon-based panels for nuclear fusion application

    International Nuclear Information System (INIS)

    Kim, Hyunmyung; Lee, Ho Jung; Kim, Sung Hwan; Jang, Changheui

    2016-01-01

    Highlights: • Plasma thermal performance of a dual-process PVD/PS W coating was evaluated. • Steady-state heat fluxes of 1–3 MW/m 2 were applied to the W coated specimens. • Less micro-pores and grain growth were observed for the dual-process coating. • Loss of coating thickness was observed for the simple PS W coating. • Dual-process PVD/PS W coating was resistant to erosion due to the surface PVD layer. - Abstract: Various tungsten (W) coating techniques have been used for the application of plasma facing material in nuclear fusion devices, which resulted in limited success. In this study, a dual-process W coating structure was developed on a graphite substrate to improve the thermal performance of the coating structure. The dual-process coating structure consisted of a thin (∼7 μm) multilayer W/Mo physical vapor deposition (PVD) coating layer deposited on top of the relatively thick (∼160 μm) plasma spray (PS) W coating on a graphite substrate panel. Then the coated sample was exposed to plasma heat flux of 1–3 MW/m 2 for 300 s. With addition of a thin surface PVD coating layer, the microstructure change in underlying PS W coating was substantially reduced compared to the simple PS W coating structure. The thickness of overall coating structure was maintained for the dual-process PVD/PS coated samples after the thermal loading tests, while a significant reduction in thickness due to surface erosion was observed for the simple PS W coated samples. The improvement in surface erosion resistance in the dual-process coating structure was discussed in view of the characteristics of PVD and PS coating layers.

  2. Plasma thermal performance of a dual-process PVD/PS tungsten coating on carbon-based panels for nuclear fusion application

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyunmyung; Lee, Ho Jung; Kim, Sung Hwan; Jang, Changheui, E-mail: chjang@kaist.ac.kr

    2016-11-01

    Highlights: • Plasma thermal performance of a dual-process PVD/PS W coating was evaluated. • Steady-state heat fluxes of 1–3 MW/m{sup 2} were applied to the W coated specimens. • Less micro-pores and grain growth were observed for the dual-process coating. • Loss of coating thickness was observed for the simple PS W coating. • Dual-process PVD/PS W coating was resistant to erosion due to the surface PVD layer. - Abstract: Various tungsten (W) coating techniques have been used for the application of plasma facing material in nuclear fusion devices, which resulted in limited success. In this study, a dual-process W coating structure was developed on a graphite substrate to improve the thermal performance of the coating structure. The dual-process coating structure consisted of a thin (∼7 μm) multilayer W/Mo physical vapor deposition (PVD) coating layer deposited on top of the relatively thick (∼160 μm) plasma spray (PS) W coating on a graphite substrate panel. Then the coated sample was exposed to plasma heat flux of 1–3 MW/m{sup 2} for 300 s. With addition of a thin surface PVD coating layer, the microstructure change in underlying PS W coating was substantially reduced compared to the simple PS W coating structure. The thickness of overall coating structure was maintained for the dual-process PVD/PS coated samples after the thermal loading tests, while a significant reduction in thickness due to surface erosion was observed for the simple PS W coated samples. The improvement in surface erosion resistance in the dual-process coating structure was discussed in view of the characteristics of PVD and PS coating layers.

  3. Anisotropic TGO rumpling in EB-PVD thermal barrier coatings under in-phase thermomechanical loading

    Energy Technology Data Exchange (ETDEWEB)

    Balint, D.S., E-mail: d.balint@imperial.ac.uk [Department of Mechanical Engineering, Imperial College London, London SW7 2AZ (United Kingdom); Kim, S.-S.; Liu Yufu; Kitazawa, R.; Kagawa, Y. [Research Center for Advanced Science and Technology, University of Tokyo, 4-6-1 Komaba, Meguro-ku, Tokyo 153-8409 (Japan); Evans, A.G. [College of Engineering, University of California, Santa Barbara, CA 93106 (United States)

    2011-04-15

    An electron beam physical vapor deposited (EB-PVD) Y{sub 2}O{sub 3}-ZrO{sub 2} thermal barrier system has been tested under in-phase thermomechanical fatigue (TMF) conditions with thermal gradient in the through-thickness direction. Undulations in the thermally grown oxide (TGO) were observed to have clear anisotropic behavior with respect to the directions parallel and perpendicular to the loading axis. It was found that undulation wavelengths were nearly the same in both directions but the amplitude in the perpendicular direction was much larger than in the parallel direction. A recent model of TGO rumpling was adapted and used to analyze and explain the origins of the observed rumpling behavior under TMF conditions. Methods for deducing variation in the coefficient of thermal expansion with temperature and in the creep properties of the substrate from the experimental strain data are also presented in the course of the derivations. Model results show that tensile stress applied in the loading direction can overcome the compression occurring from lateral expansion during oxide formation, causing undulations to flatten; undulations perpendicular to the loading axis are unaffected. However, ratcheting in the strain cycle experienced by the substrate, which occurs naturally by substrate creep, is necessary for anisotropic rumpling under cyclic stress conditions. Model predictions for constant applied stress are also presented, demonstrating a reversal in the direction of undulation alignment under compression. A threshold stress is identified, in both tension and compression, sufficient to produce appreciable anisotropic rumpling. The model predictions provide a clear mechanism for the anisotropy and further evidence that the lateral expansion strain in the oxide is the driving force for oxide rumpling.

  4. Effect of Annealing Temperature on the Water Contact Angle of PVD Hard Coatings

    Science.gov (United States)

    Yang, Yu-Sen; Cho, Ting-Pin

    2013-01-01

    Various PVD (physical vapor deposition) hard coatings including nitrides and metal-doped diamond-like carbons (Me-DLC) were applied in plastic injection and die-casting molds to improve wear resistance and reduce sticking. In this study, nitrides hcp-AlN (hexagonal close-packed AlN), Cr2N, (CrAl)2N) and Me-DLC (Si-DLC and Cr-DLC) coatings were prepared using a closed field unbalanced magnetron reactive sputtering system. The coatings were annealed in air for 2 h at various temperatures, after which the anti-sticking properties were assessed using water contact angle (WCA) measurements. The as-deposited hcp-AlN, Cr2N and (CrAl)2N coatings exhibit hydrophobic behavior and exhibit respective WCAs of 119°, 106° and 101°. The as-deposited Si-DLC and Cr-DLC coatings exhibit hydrophilic behavior and exhibit respective WCAs of 74° and 88°. The annealed Cr2N and (CrAl)2N coatings exhibit hydrophobic behavior with higher WCAs, while the annealed hcp-AlN, Si-DLC and Cr-DLC coatings are hydrophilic. The increased WCA of the annealed Cr2N and (CrAl)2N coatings is related to their crystal structure and increased roughness. The decreased WCA of the annealed hcp-AlN, Si-DLC and Cr-DLC coatings is related to their crystal structures and has little correlation with roughness. PMID:28811440

  5. Effect of Annealing Temperature on the Water Contact Angle of PVD Hard Coatings.

    Science.gov (United States)

    Yang, Yu-Sen; Cho, Ting-Pin

    2013-08-07

    Various PVD (physical vapor deposition) hard coatings including nitrides and metal-doped diamond-like carbons (Me-DLC) were applied in plastic injection and die-casting molds to improve wear resistance and reduce sticking. In this study, nitrides hcp-AlN (hexagonal close-packed AlN), Cr₂N, (CrAl)₂N) and Me-DLC (Si-DLC and Cr-DLC) coatings were prepared using a closed field unbalanced magnetron reactive sputtering system. The coatings were annealed in air for 2 h at various temperatures, after which the anti-sticking properties were assessed using water contact angle (WCA) measurements. The as-deposited hcp-AlN, Cr₂N and (CrAl)₂N coatings exhibit hydrophobic behavior and exhibit respective WCAs of 119°, 106° and 101°. The as-deposited Si-DLC and Cr-DLC coatings exhibit hydrophilic behavior and exhibit respective WCAs of 74° and 88°. The annealed Cr₂N and (CrAl)₂N coatings exhibit hydrophobic behavior with higher WCAs, while the annealed hcp-AlN, Si-DLC and Cr-DLC coatings are hydrophilic. The increased WCA of the annealed Cr₂N and (CrAl)₂N coatings is related to their crystal structure and increased roughness. The decreased WCA of the annealed hcp-AlN, Si-DLC and Cr-DLC coatings is related to their crystal structures and has little correlation with roughness.

  6. Anisotropic TGO rumpling in EB-PVD thermal barrier coatings under in-phase thermomechanical loading

    International Nuclear Information System (INIS)

    Balint, D.S.; Kim, S.-S.; Liu Yufu; Kitazawa, R.; Kagawa, Y.; Evans, A.G.

    2011-01-01

    An electron beam physical vapor deposited (EB-PVD) Y 2 O 3 -ZrO 2 thermal barrier system has been tested under in-phase thermomechanical fatigue (TMF) conditions with thermal gradient in the through-thickness direction. Undulations in the thermally grown oxide (TGO) were observed to have clear anisotropic behavior with respect to the directions parallel and perpendicular to the loading axis. It was found that undulation wavelengths were nearly the same in both directions but the amplitude in the perpendicular direction was much larger than in the parallel direction. A recent model of TGO rumpling was adapted and used to analyze and explain the origins of the observed rumpling behavior under TMF conditions. Methods for deducing variation in the coefficient of thermal expansion with temperature and in the creep properties of the substrate from the experimental strain data are also presented in the course of the derivations. Model results show that tensile stress applied in the loading direction can overcome the compression occurring from lateral expansion during oxide formation, causing undulations to flatten; undulations perpendicular to the loading axis are unaffected. However, ratcheting in the strain cycle experienced by the substrate, which occurs naturally by substrate creep, is necessary for anisotropic rumpling under cyclic stress conditions. Model predictions for constant applied stress are also presented, demonstrating a reversal in the direction of undulation alignment under compression. A threshold stress is identified, in both tension and compression, sufficient to produce appreciable anisotropic rumpling. The model predictions provide a clear mechanism for the anisotropy and further evidence that the lateral expansion strain in the oxide is the driving force for oxide rumpling.

  7. Relation of Thermal Conductivity with Process Induced Anisotropic Void Systems in EB-PVD PYSZ Thermal Barrier Coatings

    Energy Technology Data Exchange (ETDEWEB)

    Renteria, A. Flores; Saruhan-Brings, B.; Ilavsky, J.

    2008-03-03

    Thermal barrier coatings (TBCs) deposited by Electron-beam physical deposition (EB-PVD) protect the turbine blades situated at the high pressure sector of the aircraft and stationary turbines. It is an important task to uphold low thermal conductivity in TBCs during long-term service at elevated temperatures. One of the most promising methods to fulfil this task is to optimize the properties of PYSZ-based TBC by tailoring its microstructure. Thermal conductivity of the EB-PVD produced PYSZ TBCs is influenced mainly by the size, shape, orientation and volume of the various types of porosity present in the coatings. These pores can be classified as open (inter-columnar and between feather arms gaps) and closed (intra-columnar pores). Since such pores are located within the three-dimensionally deposited columns and enclose large differences in their sizes, shapes, distribution and anisotropy, the accessibility for their characterization is very complex and requires the use of sophisticated methods. In this work, three different EB-PVD TBC microstructures were manufactured by varying the process parameters, yielding various characteristics of their pores. The corresponding thermal conductivities in as-coated state and after ageing at 11000C/1h and 100h were measured via Laser Flash Analysis Method (LFA). The pore characteristics and their individual effect on the thermal conductivity are analysed by USAXS which is supported by subsequent modelling and LFA methods, respectively. Evident differences in the thermal conductivity values of each microstructure were found in as-coated and aged conditions. In summary, broader columns introduce higher values in thermal conductivity. In general, thermal conductivity increases after ageing for all three investigated microstructures, although those with initial smaller pore surface area show smaller changes.

  8. Relation of thermal conductivity with process induced anisotropic void system in EB-PVD PYSZ thermal barrier coatings.

    Energy Technology Data Exchange (ETDEWEB)

    Renteria, A. F.; Saruhan, B.; Ilavsky, J.; German Aerospace Center

    2007-01-01

    Thermal barrier coatings (TBCs) deposited by Electron-beam physical deposition (EB-PVD) protect the turbine blades situated at the high pressure sector of the aircraft and stationary turbines. It is an important task to uphold low thermal conductivity in TBCs during long-term service at elevated temperatures. One of the most promising methods to fulfil this task is to optimize the properties of PYSZ-based ,TBC by tailoring its microstructure. Thermal conductivity of the EB-PVD produced PYSZ TBCs is influenced mainly by the size, shape, orientation and volume of the various types of porosity present in the coatings. These pores can be classified as open (inter-columnar and between feather arms gaps) and closed (intra-columnar pores). Since such pores are located within the three-dimensionally deposited columns and enclose large differences in their sizes, shapes, distribution and anisotropy, the accessibility for their characterization is very complex and requires the use of sophisticated methods. In this work, three different EB-PVD TBC microstructures were manufactured by varying the process parameters, yielding various characteristics of their pores. The corresponding thermal conductivities in as-coated state and after ageing at 1100C/1h and 100h were measured via Laser Flash Analysis Method (LFA). The pore characteristics and their individual effect on the thermal conductivity are analysed by USAXS which is supported by subsequent modelling and LFA methods, respectively. Evident differences in the thermal conductivity values of each microstructure were found in as-coated and aged conditions. In summary, broader columns introduce higher values in thermal conductivity. In general, thermal conductivity increases after ageing for all three investigated microstructures, although those with initial smaller pore surface area show smaller changes.

  9. Resistencia a la corrosión y desgaste de recubrinnientos deTiN obtenidos por PVD

    Directory of Open Access Journals (Sweden)

    Conde, A.

    2005-12-01

    Full Text Available Surface hardening techniques for metallic alloys are widely used to achieve layers of very high hardness and corrosion and wear resistance. In the present paper TiN coatings are obtained by PVD on a tool steel. The films are characterized by SEM, X-ray diffraction and XPS. Corrosion behaviour in NaCl solution showed the importance of the presence of defects on the PVD coating due to the different electrochemical behaviour of the steel base. Pin-on-disk measurements at approximately 40% RH against a corundum (Al2O3 ball showed a significant decrease in the wear rate compared with the results for the standard tool steel.

    Los tratamientos de endurecimiento superficial de aleaciones metálicas se utilizan para lograr capas de muy elevada dureza, resistencia a la corrosión y desgaste. En este trabajo, se estudia el comportamiento de recubrimientos de TiN obtenidos mediante PVD sobre aceros de herramientas. Las capas obtenidas se caracterizan mediante microscopía electrónica de barrido, difracción de rayos X y XPS. Se analiza el comportamiento frente a la corrosión de las capas protectoras, así como la influencia del substrato en su comportamiento en soluciones de NaCl. Finalmente, se realizan ensayos de desgaste por deslizamiento en seco mediante la técnica de pin-on-disk, comprobándose la mayor resistencia de estas capas.

  10. Full Scale Model Test of Consolidation Acceleration on Soft Soil deposition with Combination of Timber Pile and PVD (Hybrid Pile)

    OpenAIRE

    Sandyutama, Y.; Samang, L.; Imran, A. M.; Harianto4, T.

    2015-01-01

    This research aims to analyze the effect of composite pile-PVD (hybrid pile) as the reinforcement in embankment on soft soil by the means of numerical simulation and Full-Scale Trial Embankment. The first phase cunducted by numerical analysis and obtained 6-8 meters hybrid pile length effective. Full-Scale trial embankment. was installed hybrid pile of 6 m and preloading of 4,50 height. Full-scale tests were performed to investigate the performances of Hybrid pile reinforcement. This research...

  11. Evaluación ergonómica de usuarios de PVD en la empresa: Construmer, SL

    OpenAIRE

    Martín, María Consuelo

    2012-01-01

    El objetivo de este informe es el de la evaluación ergonómica de los trabajadores como usuarios de PVD, y la estimación del nivel de riesgo que las condiciones de trabajo concretas respecto a éste, en el centro de trabajo referenciado arriba, pudieran provocar sobre los trabajadores que posean tal condición. El objeto proviene de la necesidad de dar cumplimiento a la exigencia legal impuesta por la ley 31/95, de 8 de Noviembre, sobre Prevención de Riesgos Laborales.

  12. Development of Production PVD-AIN Buffer Layer System and Processes to Reduce Epitaxy Costs and Increase LED Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cerio, Frank

    2013-09-14

    was analyzed and improvements implemented to the Veeco PVD-AlN prototype system to establish a specification and baseline PVD-AlN films on sapphire and in parallel the evaluation of PVD AlN on silicon substrates began. In Phase II of the project a Beta tool based on a scaled-up process module capable of depositing uniform films on batches of 4”or 6” diameter substrates in a production worthy operation was developed and qualified. In Phase III, the means to increase the throughput of the PVD-AlN system was evaluated and focused primarily on minimizing the impact of the substrate heating and cooling times that dominated the overall cycle time.

  13. Nanocomposite metal amorphous-carbon thin films deposited by hybrid PVD and PECVD technique.

    Science.gov (United States)

    Teixeira, V; Soares, P; Martins, A J; Carneiro, J; Cerqueira, F

    2009-07-01

    Carbon based films can combine the properties of solid lubricating graphite structure and hard diamond crystal structure, i.e., high hardness, chemical inertness, high thermal conductivity and optical transparency without the crystalline structure of diamond. Issues of fundamental importance associated with nanocarbon coatings are reducing stress, improving adhesion and compatibility with substrates. In this work new nanocomposite coatings with improved toughness based in nanocrystalline phases of metals and ceramics embedded in amorphous carbon matrix are being developed within the frame of a research project: nc-MeNxCy/a-C(Me) with Me = Mo, Si, Al, Ti, etc. Carbide forming metal/carbon (Me/C) composite films with Me = Mo, W or Ti possess appropriate properties to overcome the limitation of pure DLC films. These novel coating architectures will be adopted with the objective to decrease residual stress, improve adherence and fracture toughness, obtain low friction coefficient and high wear-resistance. Nanocomposite DLC's films were deposited by hybrid technique using a PVD-Physically Vapor Deposition (magnetron sputtering) and Plasma Enhanced Chemical Vapor Deposition (PECVD), by the use of CH4 gas. The parameters varied were: deposition time, substrate temperature (180 degrees C) and dopant (Si + Mo) of the amorphous carbon matrix. All the depositions were made on silicon wafers and steel substrates precoated with a silicon inter-layer. The characterisation of the film's physico-mechanical properties will be presented in order to understand the influence of the deposition parameters and metal content used within the a-C matrix in the thin film properties. Film microstructure and film hybridization state was characterized by Raman Spectroscopy. In order to characterize morphology SEM and AFM will be used. Film composition was measured by Energy-Dispersive X-ray analysis (EDS) and by X-ray photoelectron spectroscopy (XPS). The contact angle for the produced DLC's on

  14. Superhard PVD carbon films deposited with different gradients with and without additions of titanium and silicon

    International Nuclear Information System (INIS)

    Bauer, C.

    2003-10-01

    This work focusses on thin carbon-based films, deposited by magnetron sputtering with additional argon ion bombardment (0 eV to 800 eV) without extra adhesive layer on hard metal inserts. As one possibility of increasing the reduced adherence of hard carbon films the deposition of films with additions of titanium and silicon is studied. The aim of this work is to examine the influence of a modification of the transition between substrate and film by realizing three different types of deposition gradients. The pure carbon films are amorphous, the dominant network of atoms is formed by sp 2 bonded atoms. The amount of sp 3 bonded atoms is up to 30% and is influenced by the bombarding argon ion energy. Carbon films with additions of silicon are amorphous, only in films with a high amount of titanium (approx. 20 at%) nanocomposites of titanium carbide crystals with diameters of less than 5 nm in an amorphous carbon matrix were found. The mechanical properties and the behavior of single layer carbon films strongly depend on the argon ion energy. An increase of this energy leads to higher film hardness and higher residual stress and results in the delamination of superhard carbon films on hard metal substrates. The adhesion of single layer films for ion energies of more than 200 eV is significantly improved by additions of titanium and silicon, respectively. The addition of 23 at% silicon and titanium, respectively leads to a high reduction of the residual stress. In a non-reactive PVD process thin films were deposited with a continuously gradient in chemical composition. The results of the investigations of the films with two different concentrations of titanium and silicon, respectively show that carbon-based films with a good adhesion could be deposited. The combination of the two gradients in structure and properties and in chemical composition leads in the system with carbon and silicon carbide to hard and very adhesive films. Especially for carbon films with a high

  15. MeCrAl coatings obtained by arc PVD and pack cementation processes on nickel base superalloys

    International Nuclear Information System (INIS)

    Swadzba, L.; Maciejny, A.; Formanek, B.; Mendala, B.

    1997-01-01

    The paper presents the results of researches on obtaining and structure of high temperature resistance coatings on superalloys. The coatings were deposited on nickel and nickel base superalloys in two stages. During the first stage, the NiCr and NiCrHf coatings were obtained by arc-PVD method. Basic technology, bias, arc current, rotation, parameters of deposition of NiCr and MeCrHf coatings were defined. The high efficiency of deposition of both single and two sources was observed. The targets were made by vacuum melting and machining. An influence of targets chemical composition on coating structure and chemical coatings composition was described. The second stage was made by pack cementation HTLA (high temperature low activity) on 1323 K chromoaluminizing process. These arc-PVD and diffusion (pack cementation) connected processes permitted to obtain MeCrAl and MeCrAlHf type of coatings. The morphology, structure and microchemical composition were characterized by scanning electron microscopy, X-ray microanalysis, energy dispersive X-ray spectroscopy and X-ray diffraction methods. (orig.)

  16. Reinforced PEI/PVdF Multicore-Shell Structure Composite Membranes by Phase Prediction on a Ternary Solution

    Directory of Open Access Journals (Sweden)

    Jihye Chae

    2018-04-01

    Full Text Available To construct a polyetherimide (PEI-reinforced polyvinylidene fluoride (PVdF composite membrane with multicore-shell structure, a ternary solution was prepared and electrospun by single-nozzle electrospinning. A theoretical prediction was made for the feasibility of complete distinction of two phases. The diameters of the membrane fibers and the PEI multi-core fibrils varied with the PEI ratio and the spinning time, respectively. The tensile strength and modulus were improved to 48 MPa and 1.5 GPa, respectively. The shrinkage of the membrane was only 6.6% at 180 °C, at which temperature the commercial PE separator melted down. The reinforcement in mechanical and thermal properties is associated with multiple PEI nanofibrils oriented along the fiber axis. Indeed, the unique morphology of self-assembled multicore-shell fibers plays an important role in their properties. All in all, PEI/PVdF membranes are appropriate for a lithium-ion battery application due to their high mechanical strength, excellent thermal stability, and controllable textural properties.

  17. Synthesis and electrochemical properties of Ti-doped DLC films by a hybrid PVD/PECVD process

    Science.gov (United States)

    Jo, Yeong Ju; Zhang, Teng Fei; Son, Myoung Jun; Kim, Kwang Ho

    2018-03-01

    Low electrical conductivity and poor adhesion to metallic substrates are the main drawbacks of diamond-like carbon (DLC) films when used in electrode applications. In this study, Ti-doped DLC films with various Ti contents were synthesized on metal Ti substrates by a hybrid PVD/PECVD process, where PECVD was used for deposition of DLC films and PVD was used for Ti doping. The effects of the Ti doping ratio on the microstructure, adhesion strength, and electrical and electrochemical properties of the DLC films were systematically investigated. An increase in the Ti content led to increased surface roughness and a higher sp2/sp3 ratio of the Ti-DLC films. Ti atoms existed as amorphous-phase Ti carbide when the Ti doping ratio was less than 2.8 at.%, while the nanocrystalline TiC phase was formed in DLC films when the Ti doping ratio was exceeded 4.0 at.%. The adhesion strength, electrical resistivity, electrochemical activity and reversibility of the DLC films were greatly improved by Ti doping. The influence of Ti doping ratio on the electrical and electrochemical properties of the DLC films were also investigated and the best performance was obtained at a Ti content of 2.8 at.%.

  18. Fiber damage during the consolidation of PVD Ti-6Al-4V coated NEXTEL 610 trademark alumina fibers

    International Nuclear Information System (INIS)

    Warren, J.; Elzey, D.M.; Wadley, H.N.G.

    1995-01-01

    Titanium matrix composites reinforced with sol-gel synthesized α-alumina fiber tows have attracted interest as a potentially low cost continuous fiber reinforced metal matrix composite system. The authors have conducted a detailed investigation of fiber damage during high temperature consolidation of PVD Ti-6Al-4V metallized sol-gel alumina fiber tows. Using both hot isostatic pressing and interrupted vacuum hot press consolidation cycles, the two principal mechanisms of fiber damage have been experimentally identified to be microbending/fracture and fiber matrix reaction. A time dependent micromechanics model incorporating the evolving geometry and mechanical properties of both the fibers and matrix has been formulated to simulate the fiber bending/failure mechanism in a representative unit cell and explore the effect of fiber strength loss due to reaction with the matrix. This model has been used to design a process cycle that minimizes damage by exploiting the enhanced superplastic deformation of the initially nanocrystalline PVD Ti-6Al-4V matrix

  19. Analysis of the photo voltage decay /PVD/ method for measuring minority carrier lifetimes in P-N junction solar cells

    Science.gov (United States)

    Von Roos, O.

    1981-01-01

    The photo voltage decay (PVD) method for the measurement of minority carrier lifetimes in P-N junction solar cells with cell thickness comparable to or even less than the minority carrier diffusion length is examined. The method involves the generation of free carriers in the quasi-neutral bulk material by flashes of light and the monitoring of the subsequent decay of the induced open-circuit voltages as the carriers recombine, which is dependent on minority carrier recombination lifetime. It is shown that the voltage versus time curve for an ordinary solar cell (N(+)-P junction) is proportional to the inverse minority carrier lifetime plus a factor expressing the ratio of diffusion length to cell thickness. In the case of an ideal back-surface-field cell (N(+)-P-P(+) junction) however, the slope is directly proportional to the inverse minority carrier lifetime. It is noted that since most BSF cells are not ideal, possessing a sizable back surface recombination velocity, the PVD measurements must be treated with caution and supplemented with other nonstationary methods.

  20. Development and evaluation of two PVD-coated β-titanium orthodontic archwires for fluoride-induced corrosion protection.

    Science.gov (United States)

    Krishnan, Vinod; Krishnan, Anand; Remya, R; Ravikumar, K K; Nair, S Asha; Shibli, S M A; Varma, H K; Sukumaran, K; Kumar, K Jyothindra

    2011-04-01

    The present research was aimed at developing surface coatings on β titanium orthodontic archwires capable of protection against fluoride-induced corrosion. Cathodic arc physical vapor deposition PVD (CA-PVD) and magnetron sputtering were utilized to deposit thin films of titanium aluminium nitride (TiAlN) and tungsten carbide/carbon (WC/C) coatings on β titanium orthodontic archwires. Uncoated and coated specimens were immersed in a high fluoride ion concentration mouth rinse, following a specially designed cycle simulating daily use. All specimens thus obtained were subjected to critical evaluation of parameters such as electrochemical corrosion behaviour, surface analysis, mechanical testing, microstructure, element release, and toxicology. The results confirm previous research that β titanium archwires undergo a degradation process when in contact with fluoride mouth rinses. The study confirmed the superior nature of the TiAlN coating, evident as many fewer changes in properties after fluoride treatment when compared with the WC/C coating. Thus, coating with TiAlN is recommended in order to reduce the corrosive effects of fluorides on β titanium orthodontic archwires. Copyright © 2010 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

  1. High performance a-IGZO thin-film transistors with mf-PVD SiO2 as an etch-stop-layer

    NARCIS (Netherlands)

    Nag, M.; Steudel, S.; Bhoolokam, A.; Chasin, A.; Rockele, M.; Myny, K.; Maas, J.; Fritz, T.; Trube, J.; Groeseneken, G.; Heremans, P.

    2014-01-01

    In this work, we report on high-performance bottom-gate top-contact (BGTC) amorphous-Indium-Gallium-Zinc-Oxide (a-IGZO) thin-film transistor (TFT) with SiO2 as an etch-stop-layer (ESL) deposited by medium frequency physical vapor deposition (mf-PVD). The TFTs show field-effect mobility (μFE) of

  2. Laveren tussen ontspanning en solidariteit: de PvdA en de FNV ten tijde van de Poolse crisis (1980-1982)

    NARCIS (Netherlands)

    Miedema, C.

    2013-01-01

    The Polish independent trade union Solidarność appeared in a time of rising tension between East and West. This created a dilemma for Western left-wing movements: maintain solidarity with the Polish workers or continue the détente policy of the 1970s? The Dutch social democratic party PvdA and the

  3. Reducing virulence of the human pathogen Burkholderia by altering the substrate specificity of the quorum-quenching acylase PvdQ

    NARCIS (Netherlands)

    Koch, Gudrun; Nadal-Jimenez, Pol; Reis, Carlos R.; Muntendam, Remco; Bokhove, Marcel; Melillo, Elena; Dijkstra, Bauke W.; Cool, Robbert H.; Quax, Wim J.

    2014-01-01

    The use of enzymes to interfere with quorum sensing represents an attractive strategy to fight bacterial infections. We used PvdQ, an effective quorum-quenching enzyme from Pseudomonas aeruginosa, as a template to generate an acylase able to effectively hydrolyze C8-HSL, the major communication

  4. CrCuAgN PVD nanocomposite coatings: Effects of annealing on coating morphology and nanostructure

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xingguang, E-mail: xingguangliu1@gmail.com [Department of Materials Science and Engineering, Sir Robert Hadfield Building, The University of Sheffield, Mappin Street, Sheffield, S1 3JD (United Kingdom); Iamvasant, Chanon, E-mail: ciamvasant1@sheffield.ac.uk [Department of Materials Science and Engineering, Sir Robert Hadfield Building, The University of Sheffield, Mappin Street, Sheffield, S1 3JD (United Kingdom); Liu, Chang, E-mail: chang.liu@sheffield.ac.uk [Department of Materials Science and Engineering, Sir Robert Hadfield Building, The University of Sheffield, Mappin Street, Sheffield, S1 3JD (United Kingdom); Matthews, Allan, E-mail: allan.matthews@manchester.ac.uk [Pariser Building - B24 ICAM, School of Materials, The University of Manchester, Manchester, M13 9PL (United Kingdom); Leyland, Adrian, E-mail: a.leyland@sheffield.ac.uk [Department of Materials Science and Engineering, Sir Robert Hadfield Building, The University of Sheffield, Mappin Street, Sheffield, S1 3JD (United Kingdom)

    2017-01-15

    Highlights: • Coatings with nitrogen content up to 16 at.% exhibit a metallic Cr solid solution, even after post-coat annealing at 300 °C and 500 °C. • At higher N/Cr atomic ratios (approaching Cr{sub 2}N stoichiometry), chromium was still inclined to exist in solid solution with nitrogen, rather than as a ceramic nitride phase, even after annealing at 500 °C. • Transportation of Cu and Ag to the surface depends on annealing temperature, annealing duration, nitrogen concentration and ‘global’ Cu + Ag concentration. • Incorporation of copper appears to be a powerful strategy to enhance Ag mobility at low concentration (∼3 at.% Ag in this study) under moderately high service temperature. • A significant decrease in friction coefficient was obtained at room temperature after annealing, or during sliding wear testing at elevated temperature. - Abstract: CrCuAgN PVD nanocomposite coatings were produced using pulsed DC unbalanced magnetron sputtering. This investigation focuses on the effects of post-coat annealing on the surface morphology, phase composition and nanostructure of such coatings. In coatings with nitrogen contents up to 16 at.%, chromium exists as metallic Cr with N in supersaturated solid solution, even after 300 °C and 500 °C post-coat annealing. Annealing at 300 °C did not obviously change the phase composition of both nitrogen-free and nitrogen-containing coatings; however, 500 °C annealing resulted in significant transformation of the nitrogen-containing coatings. The formation of Ag aggregates relates to the (Cu + Ag)/Cr atomic ratio (threshold around 0.2), whereas the formation of Cu aggregates relates to the (Cu + Ag + N)/Cr atomic ratio (threshold around 0.5). The primary annealing-induced changes were reduced solubility of Cu, Ag and N in Cr, and the composition altering from a mixed ultra-fine nanocrystalline and partly amorphous phase constitution to a coarser, but still largely nanocrystalline structure. It was also

  5. Evolution of self-organization in nano-structured PVD coatings under extreme tribological conditions

    Energy Technology Data Exchange (ETDEWEB)

    Fox-Rabinovich, G., E-mail: gfox@mcmaster.ca [Department of Mechanical Engineering, McMaster University, 1280 Main St. W., Hamilton, ON, Canada L8S 4L7 (Canada); Kovalev, A. [Surface Phenomena Researches Group, CNIICHERMET, 9/23, 2-nd Baumanskaya Street, Moscow 105005 (Russian Federation); Aguirre, M.H. [Laboratory of Advanced Microscopy, Institute of Nanoscience of Aragón, University of Zaragoza, 50018 Zaragoza (Spain); Yamamoto, K. [Materials Research Laboratory, Kobe Steel Ltd, 1-5-5 Takatsuda-dai, Nishi-ku, Kobe 651-2271, Hyogo (Japan); Veldhuis, S. [Department of Mechanical Engineering, McMaster University, 1280 Main St. W., Hamilton, ON, Canada L8S 4L7 (Canada); Gershman, I. [All-Russian Railway Research Institute, 10 Third Mytishchinskaya Street, Moscow 29851 (Russian Federation); Rashkovskiy, A. [Surface Phenomena Researches Group, CNIICHERMET, 9/23, 2-nd Baumanskaya Street, Moscow 105005 (Russian Federation); Endrino, J.L. [Albengoa Research, Energia Solar 1, Palmas Altas, Seville 41014 (Spain); Beake, B. [Micro Materials Limited, Willow House, Yale Business Village, Ellice Way, Wrexham LL13 7YL (United Kingdom); Dosbaeva, G. [Department of Mechanical Engineering, McMaster University, 1280 Main St. W., Hamilton, ON, Canada L8S 4L7 (Canada); Wainstein, D. [Surface Phenomena Researches Group, CNIICHERMET, 9/23, 2-nd Baumanskaya Street, Moscow 105005 (Russian Federation); Yuan, Junifeng; Bunting, J.W. [Department of Mechanical Engineering, McMaster University, 1280 Main St. W., Hamilton, ON, Canada L8S 4L7 (Canada)

    2014-04-01

    Highlights: • The evolution of self-organization under extreme frictional conditions has been studied. • Comprehensive characterization of the tribo-films was made using various surface analytical techniques. • During the running-in stage, mullite tribo-ceramics predominate on the surface of the nano-multilayer coating, establishing a functional hierarchy within the layer of tribo-films. • It is possible to control tribo-film evolution during self-organization by means of an increase in structural complexity and the non-equilibrium state of the surface engineered layer. - Abstract: The evolution of the self-organization process where dissipative structures are formed under the extreme frictional conditions associated with high performance dry machining of hardened steels has been studied in detail. The emphasis was on the progressive studies of surface transformations within multilayer and monolayer TiAlCrSiYN-based PVD coatings during the running-in stage of wear when self-organization process occurs. The coating layer was characterized by high resolution electron energy-loss spectroscopy (HREELS). It is shown that the nano-multilayer coating possesses higher non-equilibrium structure in comparison to the monolayer. Comprehensive studies of the tribo-films (dissipative structures) formed on the friction surface were made using a number of advanced surface characterization techniques such as X-ray photoelectron spectroscopy (XPS) and X-ray absorption near edge structure (XANES). The data obtained for the tribo-films was combined with the detailed TEM studies of the structural and phase transformations within the underlying coating layer. This data was related to the micro-mechanical characteristics of the coating layer and its wear resistance. It was demonstrated that the evolution of the self-organization process is strongly controlled by the characteristics of the tribo-films formed at different stages of the wear process. Within running-in stage (after

  6. High temperature oxidation behavior of hafnium modified NiAl bond coat in EB-PVD thermal barrier coating system

    Energy Technology Data Exchange (ETDEWEB)

    Guo Hongbo; Sun Lidong; Li Hefei [Department of Material Science and Engineering, Beijing University of Aeronautics and Astronautics, No.37 Xueyuan Road, Beijing 100083 (China); Gong Shengkai [Department of Material Science and Engineering, Beijing University of Aeronautics and Astronautics, No.37 Xueyuan Road, Beijing 100083 (China)], E-mail: gongsk@buaa.edu.cn

    2008-06-30

    NiAl coatings doped with 0.5 at.% and 1.5 at.% Hf were produced by co-evaporation of NiAl and Hf ingots by electron beam physical vapor deposition (EB-PVD), respectively. The addition of 0.5 at.% Hf significantly improved the cyclic oxidation resistance of the NiAl coating. The TGO layer in the 1.5 at.% Hf doped NiAl coating is straight; while that in the 0.5 at.% Hf doped coating became undulated after thermal cycling. The doped NiAl thermal barrier coatings (TBCs) revealed improved thermal cycling lifetimes at 1423 K, compared to the undoped TBC. Failure of the 0.5 at.% Hf doped TBC occurred by cracking at the interface between YSZ topcoat and bond coat, while the 1.5 at.% Hf doped TBC cracked at the interface between bond coat and substrate.

  7. Formation and investigation of multilayer nanostructured coatings TiN/MoN for different layers thicknesses with c-pvd

    International Nuclear Information System (INIS)

    Pogrebnyak, A.D.; Bondar, O.V.; Postol'nyj, B.A.; Andreev, A.A.; Abadias, G.; Beresnev, V.M.; Sobol', O.B.

    2013-01-01

    Multilayer coatings based on TiN/MoN were obtained using the vacuum arc evaporation cathode method (C-PVD). Multilayers thickness was in the range 6,7 ÷ 8,7 μm and monolayers thickness was 2, 10, 20 and 40 nm. Vacuum-arc unit Bulat 6 was used for depositions. For the analysis of multilayer structures and properties of nanostructured coatings XRD analysis method was used (D8 ADVANCE, Bruker). For elemental composition and morphology investigation of the surface layers and multilayered coatings SEM (JEOL-7001F) with EDX attachment was used. Also HRTEM method was used to analyze the phase composition. In addition, this article provides investigation of hardness by Micro-Hardness Tester CSM (Switzerland). AFM was used for additional analysis of the topography and surface roughness of these coatings. This investigation have revealed the relationship between the layers thicknesses, substrate potential, the annealing process, physical and mechanical properties of samples. (authors)

  8. PVD-Alumina Coatings on Cemented Carbide Cutting Tools: A Study About the Effect on Friction and Adhesion Mechanism

    Directory of Open Access Journals (Sweden)

    S.E. Cordes

    2012-03-01

    Full Text Available Crystalline PVD γ-alumina coatings are interesting for machining operations due to their outstanding characteristics, such as high hot hardness, high thermal stability and low tendency to adhesion. In the present work (Ti,AlN/γ-Al2O3-coatings are deposited on cemented carbide by means of MSIP. Objectives of this work are to study the effects of coating and cutting fluid regarding friction in tribological tests and to study the wear mechanisms and cutting performance of γ-Al2O3-based coated cemented carbide cutting tools in machining operations of austenitic stainless steels. Based on the remarkable properties of the coating system the performance of the cutting tools is increasing significantly.

  9. Microstructure evolution during annealing of TiAl/NiCoCrAl multilayer composite prepared by EB-PVD

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Rubing, E-mail: zrb86411680@126.com [Department of Mechanics, School of Civil Engineering, Beijing Jiaotong University, Beijing 100044 (China); Zhang, Deming [Beijing General Research Institute of Mining and Metallurgy, Beijing 100044 (China); Chen, Guiqing [Center for Composite Materials, Harbin Institute of Technology, Harbin 150001 (China); Wang, Yuesheng [Department of Mechanics, School of Civil Engineering, Beijing Jiaotong University, Beijing 100044 (China)

    2014-07-01

    TiAl/NiCoCrAl laminate composite sheet with a thickness of 0.4–0.6 mm as well as a dimension of 150 mm × 100 mm was fabricated successfully by using electron beam physical vapor deposition (EB-PVD) method. The annealing treatment was processed at 1123 and 1323 K for 3 h in a high vacuum atmosphere, respectively. The phase composition and microstructure of TiAl/NiCoCrAl microlaminated sheet have been analyzed by X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). Based on the sheet characterization and results of the microstructure evolution during annealing treatment process, the diffusion mechanism of interfacial reaction in TiAl/NiCoCrAl microlaminate was investigated and discussed.

  10. Enriquecimiento en Si mediante PVD de chapas magnéticas convencionales para aplicaciones a altas frecuencias

    Directory of Open Access Journals (Sweden)

    Molina Aldareguía, J.

    2000-06-01

    Full Text Available The present work deals with the viability of a method for Si enrichment of conventional Fe-3%Si sheets, by means of physical vapour deposition of Si at its surface and subsequent diffusion heating. The aim is to obtain magnetic sheets with a Si content of 6.5wt%, for they show higher resistivity and null magnetostriction, leading to lower energy losses and solving the noise problems at high frequencies. The PVD deposited films, with ~5 μm thickness, show good adhesion to the substrate. Concerning the heat treatment, there is a critical heating rate between 5 and 15°/min, above which delamination of the film is observed without formation of intermetallics at the interface. At 3°/min the conditions for the formation of intermetallics are given. Direct heating up to 800°C leads to the formation of a Fe3Si(α1 surface layer, which, being brittle, does not delaminate during the heating process. Subsequent heating up to temperatures around 1200°C allows the homogenisation of the sheet composition. There is evidence of Kirkendall effect in the diffusion couple Fe3Si(α1/Fe(α, due to the fact that the diffusion of Fe in Fe3Si(α1 is faster than the diffusion of Si in Fe(α.

    El presente trabajo estudia la viabilidad de un método para enriquecer en Si chapas de Fe-3%Si convencionales, depositando Si en su superficie mediante PVD y sometiéndolas a un tratamiento térmico de difusión. Se trata de obtener chapas magnéticas con un contenido en Si de un 6,5% en peso, ya que éstas presentan mayor resistividad y magnetoestricción nula, reduciendo las pérdidas y solucionando los problemas de ruido a altas frecuencias. Las capas depositadas por PVD, de espesores ~5 μm, presentan buena adherencia al substrato. En cuanto al tratamiento térmico, se observa que hay una velocidad de calentamiento crítica entre 5 y 15°/min, por encima de la cual la película se despega sin llegarse a formar intermetálicos en la intercara. A 3°/min se dan las

  11. The limits of application of variable-energy slow positron beams for investigating TiN hard coatings prepared by PVD

    International Nuclear Information System (INIS)

    Marek, T.; Suevegh, K.; Vertes, A.; Szeles, Cs.; Lynn, K.G.

    2000-01-01

    Samples of TiN hard coatings prepared by physical vapour deposition (PVD) were investigated by means of depth-sensitive positron annihilation spectroscopy. The results indicate that the samples are at the limits of the applicability of this method presumably due to the high defect concentration. Though the samples are thoroughly characterized by other independent methods, they might not be sufficient to explain all aspects of positron-solid interactions in these cases. (author)

  12. High-temperature resistant MeCrAlY+Al coatings obtained by ARC-PVD method on Ni Base superalloys

    International Nuclear Information System (INIS)

    Swadzba, L.; Maciejny, A.; Mendala, B.; Supernak, W.

    1999-01-01

    Investigations of obtaining high temperature coatings on the Ni base superalloys by the ARC-PVD method, using exothermic reaction processes between Ni and Al with NiAl intermetallic formation are presented in the article. By the diffusion heating at 1050 o C NiAl high temperature diffusion coating containing 21% at. Al and 50 μm thick was obtained. In the next stage coatings with more complex chemical composition NiCoCrAlY were formed. The two targets were applied for formation of complex NiCoCrAlY coatings. The good consistence between the chemical composition of the targets and the coatings and an uniform distribution of elements in the coatings were shown. Then the surface was covered with aluminium also by the ARC-PVD method. In the vacuum chamber of the equipment a synthesis reaction between NiCoCrAlY and Al with the formation NiAl intermetallics of high Co, Cr, Y content was initiated by the changes in process parameters. The final heat treatment of coatings was conducted in the air and vacuum at 1050 o C. The strong segregation of yttrium in to the oxide scale in the specimens heated in the air was shown. It was possible to obtain NiAl intermetallic phase coatings modified by Co, Cr and Y by the ARC-PVD method. An example of the application of this method for the aircraft engine turbine blades was presented. Method of ARC-PVD gives the possibility chemical composition and high resistance to oxidizing and hot corrosion. (author)

  13. Composite Layers “MgAl Intermetalic Layer / PVD Coating” Obtained On The AZ91D Magnesium Alloy By Different Hybrid Surface Treatment Methods

    Directory of Open Access Journals (Sweden)

    Smolik J.

    2015-06-01

    Full Text Available Magnesium alloys have very interesting physical properties which make them ‘materials of the future’ for tools and machine components in many industry areas. However, very low corrosion and tribological resistance of magnesium alloys hampers the implementation of this material in the industry. One of the methods to improve the properties of magnesium alloys is the application of the solutions of surface engineering like hybrid technologies. In this paper, the authors compare the tribological and corrosion properties of two types of “MgAlitermetalic / PVD coating” composite layers obtained by two different hybrid surface treatment technologies. In the first configuration, the “MgAlitermetalic / PVD coating” composite layer was obtained by multisource hybrid surface treatment technology combining magnetron sputtering (MS, arc evaporation (AE and vacuum heating methods. The second type of a composite layer was prepared using a hybrid technology combined with a diffusion treatment process in Al-powder and the electron beam evaporation (EB method. The authors conclude, that even though the application of „MgAlitermetalic / PVD coating” composite layers can be an effective solution to increase the abrasive wear resistance of magnesium alloys, it is not a good solution to increase its corrosion resistance.

  14. Study the effect of ion-complex on the properties of composite gel polymer electrolyte based on Electrospun PVdF nanofibrous membrane

    International Nuclear Information System (INIS)

    Li, Weili; Xing, Yujin; Wu, Yuhui; Wang, Jiawei; Chen, Lizhuang; Yang, Gang; Tang, Benzhong

    2015-01-01

    In this paper, nanofibrous membranes based on poly(vinylidene fluoride) (PVdF) doped with ion-complex (SiO 2 -PAALi) were prepared by electrospinning technique and the corresponding composite gel-polymer electrolytes (CGPEs) were obtained after being activated in liquid electrolyte. The microstructure, physical and electrochemical performances of the nanofibrous membranes and the corresponding CGPEs were studied by various measurements such as Fourier Transform Infrared Spectroscopy(FTIR), Scanning Electron Microscope (SEM), Differential Scanning Calorimetry (DSC), Thermal Gravimetric Analysis (TGA), Stress-strain test, Linear Sweep Voltammetry (LSV), AC impedance measurement and Charge/discharge cycle test. As to the ion-complex doped nanofibrous membranes, PVdF can provide mechanical support with network structure composed of fully interconnection; while the ion-complexes are absorbed onto the surface of the PVdF nanofibers evenly instead of being aggregated. With the help of doped ion-complex, the prepared nanofibrous membranes present good liquid electrolyte absorbability, excellent mechanical performance, and high decomposition temperature. For the corresponding CGPEs, they possess high ionic conductivity, wide electrochemical window, and good charge/discharge cycle performance

  15. Structure of MeCrAlY + AlSi coatings deposited by Arc-PVD method on CMSX4 single crystal alloy

    International Nuclear Information System (INIS)

    Swadzba, L.; Hetmanczyk, M.; Mendala, B.; Saunders, S.R.J.

    2002-01-01

    Investigations of depositing high temperature resistant coatings on the Ni base superalloys by Arc-PVD method using exothermic reaction processes between Ni and Al with NiAl intermetallic formation are presented in the article. By the diffusion heating at 1050 o C in vacuum, NiAl diffusion coating containing 21% at. Al and 50 μm thick were obtained. In the next stage coatings with more complex chemical composition - MeCrAlY were formed. The MeCrAlY coatings were made from two targets. Good correlation between the chemical composition of the targets and a uniform distribution of elements in the coatings was shown. Then the surface was also covered with aluminium by the Arc-PVD method . In the vacuum chamber of the equipment a synthesis reaction between NiCoCrAlY and Al with the formation of NiAl intermetallics of high Co, Cr, Y content was initiated. The final heat treatment of coatings was conducted in vacuum at 1323 K. Strong segregation of yttrium into the oxide scale in the specimens heated in the air was shown. It was possible to form NiAl and intermetallics phase coatings modified by Co, Cr and Y by the Arc-PVD method. The coatings were formed on a single crystal CMSX-4. The structure, morphology and phase composition of coatings was carried out. (author)

  16. Effect of PbI{sub 2} deposition rate on two-step PVD/CVD all-vacuum prepared perovskite

    Energy Technology Data Exchange (ETDEWEB)

    Ioakeimidis, Apostolos; Christodoulou, Christos; Lux-Steiner, Martha; Fostiropoulos, Konstantinos, E-mail: fostiropoulos@helmholtz-berlin.de

    2016-12-15

    In this work we fabricate all-vacuum processed methyl ammonium lead halide perovskite by a sequence of physical vapour deposition of PbI{sub 2} and chemical vapour deposition (CVD) of CH{sub 3}NH{sub 3}I under a static atmosphere. We demonstrate that for higher deposition rate the (001) planes of PbI{sub 2} film show a higher degree of alignment parallel to the sample's surface. From X-ray diffraction data of the resulted perovskite film we derive that the intercalation rate of CH{sub 3}NH{sub 3}I is fostered for PbI{sub 2} films with higher degree of (001) planes alignment. The stoichiometry of the produced perovskite film is also studied by Hard X-ray photoelectron spectroscopy measurements. Complete all-vacuum perovskite solar cells were fabricated on glass/ITO substrates coated by an ultra-thin (5 nm) Zn-phthalocyanine film as hole selective layer. A dependence of residual PbI{sub 2} on the solar cells performance is displayed, while photovoltaic devices with efficiency up to η=11.6% were achieved. - Graphical abstract: A two-step PVD/CVD processed perovskite film with the CVD intercalation rate of CH{sub 3}NCH{sub 3} molecules been fostered by increasing the PVD rate of PbI{sub 2} and prolonging the CVD time. - Highlights: • A simple PVD/CVD process for perovskite film production. • Increased PVD rate yields better alignment of the PbI{sub 2} (001) crystallite planes. • CH{sub 3}NH{sub 3}I intercalation process fostered by increased PbI{sub 2} PVD rate. • Stoichiometric CH{sub 3}NH{sub 3}PbI{sub 3} suitable as absorber in photovoltaic applications • Reduced PbI{sub 2} residue at the bottom of CH{sub 3}NH{sub 3}PbI{sub 3} improves device performance.

  17. Effect of nitrogen gas flow rate on the tribological properties of TiN coated HSS using CAE PVD technique

    International Nuclear Information System (INIS)

    Mubarak, A.; Hamzah, E.; Toff, M.R.M.

    2005-01-01

    High-Speed Steel (HSS) is a material that used in various Hi-Tech industries for many reasons. The aim of this study is to investigate the tribological properties of TiN (Titanium Nitride)-coated HSS. Using Physical Vapour Deposition (PVD) Cathodic Arc Evaporation (CAE) technique coated samples. The goal of this work is to determine usefulness of TiN coatings in order to improve tribological properties of HSS, as vastly use in cutting tool industry for various applications. A Pin-on-Disc test showed that the minimum value recorded for friction coefficient was reduced from 0.294 to 0.239 when the nitrogen gas flow rate was increased from 100 sccm to 200 sccm. The decrease in friction coefficient resulted from the reduction in macrodroplets by increasing the nitrogen gas flow rate during deposition. The worn surface morphology of the TiN coated HSS was observed on a Field Emission Scanning Electron Microscope (FE-SEM), and the elemental composition on the wear scar were investigated by means of EDXS. (Author)

  18. The Study of Selected Properties of Ti EB PVD Coating Deposited Onto Inner Tube Surface at Low Temperature

    Directory of Open Access Journals (Sweden)

    Kottfer D.

    2016-03-01

    Full Text Available This study investigates the selected properties of the thin Ti coating applied by activated evaporation EB PVD technique. This technique was used for the deposition of Ti thin coating onto inner surface of OKhN3 MFA steel tubes. Deposition process was carried out at temperature 200°C. Conventional type of coatings - monolayer Ti - was analyzed by standard techniques for surface status and quality assessment - coating thickness, chemical composition by EDX analysis, adhesion, hardness, roughness, and growth direction of columns at room temperature. Ti monolayer achieved roughness Ra equal from 0.42 μm to 0.47 μm. The resulting hardness was from 2 GPa to 8.5 GPa depending on the sample location inside the vacuum chamber. Placing of the coated surface also affected the direction of grain growth of Ti coating columns. The angles α of grain growth were found to be from 40° to 60°. Angle α increased two to three times more than the incidence angle β (from 12° to 28° of evaporated Ti particles. Values of the adhesion measured along the Ti growth direction were mostly higher (up to 10% or the same as those measured perpendicular to it.

  19. A novel monolithic LEU foil target based on a PVD manufacturing process for 99Mo production via fission.

    Science.gov (United States)

    Hollmer, Tobias; Petry, Winfried

    2016-12-01

    99 Mo is the most widely used radioactive isotope in nuclear medicine. Its main production route is the fission of uranium. A major challenge for a reliable supply is the conversion from highly enriched uranium (HEU) to low enriched uranium (LEU). A promising candidate to realize this conversion is the cylindrical LEU irradiation target. The target consists of a uranium foil encapsulated between two coaxial aluminum cladding cylinders. This target allows a separate processing of the irradiated uranium foil and the cladding when recovering the 99 Mo. Thereby, both the costs and the volume of highly radioactive liquid waste are significantly reduced compared to conventional targets. The presented manufacturing process is based on the direct coating of the uranium on the inside of the outer cladding cylinder. This process was realized by a cylindrical magnetron enhanced physical vapor deposition (PVD) technique. The method features a highly automated process, a good quality of the resulting uranium foils and a high material utilization. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Controllable synthesis and defect-dependent photoluminescence properties of In2O3 nanostructures prepared by PVD

    Science.gov (United States)

    Jin, Changqing; Wei, Yongxing; Peterson, George; Zhu, Kexin; Jian, Zengyun

    2017-05-01

    In2O3 nanostructures were successfully synthesized via physical vapor deposition (PVD). It was found that the morphology of nanostuctures could be controlled by manipulation of the synthesis temperature, growth time, use of a Au-catalyst, selection of substrate material, and vapor pressure. A higher synthesis temperature is more favorable for the formation of 1D nanostructures. An increased growth time increased the width and length of the 1D nanostructures. Through the use of a Au-catalyst coated Si (1 0 0) substrate, we were able to preferentially synthesize (1 0 0) In2O3 nanostructures, even at lower growth temperatures. This research shows that a Au-catalyst is necessary for the formation of one-dimensional (1D) In2O3 nanostructures. Three dimensional (3D) octahedral nanoparticles are resultant from a Au-free Si (1 0 0) substrate. Al2O3 (1 0 0) substrates were found to be energetically favorable for the synthesis of nanofilms, not 1D nanostructures, regardless of the presence of Au-catalyst. The photoluminescence curves indicate that the defect related luminescence is not a function of morphology, but rather the ratio of the partial vapor pressures of the constituent elements (In and O), which were controlled by the growth pressure.

  1. Evolution of photo-stimulated luminescence of EB-PVD/(Ni, Pt)Al thermal barrier coatings

    International Nuclear Information System (INIS)

    Wen Mei; Jordan, Eric H.; Gell, Maurice

    2005-01-01

    Experiments are described which were designed to assess the suitability of photo-stimulated luminescence piezo-spectroscopy (PLPS) measurements as a basis for non-destructive inspection (NDI) and determination of life remaining of thermal barrier coatings (TBCs). Thermal cyclic tests were conducted on 7 wt.% Y 2 O 3 stabilized ZrO 2 (YSZ) electron beam physical vapor deposited (EB-PVD)/(Ni, Pt)Al/CMSX-4 TBCs at two temperatures 1151 and 1121 deg. C. The evolution of PLPS spectral characteristics (peak frequency shift, peak width and area ratio of peaks) was studied as a function of thermal cycles. It was observed that the average thermally grown oxide (TGO) stress and its standard deviation, and the area ratio of peaks show systematic change with thermal cycling, indicating that these characteristics can be used for NDI and determination of life remaining. The average TGO stress increases initially and then decreases monotonically with thermal cycling. The rate of change in the stress can be related to specimen life: the shallower the slope, the higher the life. The peak area ratio also decreases monotonically with cycling. The average TGO stress changes in a systematic manner versus remaining life fraction independent of temperature. Remaining life predictions were made based on average stress versus life fraction, which resulted in life assessments within ±13% of actual values excluding one specimen with abnormal behavior

  2. Karakteristik Morfologi Permukaan Pada Polimer PVdF-LiBOB-ZrO2 dan Potensinya untuk Elektrolit Baterai Litium

    Directory of Open Access Journals (Sweden)

    Etty Marti Wigayati

    2018-02-01

    Full Text Available Membran elektrolit polimer pada baterai litium ion berfungsi sebagai media transport ion dan sebagai separator antara anoda dan katoda. Dalam penelitian ini, telah dilakukan sintesis membran elektrolit polimer LiBOB (Lithium Bis Oksalato Borate dengan rumus kimia LiB(C2O42 dengan menggunakan Polyvilinidine fluoride (PVdF sebagai matriks dan bahan aditif  Zirkonium Oksida (ZrO2. Metoda yang dipergunakan adalah solution cast. Konsentrasi bahan aditif dibuat bervariasi. Membran yang terbentuk dikarakterisasi morfologi permukaan menggunakan Scanning Electrone Microscope (SEM, sifat elektrokimia dengan Cyclic Voltametric (CV dan kapasitas baterai dengan kurva charge discharge. Hasil penelitian menunjukkan bahwa morfologi permukaan rantai polimer saling berikatan dan tersusun dengan bagus. Pori tertutup oleh rantai polimer secara rata yang berikatan membentuk jaring dan saling bertumpukan pada keadaan amorf. Terjadi reaksi oksidasi dan reduksi pada sel baterai dengan kapasitas charge sekitar 24 mAh pada tegangan 4 volt, sedangkan kapasitas discharge bernilai sama sekitar 24 mAh pada tegangan 4 volt dengan penambahan 10% ZrO2.

  3. Hierarchical adaptive nanostructured PVD coatings for extreme tribological applications: the quest for nonequilibrium states and emergent behavior

    Directory of Open Access Journals (Sweden)

    German S Fox-Rabinovich, Kenji Yamamoto, Ben D Beake, Iosif S Gershman, Anatoly I Kovalev, Stephen C Veldhuis, Myram H Aguirre, Goulnara Dosbaeva and Jose L Endrino

    2012-01-01

    Full Text Available Adaptive wear-resistant coatings produced by physical vapor deposition (PVD are a relatively new generation of coatings which are attracting attention in the development of nanostructured materials for extreme tribological applications. An excellent example of such extreme operating conditions is high performance machining of hard-to-cut materials. The adaptive characteristics of such coatings develop fully during interaction with the severe environment. Modern adaptive coatings could be regarded as hierarchical surface-engineered nanostructural materials. They exhibit dynamic hierarchy on two major structural scales: (a nanoscale surface layers of protective tribofilms generated during friction and (b an underlying nano/microscaled layer. The tribofilms are responsible for some critical nanoscale effects that strongly impact the wear resistance of adaptive coatings. A new direction in nanomaterial research is discussed: compositional and microstructural optimization of the dynamically regenerating nanoscaled tribofilms on the surface of the adaptive coatings during friction. In this review we demonstrate the correlation between the microstructure, physical, chemical and micromechanical properties of hard coatings in their dynamic interaction (adaptation with environment and the involvement of complex natural processes associated with self-organization during friction. Major physical, chemical and mechanical characteristics of the adaptive coating, which play a significant role in its operating properties, such as enhanced mass transfer, and the ability of the layer to provide dissipation and accumulation of frictional energy during operation are presented as well. Strategies for adaptive nanostructural coating design that enhance beneficial natural processes are outlined. The coatings exhibit emergent behavior during operation when their improved features work as a whole. In this way, as higher-ordered systems, they achieve multifunctionality

  4. Hierarchical adaptive nanostructured PVD coatings for extreme tribological applications: the quest for nonequilibrium states and emergent behavior.

    Science.gov (United States)

    Fox-Rabinovich, German S; Yamamoto, Kenji; Beake, Ben D; Gershman, Iosif S; Kovalev, Anatoly I; Veldhuis, Stephen C; Aguirre, Myriam H; Dosbaeva, Goulnara; Endrino, Jose L

    2012-08-01

    Adaptive wear-resistant coatings produced by physical vapor deposition (PVD) are a relatively new generation of coatings which are attracting attention in the development of nanostructured materials for extreme tribological applications. An excellent example of such extreme operating conditions is high performance machining of hard-to-cut materials. The adaptive characteristics of such coatings develop fully during interaction with the severe environment. Modern adaptive coatings could be regarded as hierarchical surface-engineered nanostructural materials. They exhibit dynamic hierarchy on two major structural scales: (a) nanoscale surface layers of protective tribofilms generated during friction and (b) an underlying nano/microscaled layer. The tribofilms are responsible for some critical nanoscale effects that strongly impact the wear resistance of adaptive coatings. A new direction in nanomaterial research is discussed: compositional and microstructural optimization of the dynamically regenerating nanoscaled tribofilms on the surface of the adaptive coatings during friction. In this review we demonstrate the correlation between the microstructure, physical, chemical and micromechanical properties of hard coatings in their dynamic interaction (adaptation) with environment and the involvement of complex natural processes associated with self-organization during friction. Major physical, chemical and mechanical characteristics of the adaptive coating, which play a significant role in its operating properties, such as enhanced mass transfer, and the ability of the layer to provide dissipation and accumulation of frictional energy during operation are presented as well. Strategies for adaptive nanostructural coating design that enhance beneficial natural processes are outlined. The coatings exhibit emergent behavior during operation when their improved features work as a whole. In this way, as higher-ordered systems, they achieve multifunctionality and high wear

  5. Analysis of the environmental and nature impacts of 'Building Bridges'. Coalition VVD-PvdA, October 29, 2012. A quick scan; Analyse van de milieu- en natuureffecten van 'Bruggen slaan'. Regeerakkoord VVD-PvdA d.d. 29 oktober 2012. Een quick-scan

    Energy Technology Data Exchange (ETDEWEB)

    Dietz, F. (ed.)

    2012-11-15

    The coalition between the political parties VVD (liberals) and PvdA (socialists) connects the transition to a sustainable economy and green growth to strengthening the competitive capacity of the Dutch economy. The role of the Dutch government in the coalition aims at creating a framework and to provide facilities to realize the transition. In this memo the results of an analysis of the impacts of the coalition are given for the themes Energy and Climate, Nature, Transport and Traffic, and Green Growth [Dutch] Het Regeerakkoord VVD-PvdA koppelt de transitie naar een duurzame economie en groene groei aan het versterken van het concurrentievermogen van de Nederlandse economie. De rol van de rijksoverheid wordt in het regeerakkoord met name ingevuld als kaderstellend en faciliterend. De PBL-notitie analyseert de effecten van het regeringsakkoord voor de thema's Energie en Klimaat, Natuur, Verkeer en Vervoer, en Groene groei.

  6. C. elegans bicd-1, homolog of the Drosophila dynein accessory factor Bicaudal D, regulates the branching of PVD sensory neuron dendrites.

    Science.gov (United States)

    Aguirre-Chen, Cristina; Bülow, Hannes E; Kaprielian, Zaven

    2011-02-01

    The establishment of cell type-specific dendritic arborization patterns is a key phase in the assembly of neuronal circuitry that facilitates the integration and processing of synaptic and sensory input. Although studies in Drosophila and vertebrate systems have identified a variety of factors that regulate dendrite branch formation, the molecular mechanisms that control this process remain poorly defined. Here, we introduce the use of the Caenorhabditis elegans PVD neurons, a pair of putative nociceptors that elaborate complex dendritic arbors, as a tractable model for conducting high-throughput RNAi screens aimed at identifying key regulators of dendritic branch formation. By carrying out two separate RNAi screens, a small-scale candidate-based screen and a large-scale screen of the ~3000 genes on chromosome IV, we retrieved 11 genes that either promote or suppress the formation of PVD-associated dendrites. We present a detailed functional characterization of one of the genes, bicd-1, which encodes a microtubule-associated protein previously shown to modulate the transport of mRNAs and organelles in a variety of organisms. Specifically, we describe a novel role for bicd-1 in regulating dendrite branch formation and show that bicd-1 is likely to be expressed, and primarily required, in PVD neurons to control dendritic branching. We also present evidence that bicd-1 operates in a conserved pathway with dhc-1 and unc-116, components of the dynein minus-end-directed and kinesin-1 plus-end-directed microtubule-based motor complexes, respectively, and interacts genetically with the repulsive guidance receptor unc-5.

  7. Comparison of effective relative dielectric permittivities obtained by three independent ways for CeO2-Sm2O3 films prepared by EB-PVD (+IBAD) techniques

    International Nuclear Information System (INIS)

    Kundracik, F.; Neilinger, P.; Hartmanova, M.; Nadazdy, V.; Mansilla, C.

    2011-01-01

    Ceria, as material with relatively high dielectric permittivity, ε r , and ability to form films on the Si substrate, is a candidate for the gate dielectrics in the MOS devices. Doping with suitable e.g. trivalent rare earth oxides and suitable treatment after deposition (preparation) can improve their properties, e.g. ionic conductivity, dielectric permittivity and mechanical hardness. In this work, the dielectric properties of CeO 2 + Sm 2 O 3 films prepared by electron beam physical vapour deposition (EB-PVD) and some of them simultaneously also by the Ar + ionic beam assisted deposition (IBAD) techniques are analysed. (authors)

  8. Characteristics of CrAlSiN + DLC coating deposited by lateral rotating cathode arc PVD and PACVD process

    Energy Technology Data Exchange (ETDEWEB)

    Lukaszkowicz, Krzysztof, E-mail: krzysztof.lukaszkowicz@polsl.pl [Institute of Engineering Materials and Biomaterials, Silesian University of Technology, Konarskiego St. 18A, 44-100 Gliwice (Poland); Sondor, Jozef, E-mail: j.sondor@liss.cz [LISS, a.s., Dopravni 2603, 756 61 Roznov p.R. (Czech Republic); Balin, Katarzyna, E-mail: katarzyna.balin@us.edu.pl [A. Chełkowski Institute of Physic, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland); Kubacki, Jerzy, E-mail: jerzy.kubacki@us.edu.pl [A. Chełkowski Institute of Physic, University of Silesia, Uniwersytecka 4, 40-007 Katowice (Poland)

    2014-09-01

    Highlights: • The chemical composition of the CrAlSiN + DLC coatings was studied. • The coatings have nanostructural character with fine crystallites. • Their average size grain is less than 10 nm. • The coatings demonstrate friction coefficient within the range 0.05–0.07. • The coating demonstrated a dense cross-sectional morphology as well as good adhesion to the substrate. - Abstract: Coating system composed of CrAlSiN film covered by diamond-like carbon (DLC)-based lubricant, deposited on hot work tool steel substrate was the subject of the research. The CrAlSiN and DLC layers were deposited by PVD lateral rotating ARC-cathodes (LARC) and PACVD technology on the X40CrMoV5-1 respectively. HRTEM investigation shows an amorphous character of DLC layer. It was found that the tested CrAlSiN layer has a nanostructural character with fine crystallites while their average size is less than 10 nm. Based on the XRD pattern of the CrAlSiN, the occurrence of fcc phase was only observed in the coating, the texture direction 〈3 1 1〉 is perpendicular to the sample surface. Combined SEM, AES and ToF-SIMS studies confirmed assumed chemical composition and layered structure of the coating. The chemical distribution of the elements inside the layers and at the interfaces was analyzed by SEM and AES methods. It was shown that additional CrN layer is present between substrate and CrAlSiN coating. The atomic concentration of the particular elements of DLC and CrAlSiN layer was calculated from the XPS measurements. In sliding dry friction conditions the friction coefficient for the investigated elements is set in the range between 0.05 and 0.07. The investigated coating reveals high wear resistance. The coating demonstrated a dense cross-sectional morphology as well as good adhesion to the substrate.

  9. Lithium ion conducting PVA:PVdF polymer electrolytes doped with nano SiO2 and TiO2 filler

    Science.gov (United States)

    Hema, M.; Tamilselvi, P.

    2016-09-01

    The effect of nano SiO2 and TiO2 fillers on the thermal, mechanical and electrochemical properties of PVA:PVdF:LiCF3SO3 have been investigated by three optimized systems of SPE (80PVA:20PVdF:15LiCF3SO3), CPE-I (SPE:8SiO2) and CPE-II (SPE:4TiO2). From the TGA curve least weight loss has been observed for CPE-II indicating high thermal stability compared to other systems. Stress-strain curve of the prepared samples confirm the enhancement of tensile strength in CPE-II compared to CPE-I and SPE. Conductivity studies show that addition of TiO2 filler slightly enhances ionic conductivity 3.7×10-3 S cm-1 compared to filler free system at 303 K. Dielectric plots have been analyzed and CPE-II possesses higher dielectric constant compared to CPE-I and filler free system. Temperature dependence of modulus plots has been studied for highest conductivity possessing sample. Wider electrochemical stability has been obtained for nano-composite polymer electrolytes. The results conclude that the prepared CPE-II shows the best performance and it will be well suited for lithium ion batteries.

  10. Improved mechanical properties of Ni-rich Ni3Al coatings produced by EB-PVD for repairing single crystal blades

    Institute of Scientific and Technical Information of China (English)

    Jing-Yong Sun; Yan-Ling Pei; Shu-Suo Li; Hu Zhang; Sheng-Kai Gong

    2017-01-01

    Active control of turbine blade tip clearance for aircraft engine continues to be a concern in engine operation,because turbine blades are subjected to wear and therefore cause an increasing tip clearance between the rotating blades and the shroud and also reduce the engine efficiency.In this work,a Ni-rich Ni3Al coating with γ'/γtwo-phase microstructure was deposited by electron beam physical vapor deposition (EB-PVD),which worked as repairing the worn blade tips of single crystal blades.Nb molten pool was used to increase the molten pool temperature and thus to enhance the deposition rate.The microstructures and mechanical properties can be modified by the deposition temperatures and the following heat treatments.All coatings consist of γ'and γ phases.At deposition temperature of 600 ℃,a dense microstructure can be achieved to produce a coating with grain size of ~ 1 μm and microhardness of ~HV 477.After being heated for 4 h at a temperature of 1,100 ℃,the coatings have a more uniform microstructure,and microhardness maintains at a high level of ~ HV 292.Effect of Hf and Zr on EB-PVD Ni3Al repair coating will be further investigated.

  11. Morphology and inhibition performance of Ag thin film as antimicrobial coating deposited by RF-PVD on 316 L stainless steel

    Science.gov (United States)

    Purniawan, A.; Khrisna, Y. S. A.; Rasyida, A.; Atmono, T. M.

    2018-04-01

    Foreign body related infection (FBRIs) is caused by forming biofilm of bacterial colony of medical equipment surfaces. In many cases, the FBRIs is still happened on the surface after medical sterilization process has been performed. In order to avoid the case, surface modification by antimicrobial coating was used. In this work, we present silver (Ag) thin film on 316 L stainless steel substrate surface was deposited using Radio Frequency Sputtering PVD (RF-PVD). The morphology of Ag thin film were characterized using SEM-EDX. Surface roughness of the thin film was measured by AFM. In addition, Kirby Bauer Test in Escherichia coli (E. coli) was conducted in order to evaluate the inhibition performance of the Ag thin film antimicrobial coating. Based on SEM and AFM results show that the particle size is increased from 523 nm to 708 nm and surface roughness from 9 to 20 nm for deposition time 10 minutes to 20 minutes, respectively. In addition, the inhibition layer of the coating is about 29 mm.

  12. Improving the Wear Resistance of Moulds for the Injection of Glass Fibre–Reinforced Plastics Using PVD Coatings: A Comparative Study

    Directory of Open Access Journals (Sweden)

    Francisco Silva

    2017-02-01

    Full Text Available It is well known that injection of glass fibre–reinforced plastics (GFRP causes abrasive wear in moulds’ cavities and runners. Physical vapour deposition (PVD coatings are intensively used to improve the wear resistance of different tools, also being one of the most promising ways to increase the moulds’ lifespan, mainly when used with plastics strongly reinforced with glass fibres. This work compares four different thin, hard coatings obtained using the PVD magnetron sputtering process: TiAlN, TiAlSiN, CrN/TiAlCrSiN and CrN/CrCN/DLC. The first two are monolayer coatings while the last ones are nanostructured and consist of multilayer systems. In order to carry out the corresponding tribological characterization, two different approaches were selected: A laboratorial method, using micro-abrasion wear tests based on a ball-cratering configuration, and an industrial mode, analysing the wear resistance of the coated samples when inserted in a plastic injection mould. As expected, the wear phenomena are not equivalent and the results between micro-abrasion and industrial tests are not similar due to the different means used to promote the abrasion. The best wear resistance performance in the laboratorial wear tests was attained by the TiAlN monolayer coating while the best performance in the industrial wear tests was obtained by the CrN/TiAlCrSiN nanostructured multilayer coating.

  13. GEP-based method to formulate adhesion strength and hardness of Nb PVD coated on Ti-6Al-7Nb aimed at developing mixed oxide nanotubular arrays.

    Science.gov (United States)

    Rafieerad, A R; Bushroa, A R; Nasiri-Tabrizi, B; Fallahpour, A; Vadivelu, J; Musa, S N; Kaboli, S H A

    2016-08-01

    PVD process as a thin film coating method is highly applicable for both metallic and ceramic materials, which is faced with the necessity of choosing the correct parameters to achieve optimal results. In the present study, a GEP-based model for the first time was proposed as a safe and accurate method to predict the adhesion strength and hardness of the Nb PVD coated aimed at growing the mixed oxide nanotubular arrays on Ti67. Here, the training and testing analysis were executed for both adhesion strength and hardness. The optimum parameter combination for the scratch adhesion strength and micro hardness was determined by the maximum mean S/N ratio, which was 350W, 20 sccm, and a DC bias of 90V. Results showed that the values calculated in the training and testing in GEP model were very close to the actual experiments designed by Taguchi. The as-sputtered Nb coating with highest adhesion strength and microhardness was electrochemically anodized at 20V for 4h. From the FESEM images and EDS results of the annealed sample, a thick layer of bone-like apatite was formed on the sample surface after soaking in SBF for 10 days, which can be connected to the development of a highly ordered nanotube arrays. This novel approach provides an outline for the future design of nanostructured coatings for a wide range of applications. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Tribological properties of anti-wear PVD coatings for elevated temperatures application deposited onto X37CrMoV5-1 type hot work steel

    International Nuclear Information System (INIS)

    Dobrzanski, L.A.; Polok, M.; Adamiak, M.

    2003-01-01

    The paper presents results of tribological and adhesion investigations of anti-wear PVD coatings TiN, TiN/(Ti,Al)N and CrN types deposited in ion plating PVD process onto X37CrMoV5-1 type hot work tool steel. It was found that damage mechanism during scratch test in all investigated coatings begins with multiple spallings located on the scratch edges followed by cracking and tool coatings delamination. Regarding to the coating types it can be seen different location of such damages and loads typical for them. According to this observations it can be stated that highest adhesion among investigated coating present, CrN monolayer coating and the lowest one multilayers Ti/(Ti,Al)N coating. The wear resistance was investigated by pin-on-disc method performed in room and elevated to 500 o C temperatures. It was found that the lowest wear in to fixed investigation conditions in both room and elevated temperatures shows TiN monolayer coating. Additionally one can see that TiN coatings application improve wear resistance some five times. (author)

  15. ac impedance, DSC and FT-IR investigations on (x)PVAc-(1 - x)PVdF blends with LiClO4

    International Nuclear Information System (INIS)

    Baskaran, R.; Selvasekarapandian, S.; Kuwata, N.; Kawamura, J.; Hattori, T.

    2006-01-01

    The blended polymer electrolytes comprising poly(vinyl acetate) (PVAc)-poly(vinylidene fluoride) (PVdF) have been prepared for different blend composition with constant lithium perchlorate (LiClO 4 ) ratio by solution casting technique. The formation of the blend polymer electrolyte complex has been confirmed by FT-IR spectroscopy analysis. DSC analysis has been performed in order to observe the change in transition temperature that is caused by the blending of polymers and addition of LiClO 4 . The ac impedance and dielectric spectroscopy studies are carried out on the blended matrix to identify the optimized blend composition, which is having high ionic conductivity. The temperature dependence of conductivity of the polymer electrolytes is found to follow VTF type equation. The high ionic conductivity of 6.4 x 10 -4 S cm -1 at 343 K has been observed for blended polymer electrolyte having blend ratio 75:25 (PVAc:PVdF). The ionic transference number of mobile ions has been estimated by Wagner's polarization method and the value is reported to be t ion is 0.95-0.98 for all the blended samples. The modulus spectra reveal the non-Debye nature and distribution of relaxation times of the samples. The dielectric spectra show the low frequency dispersion, which implies the space charge effects arising from the electrodes

  16. corrosion and wear resistant ternary Cr-C-N coatings deposited by the ARC PVD process for machining tools and machining parts

    International Nuclear Information System (INIS)

    Knotek, O.; Lugscheider, E.; Zimmermann, H.; Bobzin, K.

    1997-01-01

    With the deposition of PVD hard coatings on the tools applied in machining operations it is possible to achieve significant improvements in the performance and quality of the machining processes. Depending on the machined material and the operating principle, e.g. turning, milling or drilling, not only different machining parameters but also different coating materials are necessary. In interrupted cut machining of tempered steel, for example, the life time of Ti-C-N coated inserts is several times greater than the Ti-C-N coated ones. This is a result of the favourable thermophysical and tribological properties of Ti-N-C. The potential for tool protection by CrN coatings is a result of the high ductility and low internal stress of this coating materials. CrN films can be deposited with greater film thickness, still maintaining very good adhesion. This paper presents the development of new arc PVD coatings in the system Cr-C-N. Owing to the carbon content in the coating an increased hardness and a better wear behavior in comparison to CrN was expected. The effects of various carbon carrier gases on the coating properties were examined. The coating properties were investigated by mechanical tests. X-ray diffraction, SEM analysis and corrosion tests. Some of the coatings were tested in machining tests. The results of these tests are presented in this paper. (author)

  17. Flexible free-standing TiO2/graphene/PVdF films as anode materials for lithium-ion batteries

    International Nuclear Information System (INIS)

    Ren, H.M.; Ding, Y.H.; Chang, F.H.; He, X.; Feng, J.Q.; Wang, C.F.; Jiang, Y.; Zhang, P.

    2012-01-01

    Highlights: ► Flexible TiO 2 /graphene electrode was prepared by a solvent evaporation technique. ► PVdF was used as substance to support the TiO 2 /graphene active materials. ► The flexible films can be employed as anode materials for Li-ion battery. - Abstract: Graphene composites were prepared by hydrothermal method using titanium dioxide (TiO 2 ) adsorbed graphene oxide (GO) sheets as precursors. Free-standing hybrid films for lithium-ion batteries were prepared by adding TiO 2 /graphene composites to the polyvinylidene fluoride (PVdF)/N-methyl-2-pyrrolidone (NMP) solution, followed by a solvent evaporation technique. These films were characterized by atomic force microscopy (AFM), X-ray diffraction (XRD), scanning electron microscopy (SEM) and various electrochemical techniques. Flexible films show an excellent cycling performance, which was attributed to the interconnected graphene conducting network, which depressed the increasing of electric resistance during the cycling.

  18. Characterization of the corrosion behavior of an austenitic stainless steel for biomedical applications coated with Ti N, Ti CN And DLC PVD coatings

    International Nuclear Information System (INIS)

    Antunes, Renato Altobelli

    2006-01-01

    Metallic biomaterials must present a combination of properties such as corrosion resistance, biocompatibility and mechanical resistance. Austenitic stainless steels, especially AISI 316L combine these properties with the easy of fabrication at low cost. However, they are prone to corrosion in physiological solutions. Furthermore, their corrosion products may lead to infectious ou allergenic reactions in the tissues around the implant device. In the present work, coatings produced by physical vapour deposition (PVD) methods have been applied on the surface of a 316L stainless steel to increase its corrosion resistance and biocompatibility. Three thin films were tested: titanium nitride (TiN), titanium carbonitride (TiCN) and diamond-like carbon (DLC). These materials present high hardness, wear resistance and intrinsic biocompatibility that are key features when considering biomedical applications. The characterization of the electrochemical behavior of the stainless steel coated with the three different films showed that the presence of surface defects are deleterious to the corrosion resistance of the substrate. These defects were observed using scanning electron microscopy. The evolution of the electrochemical behavior of the coated steel was explained through a mechanism based on the experimental results obtained using electrochemical impedance spectroscopy. Two different passivation treatments were carried out on the stainless steel surface, either in sulfuric or nitric acid solutions, to increase its corrosion resistance. The results suggested que these treatments were not efficient, but may be modified to improve its performance. The electronic properties of the passive films of the non-passivated and passivated stainless steel were studied using the Mott-Schottky approach. The films presented a duplex character. Below the flat band potential the behavior is typical of a highly doped type-p semiconductor. Above the flat band potential is typical of a highly

  19. Surface characteristics of hydroxyapatite-coated layer prepared on nanotubular Ti–35Ta–xHf alloys by EB-PVD

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Yong-Hoon [Department of Dental Materials and Research Center of Nano-Interface Activation for Biomaterials, School of Dentistry, Chosun University, Gwangju (Korea, Republic of); Biomechanics and Tissue Engineering Laboratory, Division of Orthodontics, College of Dentistry, The Ohio State University, Columbus, OH (United States); Moon, Byung-Hak [Department of Dental Materials and Research Center of Nano-Interface Activation for Biomaterials, School of Dentistry, Chosun University, Gwangju (Korea, Republic of); Choe, Han-Cheol, E-mail: hcchoe@chosun.ac.kr [Department of Dental Materials and Research Center of Nano-Interface Activation for Biomaterials, School of Dentistry, Chosun University, Gwangju (Korea, Republic of); Brantley, William A. [Division of Restorative, Prosthetic and Primary Care Dentistry, College of Dentistry, The Ohio State University, Columbus, OH (United States)

    2013-12-31

    In this study, we investigated the surface characteristics of hydroxyapatite (HA)-coated layers prepared by electron-beam physical vapor deposition (EB-PVD) on nanotubular Ti–35Ta–xHf alloys (x = 3, 7, and 15 wt.%). Ti–35Ta–xHf alloys were first prepared by arc melting. Formation of a nanotube structure on these alloys was achieved by an electrochemical method in 1 M H{sub 3}PO{sub 4} + 0.8 wt.% NaF electrolytes. The HA coatings were then deposited on the nanotubular surface by an EB-PVD method. The surface characteristics were analyzed by field-emission scanning electron microscopy, energy-dispersive X-ray spectroscopy, and X-ray diffraction (XRD). The electrochemical behavior was examined using a potentiodynamic polarization test in 0.9% NaCl solution. The Ti–35Ta–xHf alloys had an equiaxed grain structure with α″ + β phases, and the α″ phase disappeared with increases in Hf content. The Ti–35Ta–15Hf alloy showed higher β-phase peak intensity in the XRD patterns than that for the lower Hf-content alloys. A highly ordered nanotubular oxide layer was formed on the Ti–35Ta–15Hf alloy, and the tube length depended on Hf content. The HA coating surface formed at traces of the nanotubular titanium oxide layer and completely covered the tips of the nanotubes with a cluster shape. From the potentiodynamic polarization tests, the incorporation of Hf element and formation of the nanotubular structure were the main factors for achieving lower current density. In particular, the surface of the HA coating on the nanotubular structure exhibited higher corrosion resistance than that of the nanotubular titanium oxide structure without an HA coating. - Highlights: • Hydroxyapatite (HA) was coated on nanotubular Ti–35Ta–xHf alloys, using EB-PVD. • Increasing the Hf content reduced the relative proportion of α″ martensite to β-Ti in the microstructures. • The detailed nanotubular structure formed by anodization depended on alloy composition

  20. Surface characteristics of hydroxyapatite-coated layer prepared on nanotubular Ti–35Ta–xHf alloys by EB-PVD

    International Nuclear Information System (INIS)

    Jeong, Yong-Hoon; Moon, Byung-Hak; Choe, Han-Cheol; Brantley, William A.

    2013-01-01

    In this study, we investigated the surface characteristics of hydroxyapatite (HA)-coated layers prepared by electron-beam physical vapor deposition (EB-PVD) on nanotubular Ti–35Ta–xHf alloys (x = 3, 7, and 15 wt.%). Ti–35Ta–xHf alloys were first prepared by arc melting. Formation of a nanotube structure on these alloys was achieved by an electrochemical method in 1 M H 3 PO 4 + 0.8 wt.% NaF electrolytes. The HA coatings were then deposited on the nanotubular surface by an EB-PVD method. The surface characteristics were analyzed by field-emission scanning electron microscopy, energy-dispersive X-ray spectroscopy, and X-ray diffraction (XRD). The electrochemical behavior was examined using a potentiodynamic polarization test in 0.9% NaCl solution. The Ti–35Ta–xHf alloys had an equiaxed grain structure with α″ + β phases, and the α″ phase disappeared with increases in Hf content. The Ti–35Ta–15Hf alloy showed higher β-phase peak intensity in the XRD patterns than that for the lower Hf-content alloys. A highly ordered nanotubular oxide layer was formed on the Ti–35Ta–15Hf alloy, and the tube length depended on Hf content. The HA coating surface formed at traces of the nanotubular titanium oxide layer and completely covered the tips of the nanotubes with a cluster shape. From the potentiodynamic polarization tests, the incorporation of Hf element and formation of the nanotubular structure were the main factors for achieving lower current density. In particular, the surface of the HA coating on the nanotubular structure exhibited higher corrosion resistance than that of the nanotubular titanium oxide structure without an HA coating. - Highlights: • Hydroxyapatite (HA) was coated on nanotubular Ti–35Ta–xHf alloys, using EB-PVD. • Increasing the Hf content reduced the relative proportion of α″ martensite to β-Ti in the microstructures. • The detailed nanotubular structure formed by anodization depended on alloy composition. • The

  1. Improvement in ductility of high strength polycrystalline Ni-rich Ni{sub 3}Al alloy produced by EB-PVD

    Energy Technology Data Exchange (ETDEWEB)

    Sun, J.Y.; Pei, Y.L.; Li, S.S.; Zhang, H.; Gong, S.K., E-mail: gongsk@buaa.edu.cn

    2014-11-25

    Highlights: • High strength and high ductility of polycrystalline Ni-rich Ni{sub 3}Al alloy sheets were produced. • The elongation could be enhanced from ∼0.5% to ∼14.6% by microstructural control. • The fracture strength (∼820 MPa) was enhanced by the precipitation strengthening. • This work provides a general processing for repairing the worn single crystal blades. - Abstract: A 300 μm Ni-rich Ni{sub 3}Al sheet was produced by electron beam physical vapor deposition (EB-PVD) and followed by different heat treatments to obtain fine γ′/γ two-phase structures with large elongation. Tensile testing was performed at room-temperature, and the corresponding mechanisms were investigated in detail. Results indicated that the as-deposited Ni{sub 3}Al alloy exhibited non-equilibrium directional columnar crystal, and transited to equiaxed crystal with uniformly distributed tough γ phase after heat treatment. Meanwhile, the fracture mechanism transited from brittleness to a mixture of ductility and brittleness modes. With an appropriate heat treatment, high strength (ultimate tensile strength obtained 828 MPa) and high ductility (elongation obtained 14.6%) Ni{sub 3}Al alloy has been achieved, which was due to the mesh network microstructure. A series of transmission electron microscope (TEM) characterizations confirmed that the increasing flow stress of Ni{sub 3}Al alloy was attributed to the cubical secondary γ′ phase precipitates (25–50 nm) within the γ phase. This work provides a potential strategy for repairing the worn tip of single crystal engine blades using Ni-rich Ni{sub 3}Al alloy by EB-PVD.

  2. Lifetime-determining spalling mechanisms of NiCoCrAlRe/EB-PVD zirconia TBC systems

    Energy Technology Data Exchange (ETDEWEB)

    Fritscher, K.; Schulz, U. [DLR - German Aerospace Center, Institute of Materials Research, 51170 Cologne (Germany); Leyens, C. [Technical University of Brandenburg (BTU) Cottbus, Chair of Physical Metallurgy and Materials Technology, 03046 Cottbus (Germany)

    2007-09-15

    The mechanisms that control the lifetime of thermal barrier coating (TBC) systems have been traced by two particular overlay bondcoats serving as model systems: superalloy pins (IN100, CMSX-4) with two alternative NiCoCrAlRE (RE: Hf, Y) bond coat compositions (i) NiCoCrAlY without and (ii) with co-dopants of silicon and hafnium. On top an electron-beam physical-vapor deposited (EB-PVD) yttria partially stabilized zirconia (YPSZ) TBC commonly mixed with 2 wt.% hafnia, or, rarely with 10 wt.%, was applied. The test pins were thermo-cycled at 1100 and 1150 C until failure. Identical lifetimes in cyclic tests on YPSZ TBCs with 2 (relatively high sintering rate) and 10 wt.% hafnia (relatively low sintering rate) preclude an effect of diffusion mechanisms of the YPSZ TBC on lifetime. The fit of lifetimes and test temperatures to Arrhenius-type relationships gives activation energies for failure. These energies agree with the activation energies for anion and cation diffusion in alumina for the respective bondcoat variant: (i) for the NiCoCrAlY/TBC system for O{sup 2-} diffusion in alumina, (ii) for the NiCoCrAlYSiHf/TBC system for Al{sup 3+} diffusion in alumina. SEM and EDS investigations of the thermally grown oxides (TGOs) confirm the mechanisms responsible for TBC failure as indicated by activation energies. Two categories of failure can be distinguished: (i) NiCoCrAlY coatings fail by an ''adhesive mode of failure'' along smooth bond coat/TGO interfaces driven by a critical TGO thickness. (ii) NiCoCrAlYSiHf coatings fail later and more reluctantly by a ''cohesive'' crack mode via de-cohesion at the TGO/TBC interface. In the latter case a quasi-integrity of the crack-affected TGO is lengthily maintained up to failure by a crack-pinning mechanism which runs via Al{sup 3+} supply from the bondcoat. (Abstract Copyright [2007], Wiley Periodicals, Inc.) [German] Die Mechanismen, welche die Lebensdauer von Waermedaemmschichtsystemen

  3. Plasma-Enhanced Chemical Vapor Deposition (PE-CVD) yields better Hydrolytical Stability of Biocompatible SiOx Thin Films on Implant Alumina Ceramics compared to Rapid Thermal Evaporation Physical Vapor Deposition (PVD).

    Science.gov (United States)

    Böke, Frederik; Giner, Ignacio; Keller, Adrian; Grundmeier, Guido; Fischer, Horst

    2016-07-20

    Densely sintered aluminum oxide (α-Al2O3) is chemically and biologically inert. To improve the interaction with biomolecules and cells, its surface has to be modified prior to use in biomedical applications. In this study, we compared two deposition techniques for adhesion promoting SiOx films to facilitate the coupling of stable organosilane monolayers on monolithic α-alumina; physical vapor deposition (PVD) by thermal evaporation and plasma enhanced chemical vapor deposition (PE-CVD). We also investigated the influence of etching on the formation of silanol surface groups using hydrogen peroxide and sulfuric acid solutions. The film characteristics, that is, surface morphology and surface chemistry, as well as the film stability and its adhesion properties under accelerated aging conditions were characterized by means of X-ray photoelectron spectroscopy (XPS), energy dispersive X-ray spectroscopy (EDX), scanning electron microscopy (SEM), inductively coupled plasma-optical emission spectroscopy (ICP-OES), and tensile strength tests. Differences in surface functionalization were investigated via two model organosilanes as well as the cell-cytotoxicity and viability on murine fibroblasts and human mesenchymal stromal cells (hMSC). We found that both SiOx interfaces did not affect the cell viability of both cell types. No significant differences between both films with regard to their interfacial tensile strength were detected, although failure mode analyses revealed a higher interfacial stability of the PE-CVD films compared to the PVD films. Twenty-eight day exposure to simulated body fluid (SBF) at 37 °C revealed a partial delamination of the thermally deposited PVD films whereas the PE-CVD films stayed largely intact. SiOx layers deposited by both PVD and PE-CVD may thus serve as viable adhesion-promoters for subsequent organosilane coupling agent binding to α-alumina. However, PE-CVD appears to be favorable for long-term direct film exposure to aqueous

  4. LiFAP-based PVdF-HFP microporous membranes by phase-inversion technique with Li/LiFePO{sub 4} cell

    Energy Technology Data Exchange (ETDEWEB)

    Aravindan, V.; Vickraman, P. [Gandhigram Rural University, Department of Physics, Gandhigram (India); Sivashanmugam, A.; Thirunakaran, R.; Gopukumar, S. [Central Electrochemical Research Institute, Electrochemical Energy Systems Division, Karaikudi (India)

    2009-12-15

    Polyvinylidenefluoride-hexafluoropropylene-based (PVdF-HFP-based) gel and composite microporous membranes (GPMs and CPMs) were prepared by phase-inversion technique in the presence 10 wt% of AlO(OH){sub n} nanoparticles. The prepared membranes were gelled with 0.5-M LiPF{sub 3}(CF{sub 2}CF{sub 3}){sub 3} (lithium fluoroalkylphosphate, LiFAP) in EC:DEC (1:1 v/v) and subjected to various characterizations; the AC impedance study shows that CPMs exhibit higher conductivity than GPMs. Mechanical stability measurements on these systems reveal that CPMs exhibit Young's modulus higher than that of bare and GPMs and addition of nanoparticles drastically improves the elongation break was also noted. Transition of the host from {alpha} to {beta} phase after the loading of nanosized filler was confirmed by XRD and Raman studies. Physico-chemical properties, like liquid uptake, porosity, surface area, and activation energy, of the membranes were calculated and results are summarized. Cycling performance of Li/CPM/LiFePO{sub 4} coin cell was fabricated and evaluated at C/10 rate and delivered a discharge capacity of 157 and 148 mAh g {sup -1} respectively for first and tenth cycles. (orig.)

  5. Determination of the fatigue properties of multilayer PVD coatings on various substrates, based on the impact test and its FEM simulation

    Energy Technology Data Exchange (ETDEWEB)

    Bouzakis, K.D.; Vidakis, N. [Aristotle Univ., Thessaloniki (Greece). Dept. of Mech. Eng.; Leyendecker, T.; Erkens, G.; Wenke, R.

    1997-10-31

    The coating impact test, in combination with its finite elements method (FEM) simulation, is used to quantitatively characterize the fatigue behaviour of thin hard physical vapour deposited (PVD) coatings as well as of multilayer ones. Successive impacts of a cemented carbide ball onto a plane coated specimen induce severe contact loads and strain superficially the layered compound. The fatigue failure mode of each specimen is classified by means of scanning electron microscope (SEM) observations, microspectral analyses and profilometry. FEM simulating models of the impact test are used to determine the critical stress components, which introduce coating fatigue failure. The FEM computational results are correlated to the experimental ones and used to interpret them quantitatively. Herewith, critical values for stress components, responsible for distinctive fatigue failure modes of the coating substrate compounds are obtained and the fatigue limits of the examined multilayer coatings are inserted in general applicable Smith diagrams. Furthermore, the derived critical stresses are verified by investigating the same multilayer coatings on different substrates. (orig.) 14 refs.

  6. Application of response surface methodology on investigating flank wear in machining hardened steel using PVD TiN coated mixed ceramic insert

    Directory of Open Access Journals (Sweden)

    Ashok Kumar Sahoo

    2013-10-01

    Full Text Available The paper presents the development of flank wear model in turning hardened EN 24 steel with PVD TiN coated mixed ceramic insert under dry environment. The paper also investigates the effect of process parameter on flank wear (VBc. The experiments have been conducted using three level full factorial design techniques. The machinability model has been developed in terms of cutting speed (v, feed (f and machining time (t as input variable using response surface methodology. The adequacy of model has been checked using correlation coefficients. As the determination coefficient, R2 (98% is higher for the model developed; the better is the response model fits the actual data. In addition, residuals of the normal probability plot lie reasonably close to a straight line showing that the terms mentioned in the model are statistically significant. The predicted flank wear has been found to lie close to the experimental value. This indicates that the developed model can be effectively used to predict the flank wear in the hard turning. Abrasion and diffusion has been found to be the dominant wear mechanism in machining hardened steel from SEM micrographs at highest parametric range. Machining time has been found to be the most significant parameter on flank wear followed by cutting speed and feed as observed from main effect plot and ANOVA study.

  7. Improvement of Wear Performance of Nano-Multilayer PVD Coatings under Dry Hard End Milling Conditions Based on Their Architectural Development

    Directory of Open Access Journals (Sweden)

    Shahereen Chowdhury

    2018-02-01

    Full Text Available The TiAlCrSiYN-based family of PVD (physical vapor deposition hard coatings was specially designed for extreme conditions involving the dry ultra-performance machining of hardened tool steels. However, there is a strong potential for further advances in the wear performance of the coatings through improvements in their architecture. A few different coating architectures (monolayer, multilayer, bi-multilayer, bi-multilayer with increased number of alternating nano-layers were studied in relation to cutting-tool life. Comprehensive characterization of the structure and properties of the coatings has been performed using XRD, SEM, TEM, micro-mechanical studies and tool-life evaluation. The wear performance was then related to the ability of the coating layer to exhibit minimal surface damage under operation, which is directly associated with the various micro-mechanical characteristics (such as hardness, elastic modulus and related characteristics; nano-impact; scratch test-based characteristics. The results presented exhibited that a substantial increase in tool life as well as improvement of the mechanical properties could be achieved through the architectural development of the coatings.

  8. Structural and Mechanical Properties of the ZrC/Ni-Nanodiamond Coating Synthesized by the PVD and Electroplating Processes for the Cutting Knifes

    Science.gov (United States)

    Chayeuski, V.; Zhylinski, V.; Cernashejus, O.; Visniakov, N.; Mikalauskas, G.

    2018-04-01

    In this work, combined gradient ZrC/Ni-nanodiamond ultradispersed diamonds (UDD) coatings were synthesized on the surface of knife blades made of hard alloy WC-2 wt.% Co by electroplating and cathode arc evaporation PVD techniques to increase the durability period of a wood-cutting milling tool. The microstructure, phase and elemental composition, microhardness, and adhesion strength of the coatings were investigated. Ni-UDD layer is not mixed with the ZrC coating and hard alloy substrate. Cobalt is present in Ni-UDD layer after deposition of ZrC. The ZrC/Ni-nanodiamond coating consists of separate phases of zirconium carbide (ZrC), α-Ni, and Ni-UDD. The maximum value of microhardness of the Ni-nanodiamond coating is 5.9 GPa. The microhardness value of the ZrC/Ni-nanodiamond coatings is 25 ± 6 GPa, which corresponds to the microhardness of the hard alloy substrate and ZrC coating. The obtained high values of the critical loads on the scratch track of the ZrC/Ni-nanodiamond coating in 24 N prove a sufficiently high value of the adhesion strength of the bottom Ni-UDD layer with WC-Co substrate. Pilot testing of ZrC/Ni-nanodiamond-coated cutting tools proved their increasing durability period to be 1.5-1.6 times higher than that of bare tools, when milling laminated chipboard.

  9. The Study of Deposition Parameters, Properties for PVD TixN and CrxN Coatings Using a Closed Field Unbalanced Magnetron Sputter Ion Plating System

    Institute of Scientific and Technical Information of China (English)

    Hailin Sun; Susan Field; Jian Chen; Dennis. G. Teer

    2004-01-01

    Closed Field Unbalanced Magnetron Sputter Ion Plating (CFUBMSIP) systems have been used increasingly for PVD coating in recent years. TiN and CrN coatings, commonly used as the basic coating for a number of different hard coatings, have been chosen to study the coating process parameters for the CFUBMSIP system. In this paper, the process parameters, such as substrate temperature, substrate bias and OEM control, have been carefully examined to achieve hard and wear-resistance coatings with good adhesion. The coating structure and orientation were found to change according to the coating parameters. The Rockwell test and Scratch test were carried out to examine the coating adhesion; pin-on-disc testing was used to estimate the wear-resistant; micro-hardness was also used to determine coating hardness. HSS drill testing has been carried out to study the general properties of the coating for cutting tool application. A combination of process parameters can be selected to achieve good performance for the TiN and CrN coatings.

  10. On the application of response surface methodology for predicting and optimizing surface roughness and cutting forces in hard turning by PVD coated insert

    Directory of Open Access Journals (Sweden)

    Hessainia Zahia

    2015-04-01

    Full Text Available This paper focuses on the exploitation of the response surface methodology (RSM to determine optimum cutting conditions leading to minimum surface roughness and cutting force components. The technique of RSM helps to create an efficient statistical model for studying the evolution of surface roughness and cutting forces according to cutting parameters: cutting speed, feed rate and depth of cut. For this purpose, turning tests of hardened steel alloy (AISI 4140 (56 HRC were carried out using PVD – coated ceramic insert under different cutting conditions. The equations of surface roughness and cutting forces were achieved by using the experimental data and the technique of the analysis of variance (ANOVA. The obtained results are presented in terms of mean values and confidence levels. It is shown that feed rate and depth of cut are the most influential factors on surface roughness and cutting forces, respectively. In addition, it is underlined that the surface roughness is mainly related to the cutting speed, whereas depth of cut has the greatest effect on the evolution of cutting forces. The optimal machining parameters obtained in this study represent reductions about 6.88%, 3.65%, 19.05% in cutting force components (Fa, Fr, Ft, respectively. The latters are compared with the results of initial cutting parameters for machining AISI 4140 steel in the hard turning process.

  11. Embedded layer of Ag nanoparticles prepared by a combined PECVD/PVD process producing SiOxCy-Ag nanocomposite thin films.

    Science.gov (United States)

    Bedel, Laurent; Cayron, Cyril; Jouve, Michel; Maury, Francis

    2012-01-13

    Structural properties of SiO(x)C(y)-Ag nanocomposite thin films prepared by a dual process PVD-PECVD in the same reactor have been investigated. The experimental results have demonstrated the influence of a PECVD process carried out at room temperature for the growth of a dielectric matrix on the size and the distribution density of Ag nanoparticles (NPs) deposited beforehand by magnetron sputtering. The plasma during the growth of the encapsulation SiO(x)C(y) layer caused a diffusion of silver from NPs through the SiO(x)C(y) matrix associated with a decrease in the average size of nanoparticles and an increase of their distribution density. Silver diffusion is blocked at a barrier interface to form a buried layer of individual Ag NPs which, for instance, can find plasmonic applications. Silver also diffuses toward the outer surface inducing antibacterial properties. In both cases initial Ag NPs act as reservoirs for multifunctional properties of advanced nanostructured films.

  12. Metal (Ag/Ti)-Containing Hydrogenated Amorphous Carbon Nanocomposite Films with Enhanced Nanoscratch Resistance: Hybrid PECVD/PVD System and Microstructural Characteristics.

    Science.gov (United States)

    Constantinou, Marios; Nikolaou, Petros; Koutsokeras, Loukas; Avgeropoulos, Apostolos; Moschovas, Dimitrios; Varotsis, Constantinos; Patsalas, Panos; Kelires, Pantelis; Constantinides, Georgios

    2018-03-30

    This study aimed to develop hydrogenated amorphous carbon thin films with embedded metallic nanoparticles (a-C:H:Me) of controlled size and concentration. Towards this end, a novel hybrid deposition system is presented that uses a combination of Plasma Enhanced Chemical Vapor Deposition (PECVD) and Physical Vapor Deposition (PVD) technologies. The a-C:H matrix was deposited through the acceleration of carbon ions generated through a radio-frequency (RF) plasma source by cracking methane, whereas metallic nanoparticles were generated and deposited using terminated gas condensation (TGC) technology. The resulting material was a hydrogenated amorphous carbon film with controlled physical properties and evenly dispersed metallic nanoparticles (here Ag or Ti). The physical, chemical, morphological and mechanical characteristics of the films were investigated through X-ray reflectivity (XRR), Raman spectroscopy, Scanning Electron Microscopy (SEM), Atomic Force Microscopy (AFM), Transmission Electron Microscopy (TEM) and nanoscratch testing. The resulting amorphous carbon metal nanocomposite films (a-C:H:Ag and a-C:H:Ti) exhibited enhanced nanoscratch resistance (up to +50%) and low values of friction coefficient (<0.05), properties desirable for protective coatings and/or solid lubricant applications. The ability to form nanocomposite structures with tunable coating performance by potentially controlling the carbon bonding, hydrogen content, and the type/size/percent of metallic nanoparticles opens new avenues for a broad range of applications in which mechanical, physical, biological and/or combinatorial properties are required.

  13. Effect of La2O3 addition on interface chemistry between 4YSZ top layer and Ni based alloy bond coat in thermal barrier coating by EB PVD.

    Science.gov (United States)

    Park, Chan-Young; Yang, Young-Hwan; Kim, Seong-Won; Lee, Sung-Min; Kim, Hyung-Tae; Jang, Byung-Koog; Lim, Dae-Soon; Oh, Yoon-Suk

    2014-11-01

    The effect of a 5 mol% La2O3 addition on the forming behavior and compositional variation at interface between a 4 mol% Yttria (Y2O3) stabilized ZrO2 (4YSZ) top coat and bond coat (NiCrAlY) as a thermal barrier coating (TBC) has been investigated. Top coats were deposited by electron beam physical vapor deposition (EB PVD) onto a super alloy (Ni-Cr-Co-Al) substrate without pre-oxidation of the bond coat. Top coats are found to consist of dense columnar grains with a thin interdiffusion layer between metallic bond coats. In the as-received 4YSZ coating, a thin interdiffusion zone at the interface between the top and bond coats was found to consist of a Ni-Zr intermetallic compound with a reduced quantity of Y, Al or O elements. On the other hand, in the case of an interdiffusion area of 5 mol% La2O3-added 4YSZ coating, it was found that the complicated composition and structure with La-added YSZ and Ni-Al rich compounds separately. The thermal conductivity of 5 mol% La2O3-added 4YSZ coating (- 1.6 W/m x k at 1100 degrees C) was lower than a 4YSZ coating (- 3.2 W/m x k at 1100 degrees C) alone.

  14. Metal (Ag/Ti-Containing Hydrogenated Amorphous Carbon Nanocomposite Films with Enhanced Nanoscratch Resistance: Hybrid PECVD/PVD System and Microstructural Characteristics

    Directory of Open Access Journals (Sweden)

    Marios Constantinou

    2018-03-01

    Full Text Available This study aimed to develop hydrogenated amorphous carbon thin films with embedded metallic nanoparticles (a–C:H:Me of controlled size and concentration. Towards this end, a novel hybrid deposition system is presented that uses a combination of Plasma Enhanced Chemical Vapor Deposition (PECVD and Physical Vapor Deposition (PVD technologies. The a–C:H matrix was deposited through the acceleration of carbon ions generated through a radio-frequency (RF plasma source by cracking methane, whereas metallic nanoparticles were generated and deposited using terminated gas condensation (TGC technology. The resulting material was a hydrogenated amorphous carbon film with controlled physical properties and evenly dispersed metallic nanoparticles (here Ag or Ti. The physical, chemical, morphological and mechanical characteristics of the films were investigated through X-ray reflectivity (XRR, Raman spectroscopy, Scanning Electron Microscopy (SEM, Atomic Force Microscopy (AFM, Transmission Electron Microscopy (TEM and nanoscratch testing. The resulting amorphous carbon metal nanocomposite films (a–C:H:Ag and a–C:H:Ti exhibited enhanced nanoscratch resistance (up to +50% and low values of friction coefficient (<0.05, properties desirable for protective coatings and/or solid lubricant applications. The ability to form nanocomposite structures with tunable coating performance by potentially controlling the carbon bonding, hydrogen content, and the type/size/percent of metallic nanoparticles opens new avenues for a broad range of applications in which mechanical, physical, biological and/or combinatorial properties are required.

  15. Effect of a ductility layer on the tensile strength of TiAl-based multilayer composite sheets prepared by EB-PVD

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Rubing, E-mail: zrb86411680@126.com [Department of Mechanics, School of Civil Engineering, Beijing Jiaotong University, Beijing 100044 (China); Zhang, Yaoyao [Department of Mechanics, School of Civil Engineering, Beijing Jiaotong University, Beijing 100044 (China); Liu, Qiang [Beijing Institute of Astronautical Systems Engineering, Beijing 100076 (China); Chen, Guiqing [Center for Composite Materials, Harbin Institute of Technology, Harbin 150001 (China); Zhang, Deming [Beijing General Research Institute of Mining and Metallurgy, Beijing 100044 (China)

    2014-09-15

    TiAl/Nb and TiAl/NiCoCrAl laminate composite sheets with a thickness of 0.4–0.6 mm and dimensions of 150 mm × 100 mm were successfully fabricated by electron beam physical vapor deposition. The microstructures of the sheets were examined, and their mechanical properties were compared with those of TiAl monolithic sheet produced by electron beam physical vapor deposition. Tensile testing was performed at room temperature and 750 °C, and the fracture surfaces were examined by scanning electron microscopy. Among the three microlaminate sheets, the TiAl/NiCoCrAl micro-laminate sheet had the best comprehensive properties at room temperature, and the TiAl/Nb micro-laminate sheet showed the ideal high-temperature strength and plasticity at 750 °C. The result was discussed in terms of metal strengthening mechanism. - Highlights: • TiAl-based multilayer foils was fabricated successfully by using EB-PVD method; • The tensile properties and micro-fracture morphologies of the sheet were investigated; • The deformation behavior of the multilayer foils was discussed.

  16. Formation of semi-IPN membrane composed of crosslinked SPS-[PVdF-co-HFP/Nafion] for application in DMFC: A fine tuning between crosslinker and initiator

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Piyush; Kundu, Patit Paban, E-mail: ppk923@yahoo.com

    2015-08-15

    The semi-interpenetrating (semi-IPN) membrane composed of crosslinked sulfonated polystyrene (SPS) within the host blend of PVdF-co-HFP (Polyvinylidenefluoride-co-hexafluoropropylene) and Nafion has already been tested as a promising polymer electrolyte membrane (PEM) in terms of improved water uptake, proton conductivity and electrical efficiency for application in the direct methanol fuel cell (DMFC). These desired results have generated further curiosity about a fine tuning between the contents of divinyl benzene (DVB) as a crosslinker and azobisisobutyronitrile (AIBN) as an initiator for the optimization of PEM characteristics. It has been observed that an increase in AIBN content leads to an acceptable degree of water uptake, swelling ratio and proton conductivity in PEM, while higher DVB content causes declined methanol crossover, leading to higher membrane selectivity. These two opposing effects are optimized in terms of proton conductivity, tensile strength and membrane selectivity for the membrane consisting of 0.4 wt% of AIBN and 1.2 wt% of DVB. Moreover, the maximum power density obtained for the membrane having optimum selectivity is 56 mW cm{sup −2}, when analyzed at 90 °C. These results indicate that one can achieve a high power density in comparison to Nafion by fine tuning the contents of initiator and cross-linker during the synthesis of the semi-IPN membrane. - Graphical abstract: Display Omitted - Highlights: • PEM composed of 0.4/1.2 wt% of AIBN/DVB produced best result. • Lower methanol crossover (1.02 × 10{sup −6} cm{sup 2} s{sup −1}) compare to Nafion-117. • Higher membrane selectivity i.e 3.05 × 10{sup 4} Ss cm{sup −3} was obtained. • A maximum power density of 56 mW cm{sup −2} was obtained at 90 °C.

  17. Production and characterization of multilayer coatings of Ti/TiN on AISI 316L stainless steel by the PVD technique of cathodic arc ion plating

    International Nuclear Information System (INIS)

    Forlerer, Elena; Rodriguez, Fernando; Mingolo, Norma

    2006-01-01

    Multilayer coatings were produced from bi-layers (compound layers) of Ti/TiN in a PVD reactor of cathodic arc ion plating. The process was carried out at an Argon gas pressure of 5x10 -3 Torr for the interlayer of Ti and a nitrogen + argon pressure of 2x10 -2 Torr for the deposit of TiN and a Bias voltage of -500V for the Ti layer and -100V for the TiN layer. The arc current held constant at 80 amp. The samples were kept at high temperatures ≥ 300 o C, mounted on a rotating system that held the test piece 15-25 cm from the Ti electrode. Certified composition AISI 316L and AISI 410 stainless steel were used for the substrate. Coatings with one or two compound layers with similar thicknesses were made. The coatings were characterized mechanically by adherence, thickness and microhardness by Vickers indentation with 25g loads. The texture was studied by X-ray diffraction and present phases and residual tensions were determined. The results of the X-ray diffraction show the presence of the mostly TiN phase, with fcc structure in the mono-layer and the bi-layer. Residual tensions are compressive and elevated due to the expansion of the TiN network during the deposition process. Measurements of the bi-layers at different angles showed a relaxing of the tensions close to the surface, which could be due to the effect of the second interlayer of Ti. Preferential orientations associated with the growth process of the layers and the developed microstructure were detected in the TiN (CW)

  18. Formation of semi-IPN membrane composed of crosslinked SPS-[PVdF-co-HFP/Nafion] for application in DMFC: A fine tuning between crosslinker and initiator

    International Nuclear Information System (INIS)

    Kumar, Piyush; Kundu, Patit Paban

    2015-01-01

    The semi-interpenetrating (semi-IPN) membrane composed of crosslinked sulfonated polystyrene (SPS) within the host blend of PVdF-co-HFP (Polyvinylidenefluoride-co-hexafluoropropylene) and Nafion has already been tested as a promising polymer electrolyte membrane (PEM) in terms of improved water uptake, proton conductivity and electrical efficiency for application in the direct methanol fuel cell (DMFC). These desired results have generated further curiosity about a fine tuning between the contents of divinyl benzene (DVB) as a crosslinker and azobisisobutyronitrile (AIBN) as an initiator for the optimization of PEM characteristics. It has been observed that an increase in AIBN content leads to an acceptable degree of water uptake, swelling ratio and proton conductivity in PEM, while higher DVB content causes declined methanol crossover, leading to higher membrane selectivity. These two opposing effects are optimized in terms of proton conductivity, tensile strength and membrane selectivity for the membrane consisting of 0.4 wt% of AIBN and 1.2 wt% of DVB. Moreover, the maximum power density obtained for the membrane having optimum selectivity is 56 mW cm −2 , when analyzed at 90 °C. These results indicate that one can achieve a high power density in comparison to Nafion by fine tuning the contents of initiator and cross-linker during the synthesis of the semi-IPN membrane. - Graphical abstract: Display Omitted - Highlights: • PEM composed of 0.4/1.2 wt% of AIBN/DVB produced best result. • Lower methanol crossover (1.02 × 10 −6 cm 2 s −1 ) compare to Nafion-117. • Higher membrane selectivity i.e 3.05 × 10 4 Ss cm −3 was obtained. • A maximum power density of 56 mW cm −2 was obtained at 90 °C

  19. Al_2O_3/PVdF-HFP-CMC/PE separator prepared using aqueous slurry and post-hot-pressing method for polymer lithium-ion batteries with enhanced safety

    International Nuclear Information System (INIS)

    Deng, Yaoming; Song, Xiaona; Ma, Zhen; Zhang, Xinhe; Shu, Dong; Nan, Junmin

    2016-01-01

    A composite separator is prepared to improve the safety of lithium ion batteries (LIBs) based on a gravure coating aqueous slurry and post-hot-pressing method. An environmentally friendly aqueous slurry with an Al_2O_3 ceramic holder and polyvinylidene difluoride-hexafluoropropylene (PVdF-HFP) and carboxymethyl cellulose (CMC) dual-binders is coated on a polyolefin (PE) substrate to form a prototype Al-PHC/PE separator. Then, after assembling the separator in the batteries and hot-pressing at 70 °C and 0.8 MPa for 3 h, the granular PVdF-HFP is transformed into a colloidal structure containing an electrolyte, which can binds the Al_2O_3 nanoparticles together and increases the battery hardness. Compared with a PE separator (9 μm), the Al-PHC/PE-2 separator (12 μm, with a Al_2O_3/PVdF-HFP weight ratio of 7/3) displays a comparative ionic conductivity of 9.3 × 10"−"4 S cm"−"2 and exhibits no obvious thermal deformation at 110 °C for 60 min. All of the batteries assembled with Al-PHC/PE-2 separators passed nail penetration and impact tests. In addition, the capacity retention increases from 83.4% to 87.6% when the battery is assembled with Al-PHC/PE-2 instead of a PE separator and charge-discharged at 0.7C/1.0C for 350 cycles. The enhanced safety and cycle performance indicate the promising prospect of Al-PHC/PE separators in LIBs.

  20. Surface and interface analysis of PVD Al-O-N and {gamma}-Al{sub 2}O{sub 3} diffusion barriers

    Energy Technology Data Exchange (ETDEWEB)

    Cremer, R.; Witthaut, M.; Reichert, K.; Neuschuetz, D. [Technische Hochschule Aachen (Germany). Lehrstuhl fuer Metallurgie der Kernbrennstoffe und Theoretische Huettenkunde

    1999-10-01

    The suitability of PVD films of {gamma}-Al{sub 2}O{sub 3} and of ternary Al-O-N as diffusion barriers between a nickel based superalloy CMSX-4 and NiCoCrAlY for a possible application in gas turbines was investigated. Therefore, an Al{sub 2}O{sub 3} film and, alternatively, an Al-O-N film were deposited on CMSX-4 at 100 C substrate temperature by means of reactive magnetron sputtering ion plating (MSIP). After characterization of composition and structure of the films by X-ray photoelectron spectroscopy (XPS) and grazing incidence X-ray diffraction (XRD), a NiCoCrAlY coating was deposited onto the diffusion barriers and, for comparison, directly onto CMSX-4 by MSIP as well. The composites were annealed for 4 h at 1100 C under inert atmosphere. Wavelength dispersive X-ray (WDX) element mappings and line-scans of the cross-sectional cut served to evaluate the suitability of the films as diffusion barriers. After detachment of the coatings from the substrate, the phase stabilities of the two metastable phases {gamma}-Al{sub 2}O{sub 3} and Al-O-N were determined by means of grazing incidence XRD. Without a diffusion barrier, enhanced interdiffusion was observed. Analyses of the composite with the {gamma}-Al{sub 2}O{sub 3} interlayer revealed diffusion of Ti and Ta from the substrate into the NiCoCrAlY coating. No interdiffusion of Ni, Ti, Ta, and Cr could be detected in case of the ternary Al-O-N film. Whereas the ternary Al-O-N film remained in the as-deposited X-ray amorphous structure after annealing, a phase change from the {gamma} to the {alpha} modification could be observed in case of the Al{sub 2}O{sub 3} film, presumably responsible for its lower efficiency as a diffusion barrier. (orig.)

  1. Corrosion Resistance Behavior of Single-Layer Cathodic Arc PVD Nitride-Base Coatings in 1M HCl and 3.5 pct NaCl Solutions

    Science.gov (United States)

    Adesina, Akeem Yusuf; Gasem, Zuhair M.; Madhan Kumar, Arumugam

    2017-04-01

    The electrochemical behavior of single-layer TiN, CrN, CrAlN, and TiAlN coatings on 304 stainless steel substrate, deposited using state-of-the-art and industrial size cathodic arc PVD machine, were evaluated in 1M HCl and 3.5 pct NaCl solutions. The corrosion behavior of the blank and coated substrates was analyzed by electrochemical impedance spectroscopy (EIS), linear polarization resistance, and potentiodynamic polarization. Bond-coat layers of pure-Ti, pure-Cr, alloyed-CrAl, and alloyed-TiAl for TiN, CrN, CrAlN, and TiAlN coatings were, respectively, first deposited for improved coating adhesion before the actual coating. The average coating thickness was about 1.80 µm. Results showed that the corrosion potentials ( E corr) of the coated substrates were shifted to more noble values which indicated improvement of the coated substrate resistance to corrosion susceptibility. The corrosion current densities were lower for all coated substrates as compared to the blank substrate. Similarly, EIS parameters showed that these coatings possessed improved resistance to defects and pores in similar solution compared to the same nitride coatings developed by magnetron sputtering. The charge transfer resistance ( R ct) can be ranked in the following order: TiAlN > CrN > TiN > CrAlN in both media except in NaCl solution where R ct of TiN is lowest. While the pore resistance ( R po) followed the order: CrAlN > CrN > TiAlN > TiN in HCl solution and TiAlN > CrN > CrAlN > TiN in NaCl solution. It is found that TiAlN coating has the highest protective efficiencies of 79 and 99 pct in 1M HCl and 3.5 pct NaCl, respectively. SEM analysis of the corroded substrates in both media was also presented.

  2. Experimental and numerical investigations on the temperature distribution in PVD AlTiN coated and uncoated Al2O3/TiCN mixed ceramic cutting tools in hard turning of AISI 52100 steel

    Science.gov (United States)

    Sateesh Kumar, Ch; Patel, Saroj Kumar; Das, Anshuman

    2018-03-01

    Temperature generation in cutting tools is one of the major causes of tool failure especially during hard machining where machining forces are quite high resulting in elevated temperatures. Thus, the present work investigates the temperature generation during hard machining of AISI 52100 steel (62 HRC hardness) with uncoated and PVD AlTiN coated Al2O3/TiCN mixed ceramic cutting tools. The experiments were performed on a heavy duty lathe machine with both coated and uncoated cutting tools under dry cutting environment. The temperature of the cutting zone was measured using an infrared thermometer and a finite element model has been adopted to predict the temperature distribution in cutting tools during machining for comparative assessment with the measured temperature. The experimental and numerical results revealed a significant reduction of cutting zone temperature during machining with PVD AlTiN coated cutting tools when compared to uncoated cutting tools during each experimental run. The main reason for decrease in temperature for AlTiN coated tools is the lower coefficient of friction offered by the coating material which allows the free flow of the chips on the rake surface when compared with uncoated cutting tools. Further, the superior wear behaviour of AlTiN coating resulted in reduction of cutting temperature.

  3. Process-structure-property relationships of micron thick gadolinium oxide films deposited by reactive electron beam-physical vapor deposition (EB-PVD)

    Science.gov (United States)

    Grave, Daniel A.

    Gadolinium oxide (Gd2O3) is an attractive material for solid state neutron detection due to gadolinium's high thermal neutron capture cross section. Development of neutron detectors based on Gd2 O3 requires sufficiently thick films to ensure neutron absorption. In this dissertation work, the process-structure-property relationships of micron thick Gd2O3 films deposited by reactive electron-beam physical vapor deposition (EB-PVD) were studied. Through a systematic design of experiments, fundamental studies were conducted to determine the effects of processing conditions such as deposition temperature, oxygen flow rate, deposition rate, and substrate material on Gd2O3 film crystallographic phase, texture, morphology, grain size, density, and surface roughness. Films deposited at high rates (> 5 A/s) were examined via x-ray diffraction (XRD) and Raman spectroscopy. Quantitative phase volume calculations were performed via a Rietveld refinement technique. All films deposited at high rates were found to be fully monoclinic or mixed cubic/monoclinic phase. Generally, increased deposition temperature and increased oxygen flow resulted in increased cubic phase volume. As film thickness increased, monoclinic phase volume increased. Grazing incidence x-ray diffraction (GIXRD) depth profiling analysis showed that cubic phase was only present under large incidence angle (large penetration depth) measurements, and after a certain point, only monoclinic phase was grown. This was confirmed by transmission electron microscopy (TEM) analysis with selected area diffraction (SAD). Based on this information, a large compressive stress was hypothesized to cause the formation of the monoclinic phase and this hypothesis was confirmed by demonstrating the existence of a stress induced phase transition. An experiment was designed to introduce compressive stress into the Gd2O 3 films via ion beam assisted deposition (IBAD). This allowed for systematic increase in compressive stress while

  4. Corrosion behaviour in saline environments of single-layer titanium and aluminium coatings, and of Ti/Al alternated multi-layers elaborated by a multi-beam PVD technique

    International Nuclear Information System (INIS)

    Merati, Abdenacer

    1994-01-01

    This research thesis reports the characterization of anti-corrosion titanium and aluminium coatings deposited on a 35CD4 steel under the form of mono-metallic layers or alternated Ti/Al multi-layers, and obtained by a multibeam PVD technique. The influence of different parameters is studied: single-layer thickness (5, 15 or 30 micro-metres), multi-layer distribution (5 to 6) and substrate (smooth or threaded). Layer nature and microstructure are studied by optical microscopy and scanning electron microscopy (SEM), as well as corrosion toughness in aqueous saline environments. Coated threaded samples have been studied after tightening tests. It appears that titanium layers are denser and more uniform than aluminium layers, and that multi-layer coatings provide a better protection than single-layer coatings. The best behaviour is obtained when titanium is in contact with steel, and aluminium is the outer layer in contact with the corroding environment [fr

  5. DEFORMACIÓN ELÁSTICA RESIDUAL EN LÁMINAS DE ACERO AISI 304 RECUBIERTAS CON UNA PELÍCULA DE NITRURO DE TITANIO DEPOSITADA POR PVD-MAGNETRON SPUTTERING

    Directory of Open Access Journals (Sweden)

    H. A. COLORADO

    2009-01-01

    Full Text Available Se realizó una caracterización mediante difracción de rayos x (DRX en láminas de acero inoxidable AISI 304 recubierto con una capa de nitruro de titanio de 3 um de espesor, obtenida mediante deposición física de vapor (PVD-MAGNETRON SPUTTERING a una temperatura de 200 °C. se tomaron imágenes de microscopía electrónica de barrido (MEB, microscopía óptica (MO y microscopía de fuerza atómica (MFA para caracterizar el sustrato, la capa y la zona cercana a la intercara. adicionalmente se determinó la deformación elástica residual asociada con el ensanchamiento de los picos de DRX.

  6. Thermal cycling behavior of La{sub 2}Zr{sub 2}O{sub 7} coating with the addition of Y{sub 2}O{sub 3} by EB-PVD

    Energy Technology Data Exchange (ETDEWEB)

    Xu Zhenhua [State Key Laboratory of Rare Earth Resources Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Graduate School of Chinese Academy of Sciences, Beijing 100039 (China); Beijing Institute of Aeronautical Materials, Department 5, P.O. Box 81-5, Beijing 100095 (China); He Limin, E-mail: he_limin@yahoo.co [Beijing Institute of Aeronautical Materials, Department 5, P.O. Box 81-5, Beijing 100095 (China); Chen Xiaolong; Zhao Yu [State Key Laboratory of Rare Earth Resources Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China); Mu Rende; He Shimei [Beijing Institute of Aeronautical Materials, Department 5, P.O. Box 81-5, Beijing 100095 (China); Cao Xueqiang, E-mail: xcao@ciac.jl.c [State Key Laboratory of Rare Earth Resources Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2010-10-15

    Thermal barrier coatings (TBCs) of La{sub 2}Zr{sub 2}O{sub 7} (LZ) with the addition of 3 wt.% Y{sub 2}O{sub 3} (LZ3Y) were deposited by electron beam-physical vapor deposition (EB-PVD). The phase structures, surface and cross-sectional morphologies, cyclic oxidation behaviors of these coatings were studied in detail. The thermal cycling test at 1373 K in an air furnace indicates that the LZ3Y coating has a lifetime of 617 cycles which is about 10% longer than that of LZ coating. The improvement of chemical homogeneity of the coating, the superior growth behavior of columns and the favorable mechanical properties are all very helpful to the prolongation of thermal cycling life of LZ3Y coating. The failure of LZ and LZ3Y coatings is mainly a result of the excess La{sub 2}O{sub 3}, the chemical incompatibility of ceramic coatings with TGO layer, the thermal expansion mismatch between ceramic coatings and bond coat, and the outward diffusion of alloying elements into the ceramic coatings.

  7. Thermal cycling behavior of YSZ and La2(Zr0.7Ce0.3)2O7 as double-ceramic-layer systems EB-PVD TBCs

    International Nuclear Information System (INIS)

    Xu Zhenhua; He Limin; Mu Rende; Lu Feng; He Shimei; Cao Xueqiang

    2012-01-01

    Highlights: ► DCL coating has a longer lifetime than that of single layer coating of LZ7C3 or YSZ. ► The unique growth modes of columns within DCL coating. ► The presence of cerium in both Ce 3+ and Ce 4+ oxidation states within the coating surface. ► The spallation of DCL coating induced by transverse cracks may be the first emergence of delamination followed by spalling layer by layer. ► The outward diffusion of Cr element (bond coat) into LZ7C3 layer. - Abstract: Double-ceramic-layer (DCL) thermal barrier coatings (TBCs) of La 2 (Zr 0.7 Ce 0.3 ) 2 O 7 (LZ7C3) and yttria stabilized zirconia (YSZ) were deposited by electron beam-physical vapor deposition (EB-PVD). The thermal cycling test at 1573 K in burner-rig with a coal gas flame indicates the thermal cycling life of DCL coating is not only much longer than that of LZ7C3 coating, but also approximately 27% longer than that of YSZ coating. The superior sintering-resistance of LZ7C3 coating and the unique growth modes of columns within DCL coating are all very helpful to the prolongation of thermal cycling life of DCL coating. The failure of DCL coating is mainly a result of the reduction–oxidation of cerium oxide, the re-crystallization of some LZ7C3 fine grains, the cracks initiation, propagation and extension, the abnormal oxidation of bond coat, the degradation of t′-phase in YSZ coating and the outward diffusion of Cr alloying element into LZ7C3 coating. Since no single material that has been studied so far satisfies all the requirements for high temperature applications, DCL coating is an important development direction of TBCs.

  8. Guides d’onde en verres et vitrocéramiques fluorés dopés terre rare élaborés par PVD pour l’émission dans le visible et la conversion de fréquence

    OpenAIRE

    Dieudonné , Belto

    2012-01-01

    The project joins in the development of miniaturized laser sources RGB for display and videoprojection, frequency conversion in solar cells.Fluoride glasses ZLAG ( ZrF4-LaF3-AlF3-GaF3) co-doped with rare earths were studied. This glass has a low phonon energy, a strong solubility of the rare earth ions and can be fabricated as thin films by PVD. It is also the precursor of transparent glass-ceramics. Similar emissions in both co-doped bulk and waveguides have been observed ; blue, orange, red...

  9. Significance of a Noble Metal Nanolayer on the UV and Visible Light Photocatalytic Activity of Anatase TiO2 Thin Films Grown from a Scalable PECVD/PVD Approach.

    Science.gov (United States)

    Baba, Kamal; Bulou, Simon; Quesada-Gonzalez, Miguel; Bonot, Sébastien; Collard, Delphine; Boscher, Nicolas D; Choquet, Patrick

    2017-11-29

    UV and visible light photocatalytic composite Pt and Au-TiO 2 coatings have been deposited on silicon and glass substrates at low temperature using a hybrid ECWR-PECVD/MS-PVD process. Methylene blue, stearic acid, and sulfamethoxazole were used as dye, organic, and antibiotic model pollutants, respectively, to demonstrate the efficiency of these nanocomposite coatings for water decontamination or self-cleaning surfaces applications. Raman investigations revealed the formation of anatase polymorph of TiO 2 in all synthesized coatings with a shifting of the main vibrational mode peak to higher wavenumber in the case of Au-TiO 2 coating, indicating an increase number of crystalline defects within this coating. Because of the difference of the chemical potentials of each of the investigated noble metals, the sputtered metal layers exhibit different morphology. Pt sputtered atoms, with high surface adhesion, promote formation of a smooth 2D layer. On the other hand, Au sputtered atoms with higher cohesive forces promote the formation of 5-10 nm nanoparticles. As a result, the surface plasmon resonance phenomenon was observed in the Au-TiO 2 coatings. UV photoactivity of the nanocomposite coatings was enhanced 1.5-3 times and 1.3 times for methylene blue and stearic acid, respectively, thanks to the enhancement of electron trapping in the noble metal layer. This electron trapping phenomenon is higher in the Pt-TiO 2 coating because of its larger work function. On the other hand, the enhancement of the visible photoactivity was more pronounced (3 and 7 times for methylene blue and stearic acid, respectively) in the case of Au-TiO 2 thanks to the surface plasmon resonance. Finally, these nanocomposite TiO 2 coatings exhibited also a good ability for the degradation of antibiotics usually found in wastewater such as sulfamethoxazole. However, a complementary test have showed an increase of the toxicity of the liquid medium after photocatalysis, which could be due the

  10. Thermal cycling behavior of YSZ and La{sub 2}(Zr{sub 0.7}Ce{sub 0.3}){sub 2}O{sub 7} as double-ceramic-layer systems EB-PVD TBCs

    Energy Technology Data Exchange (ETDEWEB)

    Xu Zhenhua, E-mail: zhxuciac@yahoo.com [Beijing Institute of Aeronautical Materials, Department 5, P.O. Box 81-5, Beijing 100095 (China); He Limin; Mu Rende; Lu Feng; He Shimei [Beijing Institute of Aeronautical Materials, Department 5, P.O. Box 81-5, Beijing 100095 (China); Cao Xueqiang [State Key Laboratory of Rare Earth Resource Utilization, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Changchun 130022 (China)

    2012-06-05

    Highlights: Black-Right-Pointing-Pointer DCL coating has a longer lifetime than that of single layer coating of LZ7C3 or YSZ. Black-Right-Pointing-Pointer The unique growth modes of columns within DCL coating. Black-Right-Pointing-Pointer The presence of cerium in both Ce{sup 3+} and Ce{sup 4+} oxidation states within the coating surface. Black-Right-Pointing-Pointer The spallation of DCL coating induced by transverse cracks may be the first emergence of delamination followed by spalling layer by layer. Black-Right-Pointing-Pointer The outward diffusion of Cr element (bond coat) into LZ7C3 layer. - Abstract: Double-ceramic-layer (DCL) thermal barrier coatings (TBCs) of La{sub 2}(Zr{sub 0.7}Ce{sub 0.3}){sub 2}O{sub 7} (LZ7C3) and yttria stabilized zirconia (YSZ) were deposited by electron beam-physical vapor deposition (EB-PVD). The thermal cycling test at 1573 K in burner-rig with a coal gas flame indicates the thermal cycling life of DCL coating is not only much longer than that of LZ7C3 coating, but also approximately 27% longer than that of YSZ coating. The superior sintering-resistance of LZ7C3 coating and the unique growth modes of columns within DCL coating are all very helpful to the prolongation of thermal cycling life of DCL coating. The failure of DCL coating is mainly a result of the reduction-oxidation of cerium oxide, the re-crystallization of some LZ7C3 fine grains, the cracks initiation, propagation and extension, the abnormal oxidation of bond coat, the degradation of t Prime -phase in YSZ coating and the outward diffusion of Cr alloying element into LZ7C3 coating. Since no single material that has been studied so far satisfies all the requirements for high temperature applications, DCL coating is an important development direction of TBCs.

  11. Dependence of surface-enhanced infrared absorption (SEIRA) enhancement and spectral quality on the choice of underlying substrate: a closer look at silver (Ag) films prepared by physical vapor deposition (PVD).

    Science.gov (United States)

    Killian, Michelle M; Villa-Aleman, Eliel; Sun, Zhelin; Crittenden, Scott; Leverette, Chad L

    2011-03-01

    Silver (Ag) films of varying thickness were simultaneously deposited using physical vapor deposition (PVD) onto six infrared (IR) substrates (BaF(2), CaF(2), Ge, AMTIR, KRS-5, and ZnSe) in order to correlate the morphology of the deposited film with optimal SEIRA response and spectral band symmetry and quality. Significant differences were observed in the surface morphology of the deposited silver films, the degree of enhancement provided, and the spectral appearance of para-nitrobenzoic acid (PNBA) cast films for each silver-coated substrate. These differences were attributed to each substrate's chemical properties, which dictate the morphology of the Ag film and ultimately determine the spectral appearance of the adsorbed analyte and the magnitude of SEIRA enhancement. Routine SEIRA enhancement factors (EFs) for all substrates were between 5 and 150. For single-step Ag depositions, the following ranking identifies the greatest SEIRA enhancement factor and the maximum absorption of the 1345 cm(-1) spectral marker of PNBA at the optimal silver thickness for each substrate: BaF(2) (EF = 85 ± 19, 0.059 A, 10 nm Ag) > CaF(2) (EF = 75 ± 30, 0.052 A, 10 nm Ag) > Ge (EF = 45 ± 8, 0.019 A, 5 nm Ag) > AMTIR (EF = 38 ± 8, 0.024 A, 15 nm Ag) > KRS-5 (EF = 24 ± 1, 0.015 A, 12 nm Ag) > ZnSe (EF = 9 ± 5, 0.008 A, 8 nm Ag). A two-step deposition provides 59% larger EFs than single-step depositions of Ag on CaF(2). A maximum EF of 147 was calculated for a cast film of PNBA (surface coverage = 341 ng/cm(2)) on a 10 nm two-step Ag film on CaF(2) (0.102 A, 1345 cm(-1) symmetric NO(2) stretching band). The morphology of the two-step Ag film has smaller particles and greater particle density than the single-step Ag film.

  12. A.C. impedance, XRD, DSC, SEM and charge/discharge studies on Al2O3, TiO2, SiO2 dispersoid LiPF6/PVC/PVdF-co-HFP composite polymer electrolytes by phase inversion

    Science.gov (United States)

    Vickraman, P.; Gopukumar, S.

    2017-07-01

    The PVC/PVdF-co-HFP composite polymer electrolyte membranes (CPEMs) by varying blend ratios 1:1, 1:2, and 2:1 with fixed content of Al2O3, TiO2 and SiO2 having soaked in 0.5 M LiPF6 in EC/DEC (1:1) v/v) have been prepared by phase inversion. CPEMs of higher ionic conductivity (not dependent on electrolyte uptake as observed in our study) ASA4 (3.61×10-4 Scm-1), TSA3 (1.53×10-4 Scm-1), and SSA3 (4.81×10-4 Scm-1) have been only chosen for XRD, DSC, SEM and electrochemical studies. In XRD, crystalline peaks (phases) of PVdF have been noted with/without change in intensity as well as FWHM which correspond to type of filler interaction with host matrix. In DSC, it is observed that shifts in baseline, melting endotherms, and area under the endotherms indicating the thermal hist ory of PVC (Tg = 82 ° C) and melting of VdF crystallites varied with nature of the filler dispersoid. In SEM, the coagulated fibrils of the polymer coiled with the sponge like structure has been mapped. The charge/discharge studies are carried out on these CPEMs at C/10 rate in the voltage range 2.8 V - 4.2 V, and it is noted that the TSA3 showed better cycling performance with good capacity retention i.e., 50 cycles with 66% capacity retention than ASA4 of 28 cycles with 65% and SSA3 of 5 cycles with 56%. In the present study Coulombic efficiency is concerned only for first cycle and it is noted that the TSA3 showed 71% than 66% and 62% respectively for SSA3 and ASA4.

  13. PVD and gas production: consider local resource access requirements

    International Nuclear Information System (INIS)

    Delafosse, E.

    1993-01-01

    The history of the natural gas industry worldwide teaches us that its development has sprung mainly from two sources: favorable contingent conditions, such as in the United States, where the discovery of large gas fields coincided favorably with technological progress and the already existing city gas distribution networks, as also happened in Italy and France; and political prodding, as in the Eastern European countries, in Japan, and certain countries of Western Europe too. Today, while natural gas is winning over more and more consumers and the infrastructures now exist, the rise in consumption is being held back by supply-related constraints, and namely the problem of adjusting to the rise in gas prices in the United States, and the distancing of the resources from Europe. In this context, the development of new gas markets in the developing countries could contribute to the continuous growth of the world natural gas industry. The resources do exist, and the possibility of generating electricity with them opens the way to creating or developing this industry in some twenty developing countries, to begin with, and a greater number later. For these countries, this perspective is highly enticing, economically; but development is slow, partly due to the fact that the specific requirements of gas production projects are not satisfied. The contractual and tax structure governing their implementation does not reflect the fact that, in contrast to the petroleum industry, the producer does not have access to a true market, and he is in fact only one of the wheels in an integrated production mechanism bent specifically on putting electrical power on the market. It is easy to see the difficulties that arise from such a situation, since the indispensable steps in the process, performed successively by producer, transporter, and electric company, use two interfaces with fields of business that are in close bilateral dependency. This leads to upstream inefficiency in investments and downstream inefficiency in trade. (author). 17 refs

  14. Evaluación de un puesto de PVD

    OpenAIRE

    Iturbe, Leire

    2012-01-01

    Actualmente, está fuera de duda que la ergonomía de los puestos con pantallas de visualización de datos constituye un requisito imprescindible para prevenir los problemas derivados del trabajo habitual y prolongado con este tipo de equipos: trastornos oculares, fatiga mental y problemas musculoesqueléticos. A estos problemas se encuentran expuestos actualmente extensos colectivos de trabajadores, colectivos cuyo crecimiento corre paralelo a la incesante expansión de la informática en las o...

  15. Industrial PVD metallization for high efficiency crystalline silicon solar cells

    OpenAIRE

    Nekarda, J.; Reinwand, D.; Grohe, A.; Hartmann, P.; Preu, R.; Trassl, R.; Wieder, S.

    2009-01-01

    In this paper we present first results concerning different thermal evaporation processes for thin aluminum layers, which are carried out on a pilot system with a throughput of up to 540 wafers/h (156x156 mm2). To qualify the processes the deposited aluminum layers were evaluated with respect to homogeneity and conductivity. Additionally the effect of the different processes on the passivation quality of a thermally grown 100 nm thick SiO 2 was analyzed by means of lifetime measurements, indi...

  16. Software Design Document PVD CSCI (3). Volume 2, Appendices

    Science.gov (United States)

    1991-06-01

    FUNCTION: Igeneric -type(Type, Overline) called~y: show Ioverline in overlineif.c, (null) boundary-action in ovline-func.c, (null) Ideparture-action in...2.8.2.2-22 Ideparture-action 2.8.2.2-28 ldeparturejabel 2.8.2.2-27 idone__create_action 2.8.2.2-39 igeneric -size 2.8.2.2-17 lgeneric-type, 2.8.2.2-24

  17. Tribological Properties of PVD Ti/C-N Nanocoatnigs

    Science.gov (United States)

    Leitans, A.; Lungevics, J.; Rudzitis, J.; Filipovs, A.

    2017-04-01

    The present paper discusses and analyses tribological properties of various coatings that increase surface wear resistance. Four Ti/C-N nanocoatings with different coating deposition settings are analysed. Tribological and metrological tests on the samples are performed: 2D and 3D parameters of the surface roughness are measured with modern profilometer, and friction coefficient is measured with CSM Instruments equipment. Roughness parameters Ra, Sa, Sz, Str, Sds, Vmp, Vmc and friction coefficient at 6N load are determined during the experiment. The examined samples have many pores, which is the main reason for relatively large values of roughness parameter. A slight wear is identified in all four samples as well; its friction coefficient values range from 0,.21 to 0.29. Wear rate values are not calculated for the investigated coatings, as no expressed tribotracks are detected on the coating surface.

  18. Investigation of PVdF active diaphragms for synthetic jets

    Science.gov (United States)

    Bailo, Kelly C.; Brei, Diann E.; Calkins, Frederick T.

    2000-06-01

    Current research has shown that aircraft can gain significant aerodynamic performance benefits by employing active flow control (AFC). One of the enabling technologies of AFC is the synthetic jet. Synthetic jets, also known as zero-net-mass flux actuators, act as bi-directional pumps injecting high momentum air into the local aerodynamic flow. Previous work has concentrated on high frequency synthetic jets based on piezoelectric active diaphragms such as Thunder actuators. Low frequency synthetic jets present a unique challenge requiring large displacements, which current technology has difficulty meeting. Boeing is investigating novel shaped low frequency synthetic jets that can modify the flow over fixed aircraft wings. This paper present the initial study of two promising active diaphragm concepts: a crescent shape and an opposing bender shape. These active diaphragms were numerically modeled utilizing the general-purpose finite element code ABAQUS. Using the ABAQUS results, the dynamic volume change within each jet was calculated and incorporated into an analytical linear Bernoulli model to predict the velocities and pressures at the nozzle. Simulations were performed to determine trends to assist in selection of prototype configurations. Prototypes of both diaphragm concepts were constructed from polyvinylidene fluoride and experimentally tested at Boeing with promising results.

  19. Structure and characteristics of EB-PVD thermal insulation layers; Struktur und Eigenschaften von EB-PVD-Waermedaemmschichten

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, U. [Deutsche Forschungsanstalt fuer Luft- und Raumfahrt e.V. (DLR), Koeln (Germany). Inst. fuer Werkstoff-Forschung

    1996-12-31

    Thermal insulation layers for guide blades and rotor blades in the first two stages of a high-pressure turbines are produced by electron-beam physical vapour deposition for maximum quality. The layers have a lifetime that is longer by a factor of 2 to 10 than for plasma-sprayed layers. The following characteristics of the ceramic layer have a decisive influence on the life of the composite system: Phase composition, distribution and stability, microstructure, density, thickness, crack distribution and cohesive strength. Some selected aspects of the interdependence between production parameters, microstructure of the thermal insulation layer and service life are gone into. [Deutsch] Zur Herstellung von Waermedaemmschichten (WDS) fuer Turbinenleit- und Laufschaufeln der ersten beiden Stufen in der Hochdruckturbine wird fuer hoechste Ansprueche an die Schichtqualitaet das EB-PDV-Verfahren (electron-beam physical vapour deposition) eingesetzt. Die Lebensdauer dieser Schichten ist um den Faktor 2 bis 10 besser als beim Plasmaspritzen. Bei der keramischen Waermedaemmschicht selbst beeinflussen folgende Eigenschaften die Lebensdauer des Gesamtschichtsystems nachhaltig: Phasenzusammensetzung, -verteilung und -stabilitaet, Mikrogefuege, Dichte, Dicke, Rissverteilung und kohaesive Festigkeit. Auf einige ausgewaehlt Aspekte des Zusammenhangs zwischen Herstellungsparametern, Mikrostruktur der Waermedaemmschicht und Lebensdauer wird kurz eingegangen. (orig.)

  20. Data of evolutionary structure change: 1PVDA-2NXWB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2NXWB 1PVD 2NXW A B SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...STLGVAAVTYGAGAFNMVNAVAGAYAEKSPVVVISGAPGTTEL------LDTQFQVFKEITVAQARLDDPAKAPAEIARVLGAARAQSRPVYLEIPRNMVNAEVEP--VGDDPA---WPVD...0 1PVD A 1PVDA ...CA 231 1PVD A 1PVD...> 1 1PVD A 1PVD

  1. Data of evolutionary structure change: 1PVDB-2VBIG [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDB-2VBIG 1PVD 2VBI B G SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG...HHHHHHHHHH 0 1PVD B 1PVDB SFNDN-SKIRM 1PVD B 1PVDB 1PVD B 1PVD

  2. Antioxidant Enzymes Activity in Patients with Peripheral Vascular Disease, with and without Presence of Diabetes Mellitus

    OpenAIRE

    Jandrić-Balen, Marica; Božikov, Veljko; Bistrović, Dragica; Jandrić, Ivan; Božikov, Jadranka; Romić, Željo; Balen, Ivan

    2003-01-01

    The study evaluated antioxidant status in patients with peripheral vascular disease (PVD), with and without concomitant diabetes mellitus (DM). 211 participants were divided into standardized 4 groups: patients with PVD and DM (PVD+DM+), patients with PVD without DM (PVD+DM-), patients without PVD with DM (PVD-DM+) and patients without PVD and DM (PVD-DM-). The diagnosis of PVD was established by Doppler sonography analysis, including determination of the ankle brachial index (...

  3. HTS 63_4_ VANZYL FJ v Z _PvdM

    African Journals Online (AJOL)

    p1243322

    such suffering indicates the enormous guilt and existence of every sinner. .... made God self known as the God who forgives us our sins, a decision was taken on two .... condition of sin emanating from it affects the whole human being, without.

  4. Thermal cycling behavior of EB-PVD TBCs on CVD platinum modified aluminide coatings

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Zhenhua, E-mail: zhxubiam@aliyun.com; Wang, Zhankao; Huang, Guanghong; Mu, Rende; He, Limin

    2015-07-15

    Highlights: • The removed ridges at the grain boundaries with grit blasting. • The ridge, oxidation and cracking are features of damage initiation in TBCs. • Spalled location either at TGO/bond coat interface or inside of TGO layer. • The lower strain energy release rate within TGO layer can prolong of TBCs life. - Abstract: Thermal barrier coating systems (TBCs) including of chemical vapor deposited (Ni, Pt)Al bond coat with grit blasting process and electron beam physical vapor deposited Y{sub 2}O{sub 3}-stabilized-ZrO{sub 2} (YSZ) ceramic coating were investigated. The phase structures, surface and cross-sectional morphologies, cyclic oxidation behaviors and residual stresses of the TBCs were studied in detail. It was found that the fracture path traverses through the ceramic coating to TGO interface, as well as at the TGO to bond coat interface is obviously detected. The change in fracture plane occurs at grain boundaries. The ridge top spallation leads to separate of sufficient size to result in unstable fracture driven by the strain energy stored in the TGO. The bond coat can undergo a volume increase upon oxidation, so that a cavity, enlarged strictly by oxidation would be full to overflowing with TGO layer. The spalled location of the TBCs probably occurs either at the interface of TGO layer and bond coat or inside of TGO layer. The lower strain energy release rate within TGO layer during thermal cycling is beneficial to prolong of TBCs life. The lower is the compressive stress within TGO layer, the longer is the lifetime of TBCs.

  5. Development of tantalum oxynitride thin films produced by PVD: Study of structural stability

    Energy Technology Data Exchange (ETDEWEB)

    Cristea, D. [Centro de Física, Universidade do Minho, Campus de Gualtar, 4710-057 Braga (Portugal); Department of Materials Science, Transylvania University, 500036 Brasov (Romania); Crisan, A. [Department of Materials Science, Transylvania University, 500036 Brasov (Romania); Barradas, N.P.; Alves, E. [Instituto Superior Técnico, Universidade Técnica de Lisboa Estrada Nacional 10, ao km 139,7 2695-066, Bobadela LRS (Portugal); Moura, C.; Vaz, F. [Centro de Física, Universidade do Minho, Campus de Gualtar, 4710-057 Braga (Portugal); Cunha, L., E-mail: lcunha@fisica.uminho.pt [Centro de Física, Universidade do Minho, Campus de Gualtar, 4710-057 Braga (Portugal)

    2013-11-15

    The purpose of this work is to study the evolution of the structure and of the thermal stability of a group of tantalum oxynitride thin films, prepared by magnetron sputtering, under the influence of vacuum annealing, up to a temperature of 800 °C. When varying the partial pressure of the reactive gases (P{sub O{sub 2+N{sub 2}}}), during the deposition process, the films change from a structure with a combination of poorly developed crystallites of the tetragonal β-Ta and of the face centred cubic (fcc) Ta(O,N) phases, for the films deposited with low P{sub O2+N2}, to a quasi-amorphous structure, for the films deposited with highest pressures. For intermediate pressures, the films reveal the presence of the fcc-Ta(O,N) structure. This structure corresponds to O atoms substituting some of the N atoms on the fcc-TaN structure and/or N atoms substituting O atoms of the fcc-γ-TaO structure. When subjected to the thermal annealing at 700 °C or higher, the film produced with lowest partial pressure revealed a remarkable structural change. New diffraction peaks appear and can only be attributed to a sub-stoichiometric hexagonal tantalum nitride structure. The film did not reveal any signs of delamination or cracks after all annealing temperatures. The two films produced with highest partial pressure proved to be the most stable. Structurally, they maintain the amorphous structure after all the annealing treatments and, in addition, no cracks or delamination were detected.

  6. Monitoring of PVD, PECVD and etching plasmas using Fourier components of RF voltage

    International Nuclear Information System (INIS)

    Dvorak, P; Vasina, P; Bursikova, V; Zemlicka, R

    2010-01-01

    Fourier components of discharge voltages were measured in two different reactive plasmas and their response to the creation or destruction of a thin film was studied. In reactive magnetron sputtering the effect of transition from the metallic to the compound mode accompanied by the creation of a compound film on the sputtered target was observed. Further, deposition and etching of a diamond-like carbon film and their effects on amplitudes of Fourier components of the discharge voltage were studied. It was shown that the Fourier components, including higher harmonic frequencies, sensitively react to the presence of a film. Therefore, they can be used as a powerful tool for the monitoring of deposition and etching processes. It was demonstrated that the behaviour of the Fourier components was caused in both experiments by the presence of the film. It was not caused by changes in the chemical composition of the gas phase induced by material etched from the film or decrease in gettering rate. Further, the observed behaviour was not affected by the film conductivity. The behaviour of the Fourier components can be explained by the difference between the coefficients of secondary electron emission of the film and its underlying material.

  7. Microstructure and properties of TiAlSiN coatings prepared by hybrid PVD technology

    International Nuclear Information System (INIS)

    Yu Donghai; Wang Chengyong; Cheng Xiaoling; Zhang Fenglin

    2009-01-01

    TiAlSiN coatings with different Si content were prepared by hollow cathode discharge (HCD) and mid-frequency magnetron sputtering (MFMS) hybrid coating deposition technology. The chemical composition, microstructure, mechanical properties of these coatings were systematically investigated by means of energy dispersive spectrometry (EDS), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), nanoindentation measurement, scratch and high speed milling hardened steel tests. The coatings prepared by this method showed the structure of crystalline phase was corresponding to that of TiAlN, however, different preferred orientation with addition of Si. Proper content of Si into TiAlN led to increase of microhardness and adhesion. TiAlSiN coated end mill with Si content of 4.78 at.% had the least flank wear, which was improved about 20% milling distance than TiAlN coated end mill.

  8. Microstructure and properties of TiAlSiN coatings prepared by hybrid PVD technology

    Energy Technology Data Exchange (ETDEWEB)

    Yu Donghai [Faculty of Electromechanical Engineering, Guangdong University of Technology, Guangzhou 510006 (China); Wang Chengyong, E-mail: cywang@gdut.edu.c [Faculty of Electromechanical Engineering, Guangdong University of Technology, Guangzhou 510006 (China); Cheng Xiaoling; Zhang Fenglin [Faculty of Electromechanical Engineering, Guangdong University of Technology, Guangzhou 510006 (China)

    2009-07-01

    TiAlSiN coatings with different Si content were prepared by hollow cathode discharge (HCD) and mid-frequency magnetron sputtering (MFMS) hybrid coating deposition technology. The chemical composition, microstructure, mechanical properties of these coatings were systematically investigated by means of energy dispersive spectrometry (EDS), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), nanoindentation measurement, scratch and high speed milling hardened steel tests. The coatings prepared by this method showed the structure of crystalline phase was corresponding to that of TiAlN, however, different preferred orientation with addition of Si. Proper content of Si into TiAlN led to increase of microhardness and adhesion. TiAlSiN coated end mill with Si content of 4.78 at.% had the least flank wear, which was improved about 20% milling distance than TiAlN coated end mill.

  9. Development of nanostructured PVD coatings for total knee replacement joints using HIPIMS

    Science.gov (United States)

    Sugumaran, Arunprabhu A.

    The aim of this study was to develop thin film coatings for total knee replacement joints using high power impulse magnetron sputtering (HIPIMS). An industrial size four cathode magnetron sputtering system equipped with direct current (DC) and HIPIMS power supplies was used for this purpose. Initially, Plasma diagnostics were carried out using optical emission spectroscopy (OES) while sputtering Ti target in Ar + N2 atmosphere by utilizing various HIP IMS/conventional DCMS (henceforth UBM) source combinations by varying the process parameters such as coil current and N2 flow. Then, single layer titanium nitride (TiN) coating was deposited by varying the degree of HIPIMS utilisation and the process parameters such as bias voltage and coil current to thoroughly understand the effect of degree of HIPIMS utilisation on the microstructure, residual stress, texture, mechanical, tribological and corrosion properties of such coatings. The degree of HIPIMS utilisation was altered by increasing the number of HIPIMS targets used for the deposition. Four different source combinations were used for this purpose, as follows: 4 cathodes in conventional DCMS mode to deposit pure UBM coating, 1 HIPIMS + 3UBM and 2HIPIMS + 2UBM cathodes to deposit combined HIPIMS/UBM coatings and 2HIPIMS cathodes to deposit pure HIPIMS coatings. TiN/NbN, TiCN/NbCN and CrN/NbN multilayer coatings were deposited on CoCr alloy test buttons along with other (HSS, SS and Si) substrates since our intended application is on total knee replacement joints made of CoCr alloy. The knowledge gained by investigating the TiN (Ar + N[2]) plasma and the properties of TiN was used to determine the process parameters for depositing the multilayer coatings. X- ray diffraction (XRD) technique was used for calculating the texture, residual stress and bilayer thickness of the coatings. Nanoindentation method was used to determine the nano hardness of the coatings. The adhesion strength of the coatings was estimated by scratch and Rockwell indentation tests. Pin on disc method was used for the tribological studies such as coefficient of friction and coefficient of wear. Surface roughness measurements were carried out using a surface profiler. Microstructural characterisation of the coatings was carried out using scanning electron microscope (SEM) and transmission electron microscope (TEM). Potentiodynamic polarisation method was utilised to study the corrosion performance of the coatings. Raman spectroscopy was used to study the constituents of the corrosion products and evaluate the corrosion damage. OES measurements revealed that the degree of metal ions (Ti[1+]) increased with increasing degree of HIPIMS utilisation. The hardness, tribological and corrosion properties of TiN coatings improved with increasing degree of HIPIMS utilisation. TiN and multilayer coatings deposited by HIPIMS exhibited a smooth columnar microstructure without any voided region along the column boundaries. TiN/NbN, TiCN/NbCN and CrN/NbN multilayer coatings deposited on CoCr alloy, HSS and SS test buttons exhibited superior mechanical, tribological and corrosion properties as compared to the underlying substrate.

  10. High-quality PVD graphene growth by fullerene decomposition on Cu foils

    Czech Academy of Sciences Publication Activity Database

    Azpeitia, J.; Otero-Irurueta, G.; Palacio, I.; Martinez, J. I.; Ruiz del Arbol, N.; Santoro, G.; Gutiérrez, A.; Aballe, L.; Foerster, M.; Kalbáč, Martin; Valeš, Václav; Mompean, F. J.; Garcia-Hernandez, M.; Martín-Gago, J.A.; Munuera, C.; Lopez, M. F.

    2017-01-01

    Roč. 119, AUG 2017 (2017), s. 535-543 ISSN 0008-6223 R&D Projects: GA MŠk LL1301 EU Projects: European Commission(XE) 696656 - GrapheneCore1 Institutional support: RVO:61388955 Keywords : functional perturbation- theory * epitaxial graphene * copper substrate * pt(111) surface * raman-spectrum * cvd-graphene Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.337, year: 2016

  11. Mathematical analysis of the Photovoltage Decay (PVD) method for minority carrier lifetime measurements

    Science.gov (United States)

    Vonroos, O. H.

    1982-01-01

    When the diffusion length of minority carriers becomes comparable with or larger than the thickness of a p-n junction solar cell, the characteristic decay of the photon-generated voltage results from a mixture of contributions with different time constants. The minority carrier recombination lifetime tau and the time constant l(2)/D, where l is essentially the thickness of the cell and D the minority carrier diffusion length, determine the signal as a function of time. It is shown that for ordinary solar cells (n(+)-p junctions), particularly when the diffusion length L of the minority carriers is larger than the cell thickness l, the excess carrier density decays according to exp (-t/tau-pi(2)Dt/4l(2)), tau being the lifetime. Therefore, tau can be readily determined by the photovoltage decay method once D and L are known.

  12. Magnesium substituted hydroxyapatite formation on (Ti,Mg)N coatings produced by cathodic arc PVD technique

    International Nuclear Information System (INIS)

    Onder, Sakip; Kok, Fatma Nese; Kazmanli, Kursat; Urgen, Mustafa

    2013-01-01

    In this study, formation of magnesium substituted hydroxyapatite (Ca 10−x Mg x (PO 4 ) 6 (OH) 2 ) on (Ti,Mg)N and TiN coating surfaces were investigated. The (Ti 1−x ,Mg x )N (x = 0.064) coatings were deposited on titanium substrates by using cathodic arc physical vapor deposition technique. TiN coated grade 2 titanium substrates were used as reference to understand the role of magnesium on hydroxyapatite (HA) formation. The HA formation experiments was carried out in simulated body fluids (SBF) with three different concentrations (1X SBF, 5X SBF and 5X SBF without magnesium ions) at 37 °C. The coatings and hydroxyapatite films formed were characterized by scanning electron microscope (SEM), X-ray diffraction (XRD) and FTIR Spectroscopy techniques. The energy dispersive X-ray spectroscopy (EDS) analyses and XRD investigations of the coatings indicated that magnesium was incorporated in the TiN structure rather than forming a separate phase. The comparison between the TiN and (Ti, Mg)N coatings showed that the presence of magnesium in TiN structure facilitated magnesium substituted HA formation on the surface. The (Ti,Mg)N coatings can potentially be used to accelerate the HA formation in vivo conditions without any prior hydroxyapatite coating procedure. - Highlights: • Mg incorporated in (Ti,Mg)N coating structure and did not form a separate phase • Mg dissolution in SBF solution facilitated Mg-substituted hydroxyapatite formation • (Ti,Mg)N acted as Mg-source for Mg-substituted hydroxyapatite formation in SBF

  13. Studies on electrical conductivity and dielectric behaviour of PVdF ...

    Indian Academy of Sciences (India)

    35, No. 6, November 2012, pp. 969–975. c Indian Academy of Sciences. ... methacrylate) and 1·0 M NaI as salt have been synthesized using solution caste technique by varying the ... polymer electrolytes systems and composite polymer elec-.

  14. The morphology and structure of PVD ZrN-Cu thin films

    International Nuclear Information System (INIS)

    Audronis, M; Jimenez, O; Leyland, A; Matthews, A

    2009-01-01

    ZrN-Cu thin films containing variable amounts of copper, namely 8, 33 and 58 at%, were produced by reactive pulsed unbalanced magnetron sputtering. Coatings were found to possess hardness values of 22.5 GPa, 9.5 GPa and 3.7 GPa, respectively. The morphology of coatings was investigated by field emission gun scanning electron microscopy and the structure (microstructure and nanostructure) was investigated by conventional (bright-field and dark-field imaging) and high-resolution transmission electron microscopy. Complementary x-ray diffraction experiments were also performed. ZrN coatings containing 8 at% of copper were found to possess a nano-columnar structure composed of ZrN columnar grains, the diameter of which was approximately 15-35 nm. The majority of the copper content was apparently dissolved within the ZrN grains, rather than existing as a separate phase. Coatings of the two other compositions were found to be composed of a mixture of mostly equiaxed ZrN and Cu nano-crystalline grains, the diameters of which were in the approximate range 5-25 nm. None of the coatings investigated in this study were found to possess the so-called 'nanocomposite' structure, which is often envisaged as crystalline nano-grains surrounded by a thin amorphous intergranular phase. Instead, coatings were found to be either single-phase ZrN (with Cu in substitutional solid solution for Zr) or a mixture of ZrN and Cu nano-grains.

  15. Corrosion protection of PVD and paint coatings for selective solar absorber surfaces

    OpenAIRE

    Nunes, A.; Carvalho, M. J.; Diamantino, Teresa C.; Fernandes, J. C. S.

    2015-01-01

    The selective solar absorber surface is a fundamental part of a solar thermal collector, as it is responsible for the solar radiation absorption and for reduction of radiation heat losses. The surface’s optical properties, the solar absorption (á) and the emittance (å), have great impact on the solar thermal collector efficiency. In this work, two coatings types were studied: coatings obtained by physical vapor deposition (PVDs) and coatings obtained by projection with different paints (PCs) ...

  16. High-quality PVD graphene growth by fullerene decomposition on Cu foils

    Czech Academy of Sciences Publication Activity Database

    Azpeitia, J.; Otero-Irurueta, G.; Palacio, I.; Martinez, J. I.; Ruiz del Arbol, N.; Santoro, G.; Gutiérrez, A.; Aballe, L.; Foerster, M.; Kalbáč, Martin; Valeš, Václav; Mompean, F. J.; Garcia-Hernandez, M.; Martín-Gago, J.A.; Munuera, C.; Lopez, M. F.

    2017-01-01

    Roč. 119, AUG 2017 (2017), s. 535-543 ISSN 0008-6223 R&D Projects: GA MŠk LL1301 EU Projects: European Commission(XE) 696656 - GrapheneCore1 Institutional support: RVO:61388955 Keywords : functional perturbation-theory * epitaxial graphene * copper substrate * pt(111) surface * raman-spectrum * cvd-graphene Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.337, year: 2016

  17. Characteristics of PVdF copolymer/Nafion blend membrane for direct methanol fuel cell (DMFC)

    International Nuclear Information System (INIS)

    Cho, Ki-Yun; Eom, Ji-Yong; Jung, Ho-Young; Choi, Nam-Soon; Lee, Yong Min; Park, Jung-Ki; Choi, Jong-Ho; Park, Kyung-Won; Sung, Yung-Eun

    2004-01-01

    For direct methanol fuel cell, blends of vinylidene fluoride-hexafluoropropylene copolymer (P(VdF-co-HFP)) and Nafion were prepared the different equivalent weight of Nafion. The investigations of the blend morphology were performed by means of permeability test, uptake measurement, differential-scanning calorimetry (DSC), and scanning electron microscopy. In the blend membranes, many pores were created as the content of Nafion in blend increased. Then, the methanol uptake was sharply increased. But the methanol permeability was not sharply increased because the methanol permeation through blend membranes is diffusion-controlled process. The methanol permeability of N10 (low equivalent weight) series was similar to that of N11 series (high equivalent weight). The proton conductivity of N10 series was around one and a half times higher than that of N11 series. The cell performance of the blend was much enhanced when the equivalent weight of Nafion was 1000

  18. Hemocompatibility of Inorganic Physical Vapor Deposition (PVD Coatings on Thermoplastic Polyurethane Polymers

    Directory of Open Access Journals (Sweden)

    Daniel Heim

    2012-04-01

    Full Text Available Biocompatibility improvements for blood contacting materials are of increasing interest for implanted devices and interventional tools. The current study focuses on inorganic (titanium, titanium nitride, titanium oxide as well as diamond-like carbon (DLC coating materials on polymer surfaces (thermoplastic polyurethane, deposited by magnetron sputtering und pulsed laser deposition at room temperature. DLC was used pure (a-C:H as well as doped with silicon, titanium, and nitrogen + titanium (a-C:H:Si, a-C:H:Ti, a-C:H:N:Ti. In-vitro testing of the hemocompatibility requires mandatory dynamic test conditions to simulate in-vivo conditions, e.g., realized by a cone-and-plate analyzer. In such tests, titanium- and nitrogen-doped DLC and titanium nitride were found to be optimally anti-thrombotic and better than state-of-the-art polyurethane polymers. This is mainly due to the low tendency to platelet microparticle formation, a high content of remaining platelets in the whole blood after testing and low concentration of platelet activation and aggregation markers. Comparing this result to shear-flow induced cell motility tests with e.g., Dictostelium discoideum cell model organism reveals similar tendencies for the investigated materials.

  19. PVD of copper sulfide (Cu2S) for PIN-structured solar cells

    International Nuclear Information System (INIS)

    Siol, Sebastian; Brötz, Joachim; Klein, Andreas; Jaegermann, Wolfram; Sträter, Hendrik; Brüggemann, Rudolf; Bauer, Gottfried H

    2013-01-01

    Thin layers of chalcocite (Cu 2 S) have been deposited via physical vapour deposition using various pre- and post-treatment parameters. The electrical and morphological properties have been investigated by in situ XPS, SEM and XRD measurements. Calibrated photoluminescence experiments were performed to investigate the material's suitability as an absorber layer in thin-film solar cells. Measurements of annealed Cu 2 S layers on glass without any surface passivation showed an optical band gap of 1.25 eV as well as a splitting of the quasi-Fermi levels of 710 meV. This value exceeds the highest reported open-circuit voltage for Cu 2 S-based devices so far, which leads to the assumption that Cu 2 S has not been brought to its full potential yet. The band alignments for ZnO/Cu 2 S as well as Cu 2 S/Cu 2 O interfaces have been determined using in situ XPS interface experiments to suggest a novel device structure according to the favourable PIN-layout. First devices have been built, but show no efficiency due to shunting caused by the inferior morphology of the absorber layers. (paper)

  20. Microstructure, composition and performance of PVD coatings designed for successful dry high speed milling

    International Nuclear Information System (INIS)

    Muenz, W.-D.; Lembke, M.I.; Lewis, D.B.; Smith, I.J.

    2001-01-01

    Dry high speed machining (HSM), particularly dry high speed milling, demands hard coatings, which exhibit high toughness, high oxidation resistance, a limited amount of residual stress and excellent adhesion to the cemented carbide (CC) substrate. These requirements are met by TiAICrYN coatings grown by the combined cathodic arc/unbalanced magnetron deposition method. Fully sufficient adhesion is achieved by ion implantation of Cr into the CC prior deposition. Residual stress is controlled by an Y - free base layer; high oxidation resistance is provided by an Y - containing 3 μm thick hard coating with 29 GPa hardness and a residual stress well below -7 GPa. Under the influence of temperatures above 800 o C, Y segregates along the columns of TiAIN and plugs the in/out diffusion of elements. A top layer of Y - containing oxynitride reduces the friction against the work piece material (0.9 to 0.65). Cutting tools coated as such may be used for dry milling up to 25 k rpm in steels HRC > 60. (author)

  1. Phase controlled synthesis and cathodoluminescence properties of ZnS nanobelts synthesized by PVD

    Science.gov (United States)

    Jin, Changqing; Zhu, Kexin; Peterson, George; Zhang, Zhihong; Jian, Zengyun; Wei, Yongxing; Zheng, Deshan

    2018-01-01

    Zinc sulfide (ZnS) nanobelts were synthesized via physical vapor deposition to explore the electronic properties of optoelectronic nano-devices. It was determined that the mass ratio of wurtzite (WZ) phase to zincblende (ZB) phase and the preferential orientation (100) are related to the carrier-gas flow rate. The high concentration of planar defects within the phase boundary enhances phase transition. Cathodoluminescence measurements show a red shift of the 337 nm band-gap emission due to stacking and twin faults. We find a direct correlation between the magnitude of the red shift and the mass ratio of ZB phase. With an increase in the ZB phase, there is an increase in the concentration of stacking and twin faults introduced by the phase transformation, as indicated by an increasing red shift in the data. The absorption peaks at 666 and 719 nm were found by UV-vis absorption spectrum, which is attributed to surface defects. This work would help to better understand the important roles of planar defects in the phase transition and also provide us with a feasible route to control phase ratio and cathodoluminescence properties of ZnS nanobelts and other II-VI semiconductor nanostructures.

  2. Magnesium substituted hydroxyapatite formation on (Ti,Mg)N coatings produced by cathodic arc PVD technique.

    Science.gov (United States)

    Onder, Sakip; Kok, Fatma Nese; Kazmanli, Kursat; Urgen, Mustafa

    2013-10-01

    In this study, formation of magnesium substituted hydroxyapatite (Ca10-xMgx(PO4)6(OH)2) on (Ti,Mg)N and TiN coating surfaces were investigated. The (Ti1-x,Mgx)N (x=0.064) coatings were deposited on titanium substrates by using cathodic arc physical vapor deposition technique. TiN coated grade 2 titanium substrates were used as reference to understand the role of magnesium on hydroxyapatite (HA) formation. The HA formation experiments was carried out in simulated body fluids (SBF) with three different concentrations (1X SBF, 5X SBF and 5X SBF without magnesium ions) at 37 °C. The coatings and hydroxyapatite films formed were characterized by scanning electron microscope (SEM), X-ray diffraction (XRD) and FTIR Spectroscopy techniques. The energy dispersive X-ray spectroscopy (EDS) analyses and XRD investigations of the coatings indicated that magnesium was incorporated in the TiN structure rather than forming a separate phase. The comparison between the TiN and (Ti, Mg)N coatings showed that the presence of magnesium in TiN structure facilitated magnesium substituted HA formation on the surface. The (Ti,Mg)N coatings can potentially be used to accelerate the HA formation in vivo conditions without any prior hydroxyapatite coating procedure. © 2013.

  3. Investigation of vanadium and nitride alloys thin layers deposited by PVD

    Directory of Open Access Journals (Sweden)

    Nouveau C.

    2012-06-01

    Full Text Available In this work we present the technique of magnetron vapor deposition and the effect of several deposition parameters on the structural and morphological properties of prepared thin films. It was noted that the deposition time has an effect on the crystallinity, mechanical properties such as residual stress, roughness surface and the layer composition from target products. Studies were carried out on layers of vanadium (V and the nitride vanadium (VN.

  4. RBS and XPS study of TiOx layers prepared by the PVD technique .

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Peřina, Vratislav; Krumeich, J.; Zemek, J.; Kolouch, A.

    2004-01-01

    Roč. 36, č. 8 (2004), s. 1171-1173 ISSN 0142-2421 R&D Projects: GA ČR GP102/01/D069 Institutional research plan: CEZ:AV0Z1048901 Keywords : RBS * ERDA * TiOx Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.209, year: 2004

  5. Hemocompatibility of Inorganic Physical Vapor Deposition (PVD) Coatings on Thermoplastic Polyurethane Polymers.

    Science.gov (United States)

    Lackner, Juergen M; Waldhauser, Wolfgang; Hartmann, Paul; Bruckert, Franz; Weidenhaupt, Marianne; Major, Roman; Sanak, Marek; Wiesinger, Martin; Heim, Daniel

    2012-04-17

    Biocompatibility improvements for blood contacting materials are of increasing interest for implanted devices and interventional tools. The current study focuses on inorganic (titanium, titanium nitride, titanium oxide) as well as diamond-like carbon (DLC) coating materials on polymer surfaces (thermoplastic polyurethane), deposited by magnetron sputtering und pulsed laser deposition at room temperature. DLC was used pure (a-C:H) as well as doped with silicon, titanium, and nitrogen + titanium (a-C:H:Si, a-C:H:Ti, a-C:H:N:Ti). In-vitro testing of the hemocompatibility requires mandatory dynamic test conditions to simulate in-vivo conditions, e.g., realized by a cone-and-plate analyzer. In such tests, titanium- and nitrogen-doped DLC and titanium nitride were found to be optimally anti-thrombotic and better than state-of-the-art polyurethane polymers. This is mainly due to the low tendency to platelet microparticle formation, a high content of remaining platelets in the whole blood after testing and low concentration of platelet activation and aggregation markers. Comparing this result to shear-flow induced cell motility tests with e.g., Dictostelium discoideum cell model organism reveals similar tendencies for the investigated materials.

  6. High-quality PVD graphene growth by fullerene decomposition on Cu foils.

    Science.gov (United States)

    Azpeitia, J; Otero-Irurueta, G; Palacio, I; Martinez, J I; Del Árbol, N Ruiz; Santoro, G; Gutiérrez, A; Aballe, L; Foerster, M; Kalbac, M; Vales, V; Mompeán, F J; García-Hernández, M; Martín-Gago, J A; Munuera, C; López, M F

    2017-08-01

    We present a new protocol to grow large-area, high-quality single-layer graphene on Cu foils at relatively low temperatures. We use C 60 molecules evaporated in ultra high vacuum conditions as carbon source. This clean environment results in a strong reduction of oxygen-containing groups as depicted by X-ray photoelectron spectroscopy (XPS). Unzipping of C 60 is thermally promoted by annealing the substrate at 800ºC during evaporation. The graphene layer extends over areas larger than the Cu crystallite size, although it is changing its orientation with respect to the surface in the wrinkles and grain boundaries, producing a modulated ring in the low energy electron diffraction (LEED) pattern. This protocol is a self-limiting process leading exclusively to one single graphene layer. Raman spectroscopy confirms the high quality of the grown graphene. This layer exhibits an unperturbed Dirac-cone with a clear n-doping of 0.77 eV, which is caused by the interaction between graphene and substrate. Density functional theory (DFT) calculations show that this interaction can be induced by a coupling between graphene and substrate at specific points of the structure leading to a local sp 3 configuration, which also contribute to the D-band in the Raman spectra.

  7. Characterization of nano-composite PVD coatings for wear-resistant applications

    NARCIS (Netherlands)

    Galvan, D.; Pei, Y.T.; de Hosson, J.T.M.; DeHosson, JTM; Brebbia, CA; Nishida, SI

    2005-01-01

    Various methodologies for the characterization of nano-composite coatings are discussed, which consist TiC nano-particles distributed in an amorphous hydrocarbon (a-C:H) matrix. Complications that arise from the influence of coating roughness and underlying substrate on the properties are evaluated

  8. Evaluation of Antibacterial Activity of Titanium Surface Modified by PVD/PACVD Process.

    Science.gov (United States)

    Ji, Min-Kyung; Lee, Min-Joo; Park, Sang-Won; Lee, Kwangmin; Yun, Kwi-Dug; Kim, Hyun-Seung; Oh, Gye-Jeong; Kim, Ji-Hyun; Lim, Hyun-Pil

    2016-02-01

    The aim of this study was to evaluate the response of Streptococcus mutans (S. mutans) via crystal violet staining assay on titanium surface modified by physical vapor deposition/plasma assisted chemical vapor deposition process. Specimens were divided into the following three groups: polished titanium (control group), titanium modified by DC magnetron sputtering (group TiN-Ti), and titanium modified by plasma nitriding (group N-Ti). Surface characteristics of specimens were observed by using nanosurface 3D optical profiler and field emission scanning electron microscope. Group TiN-Ti showed TiN layer of 1.2 microm in thickness. Group N-Ti was identified as plasma nitriding with X-ray photoelectron spectroscopy. Roughness average (Ra) of all specimens had values 0.05). Within the process condition of this study, modified titanium surfaces by DC magnetron sputtering and plasma nitriding did not influence the adhesion of S. mutans.

  9. Metal nitride coatings by physical vapor deposition (PVD) for a wear resistant aluminum extrusion die.

    Science.gov (United States)

    Lee, Su Young; Kim, Sang Ho

    2014-12-01

    The purpose of this study is to investigate the friction and wear behaviors of CrN, TiN, CrAlN, and TiAIN coated onto SKD61 for application to Al 7000 series extrusion dies. On the wear test, the experimental parameters are the load and the counter material's temperature. The results showed that the friction coefficient increased with load but decreased with the counter material's temperature, and the friction coefficients of CrN and CrAIN were lower than the friction coefficients of TiAIN and TIN, especially at a higher temperature. The wear track with different coatings identified different wear behaviors; the wear behavior of CrAIN was found to be abrasive, but the wear behavior of TiN, CrN, and TiAIN was adhesive. Therefore, CrAIN showed the least wear loss with a lower friction coefficient and less adhesion with counter materials at the highest range of wear load and temperature. This resulted in the easy formation of aluminum oxide in the wear track and less Al adhesion; moreover during the hard second phase, AIN dispersed in the film during deposition.

  10. Kajian Aus Pahat pada pembubutan Baja Aisi 4340 Menggunakan Pahat Karbida PVD Berlapis

    OpenAIRE

    Carnegie, Dale

    2017-01-01

    120401084 Pada industri pemotongan logam, cairan pendingin banyak digunakan untuk memperoleh umur pahat yang lebih lama, tetapi cairan pendingin yang digunakan pada proses pemotongan logam mempunyai beberapa dampak negatif bagi kesehatan dan lingkungan. Oleh karena itu dilakukan permesinan kering pada penelitian ini untuk membuat proses pemotongan logam yang bersih dan aman terhadap lingkungan. Proses pembubutan dilakukan juga dengan permesinan keras untuk membubut material baja AISI 4340 ...

  11. Plasma analysis of different TiN PVD processes at various process parameters

    International Nuclear Information System (INIS)

    Strauss, G.N.; Schlichtherle, S.; Pulker, H.K.; Meyer, M.; Jehn, H.; Balzer, M.; Misiano, C.; Silipo, V.

    2002-01-01

    TiN coatings of some microns in thickness were deposited by different reactive plasma deposition technologies (Magnetron Sputtering Magnetically Assisted, Arc Source Ion Plating, Sputter Ion Plating Plasma Assisted) on various metal parts. The experiments were carried out in specially designed plants under variable vacuum and plasma conditions. The plasma properties of the different processes were investigated by mass spectrometry and the energy distribution of process relevant particles was additionally determined. The aim of this work was to find proper processes and conditions for a reliable low cost deposition of hard coatings at relatively high gas pressures. It was found that the magnetically forced and medium frequency pulsed biased dc magnetron sputter deposition variants, operating in the 10 -3 mbar gas pressure range, showed a relatively large amount of single and double charged positive ions with kinetic energies up to 55 and 95 eV, as consequence of the applied modifications. Cathodic arc deposition, in the same gas pressure range of 10 - 3 mbar, showed a very high number of such ions with energies up to more than 100 eV, depending on the value of the applied arc current. However, at constant distance between source and substrate the higher gas pressure increases also the number of energy reducing collisions of the coating-material vapour-species with the gas molecules. The arc source process, even when performed at high gas pressures of about 10 -1 mbar, showed a remarkable amount of ions with energies up to 75 eV resulting in high performance TiN films of quite proper 3D homogeneity. The arc source technique is able to increase film thickness uniformity up to 3 times with respect to the traditional coatings if the samples are mounted in a way that they do not influence each other. (nevyjel)

  12. Domino Platform: PVD Coaters for Arc Evaporation and High Current Pulsed Magnetron Sputtering

    International Nuclear Information System (INIS)

    Vetter, J; Müller, J; Erkens, G

    2012-01-01

    AlTiN and CrN coatings were deposited in hybrid DOMINO platforms by magnetron sputtering (DC-MS, DC-MS+HCP-MS, HCP-MS) and vacuum arc evaporation. The ion cleaning was done by the AEGD process. The coating rates and the energy efficiency of both deposition processes were compared. The roughness effects of the different coating types were discussed. Preliminary results of the change of pulse characteristics during simultaneously running of HCP-MS plus vacuum arc evaporation are shown.

  13. Variations of posterior vitreous detachment

    OpenAIRE

    Kakehashi, A.; Kado, M.; Akiba, J.; Hirokawa, H.

    1997-01-01

    AIMS—To identify variations in posterior vitreous detachment (PVD) and establish a clinical classification system for PVD.
METHODS—400 consecutive eyes were examined using biomicroscopy and vitreous photography and classified the PVD variations—complete PVD with collapse, complete PVD without collapse, partial PVD with thickened posterior vitreous cortex (TPVC), or partial PVD without TPVC.
RESULTS—In each PVD type, the most frequently seen ocular pathologies were as follows: in complete PVD ...

  14. Data of evolutionary structure change: 1PVDB-2VBFA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDB-2VBFA 1PVD 2VBF B A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...ASYMADGYARTKKAAAFLTTFGVGELSAINGLAGSYAENLPVVEIVGSPTSKVQNDGKFVHHTLADGDFKHFMKMHEPVTAARTLLT-AENATYEIDRVLSQLLKERKPVYINLPVD...HHHHH 0 1PVD B 1PVDB KGYKP-VAVPA 1 1PVD B 1PVD

  15. Electrochemical investigation of surface area effects on PVD Al-Ni as electrocatalyst for alkaline water electrolysis

    DEFF Research Database (Denmark)

    Kjartansdóttir, Cecilía Kristín; Caspersen, Michael; Egelund, Sune Daaskov

    2014-01-01

    , additional 40mV are gained. For the OER, smaller roughness values were observed with the same activity trend as for the HER. The electrocatalyst are however found not to be stable in the anodic environment during electrolysis. The corrosion mechanism of a skeletal nickel electrocatalyst during the OER...

  16. Mechanical and Tribological Properties of PVD-Coated Cemented Carbide as Evaluated by a New Multipass Scratch-Testing Method

    Directory of Open Access Journals (Sweden)

    M. Fallqvist

    2012-01-01

    Full Text Available A new test method based on multipass scratch testing has been developed for evaluating the mechanical and tribological properties of thin, hard coatings. The proposed test method uses a pin-on-disc tribometer and during testing a Rockwell C diamond stylus is used as the “pin” and loaded against the rotating coated sample. The influence of normal load on the number of cycles to coating damage is investigated and the resulting coating damage mechanisms are evaluated by posttest scanning electron microscopy. The present study presents the test method by evaluating the performance of Ti0.86Si0.14N, Ti0.34Al0.66N, and (Al0.7Cr0.32O3 coatings deposited by cathodic arc evaporation on cemented carbide inserts. The results show that the test method is quick, simple, and reproducible and can preferably be used to obtain relevant data concerning the fatigue, wear, chipping, and spalling characteristics of different coating-substrate composites. The test method can be used as a virtually nondestructive test and, for example, be used to evaluate the fatigue and wear resistance as well as the cohesive and adhesive interfacial strength of coated cemented carbide inserts prior to cutting tests.

  17. Numerical and Experimental Investigations of the Effect of PVD and Vacuum Pressure on the Degree of Saturation

    Directory of Open Access Journals (Sweden)

    Ala Nasir Aljorany

    2018-12-01

    Full Text Available Soft clays are generally characterized by low shear strength, low permeability and high compressibility. An effective method to accelerate consolidation of such soils is to use vertical drains along with vacuum preloading to encourage radial flow of water. In this research numerical modeling of prefabricated vertical drains with vacuum pressure was done to investigate the effect of using vertical drains together with vacuum pressure on the degree of saturation of fully and saturated-unsaturated soft soils. Laboratory experiments were conducted by using a specially-designed large consolidometer cell where a central drain was installed and vacuum pressure was applied. All tests were conducted with a vacuum pressure of 40 kPa applied for a period of 30 days where a degree of soil consolidation of 90% was attained. At the end of the test period fifteen samples were taken from different locations distributed along the depth and radially to measure the water content. Consolidation settlements were recorded with time for all tests. The results showed that using vacuum pressure with vertical drains is a very effective method to accelerate consolidation of soils. As the thickness of unsaturated top layer increases, the settlement of soil surface decreases. The water content decreased after 30 days of application of the vacuum pressure.

  18. Failure characteristics and mechanisms of EB-PVD TBCs with Pt-modified NiAl bond coats

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Le; Mukherjee, Sriparna; Huang, Ke; Park, Young Whan; Sohn, Yongho, E-mail: Yongho.Sohn@ucf.edu

    2015-06-18

    Microstructural evolution and failure characteristics/mechanisms were investigated for thermal barrier coatings that consist of electron beam physical vapor deposited ZrO{sub 2}−8 wt% Y{sub 2}O{sub 3} (YSZ) topcoat, Pt-modified nickel aluminide, (Ni,Pt)Al bond coat, and CMSX-4 superalloy substrate with furnace cycling at 1100 °C with 1-h dwell. Photo stimulated luminescence spectroscopy, scanning electron microscopy equipped with X-ray energy dispersive spectroscopy and transmission electron microscopy were employed to examine the residual stress of the thermally grown oxide (TGO) and microstructural changes. For comparison, (Ni,Pt)Al bond coat on CMSX-4 without the YSZ topcoat was also characterized. The TGO grew faster for the YSZ-coated (Ni,Pt)Al bond coat than the (Ni,Pt)Al coating without the YSZ topcoat. Correspondingly, the β-to-γ′/martensite formation in the (Ni,Pt)Al bond coat occurred faster on the YSZ-coated (Ni,Pt)Al bond coat. However the rumpling occurred much faster and with larger amplitude on the (Ni,Pt)Al coating without the YSZ topcoat. Still, the rumpling at the TGO/bond coat interface caused crack initiation as early as 10 thermal cycles, decohesion at the YSZ/TGO interface, and eventual spallation failure primarily through the TGO/bond coat interface. The magnitude of compressive residual stress in the TGO showed an initial increase up to 3−4 GPa followed by a gradual decrease. The rate of stress relaxation was much quicker for the TGO scale without the YSZ topcoat with distinctive relief corresponding to the cracking at the top of geometrical ridges associated with the (Ni,Pt)Al bond coat. The maximum elastic energy for the TGO scale was estimated at 90 J/m{sup 2} at 50% of its lifetime (N{sub f}=545 cycles). The YSZ presence/adhesion to the TGO scale is emphasized to minimize the undulation of the TGO/bond coat interface, i.e., decohesion at the YSZ/TGO scale accelerates the rumpling and crack-coalescence at the TGO/bond coat interface where the spallation fracture occurs.

  19. Non-destructive evaluation of degradation in EB-PVD thermal barrier coatings by infrared reflectance spectroscopy

    International Nuclear Information System (INIS)

    Flattum, Richard Y.; Cooney, Adam T.

    2013-01-01

    At room temperature and atmospheric conditions infrared reflectance spectroscopy and X-ray diffraction were employed for the detection of the phase transformation and residual stress within thermal barrier coatings (TBC). The TBC's samples initially consisted of the porous ceramic topcoat deposited by electron beam plasma vapor deposition, a bond coat and a superalloy substrate. Reflectance spectroscopy scans were performed from 7497 cm −1 to 68 cm −1 to analysis the fingerprint region as well as the chemical bonding region. These regions should indicate if a detectable change within the TBC response is a result of thermal degradation of the microstructure and the changes in yttrium dispersion throughout the yttrium stabilized zirconium. The thermal degradation was induced by thermal cycling the samples to 1100° C and then cooling them in an atmospheric environment. X-ray diffraction was also used to detect the phase composition within the TBC samples and see if either would clearly identify failure prior to actual spallation. The eventual measurability and quantify-ability of the phase changes within the TBC's may be used as an effective non-destructive evaluation (NDE) technique that would allow personnel in the field to know when servicing of the turbine blade was necessary.

  20. Nanostructured MgTiO{sub 3} thick films obtained by electrophoretic deposition from nanopowders prepared by solar PVD

    Energy Technology Data Exchange (ETDEWEB)

    Apostol, Irina [S.C. IPEE Amiral Trading Impex S.A., 115300 Curtea de Arges (Romania); Mahajan, Amit [Department of Materials and Ceramics Engineering, Centre for Research in Ceramics and Composite Materials, CICECO, University of Aveiro, 3810-093 Aveiro (Portugal); Monty, Claude J.A. [CNRS-PROMES Laboratory, 66120 Font Romeu Odeillo (France); Venkata Saravanan, K., E-mail: venketvs@cutn.ac.in [Department of Materials and Ceramics Engineering, Centre for Research in Ceramics and Composite Materials, CICECO, University of Aveiro, 3810-093 Aveiro (Portugal); Department of Physics, School of Basic and Applied Science, Central University of Tamil Nadu, Thiruvarur 61010 (India)

    2015-12-15

    Highlights: • Obtaining nano-crystalline magnesium titanium oxide powders by solar physical vapor deposition (SPVD) process. And using these nano-powders to obtain thick films on conducting substrates by electrophoretic deposition (EPD). • SPVD is a core innovative, original and environmentally friendly process to prepare nano-materials in a powder form. • Sintered thick films exhibited dielectric constant, ε{sub r} ∼18.3 and dielectric loss, tan δ ∼0.0012 at 1 MHz, which is comparable to the values reported earlier. • New contributions to the pool of information on the preparation of nano-structured MgTiO{sub 3} thick films at low temperatures. • A considerable decrease in synthesis temperature of pure MgTiO{sub 3} thick film was observed by the combination of SPVD and EPD. - Abstract: A novel combination of solar physical vapor deposition (SPVD) and electrophoretic deposition (EPD) that was developed to grow MgTiO{sub 3} nanostructured thick films is presented. Obtaining nanostructured MgTiO{sub 3} thick films, which can replace bulk ceramic components, a major trend in electronic industry, is the main objective of this work. The advantage of SPVD is direct synthesis of nanopowders, while EPD is simple, fast and inexpensive technique for preparing thick films. SPVD technique was developed at CNRS-PROMES Laboratory, Odeillo-Font Romeu, France, while the EPD was performed at University of Aveiro – DeMAC/CICECO, Portugal. The nanopowders with an average crystallite size of about 30 nm prepared by SPVD were dispersed in 50 ml of acetone in basic media with addition of triethanolamine. The obtained well-dispersed and stable suspensions were used for carrying out EPD on 25 μm thick platinum foils. After deposition, films with thickness of about 22–25 μm were sintered in air for 15 min at 800, 900 and 1000 °C. The structural and microstructural characterization of the sintered thick films was carried out using XRD and SEM, respectively. The thickness of the sintered samples were about 18–20 μm, which was determined by cross-sectional SEM. Films sintered at 900 °C exhibit a dielectric constant, ε{sub r} ∼18.3 and dielectric loss, tan δ ∼0.0012 at 1 MHz. The effects of processing techniques (SPVD and EPD) on the structure, microstructure and dielectric properties are reported in detail. The obtained results indicate that the thick films obtained in the present study can be promising for low loss materials for microwave and millimeter wave applications.

  1. Adhesion Strength of TiN Coatings at Various Ion Etching Deposited on Tool Steels Using Cathodic Arc Pvd Technique

    Science.gov (United States)

    Ali, Mubarak; Hamzah, Esah; Ali, Nouman

    Titanium nitride (TiN) widely used as hard coating material was coated on tool steels, namely on high-speed steel (HSS) and D2 tool steel by physical vapor deposition method. The goal of this study was to examine the effect of ion etching with and without titanium (Ti) and chromium (Cr) on the adhesion strength of TiN coatings deposited on tool steels. From the scratch tester, it was observed that by increasing Ti ion etching showed an increase in adhesion strength of the deposited coatings. The coatings deposited with Cr ion etching showed poor adhesion compared with the coatings deposited with Ti ion etching. Scratch test measurements showed that the coating deposited with titanium ion etching for 16 min is the most stable coating and maintained even at the critical load of 66 N. The curve obtained via penetration depth along the scratch trace is linear in the case of HSS, whereas is slightly flexible in the case of D2 tool steel. The coatings deposited on HSS exhibit better adhesion compared with those on D2 tool steel.

  2. Study of PVD AlCrN Coating for Reducing Carbide Cutting Tool Deterioration in the Machining of Titanium Alloys.

    Science.gov (United States)

    Cadena, Natalia L; Cue-Sampedro, Rodrigo; Siller, Héctor R; Arizmendi-Morquecho, Ana M; Rivera-Solorio, Carlos I; Di-Nardo, Santiago

    2013-05-24

    The manufacture of medical and aerospace components made of titanium alloys and other difficult-to-cut materials requires the parallel development of high performance cutting tools coated with materials capable of enhanced tribological and resistance properties. In this matter, a thin nanocomposite film made out of AlCrN (aluminum-chromium-nitride) was studied in this research, showing experimental work in the deposition process and its characterization. A heat-treated monolayer coating, competitive with other coatings in the machining of titanium alloys, was analyzed. Different analysis and characterizations were performed on the manufactured coating by scanning electron microscopy and energy-dispersive X-ray spectroscopy (SEM-EDXS), and X-ray diffraction (XRD). Furthermore, the mechanical behavior of the coating was evaluated through hardness test and tribology with pin-on-disk to quantify friction coefficient and wear rate. Finally, machinability tests using coated tungsten carbide cutting tools were executed in order to determine its performance through wear resistance, which is a key issue of cutting tools in high-end cutting at elevated temperatures. It was demonstrated that the specimen (with lower friction coefficient than previous research) is more efficient in machinability tests in Ti6Al4V alloys. Furthermore, the heat-treated monolayer coating presented better performance in comparison with a conventional monolayer of AlCrN coating.

  3. Lithium Ion Transport Across and Between Phase Boundaries in Heterogeneous Polymer Electrolytes, Based on PVdF

    National Research Council Canada - National Science Library

    Greenbaum, Steven

    1998-01-01

    .... In the first reported attempt to exploit 17O NMR to study lithium battery electrolytes, we have prepared 17O-enriched Li triflate and several electrolytes containing the isotopically enriched salt...

  4. The Effect of Annealing on the Structural and Optical Properties of Titanium Dioxide Films Deposited by Electron Beam Assisted PVD

    Directory of Open Access Journals (Sweden)

    Yaser M. Abdulraheem

    2013-01-01

    Full Text Available Titanium dioxide thin films were deposited on crystalline silicon substrates by electron beam physical vapor deposition. The deposition was performed under vacuum ranging from 10−5 to 10−6 Torr without process gases, resulting in homogeneous TiO2-x layers with a thickness of around 100 nm. Samples were then annealed at high temperatures ranging from 500°C to 800°C for 4 hours under nitrogen, and their structural and optical properties along with their chemical structure were characterized before and after annealing. The chemical and structural characterization revealed a substoichiometric TiO2-x film with oxygen vacancies, voids, and an interface oxide layer. It was found from X-ray diffraction that the deposited films were amorphous and crystallization to anatase phase occurred for annealed samples and was more pronounced for annealing temperatures above 700°C. The refractive index obtained through spectroscopic ellipsometry ranged between 2.09 and 2.37 in the wavelength range, 900 nm to 400 nm for the as-deposited sample, and jumped to the range between 2.23 and 2.65 for samples annealed at 800°C. The minimum surface reflectance changed from around 0.6% for the as-deposited samples to 2.5% for the samples annealed at 800°C.

  5. A Comparison of Afghanistan, Yuma, Az, and Manufactured Sands Melted on EB-PVD Thermal Barrier Coatings

    Science.gov (United States)

    2014-09-18

    mentoring me through the field of geology . His vast knowledge in this field and close “First Cousins” motivate me to broaden my knowledge within the...Blade sand sample BC – Bond Coat Button A – TBC Button made by Manufacturer A Button B – TBC Button made by Manufacturer B Ca – Calcium CMAS... Calcium , Magnesium, Aluminum, Silicate CTIO – Coating Technology Integration Office Cr – Chromium CTE – Coefficient of Thermal Expansion DoD

  6. Effect of PS-PVD production throughput on Si nanoparticles for negative electrode of lithium ion batteries

    Science.gov (United States)

    Ohta, R.; Fukada, K.; Tashiro, T.; Dougakiuchi, M.; Kambara, M.

    2018-03-01

    Silicon nanoparticles (Si-NPs) have been produced by plasma spray physical vapor deposition at throughput as high as 1 kg h-1 (17 g min-1) and the effect on the battery performance is investigated. When the Si powder feed-rate is changed from 1 to 17 g min-1, although the average primary particle size increases to 50 nm, the cycle capacity of the batteries using these Si-NPs is improved slightly owing to their less agglomerated structure. In contrast, when Ni is added to Si feedstock, the cycle capacity is improved at 1 g min-1 due to modified Si-NP structure having SiNi2 interface. Whereas, the batteries with the Si-NP produced at 17 g min-1 shows significant decrease in the cycle capacity because of the excess Ni silicide formation that is resulted from the elevated co-condensation point and the increased reaction area at high throughputs despite the constant Ni concentration in the feedstock.

  7. Van stichtelijke fraseologie naar redelijkheid. De PvdA en de oorlog in Vietnam, 1964-1973

    Directory of Open Access Journals (Sweden)

    F. Zuijdam

    2002-01-01

    Full Text Available The Dutch Labour Party and the war in VietnamDuring the 1960s, many people demonstrated against the war in Vietnam. However, the Dutch government, along with most of the major political parties in the Netherlands, chose to ignore the vox populi and refused to reject America's policy regarding Vietnam. One exception to that rule was the Dutch Labour Party. From an early stage, the social-democrats had kept a critical watch on American policy and exhibited an increasing resistance to the subsequent military intervention. In adopting this attitude towards the Vietnam War, the Labour Party had to take several developments into account. The reduction in Cold War tensions, the Cultural Revolution and, above all, the shifts in domestic politics all affected the point of view on Vietnam. One very important consideration that should be taken into account was that, at the time, the Labour Party was trapped between new forms of activism and firm opposition, on the one hand, and the wish to join the government on the other. Under these circumstances, a formal letter to the American Ambassador seemed to be the safest vehicle through which Labour's critical attitude towards Vietnam could be expressed.

  8. [PVD-silicoating before cementation of zirconia-based knee prostheses effects better cement adhesion and lower aseptic loosening rates].

    Science.gov (United States)

    Marx, R; Faramarzi, R; Oberbach, T; Begand, S; Grätz, N; Wirtz, D C

    2012-02-01

    CoCrMo alloys are contraindicated for allergy patients. For these patients, cemented or uncemented prostheses made of titanium alloy are indicated. Uncemented prostheses, however, have low primary retention, particularly the tibial components of knee joint prostheses because of the lack of a positive locking. Therefore, for knee replacement cemented CoCrMo prostheses may be suitable also for allergy sufferers if these are masked by ZrN or TiNbN layers. Alternatively the CoCrMo alloy may be replaced by high-strength oxide ceramics. For adhesion of bone cement to the ceramic surface, however, only inefficient mechanical retention spots are exposed as compared with a metal surface. Undercuts generated by corundum blasting, although highly efficient on a CoCrMo surface, are not such efficient centres on a ceramic surface due to its brittleness. Therefore, the mechanical component of retention is significantly reduced. When specific adhesion between bone cement and surface does not exist due to physical and chemical forces, the hydrolytic stability will be insufficient. Micromotions are promoted and early aseptic loosening is predictable. Silicoating of the ceramic surface will allow specific adhesion and can result in better hydrolytic stability of bonding. In order to evaluate the effectiveness of silicoating the bond strengths of blasted (mean size of corundum grains 50 µm) and silicate layered alumina-toughened zirconia (ATZ) surfaces were compared with "as fired" surfaces by utilising TiAlV probes (diameter 6 mm) for traction-adhesive strength testing. Samples machined out of CoCrMo alloy were utilised for reference. After preparing the samples for traction-adhesive strength testing (sequence: substrate, silicate and silane, protective lacquer [PolyMA], bone cement, TiAlV probe) they were aged up to 360 days at 37 °C in Ringer's solution. The bond strengths observed for all ageing intervals were well above 20 MPa and much higher and more hydrolytically stable for blasted and silicate-layered compared with "as fired" ATZ samples. Silicoating may be effective for achieving a high initial bond strength of bone cement on surfaces of oxide ceramics and also suitable to stabilise bond strength under hydrolytic conditions as present in the human body. Activation by low grain size corundum (mean grain size 50 µm) seems to be effective for activation without deteriorating the bending strength of the ceramics investigated. Due to the proposed layer system migration, micromotions and debonding should be widely reduced or even eliminated. © Georg Thieme Verlag KG Stuttgart · New York.

  9. A novel anti-frictional multiphase layer produced by plasma nitriding of PVD titanium coated ZL205A aluminum alloy

    Science.gov (United States)

    Lu, C.; Yao, J. W.; Wang, Y. X.; Zhu, Y. D.; Guo, J. H.; Wang, Y.; Fu, H. Y.; Chen, Z. B.; Yan, M. F.

    2018-02-01

    The heat treatment (consisting of solid solution and aging), is integrated with the nitriding process of titanium coated ZL205A aluminum alloy to improve the surface and matrix mechanical properties simultaneously. Two-step duplex treatment is adopted to prepare the gradient multiphase layer on a magnesium-free ZL205A aluminum-copper based alloy. Firstly, pure titanium film is deposited on the aluminum alloy substrate using magnetron sputtering. Secondly, the Ti-coated specimen is nitrided at the solid solution temperature of the substrate alloying elements in a gas mixture of N2 and H2 and aged at 175 °C. The microstructure evolution, microhardness as well as the wear resistance of obtained multiphase layers are investigated by means of scanning electron microscopy (SEM) equipped with energy dispersive X-ray spectrometer (EDS), microhardness tester and pin-on-disc tribometer. The multiphase layer, dominated by TiN0.3 or Al3Ti, is prepared with significantly increased layer depth after duplex treatment. The surface hardness of multiphase layer is remarkably improved from 23.7HV to 457HV. The core matrix hardness is also increased to 65HV after aging. The wear rate of the multiphase layer decreases about 55.22% and 49.28% in comparison with the aged and Ti coated specimens, respectively. The predominant wear mechanism for the multiphase layer is abrasive and oxidation, but severe adhesive wear for the aged and Ti coated specimens.

  10. Modelling the growth of ZnO thin films by PVD methods and the effects of post-annealing.

    Science.gov (United States)

    Blackwell, Sabrina; Smith, Roger; Kenny, Steven D; Walls, John M; Sanz-Navarro, Carlos F

    2013-04-03

    Results are presented for modelling of the evaporation and magnetron sputter deposition of Zn(x)O(y) onto an O-terminated ZnO (0001¯) wurtzite surface. Growth was simulated through a combination of molecular dynamics (MD) and an on-the-fly kinetic Monte Carlo (otf-KMC) method, which finds diffusion pathways and barriers without prior knowledge of transitions. We examine the effects of varying experimental parameters, such as substrate bias, distribution of the deposition species and annealing temperature. It was found when comparing evaporation and sputtering growth that the latter process results in a denser and more crystalline structure, due to the higher deposition energy of the arriving species. The evaporation growth also exhibits more stacking faults than the sputtered growth. Post-annealing at 770 K did not allow complete recrystallization, resulting in films which still had stacking faults where monolayers formed in the zinc blende phase, whereas annealing at 920 K enabled the complete recrystallization of some films to the wurtzite structure. At the latter temperature atoms could also sometimes be locked in the zinc blende phase after annealing. When full recrystallization did not take place, both wurtzite and zinc blende phases were seen in the same layer, resulting in a phase boundary. Investigation of the various distributions of deposition species showed that, during evaporation, the best quality film resulted from a stoichiometric distribution where only ZnO clusters were deposited. During sputtering, however, the best quality film resulted from a slightly O rich distribution. Two stoichiometric distributions, one involving mainly ZnO clusters and the other involving mainly single species, showed that the distribution of deposition species makes a huge impact on the grown film. The deposition of predominantly single species causes many more O atoms at the surface to be sputtered or reflected, resulting in an O deficiency of up to 18% in the deposited film and therefore resulting in more stacking faults and phase boundaries. The methods used allow analysis of key mechanisms that occur during the growth process and give hints as to the optimum conditions under which complete crystalline layers can form.

  11. Histopathological Evaluation of a Hydrophobic Terpolymer (PTFE-PVD-PP) as an Implant Material for Nonpenetrating Very Deep Sclerectomy.

    Science.gov (United States)

    Leszczynski, Rafal; Gumula, Teresa; Stodolak-Zych, Ewa; Pawlicki, Krzysztof; Wieczorek, Jaroslaw; Kajor, Maciej; Blazewicz, Stanislaw

    2015-08-01

    The purpose of the study was to assess the biocompatibility of porous terpolymer (polytetrafluoroethylene-co-polyvinylidene fluoride-co-polypropylene, PTFE-PVDF-PP) membranes as an implant material to be placed during nonpenetrating very deep sclerectomy (NPVDS). Another study objective was to determine whether the polymer membrane under investigation could be used to manufacture a new-generation implant, which would actively delay the process of fistula closure and facilitate aqueous humor drainage. Histological response and tissue tolerance of the implant material were assessed. The study was performed on 38 eyeballs of 19 New Zealand white rabbits (19 implanted, 19 control). Histological assessment was carried out between 2 and 52 weeks after surgery. We routinely assessed inflammatory infiltrate, neovascularization, hemorrhage, and stromal edema as well as connective tissue attachment to the implant and adjacent tissues. At 52 weeks of observation, a statistically significant difference was revealed between the study and control groups in terms of resorptive granulation, tissue, and the inflammatory infiltrate. No features of acute inflammatory response to the implant were observed, and there was an absence of histological features of acute inflammatory infiltrates and subsidence of chronic inflammatory infiltrates and resorptive granulation over time. Slight fibrotic response and insignificant changes in neighboring eye tissues all indicate good tolerance to bioimplant materials. This allows for some optimism regarding the use of hydrophobic terpolymer in the construction of new intrascleral implants. However, the ultimate decision regarding its usefulness and safety in the treatment of glaucoma requires further investigation.

  12. On the Electrochemical Behavior of PVD Ti-Coated AISI 304 Stainless Steel in Borate Buffer Solution

    Science.gov (United States)

    Fattah-alhosseini, Arash; Elmkhah, Hassan; Attarzadeh, Farid Reza

    2017-04-01

    This work aims at studying the electrochemical behavior of annealed pure titanium (Ti) and nano-structured (NS) Ti coating in borate buffer solutions. Cathodic arc evaporation was successfully applied to deposit NS Ti coating. Samples were characterized by means of scanning electron microscope and x-ray diffraction. Potentiodynamic polarization tests, electrochemical impedance spectroscopy, and Mott-Schottky analysis were employed to discuss the electrochemical behavior of samples thoroughly. Electrochemical measurements showed that the deposited NS Ti coating offers a superior passivity in borate buffer solutions of pH 9.0 and 9.5. Mott-Schottky analysis revealed that all passive films are of n-type semiconducting nature in these alkaline solutions and the deposition process did not alter the semiconducting type of passive films formed on samples. Additionally, this analysis showed that the NS Ti coating possessed lower levels of donor densities. Finally, all electrochemical tests showed that passive behavior of the NS Ti samples was superior, mainly due to the formation of thicker and less defective passive films.

  13. Effect of substrate bias on structure and properties of the TiN coatings obtained in the PVD process

    International Nuclear Information System (INIS)

    Dobrzanski, L.A.; Kwasny, W.

    2003-01-01

    The paper presents investigation results of the field of deposition parameters on structure and mechanical properties of the TiN coatings obtained by magnetron sputtering in the vacuum furnace onto the ASP 30 sintered high speed steel. Effect of sputtering parameters on chemical and phase composition, thickness, microhardness and roughness parameter. The characteristic structure and surface topography of the analyzed coatings are presented. (author)

  14. Classification of posterior vitreous detachment

    Science.gov (United States)

    Kakehashi, Akihiro; Takezawa, Mikiko; Akiba, Jun

    2014-01-01

    Diagnosing a posterior vitreous detachment (PVD) is important for predicting the prognosis and determining the indication for vitreoretinal surgery in many vitreoretinal diseases. This article presents both classifications of a PVD by slit-lamp biomicroscopy and of a shallow PVD by optical coherence tomography (OCT). By biomicroscopy, the vitreous condition is determined based on the presence or absence of a PVD. The PVD then is classified as either a complete posterior vitreous detachment (C-PVD) or a partial posterior vitreous detachment (P-PVD). A C-PVD is further divided into a C-PVD with collapse and a C-PVD without collapse, while a P-PVD is divided into a P-PVD with shrinkage of the posterior hyaloid membrane (P-PVD with shrinkage) and a P-PVD without shrinkage of the posterior hyaloid membrane (P-PVD without shrinkage). A P-PVD without shrinkage has a subtype characterized by vitreous gel attachment through the premacular hole in a posterior hyaloid membrane to the macula (P-PVD without shrinkage [M]). By OCT, a shallow PVD is classified as the absence of a shallow PVD or as a shallow PVD. A shallow PVD is then subclassified as a shallow PVD without shrinkage of the posterior vitreous cortex, a shallow PVD with shrinkage of the posterior vitreous cortex, and a peripheral shallow PVD. A shallow PVD without shrinkage of the posterior vitreous cortex has two subtypes: an age-related shallow PVD and a perifoveal PVD associated with a macular hole. PMID:24376338

  15. Data of evolutionary structure change: 1PVDA-2VBIA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBIA 1PVD 2VBI A A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ... 1PVD A 1PVD...A 233 ARG CA 308 GLN CA 388 1PVD

  16. Data of evolutionary structure change: 1PVDB-1ZPDB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDB-1ZPDB 1PVD 1ZPD B B SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG...ex>0 1PVD B 1PVDB 1 1PVD B 1PVDB 1PVD B 1PVDB KLLQ...n14> 1PVD B 1PVDB

  17. Data of evolutionary structure change: 1PVDA-1ZPDE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-1ZPDE 1PVD 1ZPD A E SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...HHHHH--HHHHH EEEEE HHHHHHHHHHHHHHH 0 1PVD... A 1PVDA KSFND-NSKIR ALA CA 225 SER CA 274 1PVD... A 1PVDA AKLLQTPID

  18. Data of evolutionary structure change: 1PVDA-2VBFB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBFB 1PVD 2VBF A B SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...LNASYMADGYARTKKAAAFLTTFGVGELSAINGLAGSYAENLPVVEIVGSPTSKVQNDGKFVHHTLADGDFKHFMKMHEPVTAARTLLT-AENATYEIDRVLSQLLKERKPVYINLPVD...2> 0 1PVD A 1PVDA KGYKP-VAVPA - 1 1PVD A

  19. Data of evolutionary structure change: 1PVDB-2NXWB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDB-2NXWB 1PVD 2NXW B B SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...SSTLGVAAVTYGAGAFNMVNAVAGAYAEKSPVVVISGAPGTTELLD------TQFQVFKEITVAQARLDDPAKAPAEIARVLGAARAQSRPVYLEIPRNMVNAEVE------PVGDDPAWPVD...ID> 0 1PVD B 1PVDB 1.6429469585418701 1 1PVD... B 1PVDB EQHPR-YGGVY<

  20. Data of evolutionary structure change: 1PVDB-2VBFB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDB-2VBFB 1PVD 2VBF B B SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...ASYMADGYARTKKAAAFLTTFGVGELSAINGLAGSYAENLPVVEIVGSPTSKVQNDGKFVHHTLADGDFKHFMKMHEPVTAARTLLT-AENATYEIDRVLSQLLKERKPVYINLPVD.../ss_2> 0 1PVD B 1PVDB KGYKP-VAVPA - 1 1PVD

  1. Data of evolutionary structure change: 1PVDA-2NXWA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2NXWA 1PVD 2NXW A A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...YSSTLGVAAVTYGAGAFNMVNAVAGAYAEKSPVVVISGAPGTTEGGL---LLDTQFQVFKEITVAQARLDDPAKAPAEIARVLGAARAQSRPVYLEIPRNMVNAEVE------PVGDDPAWPVD...ex>0 1PVD A 1PVDA THR CA 228 GLN CA 326 1PVD A 1PVDA SHHTLGNGDFTVF

  2. Improvement of the low-speed friction characteristics of a hydraulic piston pump by PVD-coating of TiN

    International Nuclear Information System (INIS)

    Hong, Yeh Sun; Lee, Sang Yul; Kim, Sung Hun; Lim, Hyun Sik

    2006-01-01

    The hydraulic pump of an Electro-hydrostatic Actuator should be able to quickly feed large volume of oil into hydraulic cylinder in order to reduce the response time. On the other hand, it should be also able to precisely dispense small amount of oil through low-speed operation so that the steady state position control error of the actuator can be accurately compensated. Within the scope of axial piston type hydraulic pumps, this paper is focused on the investigation how the surface treatment of their cylinder barrel with TiN plasma coating can contribute to the reduction of the friction and wear rate of valve plate in the low-speed range with mixed lubrication. The results showed that the friction torque of the valve plate mated with a TiN-coated cylinder barrel could be reduced to 22% of that with an uncoated original one when load pressure was 300 bar and rotational speed 100 rpm. It means that the torque efficiency of the test pump was expected to increase more than 1.3% under the same working condition. At the same time, the wear rate of the valve plate could be reduced to 40∼50%

  3. Effect of Metal Ion Etching on the Tribological, Mechanical and Microstructural Properties of TiN-COATED d2 Tool Steel Using Cae Pvd Technique

    Science.gov (United States)

    Ali, Mubarak; Hamzah, Esah Binti; Hj. Mohd Toff, Mohd Radzi

    A study has been made on TiN coatings deposited on D2 tool steel substrates by using commercially available cathodic arc evaporation, physical vapor deposition technique. The goal of this work is to determine the usefulness of TiN coatings in order to improve the micro-Vickers hardness, coefficient of friction and surface roughness of TiN coating deposited on tool steel, which is vastly use in tool industry for various applications. A pin-on-disc test was carried out to study the coefficient of friction versus sliding distance of TiN coating at various ion etching rates. The tribo-test showed that the minimum value recorded for friction coefficient was 0.386 and 0.472 with standard deviation of 0.056 and 0.036 for the coatings deposited at zero and 16 min ion etching. The differences in friction coefficient and surface roughness was mainly associated with the macrodroplets, which was produced during etching stage. The coating deposited for 16 min metal ion etching showed the maximum hardness, i.e., about five times higher than uncoated one and 1.24 times to the coating deposited at zero ion etching. After friction test, the wear track was observed by using field emission scanning electron microscope. The coating deposited for zero ion etching showed small amounts of macrodroplets as compared to the coating deposited for 16 min ion etching. The elemental composition on the wear scar were investigated by means of energy dispersive X-ray, indicate no further TiN coating on wear track. A considerable improvement in TiN coatings was recorded as a function of various ion etching rates.

  4. Effect of Coating Thickness on the Properties of TiN Coatings Deposited on Tool Steels Using Cathodic Arc Pvd Technique

    Science.gov (United States)

    Mubarak, A.; Akhter, Parvez; Hamzah, Esah; Mohd Toff, Mohd Radzi Hj.; Qazi, Ishtiaq A.

    Titanium nitride (TiN) widely used as hard coating material, was coated on tool steels, namely on high-speed steel (HSS) and D2 tool steel by physical vapor deposition method. The study concentrated on cathodic arc physical vapor deposition (CAPVD), a technique used for the deposition of hard coatings for tooling applications, and which has many advantages. The main drawback of this technique, however, is the formation of macrodroplets (MDs) during deposition, resulting in films with rougher morphology. Various standard characterization techniques and equipment, such as electron microscopy, atomic force microscopy, hardness testing machine, scratch tester, and pin-on-disc machine, were used to analyze and quantify the following properties and parameters: surface morphology, thickness, hardness, adhesion, and coefficient of friction (COF) of the deposited coatings. Surface morphology revealed that the MDs produced during the etching stage, protruded through the TiN film, resulting in film with deteriorated surface features. Both coating thickness and indentation loads influenced the hardness of the deposited coatings. The coatings deposited on HSS exhibit better adhesion compared to those on D2 tool steel. Standard deviation indicates that the coating deposited with thickness around 6.7 μm showed the most stable trend of COF versus sliding distance.

  5. Tribological and mechanical properties of Ti/TiAlN/TiAlCN nanoscale multilayer PVD coatings deposited on AISI H11 hot work tool steel

    Energy Technology Data Exchange (ETDEWEB)

    AL-Bukhaiti, M.A., E-mail: m.albukhaiti@gmail.com [Mechanical Engineering Department, Faculty of Engineering, Sana’a University, Sana’a 12544 (Yemen); Al-hatab, K.A. [Mechanical Engineering Department, Faculty of Engineering, Sana’a University, Sana’a 12544 (Yemen); Tillmann, W.; Hoffmann, F.; Sprute, T. [Institute of Materials Engineering, Technische Universitat Dortmund, Leonhard-Euler-Str.2, 44227 Dortmund (Germany)

    2014-11-01

    Highlights: • New Ti/TiAlN/TiAlCN multilayer coating was developed. • It showed low wear rates (10{sup −16} m{sup 3}/N m), low friction coefficients (μ ∼ 0.25), and good hardness (17–20 GPa). • Friction coefficients and wear rates decrease and increase, respectively, with the increase in normal load and sliding velocity. • The coating/Al{sub 2}O{sub 3} pair showed superior wear resistance and low friction coefficient in comparison to coating/100Cr6 pair. - Abstract: A new [Ti/TiAlN/TiAlCN]{sub 5} multilayer coatings were deposited onto polished substrate AISI H11 (DIN 1.2343) steel by an industrial magnetron sputtering device. The tribological performance of the coated system was investigated by a ball-on-disk tribometer against 100Cr6 steel and Al{sub 2}O{sub 3} balls. The friction coefficients and specific wear rates were measured at various normal loads (2, 5, 8, and 10 N) and sliding velocities (0.2, 0.4, and 0.8 m/s) in ambient air and dry conditions. The phase structure, composition, wear tracks morphologies, hardness, and film/substrate adhesion of the coatings were characterized by light-microscopy, scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDX), X-ray diffraction (XRD), 3D-surface analyzer, nanoindentation, and scratch tests. Results showed that the deposited coatings showed low wear rates in the scale of 10{sup −15} m{sup 3}/N m, low friction coefficients against 100Cr6 and Al{sub 2}O{sub 3} balls in the range of 0.25–0.37, and good hardness in the range of 17–20 GPa. Results also revealed that the friction coefficients and disc wear rates decrease and increase, respectively with the increase in normal load and sliding velocity for both coating/Al{sub 2}O{sub 3} and coating/100Cr6 sliding system. Compared with the uncoated-H11 substrate, the deposited coating exhibited superior tribological and mechanical properties. The dominant wear mechanism was abrasive wear for coating/Al{sub 2}O{sub 3} pair, while for coating/100Cr6 pair, a combination of mild adhesive wear, severe adhesive wear, and abrasive wear (extensive plowing) were the dominant wear mechanisms at different applied normal loads.

  6. Microstructure and functional properties of the TiNi- and CuAl-based SMA thin films and coats produced by PVD technique

    International Nuclear Information System (INIS)

    Kolomytsev, V.; Musienko, R.; Nevdacha, V.; Panarin, V.; Pasko, A.; Cesari, E.; Segui, C.; Humbeeck, J. van

    2000-01-01

    The TiNi- and CuAl-based shape memory alloy thin films and wear/corrosion resistant surface coats have been produced by the ion-plasma deposition method with an arc dispersion of the cathode/target. This technique was widely used for production of the coats from a sprayed pure metal or a single-phase alloy. We have offered to use this process for dispersion of the heterophase alloys like shape memory alloys. The arguments for choosing of this technique are discussed with respect to creation of the conditions for preservation not only chemical composition, but also phase structure of an alloy in a covering, thus the shape memory/superelastic effects to be kept in a coat. (orig.)

  7. The quorum-quenching N-acyl homoserine lactone acylase PvdQ is an Ntn-hydrolase with an unusual substrate-binding pocket

    NARCIS (Netherlands)

    Bokhove, Marcel; Jimenez, Pol Nadal; Quax, Wim J.; Dijkstra, Bauke W.

    2010-01-01

    In many Gram-negative pathogens, their virulent behavior is regulated by quorum sensing, in which diffusible signals such as N-acyl homoserine lactones (AHLs) act as chemical messaging compounds. Enzymatic degradation of these diffusible signals by, e. g., lactonases or amidohydrolases abolishes AHL

  8. The cutting properties and wear of the knives with DLC and W-DLC coatings, deposited by PVD methods, applied for wood and wood-based materials machining

    OpenAIRE

    M. Pancielejko; A. Czyżniewski; A. Gilewicz; V. Zavaleyev; W. Szymański

    2012-01-01

    Purpose: Performance of DLC and W-DLC coated woodworking knives was investigated. The results of testing DLC and W-DLC coating properties as well as the results of life-time tests in the form of wear of HSS and HM knives with these coatings is presents.Design/methodology/approach: DLC coating was deposited by MCVA method, and W-DLC coating was deposited by pulsed RMS. Tests of knives coated with DLC and W-DLC as uncoated ones was made by machining: MDF board, pinewood slats and floorboard - u...

  9. Process-Structure-Property Relationships of Micron Thick Gadolinium Oxide Films Deposited by Reactive Electron Beam-Physical Vapor Deposition (EB-PVD)

    Science.gov (United States)

    2014-12-01

    transparency is important (i.e., protective eyewear , windshields, building windows and architecture, road signs, etc).22 However, for development of a Gd2G...B. in Industrial Minerals and Rocks 769-792 (2006). 32. Atwood, D. A. The Rare Earth Elements : Fundamentals and Applications. 1-624 (Wiley, 2013

  10. Low Conductive Thermal Barrier Coatings Produced by Ion Beam Assisted EB-PVD with Controlled Porosity, Microstructure Refinement and Alloying Additions for High Temperature Applications

    Science.gov (United States)

    Wolfe, Douglas E.; Singh, Jogender

    2005-01-01

    Various advanced Hafnia-based thermal barrier coatings (TBC) were applied on nickel-based superalloy coupons by electron beam physical vapor deposition. In addition, microstructural modifications to the coating material were made in an effort to reduce the thermal conductivity of the coating materials. Various processing parameters and coating system modifications were made in order to deposit the alloyed TBC with the desired microstructure and thus coating performance, some of which include applying coatings at substrate temperatures of 1150 C on both PtAl and CoNiCrAlY bond coated samples, as well as using 8YSZ as a bond layer. In addition, various characterization techniques including thermal cyclic tests, scanning electron microscopy, x-ray diffraction, thermal conductivity, and reflectivity measurements were performed. Although the coating microstructure was never fully optimized due to funding being cut short, significant reductions in thermal conductivity were accomplished through both chemistry changes (composition) and microstructural modifications.

  11. The effect of Al intermediate layer on thermal resistance of EB-PVD yttria-stabilized zirconia coatings on titanium substrate

    Science.gov (United States)

    Panin, Alexey; Panin, Victor; Kazachenok, Marina; Shugurov, Artur; Sinyakova, Elena; Martynov, Sergey; Rusyaev, Andrey; Kasterov, Artur

    2017-12-01

    The yttria-stabilized zirconia coatings sprayed on titanium substrates by the electron beam physical vapor deposition were subjected to thermal annealing in air at 1000°C for 1, 30 and 60 min. The delamination and fracture of the coatings are studied by the scanning electron microscopy and X-ray diffraction. It is shown that a magnetron sputtered Al interlayer between the coating and the substrate considerably improves the thermal resistance of ceramic coatings.

  12. Tribological and Wear Performance of Carbide Tools with TiB2 PVD Coating under Varying Machining Conditions of TiAl6V4 Aerospace Alloy

    Directory of Open Access Journals (Sweden)

    Jose Mario Paiva

    2017-11-01

    Full Text Available Tribological phenomena and tool wear mechanisms during machining of hard-to-cut TiAl6V4 aerospace alloy have been investigated in detail. Since cutting tool wear is directly affected by tribological phenomena occurring between the surfaces of the workpiece and the cutting tool, the performance of the cutting tool is strongly associated with the conditions of the machining process. The present work shows the effect of different machining conditions on the tribological and wear performance of TiB2-coated cutting tools compared to uncoated carbide tools. FEM modeling of the temperature profile on the friction surface was performed for wet machining conditions under varying cutting parameters. Comprehensive characterization of the TiB2 coated vs. uncoated cutting tool wear performance was made using optical 3D imaging, SEM/EDX and XPS methods respectively. The results obtained were linked to the FEM modeling. The studies carried out show that during machining of the TiAl6V4 alloy, the efficiency of the TiB2 coating application for carbide cutting tools strongly depends on cutting conditions. The TiB2 coating is very efficient under roughing at low speeds (with strong buildup edge formation. In contrast, it shows similar wear performance to the uncoated tool under finishing operations at higher cutting speeds when cratering wear predominates.

  13. One-step synthesis and scale-dependent luminescence properties of 1D Zn0.9Cd0.1S nanostructures prepared by PVD

    International Nuclear Information System (INIS)

    Jin, Changqing; Zhu, Kexin; Jian, Zengyun; Wei, Yongxing; Ge, Chenghai; Peterson, George

    2017-01-01

    1D Zn 0.9 Cd 0.1 S nanostructures were successfully synthesized via one-step physical vapor deposition. The separation of ultraviolet (UV) emission peaks in the cathodoluminescence (CL) curves, taken in combination with x-ray diffraction (XRD) patterns, proves the coexistence of wurtzite and zincblende phases. The diversity of morphology in nanostuctures originates from Au catalyst splitting during the growth process. The similar photoluminescence spectrums at different positions prove that the composition and defect types were homogeneous, and that defect distribution and density have very small fluctuation at the micron scale. In contrast, the CL curves taken from different locations showed that the defect types and distribution were not uniform on the nanoscale level. (paper)

  14. Influência da texturização laser na vida de ferramentas de torneamento revestidas por CVD e PVD

    OpenAIRE

    Davi Neves

    2010-01-01

    Resumo: Uma característica dos revestimentos aplicados nas ferramentas de corte é a adesão. A adesão deficiente libera particulados duros e abrasivos resultantes da fragmentação prematura do revestimento, acelerando o desgaste das superfícies em contato. Na texturização, um laser de pulsos curtos e de alta frequência provoca, na interação com a superfície, uma mudança das propriedades advinda da fusão e ablação de material. Neste processo podem ocorrer a limpeza e a texturização simultâneas d...

  15. Comorbidities Among Women With Vulvovaginal Complaints in Family Practice

    NARCIS (Netherlands)

    Leusink, P.M.; Kaptheijns, A.; Laan, E; Boven, K. van; Lagro-Janssen, A.

    2016-01-01

    BACKGROUND: The lifetime prevalence of women suffering from provoked vestibulodynia (PVD) is estimated to be approximately 15%. The etiology of PVD is not yet clear. Recent studies approach PVD as a chronic multifactorial sexual pain disorder. PVD is associated with pain syndromes, genital

  16. Data of evolutionary structure change: 1PVDA-2VBFA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBFA 1PVD 2VBF A A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...YMADGYARTKKAAAFLTTFGVGELSAINGLAGSYAENLPVVEIVGSPTSKVQNDGKFVHHTLADGDFKHFMKMHEPVTAARTLLT-AENATYEIDRVLSQLLKERKPVYINLPVD...ment> 0 1PVD A 1PVD... ASN CA 268 ALA CA 373 THR CA 367 1PVD... A 1PVDA

  17. Comorbidities Among Women With Vulvovaginal Complaints in Family Practice

    NARCIS (Netherlands)

    Leusink, Peter; Kaptheijns, Anne; Laan, Ellen; van Boven, Kees; Lagro-Janssen, Antoine

    2016-01-01

    Background: The lifetime prevalence of women suffering from provoked vestibulodynia (PVD) is estimated to be approximately 15%. The etiology of PVD is not yet clear. Recent studies approach PVD as a chronic multifactorial sexual pain disorder. PVD is associated with pain syndromes, genital

  18. Data of evolutionary structure change: 1PVDB-2NXWA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDB-2NXWA 1PVD 2NXW B A SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...DAAARYSSTLGVAAVTYGAGAFNMVNAVAGAYAEKSPVVVISGAPGTTEGGL---LLDTQFQVFKEITVAQARLDDPAKAPAEIARVLGAARAQSRPVYLEIPRNMVNAEVE------PVG-DDPAWPVD...indel> 0 1PVD B 1PVD...rmsd> 1.6578389406204224 1 1PVD... B 1PVDB EQHPR-YGGVY

  19. Wear resistant PVD-/CVD-dry lubricant coatings for the environmental and innovative production. Subproject 3: dry lubricant coatings - carbon coatings. Final report; Verschleissfeste PVD-/CVD-Trockenschmierstoffschichten fuer die umweltschonende und innovative Fertigung. Teilprojekt 3: Kohlenstoffbasierte Trockenschmierstoffschichten (TSS-C). Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Schattke, A.; Hockauf, W.

    2002-09-05

    The partners Bosch, Metaplas Ionon and Roth and Rau developed dry lubricant coatings on a carbon coating base. The cutting tools used for the testing were developed in former dry cutting projects especially for cutting with minimum quantity lubrication (MQL). The coatings were tested in cutting and metal forming. After tribological testing at the coating companies the deposited coatings were evaluated by machining tests in drilling, thread forming and metal forming at the universities of Darmstadt and Kassel. The best coatings were tested in production field tests (laboratory) or, if possible, in the production at company Bosch and at other end users of the joint project. It was possible to show that carbon coatings are very good at punching and sheet bending. Also at drilling and thread forming in cast iron and low alloyed steels the results are good enough for production. The results at drilling and thread forming in aluminium alloys and high alloyed steels (X90CrMoV18) were not good enough for production under dry conditions. But testing with a reduced amount of MQL (6ml/h) showed better cutting parameters than commercial coatings. Also cutting length and quality of the parts are better. Even with the best coatings it was not possible to make dry massive forming with reduced temperature. At these high temperatures and high surface pressures it was not possible to work without lubricants. (orig.) [German] Im Projekt wurden von den Partnern Bosch, Metaplas Ionon und Roth and Rau Trockenschmierstoffschichten auf Kohlenstoffbasis entwickelt. Diese wurden auf Werkzeuge abgeschieden, deren Geometrien in bereits abgeschlossenen Projekten fuer die Trockenzerspannung mit Minimalmengenschmierung optimiert wurden. Die Schichten sind fuer die Zerspannung und Umformtechnik vorgesehen. An tribologische Tests bei den Beschichtern schlossen sich Filtertests an den Hochschulen Darmstadt und Kassel an, bei denen die Schichten in Bohr-, Gewindeform- und Umformtests untersucht wurden. Geeignete Schichten kamen in fertigungsnahe Feldtests bzw. in die Fertigung beim Endanwender Bosch und projektuebergreifend bei anderen Endanwendern des Gesamtprojektes. Es zeigte sich, dass die Kohlenstoffschichten bei Stanz- und Blechumformungsoperationen hervorragende Ergebnisse liefern. Auch beim Bohren und Gewindeformen in Gusswerkstoffen und niedrig legierten Staehlen konnten trocken fertigungsrelevante Ergebnisse erzielt werden. Bohren und Gewindeformen in Aluminiumlegierungen und hochlegierten Staehlen war trocken mit fertigungsrelevanten Schnittwerten nicht moeglich. Vergleichsversuche mit Minimalmengenschmierung haben jedoch aufgezeigt, dass trotz Reduzierung der Minimalmenge auf 6 ml/Std. deutlich hoehere Schnittwerte gefahren werden konnten, als mit bisher am Markt erhaeltlichen Beschichtungen. Auch die Standmenge und die Qualitaet der Bearbeitungen konnte verbessert werden. Der Versuch, besonders gute Beschichtungen auch in der Halbwarm-Massivumformung einzusetzen, ist leider gescheitert. Bei den hohen Temperaturen und Flaechenpressungen war ein Arbeiten ohne Schmiermittel grundsaetzlich nicht moeglich. Die Arbeiten wurden deshalb zur Mitte des Projektes abgebrochen. (orig.)

  20. Are primary and secondary provoked vestibulodynia two different entities? A comparison of pain, psychosocial, and sexual characteristics.

    Science.gov (United States)

    Aerts, Leen; Bergeron, Sophie; Corsini-Munt, Serena; Steben, Marc; Pâquet, Myriam

    2015-06-01

    Provoked vestibulodynia (PVD) is suspected to be the most frequent cause of vulvodynia in premenopausal women. Based on the onset of PVD relative to the start of sexual experience, PVD can be divided into primary (PVD1) and secondary PVD (PVD2). Studies comparing these PVD subgroups are inconclusive as to whether differences exist in sexual and psychosocial functioning. The aim of this study was to compare the pain, sexual and psychosocial functioning of a large clinical and community-based sample of premenopausal women with PVD1 and PVD2. A total of 269 women (n = 94 PVD1; n = 175 PVD2) completed measures on sociodemographics, pain, sexual, and psychosocial functioning. Dependent variables were the 0-10 pain numerical rating scale, McGill-Melzack Pain Questionnaire, Female Sexual Function Index, Global Measure of Sexual Satisfaction, Beck Depression Inventory-II, Painful Intercourse Self-Efficacy Scale, Pain Catastrophizing Scale, State-Trait Anxiety Inventory Trait Subscale, Ambivalence over Emotional Expression Questionnaire, Hurlbert Index of Sexual Assertiveness, Experiences in Close Relationships Scale--Revised, and Dyadic Adjustment Scale-Revised. At first sexual relationship, women with PVD2 were significantly younger than women with PVD1 (P sexual, psychological, and relational functioning between the PVD subgroups. Nevertheless, on average, both groups were in the clinical range of sexual dysfunction and reported impaired psychological functioning. The findings show that there are no significant differences in the sexual and psychosocial profiles of women with PVD1 and PVD2. Results suggest that similar psychosocial and sex therapy interventions should be offered to both subgroups of PVD. © 2015 International Society for Sexual Medicine.

  1. Evaluation of age and peripheral vascular disease as risk factors for ...

    African Journals Online (AJOL)

    Results: Among the 120 diabetic participants, peripheral vascular disease (PVD) was detected only in those aged 50 years and above and all the three diagnostic methods detected PVD increasingly with advancing age. Clinical criteria detected PVD in 4.7% of those aged 50-59 years and 26.3% of those aged .70years.

  2. Prevalence and Associations of Incomplete Posterior Vitreous Detachment in Adult Chinese: The Beijing Eye Study

    Science.gov (United States)

    Shao, Lei; Xu, Liang; You, Qi Sheng; Wang, Ya Xing; Chen, Chang Xi; Yang, Hua; Zhou, Jin Qiong; Jonas, Jost B.; Wei, Wen Bin

    2013-01-01

    Purpose To determine prevalence and associations of incomplete posterior vitreous detachment (PVD). Methods The population-based cross-sectional Beijing Eye Study 2011 included 3468 individuals with a mean age of 64.6±9.8 years (range: 50–93 years). A detailed ophthalmic examination was performed including spectral-domain optical coherence tomography (SD-OCT). Incomplete PVD was differentiated into type 1 (shallow PVD with circular perifoveal vitreous attachment), type 2 (PVD reaching fovea but not foveola), type 3 (shallow PVD with pinpoint vitreous attachment at the foveola), and type 4 (PVD completely detached from the macula, attached to the optic disc). Results An incomplete PVD was detected in 3948 eyes (prevalence: 60.5±0.6%; 95% Confidence Interval (CI): 59.3%,61.7%) of 2198 subjects (67.1±0.8%;95%CI: 65.6%,68.7%). Type 1 PVD was seen in 3090 (78.3%) eyes, type 2 PVD in 504 (12.8%) eyes, type 3 PVD in 70 (1.8%) eyes, and type 4 PVD in 284 (7.2%) eyes. Prevalence of incomplete PVD was associated with younger age (PPVD was associated with higher age (PPVD (detected in 67.1% subjects) was associated with younger age, male gender, rural region of habitation, larger corneal diameter, better best corrected visual acuity and hyperopic refractive error. PMID:23544043

  3. Data of evolutionary structure change: 1PVDA-1ZPDB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-1ZPDB 1PVD 1ZPD A B SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEV...>GLU CA 220 ALA CA 223 SER CA 273 1PVD... A 1PVDA AKLLQTPIDMSLKPN ...A 187 GLU CA 243 LEU CA 296 LYS CA 223 1PVD... A 1PVDA AKGYKPVAV

  4. Data of evolutionary structure change: 1PVDA-2VBIG [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1PVDA-2VBIG 1PVD 2VBI A G SEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVG.../ss_2> 0 1PVD A 1PVDA SFNDN-SKIRM HHH ...ine>PRO CA 225 GLU CA 183 1PVD... A 1PVDA LQTPIDMSLKP

  5. Symptomatic vitelline duct anomalies in children | Ameh | South ...

    African Journals Online (AJOL)

    Only 1 patient with PVD had an associated anomaly (intestinal malrotation). The diagnosis of PVD was obvious clinically, but in 1 patient the fistula was demonstrated by fistulogram. The diagnosis of MD was intraoperative in all 3 patients. Treatment was by various types of resection for PVD and MD and excision for ...

  6. Influence of the target-substrate distance on the S-W stoichiometry and triboperformance of WSxC films deposited by PVD in reactive and non-reactive processes

    NARCIS (Netherlands)

    Cao, Huatang; De Hosson, J.T.M.; Pei, Yutao T.

    2017-01-01

    Layered transition metal dichalcogenides (TMD) such as WS2 are materials well-known for their solid lubrication properties in vacuum [1]. However, the lubricating property degrades through oxidation in moisture and it is also limited by its low hardness and low load-bearing capacity. The

  7. Mechanical properties of heat treated and worn PVD, TiN, (Ti, Al)N, (Ti, Nb)N and Ti(C, N) coatings as measured by nanoindentation

    Energy Technology Data Exchange (ETDEWEB)

    Vancoille, E.; Celis, J.P.; Roos, J.R. (Dept. of Metallurgy and Materials Engineering, Katholieke Univ. Leuven, Heverlee (Belgium))

    1993-03-15

    Steered arc ion plated TiN, (Ti[sub 50], Al[sub 50])N, (Ti[sub 85], Nb[sub 15])N and Ti(C[sub 60], N[sub 40]) coatings were heat treated in an inert argon atmosphere at temperatures up to 900degC. The hardness, Young's modulus and plasticity of the coatings were measured with nanoindentation after heating. As the coatings were annealed at higher temperatures, the hardness decreased and the plasticity increased. X-ray diffraction of the coatings showed that this corresponds to a decrease in internal stress and a change of crystallographic texture. The nanohardness of the cutting edge of coated drills was also measured after these were used in AISI 4140 steel. Scanning electron microscopy demonstrated the presence of a silicate layer located near the cutting edge of (Ti[sub 85], Nb[sub 15])N coated drills. Nanoindentation showed that the mechanical signature of the surface film further away from the cutting edge corresponded to a heat-treated coating covered with an oxide layer. (orig.).

  8. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  9. Influence of deposition conditions on electrical and mechanical properties of Sm2O3-doped CeO2 thin films prepared by EB-PVD (+IBAD) methods. Part 1: Effective relative permittivity

    Science.gov (United States)

    Hartmanová, Mária; Nádaždy, Vojtech; Kundracik, František; Mansilla, Catina

    2013-03-01

    Study is devoted to the effective relative permittivity ɛr of CeO2 + x. Sm2O3 thin films prepared by electron-beam physical vapour deposition and ionic beam-assisted deposition methods; ɛr was investigated by three independent ways from the bulk parallel capacitance Cp, impedance capacitance Cimp, and accumulation capacitance Cacc in dependence on the deposition conditions (deposition temperature, dopant amount x and Ar+ ion bombardment during the film deposition) used. Investigations were performed using impedance spectroscopy, capacitance-voltage and current-voltage characteristics as well as deep level transient spectroscopy. Results obtained are described and discussed.

  10. Peripheral vascular disease is associated with reduced glycosuria in newly diagnosed type 2 diabetic patients

    DEFF Research Database (Denmark)

    Olivarius, Niels de Fine; Holstein-Rathlou, N H; Siersma, V

    2004-01-01

    was 65.2 years. Urinary glucose concentration (UGC) was determined quantitatively in a freshly voided morning urine specimen. RESULTS: The over-all prevalence of peripheral vascular disease (PVD) was 16.5%. Bivariately, high values of UGC were associated with low prevalence of PVD (p...). The predictive value of PVD--together with HbA1c, glomerular filtration rate (GFR) and 10 other possible predictors--was confirmed in a logistic regression analysis with glycosuria (Y/N) as outcome variable (p=0.0004). CONCLUSION: Surprisingly, type 2 diabetic patients with PVD tend not to have glycosuria...... as compared to patients without PVD. PVD may be indicative of generalized atherosclerotic lesions in the major vessels, including the renal arteries. This could lead to a lowering of GFR and thereby of the amount of glucose filtered. Assuming no, or only a minor direct effect of PVD on tubular function...

  11. Cognitive, psychophysical, and neural correlates of vulvar pain in primary and secondary provoked vestibulodynia: a pilot study.

    Science.gov (United States)

    Sutton, Katherine; Pukall, Caroline; Wild, Conor; Johnsrude, Ingrid; Chamberlain, Susan

    2015-05-01

    Provoked vestibulodynia (PVD) is a common condition characterized by localized, provoked pain that can be present since first vaginal penetration attempt (primary) or can develop after a period of pain-free penetration (secondary). Research has demonstrated psychosocial and psychophysical differences between women with these subtypes of PVD, but the question of whether neural responses to pain also differ remains to be investigated. This study aims to examine whether cognitive, psychophysical, and neural responses to vulvar pressure pain differ between women with PVD1 and PVD2. Women with PVD1 and PVD2 were compared for group differences using multiple modalities, including questionnaires, psychophysical testing, and neuroimaging. Pain ratings were held constant across groups, rather than amount of pressure applied. Demographics, sexual functioning, four questionnaires examining anxiety and catastrophizing, quantitative sensory testing at the vulvar vestibule using a vulvalgesiometer, and functional and structural magnetic resonance imaging (MRI). Findings suggest that women with PVD1 are more anxious and that they catastrophize more about their vulvar and nonvulvar pain than women with PVD2. Overall, MRI results demonstrated structural and functional similarities to other chronic pain findings for both groups of women. Gray matter (GM) density also differed between groups: women with PVD1 showed significant decreases in GM throughout areas associated with pain processing. Functionally, between-groups differences were found during painful vulvar stimulation despite lower pressures applied to the vulva for women with PVD1 because of their heightened sensitivity; the determination of the level of vulvar pressure to elicit pain was based on subjective ratings. Findings are limited by sample size and liberal alpha values; however, future research is certainly warranted based on the preliminary findings of this study suggesting both similarities and differences between

  12. Body image in women with primary and secondary provoked vestibulodynia: a controlled study.

    Science.gov (United States)

    Maillé, Delphine L; Bergeron, Sophie; Lambert, Bernard

    2015-02-01

    Provoked vestibulodynia (PVD) is a women's genito-pelvic pain condition associated with psychosexual impairments, including depression. Body image (BI) has been found to be different in women with primary (PVD1) and secondary (PVD2) PVD. No controlled study has compared BI in women with PVD1 and PVD2 and investigated its associations with sexual satisfaction, sexual function, and pain. The aims of this study were to (i) compare BI in women with PVD1, PVD2, and asymptomatic controls and (ii) to examine associations between BI and sexual satisfaction, sexual function, and pain during intercourse in women with PVD. Fifty-seven women (20 with PVD1, 19 with PVD2, and 18 controls) completed measures of BI, sexual satisfaction, sexual function, pain during intercourse, and depression. The main outcome measures were (i) Global Measure of Sexual Satisfaction Scale, (ii) Female Sexual Function Index, and (iii) pain numerical rating scale. Controlling for depression, women with PVD1 reported more body exposure anxiety during sexual activities than women with PVD2 and controls F(2,51)=4.23, P=0.02. For women with PVD, more negative BI during sexual activities was associated with lower sexual satisfaction (β=-0.45, P=0.02) and function (β=-0.39, P=0.04) and higher pain during intercourse (β=0.59, P=0.004). More positive body esteem was associated with higher sexual function (β=0.34, P=0.05). Findings suggest that women with PVD1 present more body exposure anxiety during sexual activities than women with PVD2 and asymptomatic women. Body esteem and general attitudes toward women's genitalia were not significantly different between groups. Higher body exposure anxiety during sexual activities was associated with poorer sexual outcomes in women with PVD. Further studies assessing interventions targeting BI during sexual activities in this population are needed, as improving BI during sexual interactions may enhance sexual outcomes in women with PVD. © 2014 International

  13. PERIPAPILLARY RETINAL NERVE FIBER THICKNESS CHANGES AFTER VITRECTOMY FOR EPIRETINAL MEMBRANE IN EYES WITH AND WITHOUT VITREOUS DETACHMENT.

    Science.gov (United States)

    Mariotti, Cesare; Nicolai, Michele; Longo, Antonio; Viti, Francesca; Bambini, Elisa; Saitta, Andrea; Pirani, Vittorio; Orsini, Emanuele; Baruffa, Daniela; Reibaldi, Michele

    2017-12-01

    To compare the changes in postoperative peripapillary retinal nerve fiber layer (p-RNFL) thickness after vitrectomy for epiretinal membrane in eyes with preexisting posterior vitreous detachment (PVD) and eyes with surgically induced PVD. This study included consecutive patients who underwent 25-gauge vitrectomy for epiretinal membrane. Eyes were divided, according to intraoperative PVD status, into a preexisting PVD group and surgically induced PVD group. Best-corrected visual acuity, p-RNFL thickness, and central retinal thickness were performed before and at 1, 3, and 6 months after surgery. One hundred and twenty eyes of 120 patients were enrolled: 64 eyes in the preexisting PVD group and 56 eyes in the surgically induced PVD group. In the preexisting PVD group at 6 months, the mean global p-RNFL thickness did not change, whereas it was reduced in the temporal sector (P = 0.034). In the surgically induced PVD group at 6 months, significant decreases were observed in global p-RNFL thickness (P = 0.027), temporal (P = 0.021), temporal inferior (P = 0.030), and nasal inferior sectors (P = 0.010). At 6 months, the two groups differed significantly in temporal (P PVD.

  14. Galaxy and Mass Assembly (GAMA): small-scale anisotropic galaxy clustering and the pairwise velocity dispersion of galaxies

    Science.gov (United States)

    Loveday, J.; Christodoulou, L.; Norberg, P.; Peacock, J. A.; Baldry, I. K.; Bland-Hawthorn, J.; Brown, M. J. I.; Colless, M.; Driver, S. P.; Holwerda, B. W.; Hopkins, A. M.; Kafle, P. R.; Liske, J.; Lopez-Sanchez, A. R.; Taylor, E. N.

    2018-03-01

    The galaxy pairwise velocity dispersion (PVD) can provide important tests of non-standard gravity and galaxy formation models. We describe measurements of the PVD of galaxies in the Galaxy and Mass Assembly (GAMA) survey as a function of projected separation and galaxy luminosity. Due to the faint magnitude limit (r PVD to smaller scales (r⊥ = 0.01 h - 1 Mpc) than previous work. The measured PVD at projected separations r⊥ ≲ 1 h - 1 Mpc increases near monotonically with increasing luminosity from σ12 ≈ 200 km s - 1 at Mr = -17 mag to σ12 ≈ 600 km s - 1 at Mr ≈ -22 mag. Analysis of the Gonzalez-Perez et al. (2014) GALFORM semi-analytic model yields no such trend of PVD with luminosity: the model overpredicts the PVD for faint galaxies. This is most likely a result of the model placing too many low-luminosity galaxies in massive haloes.

  15. Pelvic floor muscle assessment outcomes in women with and without provoked vestibulodynia and the impact of a physical therapy program.

    Science.gov (United States)

    Gentilcore-Saulnier, Evelyne; McLean, Linda; Goldfinger, Corrie; Pukall, Caroline F; Chamberlain, Susan

    2010-02-01

    Physical therapy (PT) may reduce the pain associated with provoked vestibulodynia (PVD) based on previous findings that pelvic floor muscle dysfunction (PFMD) is associated with PVD symptoms. The goals of this study were: (i) to determine whether women with and without PVD differ on measures of pelvic floor muscle (PFM) behavior; and (ii) to assess the impact of PT treatment for women with PVD on these measures. Eleven women with PVD and 11 control women completed an assessment evaluating PFM behavior using surface electromyography (SEMG) recordings and a digital intravaginal assessment. Women with PVD repeated the assessment after they had undergone eight PT treatment sessions of manual therapy, biofeedback, electrical stimulation, dilator insertions, and home exercises. Superficial and deep PFM SEMG tonic activity and phasic activity in response to a painful pressure stimulus, PFM digital assessment variables (tone, flexibility, relaxation capacity, and strength). At pretreatment, women with PVD had higher tonic SEMG activity in their superficial PFMs compared with the control group, whereas no differences were found in the deep PFMs. Both groups demonstrated contractile responses to the painful pressure stimulus that were significantly higher in the superficial as compared with the deep PFMs, with the responses in the PVD group being higher than those in control women. Women with PVD had higher PFM tone, decreased PFM flexibility and lower PFM relaxation capacity compared with control women. Posttreatment improvements included less PFM responsiveness to pain, less PFM tone, improved vaginal flexibility, and improved PFM relaxation capacity, such that women with PVD no longer differed from controls on these measures. Women with PVD demonstrated altered PFM behavior when compared with controls, providing empirical evidence of PFMD, especially at the superficial layer. A PT rehabilitation program specifically targeting PFMD normalized PFM behavior in women with PVD.

  16. Provoked Vestibulodynia and the Health Care Implications of Comorbid Pain Conditions.

    Science.gov (United States)

    Lester, Robynn A; Brotto, Lori A; Sadownik, Leslie A

    2015-11-01

    Sexual pain secondary to provoked vestibulodynia (PVD) is a chronic pain condition affecting up to 16% of women. Women with PVD may report other chronic pain conditions. The goals of this study were (1) to identify the prevalence of self-reported chronic pain conditions in a sample of women with a diagnosis of PVD and seeking treatment, and (2) to compare demographic and clinical characteristics and health care needs of women with PVD alone and women with PVD and two or more self-reported chronic pain conditions. We assessed the characteristics of 236 women with PVD alone and 55 women with PVD and comorbid chronic pain using a standardized questionnaire, the Beck Depression Inventory, the State-Trait Anxiety Inventory, the Pain Vigilance and Awareness Questionnaire, and the Female Sexual Distress Scale. Compared with women with PVD alone, women with PVD and other concurrent pain reported a significantly longer duration of pain, pain radiating to other parts of the vulva, and pain interfering in a variety of daily activities. This group was also significantly more likely to have seen more gynaecologists, and to have had more office visits with their gynaecologist than women with PVD alone. They were more likely to have tried anticonvulsants, antidepressants, and stress/relaxation therapy for their PVD and were also more likely to have allergies and skin sensitivities. Finally, this group of women had higher symptoms of depression, trait anxiety, and showed a trend towards more pain vigilance. Taken together, these findings suggest that physicians caring for women with PVD and concurrent chronic pain must be alert to the potentially greater health needs among this subsample of women.

  17. Classification of posterior vitreous detachment

    OpenAIRE

    Kakehashi, Akihiro; Takezawa, Mikiko; Akiba, Jun

    2013-01-01

    Akihiro Kakehashi,1 Mikiko Takezawa,1 Jun Akiba21Department of Ophthalmology, Jichi Medical University, Saitama Medical Center, Saitama, 2Kanjodori Eye Clinic, Asahikawa, JapanAbstract: Diagnosing a posterior vitreous detachment (PVD) is important for predicting the prognosis and determining the indication for vitreoretinal surgery in many vitreoretinal diseases. This article presents both classifications of a PVD by slit-lamp biomicroscopy and of a shallow PVD by optical coherence tomography...

  18. UKPDS 59: hyperglycemia and other potentially modifiable risk factors for peripheral vascular disease in type 2 diabetes.

    Science.gov (United States)

    Adler, Amanda I; Stevens, Richard J; Neil, Andrew; Stratton, Irene M; Boulton, Andrew J M; Holman, Rury R

    2002-05-01

    To determine the role of hyperglycemia in prospective analyses of peripheral vascular disease (PVD) in type 2 diabetes, taking into account other potential risk factors. Potential risk factors for the development of PVD were examined in 3,834 of 5,102 individuals enrolled in the U.K. Prospective Diabetes Study (UKPDS) without PVD at diagnosis of diabetes, followed for 6 years, and for whom relevant data were available. PVD was defined as two of the following: ankle-arm blood pressure index < 0.8, absence of both dorsalis pedis and posterior tibial pulses to palpation in one or both legs, and intermittent claudication. Logistic regression was used to estimate the association between potential risk factors measured 3-4 months after diagnosis of diabetes and incident PVD. The prevalence of PVD at 3-year intervals to 18 years was determined. Hyperglycemia, assessed as HbA(1c), was associated with an increased risk for incident PVD, independent of other risk factors including age, increased systolic blood pressure, reduced HDL cholesterol, smoking, prior cardiovascular disease, peripheral sensory neuropathy, and retinopathy. Each 1% increase in HbA(1c) was associated with a 28% increased risk of PVD (95% CI 12-46), and each 10-mmHg increase in systolic blood pressure with a 25% increase in risk (95% CI 10-43). Hyperglycemia, as well as smoking, dyslipidemia, and blood pressure are potentially modifiable risk factors for the development of PVD.

  19. NRC Information No. 88-14: Potential problems with electrical relays

    International Nuclear Information System (INIS)

    Rossi, C.E.

    1992-01-01

    This information notice is being provided to alert recipients to potential problems involving HFA, PVD 21B, PVD 21D, and HGA relays manufactured by General Electric Company (GE), as described below. Although some of these problems are several years old, they are included because utilities are still identifying problems discovered while implementing advice issued by GE in the early 1980s. The specific problem with the HFA relays concerns mechanical binding in the relay caused by incorrect location of a stop tab that is welded to the armature. The problems with the PVD 21B, PVD 21D, and HGA concern their seismic capability

  20. Synthesis, iron(III) complexation properties, molecular dynamics simulations and P. aeruginosa siderophore-like activity of two pyoverdine analogs.

    Science.gov (United States)

    Antonietti, Viviane; Boudesocque, Stéphanie; Dupont, Laurent; Farvacques, Natacha; Cézard, Christine; Da Nascimento, Sophie; Raimbert, Jean-François; Socrier, Larissa; Robin, Thierry-Johann; Morandat, Sandrine; El Kirat, Karim; Mullié, Catherine; Sonnet, Pascal

    2017-09-08

    P. aeruginosa ranks among the top five organisms causing nosocomial infections. Among the many novel strategies for developing new therapeutics against infection, targeting iron uptake mechanism seems promising as P. aeruginosa needs iron for its growth and survival. To scavenge iron, the bacterium produces siderophores possessing a very high affinity towards Fe(III) ions such as pyoverdines. In this work, we decided to study two pyoverdine analogs, aPvd2 and aPvd3, structurally close to the endogen pyoverdine. The pFe constants calculated with the values of formation showed a high affinity of aPvd3 towards Fe(III). Molecular dynamics calculations demonstrated that aPvd3-Fe forms with Fe(III) stable 1:1 complexes in water, whereas aPvd2 does not. Only aPvd3 is able to increase the bacterial growth and represents thus an alternative to pyoverdine for iron acquisition by the bacterium. The aPvd2-3 interaction studies with a lipid membrane indicated that they were unable to interact and to cross the plasma membrane of bacteria by passive diffusion. Consequently, the penetration of aPvd3 is ruled by a transport membrane protein. These results showed that aPvd3 may be used to inhibit pyoverdine uptake or to promote the accumulation and release of antibiotics into the cell following a Trojan horse strategy. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  1. Doppler ultrasound exam of an arm or leg

    Science.gov (United States)

    Peripheral vascular disease - Doppler; PVD - Doppler; PAD - Doppler; Blockage of leg arteries - Doppler; Intermittent claudication - Doppler; Arterial insufficiency of the legs - Doppler; Leg pain and ...

  2. Hospital Readmissions in Diabetic Kidney Transplant Recipients with Peripheral Vascular Disease.

    Science.gov (United States)

    Lubetzky, Michelle; Kamal, Layla; Ajaimy, Maria; Akalin, Enver; Kayler, Liise

    2018-04-28

    The benefits of kidney transplantation in diabetic patients with peripheral vascular disease (PVD) are unclear. While patients may have improved survival compared to dialysis, the burden of care after transplant has not been assessed. We performed a retrospective review of adult diabetic kidney-only transplant recipients with and without PVD transplanted from January 2012 until June 30, 2015. Of 203 diabetic kidney transplant recipients, 56 (27.6%) had PVD and 147 (72.4%) had no PVD. At a median of 3.14 years follow up there were no significant differences in 30-, 90-, or 1-year readmission rates. At 1 year after transplant, PVD patients were significantly more likely to have a greater sum of unplanned inpatient days (44.6% versus 27.9% with ≥10 inpatient days, p=0.03) and at least one reoperation (28.6% vs. 8.7%, pPVD had significantly increased rates of non-graft related operations of which 31.2% were PVD related. Diabetic patients with PVD utilize more resources after kidney transplant, spending more time in the hospital and undergoing more post-transplant operations. The causes of readmission are predominantly related to progression of PVD rather than allograft complications. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  3. The effects of aging vitreous on contrast sensitivity function.

    Science.gov (United States)

    Garcia, Giancarlo A; Khoshnevis, Matin; Yee, Kenneth M P; Nguyen, Justin H; Nguyen-Cuu, Jeannie; Sadun, Alfredo A; Sebag, J

    2018-05-01

    Contrast sensitivity function (CSF) declines with age. When unassociated with cataracts, this is hypothesized to be due to macular ganglion cell complex (GCC) thinning. However, other studies found associations with increased vitreous echodensity and posterior vitreous detachment (PVD). We investigate the relationship between CSF, vitreous echodensity, PVD, and GCC thickness as related to age in the same subjects. Age, CSF (Weber index: %W), vitreous echodensity (quantitative ultrasonography [QUS]), lens status (phakia or pseudophakia), best-corrected visual acuity (BCVA), and GCC thickness (SD-OCT) were evaluated in 57 eyes of 57 subjects with (n = 32, mean age = 62 years) and without (n = 25, mean age = 44 years) PVD (P PVD (2.98 ± 0.31 %W) compared to no PVD (1.97 ± 0.24 %W; P PVD than those without (P PVD status, vitreous echodensity, and age were the only independent variables demonstrating significant effects on CSF. Lens status, BCVA, and GCC thickness did not demonstrate association with CSF. PVD, vitreous echodensity, and age are determinants of CSF. PVD and increased vitreous echodensity are each associated with diminished CSF, independent of age. Thus, in the absence of GCC thinning and cataracts, vitreous changes may be a cause of decreased CSF with age.

  4. Posterior Vitreous Detachment as Observed by Wide-Angle OCT Imaging.

    Science.gov (United States)

    Tsukahara, Mayuka; Mori, Keiko; Gehlbach, Peter L; Mori, Keisuke

    2018-04-06

    Posterior vitreous detachment (PVD) plays an important role in vitreoretinal interface disorders. Historically, observations of PVD using OCT have been limited to the macular region. The purpose of this study is to image the wide-angle vitreoretinal interface after PVD in normal subjects using montaged OCT images. An observational cross-sectional study. A total of 144 healthy eyes of 98 normal subjects aged 21 to 95 years (51.4±22.0 [mean ± standard deviation]). Montaged images of horizontal and vertical OCT scans through the fovea were obtained in each subject. Montaged OCT images. By using wide-angle OCT, we imaged the vitreoretinal interface from the macula to the periphery. PVD was classified into 5 stages: stage 0, no PVD (2 eyes, both aged 21 years); stage 1, peripheral PVD limited to paramacular to peripheral zones (88 eyes, mean age 38.9±16.2 years, mean ± standard deviation); stage 2, perifoveal PVD extending to the periphery (12 eyes, mean age 67.9±8.4 years); stage 3, peripapillary PVD with persistent vitreopapillary adhesion alone (7 eyes, mean age 70.9±11.9 years); stage 4, complete PVD (35 eyes, mean age 75.1±10.1 years). All stage 1 PVDs (100%) were observed in the paramacular to peripheral region where the vitreous gel adheres directly to the cortical vitreous and retinal surface. After progression to stage 2 PVD, the area of PVD extends posteriorly to the perifovea and anteriorly to the periphery. Vitreoschisis was observed in 41.2% at PVD initiation (stage 1a). Whereas prior work suggests that PVD originates in the perifoveal region and after the sixth decade, our observations demonstrate that (1) PVD first appears even in the third decade of life and gradually appears more extensively throughout life; (2) more than 40% of eyes without fundus diseases at their PVD initiation are associated with vitreoschisis; and (3) PVD is first noted primarily in the paramacular-peripheral region where vitreous gel adheres to the retinal surface and is

  5. Response of lactating dairy cows with or without purulent vaginal discharge to gonadotropin-releasing hormone and prostaglandin F2α.

    Science.gov (United States)

    Voelz, B E; Rocha, L; Scortegagna, F; Stevenson, J S; Mendonça, L G D

    2018-02-15

    Purulent vaginal discharge (PVD) is a common uterine disease in dairy cattle that has negative effects on reproductive performance. Reproductive management programs that synchronize ovulation use gonadotropin-releasing hormone (GnRH) to induce ovulation and prostaglandin F2α (PGF2α) to induce luteolysis. The objectives of this study were to evaluate ovarian response to treatment with GnRH and the odds of bearing a corpus luteum or being inseminated in dairy cows with or without PVD. Another objective was to determine the hazard of insemination after administration of PGF2α in dairy cows with or without PVD. Primiparous (n = 291) and multiparous (n = 402) cows were evaluated for PVD using a Metricheck device at 46 ± 3 and 35 ± 3 days in milk (DIM) (study day 0), respectively. On study day 14, primiparous (n = 107) and multiparous (n = 197) cows were treated with GnRH and subsequent ovulation was recorded. Primiparous (n = 178) and multiparous (n = 368) cows not inseminated by study day 21 were administered PGF2α and response to PGF2α treatment was determined by detection of estrus. Furthermore, cows were categorized by the presence of a CL or being inseminated by study days 14, 21, and 35. Overall prevalence of PVD was 28.5% and 13.4% for primiparous and multiparous cows, respectively. Projected 305-d milk yield was less (P PVD+ multiparous cows compared with PVD- multiparous cows, however, no (P = 0.26) difference was detected between primiparous PVD+ and PVD- cows. Ovulatory response to GnRH treatment was 51.8% and 47.8% for primiparous and multiparous cows, respectively. Primiparous PVD- cows tended (P = 0.06) to be less likely to ovulate to GnRH than primiparous PVD+ cows, whereas multiparous PVD+ cows were less (P = 0.04) likely to ovulate to GnRH than PVD- multiparous cows. The odds of bearing a corpus luteum or being inseminated by study days 14, 21, or 35 was not associated with PVD in primiparous cows. In contrast, the odds of bearing a corpus luteum

  6. Disease-Related Microstructural Differences in the Brain in Women With Provoked Vestibulodynia.

    Science.gov (United States)

    Gupta, Arpana; Woodworth, Davis C; Ellingson, Benjamin M; Rapkin, Andrea J; Naliboff, Bruce; Kilpatrick, Lisa A; Stains, Jean; Masghati, Salome; Tillisch, Kirsten; Mayer, Emeran A; Labus, Jennifer S

    2018-05-01

    Provoked vestibulodynia (PVD) is a chronic pelvic pain disorder affecting 16% of the female population. Neuroimaging studies have highlighted central abnormalities in PVD, similar to other chronic pelvic pain disorders, including brain regions involved in sensory processing and modulation of pain. The aim of the study was to determine alterations in the subvoxel, microstructural organization within tissues in PVD compared with healthy control participants (HCs) and a disease control group (irritable bowel syndrome [IBS]). Diffusion tensor imaging magnetic resonance imaging was conducted in 87 age-matched premenopausal women (29 PVD, 29 HCs, 29 IBS). Statistical parameter mapping of fractional anisotropy (FA) and mean diffusivity (MD) maps were used to identify microstructural difference in the brain specific to PVD or shared with IBS. PVD alterations in microstructural organization of the brain were predominantly observed in fibers associated with sensorimotor integration and pain processing that relay information between the thalamus, basal ganglia, sensorimotor, and insular cortex. PVD, compared with HCs, showed extensive increases in the FA of somatosensory and basal ganglia regions. In contrast, PVD and IBS subjects did not show any FA-related group differences. PVD subjects showed greater MD in the basal ganglia compared with HCs (higher MD in the internal capsule and pallidum) and IBS (higher MD in the putamen and pallidum). Increases in MD were associated with increased vaginal muscle tenderness and vulvar pain. The current findings highlight possible shared mechanisms between 2 different pelvic pain disorders, but also highlight the widespread alterations observed specifically in PVD compared with HCs. Alterations in microstructure in PVD were observed in fibers associated with sensorimotor integration and pain processing, which were also associated with increased vaginal muscle tenderness and vulvar pain. These alterations may be contributing to increased

  7. Optogenetic analysis of a nociceptor neuron and network reveals ion channels acting downstream of primary sensors

    Science.gov (United States)

    Husson, Steven J.; Costa, Wagner Steuer; Wabnig, Sebastian; Stirman, Jeffrey N.; Watson, Joseph D.; Spencer, W. Clay; Akerboom, Jasper; Looger, Loren L.; Treinin, Millet; Miller, David M.; Lu, Hang; Gottschalk, Alexander

    2012-01-01

    Summary Background Nociception generally evokes rapid withdrawal behavior in order to protect the tissue from harmful insults. Most nociceptive neurons responding to mechanical insults display highly branched dendrites, an anatomy shared by Caenorhabditis elegans FLP and PVD neurons, which mediate harsh touch responses. Although several primary molecular nociceptive sensors have been characterized, less is known about modulation and amplification of noxious signals within nociceptor neurons. First, we analyzed the FLP/PVD network by optogenetics and studied integration of signals from these cells in downstream interneurons. Second, we investigated which genes modulate PVD function, based on prior single neuron mRNA profiling of PVD. Results Selectively photoactivating PVD, FLP and downstream interneurons using Channelrhodopsin-2 (ChR2) enabled functionally dissecting this nociceptive network, without interfering signals by other mechanoreceptors. Forward or reverse escape behaviors were determined by PVD and FLP, via integration by command interneurons. To identify mediators of PVD function, acting downstream of primary nocisensor molecules, we knocked down PVD-specific transcripts by RNAi and quantified light-evoked PVD-dependent behavior. Cell-specific disruption of synaptobrevin or voltage-gated Ca2+-channels (VGCCs) showed that PVD signals chemically to command interneurons. Knocking down the DEG/ENaC channel ASIC-1 and the TRPM channel GTL-1 indicated that ASIC-1 may extend PVD’s dynamic range and that GTL-1 may amplify its signals. These channels act cell-autonomously in PVD, downstream of primary mechanosensory molecules. Conclusions Our work implicates TRPM channels in modifying excitability of, and DEG/ENaCs in potentiating signal output from a mechano-nociceptor neuron. ASIC-1 and GTL-1 homologues, if functionally conserved, may denote valid targets for novel analgesics. PMID:22483941

  8. Effect of pyoverdine supply on cadmium and nickel complexation and phytoavailability in hydroponics.

    Science.gov (United States)

    Ferret, C; Cornu, J Y; Elhabiri, M; Sterckeman, T; Braud, A; Jezequel, K; Lollier, M; Lebeau, T; Schalk, I J; Geoffroy, V A

    2015-02-01

    Siderophores are chelators with a high selectivity for Fe(III) and a good affinity for divalent metals, including Cd(II) and Ni(II). Inoculation with siderophore-producing bacteria (SPB) has thus been proposed as an alternative to chelator supply in phytoremediation. Accurate assessments of the potential of this association require a dissection of the interaction of siderophores with metals at the soil-root interface. This study focuses on pyoverdine (Pvd), the main siderophore produced by Pseudomonas aeruginosa. We first assessed the ability of Pvd to coordinate Ni(II). The stability constant of Pvd-Ni(II) (log K (L'Ni) = 10.9) was found to be higher than that of Pvd-Cd(II) (log K (L'Cd) = 8.2). We then investigated the effect of a direct supply of Pvd on the mobilization, speciation, and phytoavailability of Cd and Ni in hydroponics. When supplied at a concentration of 50 μM, Pvd selectively promoted Ni mobilization from smectite. It decreased plant Ni and Cd contents and the free ionic fractions of these two metals, consistent with the free ion activity model. Pvd had a more pronounced effect for Ni than for Cd, as predicted from its coordination properties. Inoculation with P. aeruginosa had a similar effect on Ni phytoavailability to the direct supply of Pvd.

  9. The decline of soil due to the pile of highway project Medan-Kualanamu (STA 35 + 901) with the finite element method

    Science.gov (United States)

    Hastuty, I. P.; Roesyanto; Sihite, A. B.

    2018-02-01

    Consolidation is the process of discharge of water from the ground through the pore cavity. Consolidation occurs in soft soil or unstable soil that allows an improvement in order to make the soil more stable. The method of using Prefabricated Vertical Drain (PVD) is one way to improve unstable soils. PVD works like a sand column that can drain water vertically. This study aims to determine the decrease, pore water pressure and soil consolidation rate with Prefabricated Vertical Drain (PVD) and without PVD analytically and using finite element method that affect the duration of soil decline to reach 90% consolidation or in other words soil does not decline anymore. Based on the analytical calculation, the decrease obtained is equal to 0.47 m meanwhile the result of calculation using finite element method is 0.45 m. The consolidation rate obtained from analytical calculation is 19 days with PVD and 115 days without PVD. The consolidation rate obtained from finite element method is 63 days with PVD and 110 days without PVD. And the pore water pressure is 0.92 KN/m2.

  10. Facilitators and barriers in the diagnostic process of vulvovaginal complaints (vulvodynia) in general practice: a qualitative study

    NARCIS (Netherlands)

    Leusink, Peter; Teunissen, Doreth; Lucassen, Peter L.; Laan, Ellen T.; Lagro-Janssen, Antoine L.

    2018-01-01

    Background: The gap between the relatively high prevalence of provoked vulvodynia (PVD) in the general population and the low incidence in primary care can partly be explained by physicians' lack of knowledge about the assessment and management of PVD. Objectives: To recognize barriers and

  11. Physical vapor deposited films of a perylene derivative: supramolecular arrangement and thermal stability

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Jose Diego; Alessio, Priscila; Silva, Matheus Rodrigues Medeiros; Aroca, Ricardo Flavio; Souza, Agda Eunice de; Constantino, Carlos Jose Leopoldo, E-mail: case@fct.unesp.br [Universidade Estadual Paulista Julio de Mesquita Filho (UNESP), Presidente Prudente, SP (Brazil). Dept. de Fisica

    2017-07-15

    The analysis of supramolecular arrangement is essential to understand the role of this key factor on the optical and electrical properties of organic thin films. In this work, thin solid films of bis(phenethylimido) perylene (PhPTCD) fabricated using physical vapor deposition (PVD) technique (thermal evaporation), deposited simultaneously onto different substrates (Ag mirror, Ge, and quartz plates) contingent on the characterization technique. The main objective is to study the PhPTCD supramolecular arrangement and the thermal stability of this arrangement in PVD films. The ultraviolet-visible absorption reveals a controlled growth of the PVD films, and the micro-Raman scattering data show that the PhPTCD molecule is not thermally degraded in the conditions of these experiments. The microscopy also shows a homogeneous morphological surface of the PVD film at macro and micro scales, with molecular aggregates at nanoscale. Besides, the PVD film roughness does not follow substrate roughness. The X-ray diffraction indicates a crystalline structure for PhPTCD powder and an amorphous form for PhPTCD PVD film. The infrared absorption spectroscopy points to a preferential flat-on organization of the molecules in the PVD films. In addition, the annealing process (200 deg C for 20 minutes) does not affect the supramolecular arrangement of the PhPTCD PVD films. (author)

  12. Frequency dependence of electrical properties of polyvinylidene fluoride/graphite electrode waste/natural carbon black composite

    Science.gov (United States)

    Insiyanda, D. R.; Indayaningsih, N.; Prihandoko, B.; Subhan, A.; Khaerudini, D. S.; Widodo, H.; Destyorini, F.; Chaer, A.

    2018-03-01

    Polyvinylidene fluoride (PVdF) is a semi-crystalline thermoplastic material with remarkably high piezoelectric coefficient and an attractive polymer matrix for micro-composite with superior mechanical and electrical properties. The conductive filler is obtained from Graphite Electrode Waste (GEW) and Natural Carbon Black (NCB). The variation of composite content (%) of PVdF/NCB/GEW were 100/0/0, 95/5/0, 95/0/5, 95/2.5/2.5. This experiment employed dry dispersion method for material mixing. The materials were then moulded using hot press machine with compression parameters of P = 5.5 MPa, T = 150 °C, t = 60 minutes, A = 5×5×(0.2 - 0.4) cm3. The electrical conductivity properties of pure PVdF, as well as PVdF/GEW, PVdF/NCB, and PVdF/NCB/GEW composites were investigated in a frequency range of 100 to 100000 Hz. The PVdF/GEW sample obtained the highest electrical conductivity. It is concluded that GEW and NCB can be incorporated into PVdF as a conductive filler to increase the conductivity of conductive material composite without solvent.

  13. Dynein and EFF-1 control dendrite morphology by regulating the localization pattern of SAX-7 in epidermal cells.

    Science.gov (United States)

    Zhu, Ting; Liang, Xing; Wang, Xiang-Ming; Shen, Kang

    2017-12-01

    Our previous work showed that the cell adhesion molecule SAX-7 forms an elaborate pattern in Caenorhabditis elegans epidermal cells, which instructs PVD dendrite branching. However, the molecular mechanism forming the SAX-7 pattern in the epidermis is not fully understood. Here, we report that the dynein light intermediate chain DLI-1 and the fusogen EFF-1 are required in epidermal cells to pattern SAX-7. While previous reports suggest that these two molecules act cell-autonomously in the PVD, our results show that the disorganized PVD dendritic arbors in these mutants are due to the abnormal SAX-7 localization patterns in epidermal cells. Three lines of evidence support this notion. First, the epidermal SAX-7 pattern was severely affected in dli-1 and eff-1 mutants. Second, the abnormal SAX-7 pattern was predictive of the ectopic PVD dendrites. Third, expression of DLI-1 or EFF-1 in the epidermis rescued both the SAX-7 pattern and the disorganized PVD dendrite phenotypes, whereas expression of these molecules in the PVD did not. We also show that DLI-1 functions cell-autonomously in the PVD to promote distal branch formation. These results demonstrate the unexpected roles of DLI-1 and EFF-1 in the epidermis in the control of PVD dendrite morphogenesis. © 2017. Published by The Company of Biologists Ltd.

  14. Physical vapor deposited films of a perylene derivative: supramolecular arrangement and thermal stability

    International Nuclear Information System (INIS)

    Fernandes, Jose Diego; Alessio, Priscila; Silva, Matheus Rodrigues Medeiros; Aroca, Ricardo Flavio; Souza, Agda Eunice de; Constantino, Carlos Jose Leopoldo

    2017-01-01

    The analysis of supramolecular arrangement is essential to understand the role of this key factor on the optical and electrical properties of organic thin films. In this work, thin solid films of bis(phenethylimido) perylene (PhPTCD) fabricated using physical vapor deposition (PVD) technique (thermal evaporation), deposited simultaneously onto different substrates (Ag mirror, Ge, and quartz plates) contingent on the characterization technique. The main objective is to study the PhPTCD supramolecular arrangement and the thermal stability of this arrangement in PVD films. The ultraviolet-visible absorption reveals a controlled growth of the PVD films, and the micro-Raman scattering data show that the PhPTCD molecule is not thermally degraded in the conditions of these experiments. The microscopy also shows a homogeneous morphological surface of the PVD film at macro and micro scales, with molecular aggregates at nanoscale. Besides, the PVD film roughness does not follow substrate roughness. The X-ray diffraction indicates a crystalline structure for PhPTCD powder and an amorphous form for PhPTCD PVD film. The infrared absorption spectroscopy points to a preferential flat-on organization of the molecules in the PVD films. In addition, the annealing process (200 deg C for 20 minutes) does not affect the supramolecular arrangement of the PhPTCD PVD films. (author)

  15. Probing the crossover in CO desorption from single crystal to nanoparticulate Ru model catalysts

    DEFF Research Database (Denmark)

    Murphy, Shane; Strebel, Christian Ejersbo; Vendelbo, Søren Bastholm

    2011-01-01

    Crossover in CO desorption behavior and nanoscale structure probed with STM from ruthenium single crystals to PVD and mass-selected nanoparticles.......Crossover in CO desorption behavior and nanoscale structure probed with STM from ruthenium single crystals to PVD and mass-selected nanoparticles....

  16. The eventual outcome of patients who had lower limb amputations ...

    African Journals Online (AJOL)

    C De Klerk

    Background: Peripheral vascular disease (PVD) presenting with irreversible lower limb pathology has a high morbidity and mortality rate. This study aimed to determine the outcome of patients who underwent lower limb amputations (LLAs) because of PVD at Pelonomi Hospital, Bloemfontein, 2008–2011. Methods: ...

  17. Sidestream dark field images of the microcirculation

    DEFF Research Database (Denmark)

    Petersen, Sandra M; Greisen, Gorm; Hyttel-Sorensen, Simon

    2014-01-01

    by the same blinded observer using validated software. Vessels were detected, generating the parameter Total Vessel Density (TVD), and flow was determined by (i) classifying each vessel separately, generating the parameters Perfused Vessel Density (PVD) and Proportion of Perfused Vessels (PPV), and by (ii...... than for PVD (ICC = 0.89, p

  18. The fellow eye of patients with phakic rhegmatogenous retinal detachment from atrophic holes of lattice degeneration without posterior vitreous detachment.

    Science.gov (United States)

    Gonzales, C R; Gupta, A; Schwartz, S D; Kreiger, A E

    2004-11-01

    Primary phakic rhegmatogenous retinal detachment (RRD) without posterior vitreous detachment (PVD) represents a unique clinical entity that behaves differently from RRD associated with PVD. While previous studies have reported the long term findings in the fellow eye of patients with RRD and PVD, the outcome of the fellow eye of patients with RRD without PVD is not known. Consecutive patients with RRD not associated with PVD were studied retrospectively. The authors evaluated the fellow eye for retinal detachment or other vision threatening pathology. 27 patients (mean age 32 years) were studied with follow up of between 9 and 326 months (mean 111 months). 24 (89%) were myopic. Bilateral retinal detachment occurred in eight patients (30%). On initial examination, 17 patients (63%) had retinal findings (including lattice degeneration, atrophic holes, and/or cystic retinal tufts) in the fellow eye that might predispose them to retinal detachment. 14 vision threatening events or diagnoses occurred (nine of which were rhegmatogenous in nature) in the fellow eye including eight retinal detachments, one traumatic PVD without retinal tears, one retinal tear after PVD, one diagnosis of pigmentary glaucoma needing trabeculectomy, two visually significant cataracts, and one diagnosis of chorioretinitis. 23 patients (85%) maintained visual acuity better than 20/50, with most retaining 20/20 vision in the fellow eye. Patients who experience RRD without PVD are at risk of developing vision threatening events in the contralateral eye and, as such, the fellow eye should be followed carefully.

  19. Transcutaneous Electrical Nerve Stimulation as an Additional Treatment for Women Suffering from Therapy-Resistant Provoked Vestibulodynia : A Feasibility Study

    NARCIS (Netherlands)

    Vallinga, Marleen S.; Spoelstra, Symen K.; Hemel, Inge L. M.; van de Wiel, Harry B. M.; Schultz, Willibrord C. M. Weijnnar

    IntroductionThe current approach to women with provoked vestibulodynia (PVD) comprises a multidimensional, multidisciplinary therapeutic protocol. As PVD is considered to be a chronic pain disorder, transcutaneous electrical nerve stimulation (TENS) can be used as an additional therapy for women

  20. Application of ultrasound in the diagnosis of posterior vitreous detachment

    Directory of Open Access Journals (Sweden)

    Hui-Wei Wang

    2013-12-01

    Full Text Available AIM: To investigate the utility of ultrasound in the diagnosis of posterior vitreous detachment(PVD. METHODS: From September 2011 to September 2012, 506 eyes of 305 cases(male 191, female 114of PVD patients in our hospital were checked and analyzed with ultrasound.RESULTS: Totally, 179 eyes were diagnosed as partial PVD, the proportion was 35.4%. And 327 eyes were diagnosed as complete PVD, the proportion was 64.6%. Among the 61 eyes(12.1%with a small amount of hemorrhage of vitreous humor,retinal breaks of 26 eyes(5.1%were founded. Given the photocoagulation nicely heal to the breaks and then recovered. CONCLUSION:Ultrasonography can accurately diagnose PVD. It has non-invasive,convenience, and other characteristics, and it is worthy of clinical popularization.

  1. Supramolecular structure of a perylene derivative in thin films deposited by physical vapor deposition

    International Nuclear Information System (INIS)

    Fernandes, Jose D.; Aoki, Pedro H.B.; Constantino, Carlos J.J.; Junior, Wagner D.M.; Teixeira, Silvio R.

    2014-01-01

    Full text: Thin films of a perylene derivative, the bis butylimido perylene (BuPTCD), were produced using thermal evaporation (PVD, physical vapor deposition). The main objective is to investigate the supramolecular structure of the BuPTCD in these PVD films, which implies to control the thickness and to determine the molecular organization, morphology at micro and nanometer scales and crystallinity. This supramolecular structure is a key factor in the optical and electrical properties of the film. The ultraviolet-visible absorption revealed an uniform growth of the PVD films. The optical and atomic force microscopy images showed a homogeneous surface of the film at micro and nanometer scales. A preferential orientation of the molecules in the PVD films was determined via infrared absorption. The X-ray diffraction showed that both powder and PVD film are in the crystalline form. (author)

  2. Risk factors for posterior vitreous detachment: a case-control study.

    Science.gov (United States)

    Chuo, Jean Y; Lee, Tracy Y Y; Hollands, Hussein; Morris, Andrew H; Reyes, Romina C; Rossiter, Jonathan D; Meredith, Sarah P; Maberley, David A L

    2006-12-01

    To identify possible risk factors for the development of posterior vitreous detachment (PVD). Retrospective case-control study. A total of 138 cases with PVD and 114 age-matched controls were accrued from two different sites. Demographic, medical, ocular, and lifestyle data were obtained through chart review, questionnaires, and clinical examination. A 108-item semiquantitative food frequency questionnaire was also used to estimate macro- and micronutrient intake. Univariate and multivariate regression analyses were employed to identify variables significantly associated with the main outcome measure of PVD. Subgroup analysis of gender-specific variables was performed. Among all patients, multivariate regression analysis demonstrated female gender (odds ratio [OR] = 2.01, P = .016), myopic refraction (OR = 4.32, P < .0005), and higher intake of vitamin B6 (OR = 2.61, P = .001) to be associated with PVD after controlling for age. In the subgroup analysis of women, menopause (OR = 18.2, P < .0005), myopic refraction (OR = 3.42, P = .01), and higher intake of vitamin B6 (OR = 3.92, P = .005) were associated with PVD. Specifically, there was a significant association between vitamin B6 and PVD amongst premenopausal women but not amongst postmenopausal women. An association between PVD and menopause has not been documented previously. We suspect that high estrogen levels seen in premenopausal women may be protective against PVD and that hormonal changes associated with menopause may lead to changes in the vitreous, predisposing to PVD. Higher levels of intake of vitamin B6 were also associated with the development of PVD in premenopausal women possibly through an anti-estrogen effect. These findings should be investigated further with prospective studies.

  3. The effect of solifenacin on postvoid dribbling in women: results of a randomized, double-blind placebo-controlled trial.

    Science.gov (United States)

    Ablove, Tova; Bell, Lauren N; Liang, Hong; Chappell, Richard J; Toklu, Hale Z; Yale, Steven H

    2018-03-24

    To determine the effectiveness of the muscarinic receptor antagonist solifenacin (VESIcare®) in the treatment of postvoid dribbling (PVD). We carried out a multicenter, 12-week, double-blind, randomized, placebo-controlled, parallel design study. Between 2012 and 2015, a total of 118 women (age 18-89 years) with PVD at least twice/weekly, were randomized to receive solifenacin (5 mg; n = 58) or placebo (n = 60) once daily. The primary outcome was the percentage reduction in PVD episodes. Secondary outcomes included the percentage of patients with ≥50% reduction in PVD episodes and changes in quality of life. There were no differences in either the primary or secondary outcome variables. Subgroup analysis, based on those with more severe disease (>10 PVD episodes/week), showed a greater and significant percentage reduction in the frequency of PVD episodes per day (60.3% vs 32.1%; p = 0.035) and a higher percentage of patients showing ≥50% reduction in the frequency of PVD episodes with solifenacin (68.1% vs 45.8%; p = 0.0476). A significant solifenacin effect occurred at week 2 and continued through week 12 for the subgroup. For solifenacin, PVD reduction was the same for the entire cohort and subgroup, whereas for placebo, it was 10% lower in the subgroup, declining from 42% to 32%. There were no differences in PVD outcomes between the solifenacin and placebo groups. Solifenacin may play a role in treating women with the most severe symptoms. Because of the powerful placebo response seen in this study, behavior-based interventions may be useful for treating PVD.

  4. Psychophysical properties of female genital sensation.

    Science.gov (United States)

    Farmer, Melissa A; Maykut, Caroline A; Huberman, Jackie S; Huang, Lejian; Khalifé, Samir; Binik, Yitzchak M; Apkarian, A Vania; Schweinhardt, Petra

    2013-11-01

    Provoked vestibulodynia (PVD) is characterized by the presence of vulvar touch and pain hypersensitivity. Pain with vaginal distension, which motivates treatment seeking and perpetuates distress, is frequently reported with PVD. However, the concordance between the perception of vulvar and vaginal sensation (ie, somatic and visceral genital sensations, respectively) remains unstudied in healthy women, as well as in clinical populations such as PVD. To evaluate the static and dynamic (time-varying) properties of somatic and visceral genital sensation, women with PVD (n=14) and age- and contraceptive-matched healthy controls (n=10) rated varying degrees of nonpainful and painful genital stimulation. Somatic (vulvar) mechanical sensitivity to nonpainul and painful degrees of force were compared to visceral (vaginal) sensitivity to nonpainful and painful distension volumes. Results indicated that healthy women showed substantial individual variation in and high discrimination of vulvar and vaginal sensation. In contrast, PVD was associated with vulvar allodynia and hyperalgesia, as well as vaginal allodynia. Modeling of dynamic perception revealed novel properties of abnormal PVD genital sensation, including temporal delays in vulvar touch perception and reduced perceptual thresholds for vaginal distension. The temporal properties and magnitude of PVD distension pain were indistinguishable from vaginal fullness in healthy controls. These results constitute the first empirical comparison of somatic and visceral genital sensation in healthy women. Findings provide novel insights into the sensory abnormalities that characterize PVD, including an experimental demonstration of visceral allodynia. This investigation challenges the prevailing diagnostic assessment of PVD and reconceptualizes PVD as a chronic somatic and visceral pain condition. Copyright © 2013. Published by Elsevier B.V.

  5. A Comparison of Approach and Avoidance Sexual Goals in Couples With Vulvodynia and Community Controls.

    Science.gov (United States)

    Dubé, Justin P; Bergeron, Sophie; Muise, Amy; Impett, Emily A; Rosen, Natalie O

    2017-11-01

    Provoked vestibulodynia (PVD) is a prevalent form of vulvodynia that interferes with the sexual and relational functioning of affected couples. Approach and avoidance sexual goals are associated with the sexual and relationship well-being of women with PVD and their partners. However, whether sexual goals differ in couples coping with PVD compared with community couples is unknown. To compare the approach and avoidance sexual goals of women with PVD and their partners with a control sample of community women and their partners to build on an established motivational model and to compare the sexual goals of women with PVD with those of their partners. Women diagnosed with PVD and their partners (n = 161) and control couples (n = 172) completed measures of approach and avoidance sexual goals. Approach and Avoidance Sexual Goals Questionnaire. Women with PVD reported lower approach and higher avoidance sexual goals than control women, whereas partners of women with PVD did not differ from control partners in their sexual goals. Women with PVD also reported lower approach and higher avoidance sexual goals compared with their partners, whereas there were no differences between partners in the control sample. Given that avoidance sexual goals have been linked to negative sexual and relational outcomes, clinicians could strive to help couples with PVD become aware of their sexual motives, with the aim of weakening avoidance sexual goals and bolstering approach sexual goals. This is the first study to empirically document differences in sexual goals between couples affected by PVD and community couples. Limitations include the study's correlational design, differences in demographic characteristics between samples, and the homogeneity of participants' sexual orientation. Findings suggest that the sexual goals of women affected by PVD differ from those of community women and from their partners and support sexual goals as targets for psychological interventions to help

  6. Preparation and characterization of poly(vinylidene fluoride) based composite electrolytes for electrochemical devices

    International Nuclear Information System (INIS)

    Karabelli, D.; Leprêtre, J.-C.; Cointeaux, L.; Sanchez, J.-Y.

    2013-01-01

    Highlights: • Macroporous PVdF based membranes for electrochemical applications were prepared with support materials. • Woven PET and PA fabrics and non-woven cellulose paper are used as support materials. • Porous structure of PVdF was obtained on the support material. • Interaction between the electrolyte solvent and the composite material played an important role on the mechanical properties. • Compared to the pure PVdF separators, enhanced mechanical strength was obtained for composite separators, without decreasing the ionic conductivity. -- Abstract: PVdF-based separators are very promising materials in electrochemical energy storage systems but they suffer from fairly poor mechanical properties. To overcome this drawback, composite PVdF separators were fabricated and characterized in electrolytes of Li-ion batteries and supercapacitors. Macroporous PVdF composite separators were prepared by phase inversion method using PA and PET, and non-woven cellulose as support layers. Ionic conductivity and thermomechanical analyses were performed using electrolytes of Li-ion batteries and supercapacitors. The composite approach allowed a tremendous increase of the mechanical performances of the separator (between 340 and 750 MPa) compared to the unreinforced PVdF separator (56 MPa), without compromising the ionic conductivities (up to 15.6 mS cm −1 )

  7. Incidence of dizziness and vertigo in Japanese primary care clinic patients with lifestyle-related diseases: an observational study.

    Science.gov (United States)

    Wada, Masaoki; Takeshima, Taro; Nakamura, Yosikazu; Nagasaka, Shoichiro; Kamesaki, Toyomi; Oki, Hiroshi; Kajii, Eiji

    2015-01-01

    Dizziness and vertigo are highly prevalent symptoms among patients presenting at primary care clinics, and peripheral vestibular disorder (PVD) is their most frequent cause. However, the incidence of PVD has not been well documented. This study aimed to investigate the incidence of dizziness, vertigo, and PVD among patients presenting at a primary care clinic. This was an observational study. Between November 2011 and March 2013, we observed 393 patients, all at least 20 years old, who had been treated for chronic diseases such as hypertension, dyslipidemia, and diabetes mellitus for at least 6 months at a primary clinic (Oki Clinic) in Japan. The main outcome of interest was new incidence of dizziness, vertigo, and PVD events. During the 1-year follow-up period, the otorhinolaryngologist diagnosed and reported new PVD events. The mean age of the 393 participants at entry was 65.5 years. Of the study participants, 12.7%, 82.4%, and 92.6% had diabetes mellitus, hypertension, and dyslipidemia, respectively. We followed up all the participants (100%). During the 662.5 person-years of follow-up, 121 cases of dizziness or vertigo (dizziness/vertigo) and 76 cases of PVD were observed. The incidence of dizziness/vertigo and PVD was 194.7 (95% confidence interval: 161.6-232.6) per 1,000 person-years and 115.7 (95% confidence interval: 92.2-142.6) per 1,000 person-years, respectively. There were 61 cases of acute peripheral vestibulopathy, 12 of benign paroxysmal positional vertigo, and three of Meniere's disease among the 76 PVD patients. We reported the incidence of dizziness/vertigo among Japanese primary care clinic patients, which was higher than that usually observed in the general population. Furthermore, we described the incidence of PVD and found that it was a major cause of dizziness/vertigo.

  8. Identification of type II and type III pyoverdine receptors from Pseudomonas aeruginosa.

    Science.gov (United States)

    de Chial, Magaly; Ghysels, Bart; Beatson, Scott A; Geoffroy, Valérie; Meyer, Jean Marie; Pattery, Theresa; Baysse, Christine; Chablain, Patrice; Parsons, Yasmin N; Winstanley, Craig; Cordwell, Stuart J; Cornelis, Pierre

    2003-04-01

    Pseudomonas aeruginosa produces, under conditions of iron limitation, a high-affinity siderophore, pyoverdine (PVD), which is recognized at the level of the outer membrane by a specific TonB-dependent receptor, FpvA. So far, for P. aeruginosa, three different PVDs, differing in their peptide chain, have been described (types I-III), but only the FpvA receptor for type I is known. Two PVD-producing P. aeruginosa strains, one type II and one type III, were mutagenized by a mini-TnphoA3 transposon. In each case, one mutant unable to grow in the presence of the strong iron chelator ethylenediaminedihydroxyphenylacetic acid (EDDHA) and the cognate PVD was selected. The first mutant, which had an insertion in the pvdE gene, upstream of fpvA, was unable to take up type II PVD and showed resistance to pyocin S3, which is known to use type II FpvA as receptor. The second mutant was unable to take up type III PVD and had the transposon insertion in fpvA. Cosmid libraries of the respective type II and type III PVD wild-type strains were constructed and screened for clones restoring the capacity to grow in the presence of PVD. From the respective complementing genomic fragments, type II and type III fpvA sequences were determined. When in trans, type II and type III fpvA restored PVD production, uptake, growth in the presence of EDDHA and, in the case of type II fpvA, pyocin S3 sensitivity. Complementation of fpvA mutants obtained by allelic exchange was achieved by the presence of cognate fpvA in trans. All three receptors posses an N-terminal extension of about 70 amino acids, similar to FecA of Escherichia coli, but only FpvAI has a TAT export sequence at its N-terminal end.

  9. Incidence of dizziness and vertigo in Japanese primary care clinic patients with lifestyle-related diseases: an observational study

    Science.gov (United States)

    Wada, Masaoki; Takeshima, Taro; Nakamura, Yosikazu; Nagasaka, Shoichiro; Kamesaki, Toyomi; Oki, Hiroshi; Kajii, Eiji

    2015-01-01

    Objective Dizziness and vertigo are highly prevalent symptoms among patients presenting at primary care clinics, and peripheral vestibular disorder (PVD) is their most frequent cause. However, the incidence of PVD has not been well documented. This study aimed to investigate the incidence of dizziness, vertigo, and PVD among patients presenting at a primary care clinic. Design This was an observational study. Setting and participants Between November 2011 and March 2013, we observed 393 patients, all at least 20 years old, who had been treated for chronic diseases such as hypertension, dyslipidemia, and diabetes mellitus for at least 6 months at a primary clinic (Oki Clinic) in Japan. Outcome The main outcome of interest was new incidence of dizziness, vertigo, and PVD events. During the 1-year follow-up period, the otorhinolaryngologist diagnosed and reported new PVD events. Results The mean age of the 393 participants at entry was 65.5 years. Of the study participants, 12.7%, 82.4%, and 92.6% had diabetes mellitus, hypertension, and dyslipidemia, respectively. We followed up all the participants (100%). During the 662.5 person-years of follow-up, 121 cases of dizziness or vertigo (dizziness/vertigo) and 76 cases of PVD were observed. The incidence of dizziness/vertigo and PVD was 194.7 (95% confidence interval: 161.6–232.6) per 1,000 person-years and 115.7 (95% confidence interval: 92.2–142.6) per 1,000 person-years, respectively. There were 61 cases of acute peripheral vestibulopathy, 12 of benign paroxysmal positional vertigo, and three of Meniere’s disease among the 76 PVD patients. Conclusion We reported the incidence of dizziness/vertigo among Japanese primary care clinic patients, which was higher than that usually observed in the general population. Furthermore, we described the incidence of PVD and found that it was a major cause of dizziness/vertigo. PMID:25931828

  10. Structural properties of In2Se3 precursor layers deposited by spray pyrolysis and physical vapor deposition for CuInSe2 thin-film solar cell applications

    International Nuclear Information System (INIS)

    Reyes-Figueroa, P.; Painchaud, T.; Lepetit, T.; Harel, S.; Arzel, L.; Yi, Junsin; Barreau, N.; Velumani, S.

    2015-01-01

    The structural properties of In 2 Se 3 precursor thin films grown by chemical spray pyrolysis (CSP) and physical vapor deposition (PVD) methods were compared. This is to investigate the feasibility to substitute PVD process of CuInSe 2 (CISe) films by CSP films as precursor layer, thus decreasing the production cost by increasing material-utilization efficiency. Both films of 1 μm thickness were deposited at the same substrate temperature of 380 °C. X-ray diffraction and Raman spectra confirm the formation of γ-In 2 Se 3 crystalline phase for both films. The PVD and CSP films exhibited (110) and (006) preferred orientations, respectively. The PVD films showed a smaller full width at half maximum value (0.09°) compared with CSP layers (0.1°). Films with the same crystalline phase but with different orientations are normally used in the preparation of high quality CISe films by 3-stage process. Scanning electron microscope cross-section images showed an important difference in grain size with well-defined larger grains of size 1–2 μm in the PVD films as compared to CSP layers (600 nm). Another important characteristic that differentiates the two precursor films is the oxygen contamination. X-ray photoelectron spectroscopy showed the presence of oxygen in CSP films. The oxygen atoms could be bonded to indium by replacing Se vacancies, which are formed during CSP deposition. Taking account of the obtained results, such CSP films can be used as precursor layer in a PVD process in order to produce CISe absorber films. - Highlights: • To find the intricacies involved in spray pyrolysis (CSP) and physical vapor (PVD) deposition. • Comparison of CSP and PVD film formations — especially in structural properties. • Feasibility to substitute CSP (cheaper) films for PVD in the manufacturing process. • Decreasing the global production cost of Cu(In,Ga)Se 2 devices in the 3-stage process

  11. Missed retinal breaks in rhegmatogenous retinal detachment

    Directory of Open Access Journals (Sweden)

    Brijesh Takkar

    2016-12-01

    Full Text Available AIM: To evaluate the causes and associations of missed retinal breaks (MRBs and posterior vitreous detachment (PVD in patients with rhegmatogenous retinal detachment (RRD. METHODS: Case sheets of patients undergoing vitreo retinal surgery for RRD at a tertiary eye care centre were evaluated retrospectively. Out of the 378 records screened, 253 were included for analysis of MRBs and 191 patients were included for analysis of PVD, depending on the inclusion criteria. Features of RRD and retinal breaks noted on examination were compared to the status of MRBs and PVD detected during surgery for possible associations. RESULTS: Overall, 27% patients had MRBs. Retinal holes were commonly missed in patients with lattice degeneration while missed retinal tears were associated with presence of complete PVD. Patients operated for cataract surgery were significantly associated with MRBs (P=0.033 with the odds of missing a retinal break being 1.91 as compared to patients with natural lens. Advanced proliferative vitreo retinopathy (PVR and retinal bullae were the most common reasons for missing a retinal break during examination. PVD was present in 52% of the cases and was wrongly assessed in 16%. Retinal bullae, pseudophakia/aphakia, myopia, and horse shoe retinal tears were strongly associated with presence of PVD. Traumatic RRDs were rarely associated with PVD. CONCLUSION: Pseudophakic patients, and patients with retinal bullae or advanced PVR should be carefully screened for MRBs. Though Weiss ring is a good indicator of PVD, it may still be over diagnosed in some cases. PVD is associated with retinal bullae and pseudophakia, and inversely with traumatic RRD.

  12. Characterization of Beryllium Windows for Coherent X-ray Optics

    International Nuclear Information System (INIS)

    Goto, Shunji; Yabashi, Makina; Tamasaku, Kenji; Ishikawa, Tetsuya

    2007-01-01

    Beryllium foils fabricated by several processes were characterized using spatially coherent x rays at 1-km beamline of SPring-8. By thickness dependence of bright x-ray spot density due to Fresnel diffraction from several-micron deficiencies, we found that speckles (bright x-ray spots) were due to voids with densities 103-104 mm-3 in powder foils and ingot foils. Compared with powder and ingot foils, a polished physical-vapor-deposited (PVD) beryllium foil gave highly uniform beams with no speckles. The PVD process eliminates the internal voids in principle and the PVD foil is the best for coherent x-ray applications

  13. Determining Iron Content in Foods by Spectrophotometry.

    Science.gov (United States)

    Adams, Paul E.

    1995-01-01

    Describes a laboratory experiment for secondary school chemistry students utilizing the classic reaction between the iron(III) ion and the thiocyanate ion. The experiment also works very well in other chemistry courses as an experience in spectrophotometric analysis. (PVD)

  14. Ethnic differences in the association between angiotensin-converting enzyme gene insertion/deletion polymorphism and peripheral vascular disease: A meta-analysis

    Directory of Open Access Journals (Sweden)

    Chao Han

    2017-12-01

    Conclusion: ACE I/D polymorphism might be associated with susceptibility to PVD in the Asian population, but there was no clear evidence indicating a similar significant relationship among Caucasians.

  15. Formation of permeation barriers on ceramic SiC/SiC composites

    International Nuclear Information System (INIS)

    Racault, C.; Fenici, P.

    1996-01-01

    The effectiveness as permeation barriers of the following CVD and PVD (sputtering) coatings has been investigated: TiC+Al 2 O 3 (CVD), SiC(CVD), SiO 2 (CVD), TiN(CVD), TiN(CVD)+TiN(PVD) and SiC(CVD)+Al 2 O 3 (PVD). The substrate material was a SiC/SiC composite, proposed as low activation structural material for fusion applications. Permeation measurements were performed in the temperature range 300-750 K using deuterium at pressures in the range 0.5-150 kPa. A linear dependence of permeation rate on pressure was measured. The efficiency of the coatings as deuterium permeation barriers is discussed in terms of coating microstructure. The best result was obtained with a bilayer of TiN(CVD) (15 μm) +TiN(PVD) (8 μm). (orig.)

  16. Improved performance of GaN based light emitting diodes with ex-situ sputtered AlN nucleation layers

    Directory of Open Access Journals (Sweden)

    Shuo-Wei Chen

    2016-04-01

    Full Text Available The crystal quality, electrical and optical properties of GaN based light emitting diodes (LEDs with ex-situ sputtered physical vapor deposition (PVD aluminum nitride (AlN nucleation layers were investigated. It was found that the crystal quality in terms of defect density and x-ray diffraction linewidth was greatly improved in comparison to LEDs with in-situ low temperature GaN nucleation layer. The light output power was 3.7% increased and the reverse bias voltage of leakage current was twice on LEDs with ex-situ PVD AlN nucleation layers. However, larger compressive strain was discovered in LEDs with ex-situ PVD AlN nucleation layers. The study shows the potential and constrain in applying ex-situ PVD AlN nucleation layers to fabricate high quality GaN crystals in various optoelectronics.

  17. Optical coating preparation

    International Nuclear Information System (INIS)

    Belleville, P.; Sabary, F.; Marcel, C.

    2003-01-01

    In order to optimize the properties of optical components, thin film deposition with controlled thickness and refractive index is often needed. Two different deposition techniques are proposed in this article and illustrated with examples: physical vapor deposition (PVD) and liquid sol-gel process (LSG). PVD and LSG techniques are equivalent as far as the following topics are concerned: elaboration of oxide or composite coated material, optical performance, mechanical performance, and laser performance. PVD is better for the elaboration of metallic films, the design of multi-layers or complex pile-up of layers. LSG is better for the treatment of large surfaces, for substrates with complicated shapes and for its low cost. PVD technique has been widely used so it benefited from an industrial maturity and a clean technology concerning wastes and effluents. On the contrary LSG is a new technique not yet widely used in industrial processes but that looks promising. (A.C.)

  18. Hardness and Elastic Modulus of Titanium Nitride Coatings Prepared by Pirac Method

    Science.gov (United States)

    Wu, Siyuan; Wu, Shoujun; Zhang, Guoyun; Zhang, Weiguo

    In the present work, hardness and elastic modulus of a titanium nitride coatings prepared on Ti6Al4V by powder immersion reaction-assisted coating (PIRAC) are tested and comparatively studied with a physical vapor deposition (PVD) TiN coating. Surface hardness of the PIRAC coatings is about 11GPa, much lower than that of PVD coating of 22GPa. The hardness distribution profile from surface to substrate of the PVD coatings is steeply decreased from ˜22GPa to ˜4.5GPa of the Ti6Al4V substrate. The PIRAC coatings show a gradually decreasing hardness distribution profile. Elastic modulus of the PVD coating is about 426GPa. The PIRAC coatings show adjustable elastic modulus. Elastic modulus of the PIRAC coatings prepared at 750∘C for 24h and that at 800∘C for 8h is about 234 and 293GPa, respectively.

  19. iMAST Quarterly, Number 2, 2003

    National Research Council Canada - National Science Library

    Singh, Jogender; Wolfe, Douglas E

    2003-01-01

    .... This issue features an article on: Tailored Microstructure of Zirconia and Hafnia-Based Thermal Barrier Coatings with Low Thermal Conductivity and High Hemispherical Reflectance by EB-PVD, as well as Institute Notes, personnel changes...

  20. Sarcomeres pattern proprioceptive sensory dendritic endings through Perlecan/UNC-52 in C. elegans

    Science.gov (United States)

    Liang, Xing; Dong, Xintong; Moerman, Donald G.; Shen, Kang; Wang, Xiangming

    2015-01-01

    Sensory dendrites innervate peripheral tissues through cell-cell interactions that are poorly understood. The proprioceptive neuron PVD in C. elegans extends regular terminal dendritic branches between muscle and hypodermis. We found that the PVD branch pattern was instructed by adhesion molecule SAX-7/L1CAM, which formed regularly spaced stripes on the hypodermal cell. The regularity of the SAX-7 pattern originated from the repeated and regularly spaced dense body of the sarcomeres in the muscle. The extracellular proteoglycan, UNC-52/Perlecan, links the dense body to the hemidesmosome on the hypodermal cells, which in turn instructed the SAX-7 stripes and PVD dendrites. Both UNC-52 and hemidesmosome components exhibited highly regular stripes that interdigitated with the SAX-7 stripe and PVD dendrites, reflecting the striking precision of subcellular patterning between muscle, hypodermis and dendrites. Hence, the muscular contractile apparatus provides the instructive cues to pattern proprioceptive dendrites. PMID:25982673

  1. Incidence and causes of iatrogenic retinal breaks in idiopathic macular hole and epiretinal membrane.

    Science.gov (United States)

    Yagi, Fumihiko; Takagi, Seiji; Tomita, Goji

    2014-03-01

    To evaluate the incidence and cause of iatrogenic retinal breaks (RBs) and postoperative retinal detachment (RD) in cases of idiopathic macular hole (MH) and epiretinal membrane (ERM). We analyzed 79 eyes with MH and 41 eyes with ERM, the relationship between the incidence of RBs and RD, and the frequency of posterior vitreous detachment (PVD) and lattice degeneration (LD). The incidence of RBs related to the operation was significantly higher in eyes with MH. The frequency of PVD was significantly higher in eyes with ERM. The frequency of LD did not differ between groups. In the MH group, the incidence of RBs related to the operation was high in eyes without PVD, but with LD. We observed four cases of RD in the MH group. The MH group had higher incidence of RBs related to the operation, especially in eyes without PVD or with LD.

  2. The effects of exercise training in patients with peripheral vascular ...

    African Journals Online (AJOL)

    mon tools to assess walking tolerance in patients with PVD. A wide variety of ... Department of Sport Management. Faculty of ... cise to maximal claudication pain in order to elicit the best training ..... Edinburgh artery study: Prevalence of ...

  3. Radiation-induced crosslinking of poly(vinylidene fluoride)

    International Nuclear Information System (INIS)

    Makuuchi, Keizo

    1977-07-01

    The factors influencing radiation-induced crosslinking efficiency of poly(vinylidene fluoride) (PVdF) have been studied. Results of the basic research on irradiation conditions (dose rate and atmosphere) and initial physical properties of PVdF (structure of molecular chain and molecular mobility of chain segment) showed that crosslinking efficiency is raised in irradiation at high temperature above 50 0 C under vacuum in the presence of an absorbent for the evolved hydrogen fluoride. The crosslinking reaction is also accelerated with irregular molecular structure such as head-to-head bond in main chain. High crosslinking efficiency is obtained by addition of a polyfunctional monomer having good solubility with PVdF. Mechanical properties of PVdF, the strength at high temperature near the melting point in particular, are improved by crosslinking in the presence of a polyfunctional monomer. (auth.)

  4. Effectiveness of intrauterine treatment with cephapirin in dairy cows with purulent vaginal discharge.

    Science.gov (United States)

    Tison, N; Bouchard, E; DesCôteaux, L; Lefebvre, R C

    2017-02-01

    The objective of this study was to assess the efficacy of cephapirin intrauterine treatment preceding a timed artificial insemination protocol in lactating dairy cows with purulent vaginal discharges (PVDs). Holstein dairy cows (n = 1247) from 18 herds were enrolled in a controlled randomized clinical trial. At 34 days in milk (DIM; ±7 days), cows had a genital examination (transrectal palpation, vaginoscopy, and uterine bacteriology). They were randomly assigned to either the control group (CONT, no treatment) or the treatment group (CEPH) consisting of 1 intrauterine infusion of 500-mg cephapirin benzathine (RCL) (Metricure, Merck Animal Health, Montreal, Canada) regardless of the uterine health status. All cows were systematically enrolled in a presynch-ovsynch protocol for the first insemination. A second genital examination was made 2 weeks later. Cows that received any systemic or local antibiotics 10 days prior sampling to the end of the synchronization protocol were excluded from the study. Reproductive data of cows were collected for at least 300 DIM, entered in a databank, and validated (health record management software, DSAHR). Pregnancy diagnosis was done by transrectal palpation at the routinely scheduled veterinarian visits. On the basis of the highest sum of sensibility and specificity for pregnancy status at 120 DIM, the optimal cutoff for vaginal discharge score was determined as the presence of cloudy discharge with or without purulent material (PVD+, score 2). With a prevalence of 21.6% at 34 DIM, PVD+ was detrimental to the first-service conception rate (FSCR; PVD+: 26 ± 5%; PVD-: 40 ± 3%; P = 0.02). The negative effect of PVD+ was indicated by a hazard ratio of 0.72 (chi-square = 8.58; P < 0.01; 95% confidence interval = 0.56-0.91). Treatment with cephapirin was associated with a significant improvement of the FSCR in PVD+ cows (PVD+ CEPH: 36 ± 5%, PVD+ CONT: 23 ± 5%; P < 0.05), although it did not produce a

  5. Microtexture of the thermally grown alumina in commercial thermal barrier coatings

    Energy Technology Data Exchange (ETDEWEB)

    Karadge, M. [School of Materials, University of Manchester, Grosvenor St., Manchester M1 7HS (United Kingdom); Zhao, X. [School of Materials, University of Manchester, Grosvenor St., Manchester M1 7HS (United Kingdom); Preuss, M. [School of Materials, University of Manchester, Grosvenor St., Manchester M1 7HS (United Kingdom); Xiao, P. [School of Materials, University of Manchester, Grosvenor St., Manchester M1 7HS (United Kingdom)]. E-mail: Ping.Xiao@manchester.ac.uk

    2006-02-15

    otextures of the thermally grown {alpha}-alumina (TGO) in isothermally treated and thermal cycled electron beam physical vapor deposited thermal barrier coatings (EB-PVD-TBC) and isothermally treated air plasma sprayed (APS-TBC) specimens were studied by high resolution electron back-scattered diffraction. The TGO in EB-PVD specimens exhibited a basal microtexture. The TGO in APS specimens, however, did not show any significant microtexture development.

  6. Vapor phase coatings of metals and organics for laser fusion target applications

    International Nuclear Information System (INIS)

    Simonsic, G.A.; Powell, B.W.

    Techniques for applying a variety of metal and organic coatings to 50- to 500 μm diameter glass micro-balloons are discussed. Coating thicknesses vary from 1- to 10 μm. Physical vapor deposition (PVD), chemical vapor deposition (CVD), and electrolytic and electroless plating are some of the techniques being evaluated for metal deposition. PVD and glow discharge polymerization are being used for the application of organic coatings. (U.S.)

  7. Can Fear, Pain, and Muscle Tension Discriminate Vaginismus from Dyspareunia/Provoked Vestibulodynia? Implications for the New DSM-5 Diagnosis of Genito-Pelvic Pain/Penetration Disorder.

    Science.gov (United States)

    Lahaie, Marie-Andrée; Amsel, Rhonda; Khalifé, Samir; Boyer, Stephanie; Faaborg-Andersen, Marie; Binik, Yitzchak M

    2015-08-01

    Fear has been suggested as the crucial diagnostic variable that may distinguish vaginismus from dyspareunia. Unfortunately, this has not been systematically investigated. The primary purpose of this study, therefore, was to investigate whether fear as evaluated by subjective, behavioral, and psychophysiological measures could differentiate women with vaginismus from those with dyspareunia/provoked vestibulodynia (PVD) and controls. A second aim was to re-examine whether genital pain and pelvic floor muscle tension differed between vaginismus and dyspareunia/PVD sufferers. Fifty women with vaginismus, 50 women with dyspareunia/PVD, and 43 controls participated in an experimental session comprising a structured interview, pain sensitivity testing, a filmed gynecological examination, and several self-report measures. Results demonstrated that fear and vaginal muscle tension were significantly greater in the vaginismus group as compared to the dyspareunia/PVD and no-pain control groups. Moreover, behavioral measures of fear and vaginal muscle tension were found to discriminate the vaginismus group from the dyspareunia/PVD and no-pain control groups. Genital pain did not differ significantly between the vaginismus and dyspareunia/PVD groups; however, genital pain was found to discriminate both clinical groups from controls. Despite significant statistical differences on fear and vaginal muscle tension variables between women suffering from vaginismus and dyspareunia/PVD, a large overlap was observed between these conditions. These findings may explain the great difficulty health professionals experience in attempting to reliably differentiate vaginismus from dyspareunia/PVD. The implications of these data for the new DSM-5 diagnosis of Genito-Pelvic Pain/Penetration Disorder are discussed.

  8. GCH1-polymorphism and pain sensitivity among women with provoked vestibulodynia

    Directory of Open Access Journals (Sweden)

    Heddini Ulrika

    2012-09-01

    Full Text Available Abstract Background Provoked vestibulodynia (PVD is a pain disorder localized in the vestibular mucosa. It is the most common cause of dyspareunia among young women and it is associated with general pain hypersensitivity and other chronic pain conditions. Polymorphism in the guanosine triphosphate cyclohydrolase (GCH1 gene has been found to influence general pain sensitivity and the risk of developing a longstanding pain condition. The aim of this study was to investigate GCH1-polymorphism in women with PVD and healthy controls, in correlation to pain sensitivity. Results We found no correlation between the previously defined pain-protective GCH1-SNP combination and the diagnosis of PVD. Nor any correlation with pain sensitivity measured as pressure pain thresholds on the arm, leg and in the vestibule, coital pain scored on a visual analog scale and prevalence of other bodily pain conditions among women with PVD (n = 98 and healthy controls (n = 102. However, among patients with current treatment (n = 36, there was a significant interaction effect of GCH1-gene polymorphism and hormonal contraceptive (HC therapy on coital pain (p = 0.04 as well as on pressure pain thresholds on the arm (p = 0.04. PVD patients carrying the specified SNP combination and using HCs had higher pain sensitivity compared to non-carriers. In non-HC-users, carriers had lower pain sensitivity. Conclusions The results of this study gave no support to the hypothesis that polymorphism in the GCH1-gene contributes to the etiology of PVD. However, among patients currently receiving treatment an interaction effect of the defined SNP combination and use of hormonal contraceptives on pain sensitivity was found. This finding offers a possible explanation to the clinically known fact that some PVD patients improve after cessation of hormonal contraceptives, indicating that PVD patients carrying the defined SNP combination of GCH1 would benefit from this

  9. Treatment of Provoked Vulvodynia in a Swedish cohort using desensitization exercises and cognitive behavioral therapy

    OpenAIRE

    Lindstr?m, Suzanne; Kvist, Linda J.

    2015-01-01

    Background Problems related to pain during vaginal penetration are complex and the etiology is multi-factorial. It was the aim of the present study to measure whether treatment using desensitization exercises and cognitive behavioral therapy (CBT) for women with provoked vulvodynia (PVD) could increase sexual interest, sexual satisfaction and response whilst decreasing experiences of sexual pain. Methods and outcome measures Sixty women suffering from PVD were treated during a 10-week period ...

  10. Provoked Vestibulodynia: Does Pain Intensity Correlate With Sexual Dysfunction and Dissatisfaction?

    Science.gov (United States)

    Aerts, Leen; Bergeron, Sophie; Pukall, Caroline F; Khalifé, Samir

    2016-06-01

    Provoked vestibulodynia (PVD) is suspected to be the most frequent cause of vulvodynia in premenopausal women. Previous research has been inconclusive as to whether higher vulvovaginal pain ratings are associated with lower sexual function and satisfaction in women with PVD. Whether pain intensity correlates with sexual impairment is an important question given its implications for treatment recommendations. To examine the associations among self-reported and objective pain measurements, sexual function, and sexual satisfaction in a large combined clinical and community sample of premenopausal women diagnosed with PVD. Ninety-eight women with PVD underwent a cotton-swab test, a vestibular friction pain measurement, and a vestibular pressure-pain threshold measurement. In addition to sociodemographics, participants completed measurements of pain, sexual function, and sexual satisfaction. Self-report measurements were the pain numerical rating scale (0-10), the McGill-Melzack Pain Questionnaire, the Female Sexual Function Index, and the Global Measure of Sexual Satisfaction. Objective measurements were pain during a cotton-swab test, pain during a vestibular friction procedure, and the vestibular pressure-pain threshold measurement. Age and relationship duration were significantly correlated with the Female Sexual Function Index total score (r = -0.31, P sexual function and satisfaction in women with PVD. The findings show that in women with PVD, self-report and objective pain ratings are not associated with sexual function and satisfaction. The results support the biopsychosocial nature of PVD and underscore the importance of a patient-focused multidisciplinary treatment approach for PVD. Copyright © 2016 International Society for Sexual Medicine. Published by Elsevier Inc. All rights reserved.

  11. Quantitative near-infrared spectroscopy on patients with peripheral vascular disease

    OpenAIRE

    Franceschini, MA; Fantini, S; Palumbo, R; Pasqualini, L; Vaudo, G; Franceschini, E; Gratton, E; Palumbo, B; Innocente, S; Mannarino, E

    1997-01-01

    We have used near-infrared spectroscopy to measure the hemoglobin saturation at rest and during exercise on patients affected by peripheral vascular disease (PVD). The instrument used in our study is a frequency-domain tissue oximeter which employs intensity modulated (110 MHz) laser diodes. We examined 9 subjects, 3 of which were controls and 6 were patients affected by stage II PVD. The optical probe was located on the calf muscle of the subjects. The measurement protocol consisted of: (1) ...

  12. Transcutaneous electrical nerve stimulation as an additional treatment for women suffering from therapy-resistant provoked vestibulodynia: a feasibility study.

    Science.gov (United States)

    Vallinga, Marleen S; Spoelstra, Symen K; Hemel, Inge L M; van de Wiel, Harry B M; Weijmar Schultz, Willibrord C M

    2015-01-01

    The current approach to women with provoked vestibulodynia (PVD) comprises a multidimensional, multidisciplinary therapeutic protocol. As PVD is considered to be a chronic pain disorder, transcutaneous electrical nerve stimulation (TENS) can be used as an additional therapy for women with otherwise therapy-resistant PVD. The aims of this study were to evaluate whether TENS has a beneficial effect on vulvar pain, sexual functioning, and sexually-related personal distress in women with therapy-resistant PVD and to assess the effect of TENS on the need for vestibulectomy. A longitudinal prospective follow-up study was performed on women with therapy-resistant PVD who received additional domiciliary TENS. Self-report questionnaires and visual analog scales (VASs) were completed at baseline (T1), post-TENS (T2), and follow-up (T3). Vulvar pain, sexual functioning, and sexually-related personal distress were the main outcome measures. Thirty-nine women with therapy-resistant PVD were included. Mean age was 27 ± 5.6 years (range: 19 to 41); mean duration between TENS and T3 follow-up was 10.1 ± 10.7 months (range: 2 to 32). Vulvar pain VAS scores directly post-TENS (median 3.4) and at follow-up (median 3.2) were significantly (P pain and the need for vestibulectomy. The long-term effect was stable. These results not only support our hypothesis that TENS constitutes a feasible and beneficial addition to multidimensional treatment for therapy-resistant PVD, but also the notion that PVD can be considered as a chronic pain syndrome. © 2014 International Society for Sexual Medicine.

  13. Separate transcriptionally regulated pathways specify distinct classes of sister dendrites in a nociceptive neuron.

    Science.gov (United States)

    O'Brien, Barbara M J; Palumbos, Sierra D; Novakovic, Michaela; Shang, Xueying; Sundararajan, Lakshmi; Miller, David M

    2017-12-15

    The dendritic processes of nociceptive neurons transduce external signals into neurochemical cues that alert the organism to potentially damaging stimuli. The receptive field for each sensory neuron is defined by its dendritic arbor, but the mechanisms that shape dendritic architecture are incompletely understood. Using the model nociceptor, the PVD neuron in C. elegans, we determined that two types of PVD lateral branches project along the dorsal/ventral axis to generate the PVD dendritic arbor: (1) Pioneer dendrites that adhere to the epidermis, and (2) Commissural dendrites that fasciculate with circumferential motor neuron processes. Previous reports have shown that the LIM homeodomain transcription factor MEC-3 is required for all higher order PVD branching and that one of its targets, the claudin-like membrane protein HPO-30, preferentially promotes outgrowth of pioneer branches. Here, we show that another MEC-3 target, the conserved TFIIA-like zinc finger transcription factor EGL-46, adopts the alternative role of specifying commissural dendrites. The known EGL-46 binding partner, the TEAD transcription factor EGL-44, is also required for PVD commissural branch outgrowth. Double mutants of hpo-30 and egl-44 show strong enhancement of the lateral branching defect with decreased numbers of both pioneer and commissural dendrites. Thus, HPO-30/Claudin and EGL-46/EGL-44 function downstream of MEC-3 and in parallel acting pathways to direct outgrowth of two distinct classes of PVD dendritic branches. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Improved power conversion efficiency of dye-sensitized solar cells using side chain liquid crystal polymer embedded in polymer electrolytes

    International Nuclear Information System (INIS)

    Cho, Woosum; Lee, Jae Wook; Gal, Yeong-Soon; Kim, Mi-Ra; Jin, Sung Ho

    2014-01-01

    Side chain liquid crystal polymer (SCLCP) embedded in poly(vinylidenefluoride-co-hexafluoropropylene) (PVdF-co-HFP)-based polymer electrolytes (PVdF-co-HFP:side chain liquid crystal polymer (SCLCP)) was prepared for dye-sensitized solar cell (DSSC) application. The polymer electrolytes contained tetrabutylammonium iodide (TBAI), iodine (I 2 ), and 8 wt% PVdF-co-HFP in acetonitrile. DSSCs comprised of PVdF-co-HFP:SCLCP-based polymer electrolytes displayed enhanced redox couple reduction and reduced charge recombination in comparison to those of the conventional PVdF-co-HFP-based polymer electrolyte. The significantly increased short-circuit current density (J sc , 10.75 mA cm −2 ) of the DSSCs with PVdF-co-HFP:SCLCP-based polymer electrolytes afforded a high power conversion efficiency (PCE) of 5.32% and a fill factor (FF) of 0.64 under standard light intensity of 100 mW cm −2 irradiation of AM 1.5 sunlight. - Highlights: • We developed the liquid crystal polymer embedded on polymer electrolyte for DSSCs. • We fabricated the highly efficient DSSCs using polymer electrolyte. • The best PCE achieved for P1 is 5.32% using polymer electrolyte

  15. Improved power conversion efficiency of dye-sensitized solar cells using side chain liquid crystal polymer embedded in polymer electrolytes

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Woosum [Department of Chemistry Education, and Department of Frontier Materials Chemistry, and Institute for Plastic Information and Energy Materials, Pusan National University, Busan 609-735 (Korea, Republic of); Lee, Jae Wook, E-mail: jlee@donga.ac.kr [Department of Chemistry, Dong-A University, Busan 604-714 (Korea, Republic of); Gal, Yeong-Soon [Polymer Chemistry Lab, College of General Education, Kyungil University, Hayang 712-701 (Korea, Republic of); Kim, Mi-Ra, E-mail: mrkim2@pusan.ac.kr [Department of Polymer Science and Engineering, Pusan National University, Busan 609-735 (Korea, Republic of); Jin, Sung Ho, E-mail: shjin@pusan.ac.kr [Department of Chemistry Education, and Department of Frontier Materials Chemistry, and Institute for Plastic Information and Energy Materials, Pusan National University, Busan 609-735 (Korea, Republic of)

    2014-02-14

    Side chain liquid crystal polymer (SCLCP) embedded in poly(vinylidenefluoride-co-hexafluoropropylene) (PVdF-co-HFP)-based polymer electrolytes (PVdF-co-HFP:side chain liquid crystal polymer (SCLCP)) was prepared for dye-sensitized solar cell (DSSC) application. The polymer electrolytes contained tetrabutylammonium iodide (TBAI), iodine (I{sub 2}), and 8 wt% PVdF-co-HFP in acetonitrile. DSSCs comprised of PVdF-co-HFP:SCLCP-based polymer electrolytes displayed enhanced redox couple reduction and reduced charge recombination in comparison to those of the conventional PVdF-co-HFP-based polymer electrolyte. The significantly increased short-circuit current density (J{sub sc}, 10.75 mA cm{sup −2}) of the DSSCs with PVdF-co-HFP:SCLCP-based polymer electrolytes afforded a high power conversion efficiency (PCE) of 5.32% and a fill factor (FF) of 0.64 under standard light intensity of 100 mW cm{sup −2} irradiation of AM 1.5 sunlight. - Highlights: • We developed the liquid crystal polymer embedded on polymer electrolyte for DSSCs. • We fabricated the highly efficient DSSCs using polymer electrolyte. • The best PCE achieved for P1 is 5.32% using polymer electrolyte.

  16. Improved Steganographic Method Preserving Pixel-Value Differencing Histogram with Modulus Function

    Directory of Open Access Journals (Sweden)

    Lee Hae-Yeoun

    2010-01-01

    Full Text Available Abstract We herein advance a secure steganographic algorithm that uses a turnover policy and a novel adjusting process. Although the method of Wang et al. uses Pixel-Value Differencing (PVD and their modulus function provides high capacity and good image quality, the embedding process causes a number of artifacts, such as abnormal increases and fluctuations in the PVD histogram, which may reveal the existence of the hidden message. In order to enhance the security of the algorithm, a turnover policy is used that prevents abnormal increases in the histogram values and a novel adjusting process is devised to remove the fluctuations at the border of the subrange in the PVD histogram. The proposed method therefore eliminates all the weaknesses of the PVD steganographic methods thus far proposed and guarantees secure communication. In the experiments described herein, the proposed algorithm is compared with other PVD steganographic algorithms by using well-known steganalysis techniques, such as RS-analysis, steganalysis for LSB matching, and histogram-based attacks. The results support our contention that the proposed method enhances security by keeping the PVD histogram similar to the cover, while also providing high embedding capacity and good imperceptibility to the naked eye.

  17. Etching characteristics and application of physical-vapor-deposited amorphous carbon for multilevel resist

    International Nuclear Information System (INIS)

    Kim, H. T.; Kwon, B. S.; Lee, N.-E.; Park, Y. S.; Cho, H. J.; Hong, B.

    2008-01-01

    For the fabrication of a multilevel resist (MLR) based on a very thin, physical-vapor-deposited (PVD) amorphous carbon (a-C) layer, the etching characteristics of the PVD a-C layer with a SiO x hard mask were investigated in a dual-frequency superimposed capacitively coupled plasma etcher by varying the following process parameters in O 2 /N 2 /Ar plasmas: high-frequency/low-frequency combination (f HF /f LF ), HF/LF power ratio (P HF /P LF ), and O 2 and N 2 flow rates. The very thin nature of the a-C layer helps to keep the aspect ratio of the etched features low. The etch rate of the PVD a-C layer increased with decreasing f HF /f LF combination and increasing P LF and was initially increased but then decreased with increasing N 2 flow rate in O 2 /N 2 /Ar plasmas. The application of a 30 nm PVD a-C layer in the MLR structure of ArF PR/BARC/SiO x /PVD a-C/TEOS oxide supported the possibility of using a very thin PVD a-C layer as an etch-mask layer for the TEOS-oxide layer

  18. Physically vapor deposited coatings on tools: performance and wear phenomena

    International Nuclear Information System (INIS)

    Koenig, W.; Fritsch, R.; Kammermeier, D.

    1991-01-01

    Coatings produced by physical vapor deposition (PVD) enhance the performance of tools for a broad variety of production processes. In addition to TiN, nowadays (Ti,Al)N and Ti(C,N) coated tools are available. This gives the opportunity to compare the performance of different coatings under identical machining conditions and to evaluate causes and phenomena of wear. TiN, (Ti,Al)N and Ti(C,N) coatings on high speed steel (HSS) show different performances in milling and turning of heat treated steel. The thermal and frictional properties of the coating materials affect the structure, the thickness and the flow of the chips, the contact area on the rake face and the tool life. Model tests show the influence of internal cooling and the thermal conductivity of coated HSS inserts. TiN and (Ti,Zr)N PVD coatings on cemented carbides were examined in interrupted turning and in milling of heat treated steel. Experimental results show a significant influence of typical time-temperature cycles of PVD and chemical vapor deposition (CVD) coating processes on the physical data and on the performance of the substrates. PVD coatings increase tool life, especially towards lower cutting speeds into ranges which cannot be applied with CVD coatings. The reason for this is the superior toughness of the PVD coated carbide. The combination of tough, micrograin carbide and PVD coating even enables broaching of case hardened sliding gears at a cutting speed of 66 m min -1 . (orig.)

  19. Improved Steganographic Method Preserving Pixel-Value Differencing Histogram with Modulus Function

    Directory of Open Access Journals (Sweden)

    Heung-Kyu Lee

    2010-01-01

    Full Text Available We herein advance a secure steganographic algorithm that uses a turnover policy and a novel adjusting process. Although the method of Wang et al. uses Pixel-Value Differencing (PVD and their modulus function provides high capacity and good image quality, the embedding process causes a number of artifacts, such as abnormal increases and fluctuations in the PVD histogram, which may reveal the existence of the hidden message. In order to enhance the security of the algorithm, a turnover policy is used that prevents abnormal increases in the histogram values and a novel adjusting process is devised to remove the fluctuations at the border of the subrange in the PVD histogram. The proposed method therefore eliminates all the weaknesses of the PVD steganographic methods thus far proposed and guarantees secure communication. In the experiments described herein, the proposed algorithm is compared with other PVD steganographic algorithms by using well-known steganalysis techniques, such as RS-analysis, steganalysis for LSB matching, and histogram-based attacks. The results support our contention that the proposed method enhances security by keeping the PVD histogram similar to the cover, while also providing high embedding capacity and good imperceptibility to the naked eye.

  20. Effects of intrauterine infusion of Escherichia coli lipopolysaccharide on uterine health, resolution of purulent vaginal discharge, and reproductive performance of lactating dairy cows.

    Science.gov (United States)

    Moraes, João G N; Silva, Paula R B; Mendonça, Luís G D; Scanavez, Alexandre A; Silva, Joseane C C; Chebel, Ricardo C

    2017-06-01

    The objectives of the current experiment were to evaluate the effects of intrauterine infusion of Escherichia coli lipopolysaccharide (LPS) in cows diagnosed with purulent vaginal discharge (PVD) on intrauterine cell population, resolution of PVD, uterine health, and reproductive performance. Jersey cows (n = 3,084) were examined using the Metricheck device to diagnose PVD at 35 ± 6 d postpartum. Purulent vaginal discharge was defined as the presence of purulent (≥50% pus) discharge detectable in the vagina. Of the 310 cows positive for PVD, 267 cows were enrolled in the current experiment. To ensure proper timing of treatment and collection of samples, only 9 PVD-positive cows were treated per day. Selected cows were balanced at 35 ± 6 d postpartum for lactation number, body condition score, and milk yield and were randomly assigned to receive an intrauterine infusion of 20 mL of phosphate-buffered saline (PBS; control, n = 87), 20 mL of PBS with 150 µg LPS (LPS150, n = 91), or 20 mL of PBS with 300 µg of LPS (LPS300, n = 89). Uterine cytology was performed immediately before treatment and 1, 2, and 7 d after treatment to evaluate the effect of LPS treatment on intrauterine cell population. Cows were examined with the Metricheck device at 7 and 28 d after treatment to evaluate the effects of treatment on resolution of PVD. Reproductive status was recorded up to 200 d postpartum. Cows diagnosed with PVD had greater incidence of twinning, dystocia, retained placenta, and metritis after calving than cows without PVD. Count of polymorphonuclear leukocytes (PMNL) in uterine cytology 1, 2, and 7 d after intrauterine infusion was not statistically different among treatments. From d 0 to 1, however, PMNL count in uterine cytology of PBS cows increased by 5%, whereas the PMNL count in uterine cytology of LPS150 and LPS300 cows increased by 54 and 48%, respectively. Treatment did not affect the likelihood of cows being diagnosed with PVD 7 and 28 d after intrauterine

  1. Carotid plaque is a new risk factor for peripheral vestibular disorder: a retrospective cohort study.

    Science.gov (United States)

    Wada, Masaoki; Takeshima, Taro; Nakamura, Yosikazu; Nagasaka, Shoichiro; Kamesaki, Toyomi; Kajii, Eiji

    2016-08-01

    Many chronic diseases are associated with dizziness or vertigo, as is peripheral vestibular disorder (PVD). Although carotid plaque development is linked to atherosclerosis, it is unclear whether such plaques can lead to the development of PVD. We therefore conducted this study to investigate the presence of an association between carotid plaque and new PVD events.In this retrospective study, we consecutively enrolled 393 patients ≥20 years old who had been treated for chronic diseases such as hypertension, dyslipidemia, and diabetes mellitus for ≥6 months at a primary care clinic (Oki Clinic, Japan) between November 2011 and March 2013. Carotid plaque presence was measured with high-resolution ultrasonography for all patients. During a 1-year follow-up period, an otorhinolaryngologist diagnosed and reported any new PVD events (the main end point). Hazard ratios (HRs) and 95% confidence intervals (CIs) for new PVD occurrence were estimated using the Cox proportional hazard regression model.The mean age of the participants was 65.5 years; 33.8% were men, and 12.7%, 82.4%, and 93.1% had diabetes mellitus, hypertension, and dyslipidemia, respectively. There were 76 new PVD events; patients with carotid plaque had a greater risk of such events (crude HR: 3.25; 95% CI: 1.62-6.52) compared to those without carotid plaque. This risk was even higher after adjusting for traditional risk factors for atherosclerosis (adjusted HR: 4.41; 95% CI: 1.75-11.14).Carotid plaques are associated with an increased risk of new PVD events.

  2. The Proprotein Convertase KPC-1/Furin Controls Branching and Self-avoidance of Sensory Dendrites in Caenorhabditis elegans

    Science.gov (United States)

    Bülow, Hannes E.

    2014-01-01

    Animals sample their environment through sensory neurons with often elaborately branched endings named dendritic arbors. In a genetic screen for genes involved in the development of the highly arborized somatosensory PVD neuron in C. elegans, we have identified mutations in kpc-1, which encodes the homolog of the proprotein convertase furin. We show that kpc-1/furin is necessary to promote the formation of higher order dendritic branches in PVD and to ensure self-avoidance of sister branches, but is likely not required during maintenance of dendritic arbors. A reporter for kpc-1/furin is expressed in neurons (including PVD) and kpc-1/furin can function cell-autonomously in PVD neurons to control patterning of dendritic arbors. Moreover, we show that kpc-1/furin also regulates the development of other neurons in all major neuronal classes in C. elegans, including aspects of branching and extension of neurites as well as cell positioning. Our data suggest that these developmental functions require proteolytic activity of KPC-1/furin. Recently, the skin-derived MNR-1/menorin and the neural cell adhesion molecule SAX-7/L1CAM have been shown to act as a tripartite complex with the leucine rich transmembrane receptor DMA-1 on PVD mechanosensory to orchestrate the patterning of dendritic branches. Genetic analyses show that kpc-1/furin functions in a pathway with MNR-1/menorin, SAX-7/L1CAM and DMA-1 to control dendritic branch formation and extension of PVD neurons. We propose that KPC-1/furin acts in concert with the ‘menorin’ pathway to control branching and growth of somatosensory dendrites in PVD. PMID:25232734

  3. Posterior vitreous detachment and retinal detachment after cataract surgery.

    Science.gov (United States)

    Ripandelli, Guido; Coppé, Andrea Maria; Parisi, Vincenzo; Olzi, Diego; Scassa, Cecilia; Chiaravalloti, Adele; Stirpe, Mario

    2007-04-01

    To evaluate possible changes of vitreous status in emmetropic eyes after uneventful phacoemulsification surgery, and possible related complications such as the onset of retinal detachment (RD). Retrospective case series. Four hundred fifty-three emmetropic eyes from 453 patients (mean age, 62.03+/-5.57 years) subjected to uneventful phacoemulsification with intraocular lens implantation in the capsular bag were considered in the study. They had a refractive error within +/-0.5 diopters (mean, -0.21+/-0.08). Eyes with peripheral retinal lattice degeneration were included only if asymptomatic and only if the degeneration involved one retinal quadrant. After cataract surgery, the 453 eyes were evaluated preoperatively at days 1, 15, and 30 and months 3, 6, 12, 18, 24, 36, 48, and 60. The whole period of follow-up was 5 years. Evaluation of vitreous status by biomicroscopic examination, indirect binocular ophthalmoscopy, and B-scan ultrasonography. Postoperative onset of posterior vitreous detachment (PVD) and RD. After cataract surgery, a PVD occurred in 107 of 141 (75.88%) eyes without preoperative PVD or lattice degeneration. Posterior vitreous detachment occurred in 41 of 47 eyes (87.23%) with preoperative lattice degeneration and no PVD. Eyes with preoperative lattice degeneration and postoperative PVD showed a higher incidence of RD after cataract surgery (21.27%) than eyes without preoperative PVD or lattice degeneration (0.70%). In all patients with lattice degeneration, RD originated from horseshoe retinal tears on lattice areas located on the superior quadrants. No correlation was observed between the development of RD and age. Our results suggest that the onset of postoperative PVD should be considered an important risk factor for the development of RD after cataract surgery, particularly in eyes with lattice areas.

  4. Time course of development of posterior vitreous detachments after phacoemulsification surgery.

    Science.gov (United States)

    Hikichi, Taiichi

    2012-10-01

    To determine when posterior vitreous detachments (PVDs) develop after phacoemulsification and aspiration combined with foldable intraocular lens implantation. Prospective, consecutive case series. A total of 575 eyes without a PVD preoperatively were studied prospectively and followed for 3 years after uneventful phacoemulsification surgery. All patients underwent a comprehensive ocular examination, including a dynamic vitreous examination using biomicroscopy with and without a preset lens and a preoperative retinal examination on the day of surgery; the day postoperatively; 1 week and 1, 3, 6, and 12 months postoperatively; and every 6 months for 3 years postoperatively. The patients were divided into groups and analyzed on the basis of age and refractive error or axial length. The cumulative incidence rates of eyes that developed PVD for 3 years postoperatively at each postoperative time point. The cumulative numbers and percentages of eyes that developed a PVD were 6 (1.0%), 18 (3.1%), 31 (5.4%), 45 (7.8%), 63 (11.0%), 88 (15.3%), 106 (18.4%), 133 (23.1%), and 172 (30.0%) within 1 week and 1, 3, 6, 12, 18, 24, 30, and 36 months, respectively. Eleven (6.4%) of the 172 eyes in which a PVD developed during the follow-up period had new retinal breaks with or without a retinal detachment. Eight (15.4%) of 52 eyes with lattice degeneration and 3 (2.5%) of 120 eyes without lattice degeneration had retinal breaks associated with a PVD; these percentages were significant (P = 0.003). Development of PVDs seems to accelerate after phacoemulsification and linearly accumulated for 3 years postoperatively. Approximately 6% of eyes with a PVD had retinal breaks and eyes with lattice degeneration had a 6.2-fold higher risk of developing retinal breaks associated with a PVD. Long-term follow-up is needed after phacoemulsification is performed. Copyright © 2012 American Academy of Ophthalmology. Published by Elsevier Inc. All rights reserved.

  5. Incidence of dizziness and vertigo in Japanese primary care clinic patients with lifestyle-related diseases: an observational study

    Directory of Open Access Journals (Sweden)

    Wada M

    2015-04-01

    Full Text Available Masaoki Wada,1,2 Taro Takeshima,1 Yosikazu Nakamura,3 Shoichiro Nagasaka,4 Toyomi Kamesaki,1 Hiroshi Oki,2 Eiji Kajii1 1Division of Community and Family Medicine, Center for Community Medicine, Jichi Medical University, Tochigi, Japan; 2Oki Clinic, Ibaraki, Japan; 3Department of Public Health, Jichi Medical University, Tochigi, Japan; 4Department of Internal Medicine, Division of Endocrinology and Metabolism, Jichi Medical University, Tochigi, Japan Objective: Dizziness and vertigo are highly prevalent symptoms among patients presenting at primary care clinics, and peripheral vestibular disorder (PVD is their most frequent cause. However, the incidence of PVD has not been well documented. This study aimed to investigate the incidence of dizziness, vertigo, and PVD among patients presenting at a primary care clinic. Design: This was an observational study. Setting and participants: Between November 2011 and March 2013, we observed 393 patients, all at least 20 years old, who had been treated for chronic diseases such as hypertension, dyslipidemia, and diabetes mellitus for at least 6 months at a primary clinic (Oki Clinic in Japan. Outcome: The main outcome of interest was new incidence of dizziness, vertigo, and PVD events. During the 1-year follow-up period, the otorhinolaryngologist diagnosed and reported new PVD events. Results: The mean age of the 393 participants at entry was 65.5 years. Of the study participants, 12.7%, 82.4%, and 92.6% had diabetes mellitus, hypertension, and dyslipidemia, respectively. We followed up all the participants (100%. During the 662.5 person-years of follow-up, 121 cases of dizziness or vertigo (dizziness/vertigo and 76 cases of PVD were observed. The incidence of dizziness/vertigo and PVD was 194.7 (95% confidence interval: 161.6–232.6 per 1,000 person-years and 115.7 (95% confidence interval: 92.2–142.6 per 1,000 person-years, respectively. There were 61 cases of acute peripheral vestibulopathy, 12 of

  6. Genetic and functional analysis of the bovine uterine microbiota. Part II: Purulent vaginal discharge versus healthy cows.

    Science.gov (United States)

    Bicalho, M L S; Lima, S; Higgins, C H; Machado, V S; Lima, F S; Bicalho, R C

    2017-05-01

    The aim of this study was to characterize, using metagenomic shotgun DNA sequencing, the intrauterine microbial population and its predicted functional diversity within healthy cows and cows presenting purulent vaginal discharge (PVD). Twenty Holstein dairy cows from a single farm were enrolled in the study at 25 to 35 d postpartum. Purulent vaginal discharge was diagnosed by retrieving and scoring vaginal discharge using the Metricheck device (Simcro, Hamilton, New Zealand). Intrauterine samples for metagenomic analysis were collected by the cytobrush technique from 8 cows diagnosed with PVD and 12 healthy cows. Pair-end sequencing was performed using the Illumina MiSeq platform (Illumina Inc., San Diego, CA). Metagenomic sequences were analyzed using the MG-RAST server (metagenomic rapid annotations using subsystems technology; http://metagenomics.anl.gov/), and the STAMP software (http://kiwi.cs.dal.ca/Software/STAMP) was used to study statistically significant differential abundance of taxonomic and functional features between the 2 metagenomes. Additionally, the total number of bacterial 16S rDNA copies was estimated by real-time PCR. Taxonomic analysis revealed that Bacteroidetes was the most abundant phylum in the uterine microbiota from cows with PVD, and Fusobacteria was almost completely absent in the healthy uterine microbiota. Moreover, species belonging to the genus Trueperella were present only in the uterine microbiota of PVD cows. The increased abundance of Fusobacteria and the unique presence of Trueperella in the PVD cows highlight the important role of these bacteria in the pathogenesis of PVD. Genes encoding cytolethal distending toxin were exclusive to the microbiota of PVD cows. Similarly, genes associated with lipid A modification were present only in samples from PVD cows; such modification is associated with greater resistance to cationic antimicrobial peptides. Conversely, genes encoding bacteriocins and ribosomally antibacterial peptide

  7. Determination of optimal diagnostic criteria for purulent vaginal discharge and cytological endometritis in dairy cows.

    Science.gov (United States)

    Denis-Robichaud, J; Dubuc, J

    2015-10-01

    The objectives of this observational study were to identify the optimal diagnostic criteria for purulent vaginal discharge (PVD) and cytological endometritis (ENDO) using vaginal discharge, endometrial cytology, and leukocyte esterase (LE) tests, and to quantify their effect on subsequent reproductive performance. Data generated from 1,099 untreated Holstein cows (28 herds) enrolled in a randomized clinical trial were used in this study. Cows were examined at 35 (± 7) d in milk for PVD using vaginal discharge scoring and for ENDO using endometrial cytology and LE testing. Optimal combinations of diagnostic criteria were determined based on the lowest Akaike information criterion (AIC) to predict pregnancy status at first service. Once identified, these criteria were used to quantify the effect of PVD and ENDO on pregnancy risk at first service and on pregnancy hazard until 200 d in milk (survival analysis). Predicting ability of these diagnostic criteria was determined using area under the curve (AUC) values. The prevalence of PVD and ENDO was calculated as well as the agreement between endometrial cytology and LE. The optimal diagnostic criteria (lowest AIC) identified in this study were purulent vaginal discharge or worse (≥ 4), ≥ 6% polymorphonuclear leukocytes (PMNL) by endometrial cytology, and small amounts of leukocytes or worse (≥ 1) by LE testing. When using the combination of vaginal discharge and PMNL percentage as diagnostic tools (n = 1,099), the prevalences of PVD and ENDO were 17.1 and 36.2%, respectively. When using the combination of vaginal discharge and LE (n = 915), the prevalences of PVD and ENDO were 17.1 and 48.4%. The optimal strategies for predicting pregnancy status at first service were the use of LE only (AUC = 0.578) and PMNL percentage only (AUC = 0.575). Cows affected by PVD and ENDO had 0.36 and 0.32 times the odds, respectively, of being pregnant at first service when using PMNL percentage compared with that of unaffected

  8. Fluorine incorporation into SnO2 nanoparticles by co-milling with polyvinylidene fluoride

    Science.gov (United States)

    Senna, Mamoru; Turianicová, Erika; Šepelák, Vladimír; Bruns, Michael; Scholz, Gudrun; Lebedkin, Sergei; Kübel, Christian; Wang, Di; Kaňuchová, Mária; Kaus, Maximilian; Hahn, Horst

    2014-04-01

    Fluorine was incorporated into SnO2 nanoparticles from polyvinylidene fluoride (PVdF) by co-milling. The incorporation process was triggered by an oxidative partial decomposition of PVdF due to the abstraction of oxygen atoms, and began soon after milling with a simultaneous decrease in the crystallite size of SnO2 from 56 nm to 19 nm, and increase in the lattice strain by a factor 7. Appearance of D and G Raman peaks indicated that the decomposition of PVdF was accompanied by the formation of nanometric carbon species. Decomposing processes of PVdF were accompanied by the continuous change in the states of F, with a decrease of C-F in PVdF and increase in Sn-F. This indicates the gradual incorporation of F into SnO2, by replacing a part of oxygen in the oxide with fluorine. These serial mechanochemical reaction processes were discussed on the basis of X-ray diffractometry, FT-IR, Raman and UV-Vis diffuse reflectance spectroscopy, transmission electron microscopy, F1s, Sn3d and C1s X-ray photoelectron spectroscopy and Auger electron spectra, as well as magic angle spinning NMR spectroscopy of 19F and 119Sn. The present findings serve as an initial stage of incorporating fluorine into SnO2 via a solvent-free solid-state process, toward the rational fabrication of fluorine doped SnO2 powders.

  9. Regional vascular density-visual field sensitivity relationship in glaucoma according to disease severity.

    Science.gov (United States)

    Shin, Joong Won; Lee, Jiyun; Kwon, Junki; Choi, Jaewan; Kook, Michael S

    2017-12-01

    To study whether there are global and regional relationships between peripapillary vascular density (pVD) assessed by optical coherence tomography angiography (OCT-A) and visual field (VF) mean sensitivity at different glaucoma stages. Microvascular images and peripapillary retinal nerve fibre layer (pRNFL) thicknesses were obtained using a Cirrus OCT-A device in 91 glaucoma subjects. The pVD was measured at various spatial locations according to the Garway-Heath map, using a MATLAB software (The MathWorks, Natick, Massachusetts). VF mean sensitivity (VFMS) was recorded in the 1/L scale. Global and regional vasculature-function (pVD vs VFMS) relationships were assessed in separate patient groups at mild and moderate-to-advanced stages of glaucoma. The pVDs at superotemporal and inferotemporal regions were significantly associated with corresponding VFMS in mild glaucoma (pglaucoma, there were significant associations between pVD and VFMS, regardless of location. The association between global pVD and VFMS was significantly stronger than that between global pRNFL thickness and VFMS in moderate-to-advanced stage glaucoma (p glaucoma. OCT-A may be useful in monitoring glaucoma at various stages. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  10. To say or not to say: Dyadic ambivalence over emotional expression and its associations with pain, sexuality, and distress in couples coping with provoked vestibulodynia.

    Science.gov (United States)

    Awada, Nayla; Bergeron, Sophie; Steben, Marc; Hainault, Victoria-Ann; McDuff, Pierre

    2014-05-01

    Provoked vestibulodynia (PVD) is a highly prevalent and taxing female genital pain condition. Despite the intimate nature of this pain and the fact that affective factors such as anxiety have been shown to modulate its manifestations, no study has yet explored the emotional regulation of couples in which the woman suffers from PVD. Ambivalence over emotional expression (AEE) is an emotional regulation variable that quantifies the extent to which a person is comfortable with the way she or he expresses emotions. We examined whether the dyadic AEE of couples in which the woman suffers from PVD was differentially associated with women's pain and couples' psychological, sexual, and relational functioning. Couples (N = 254), in which the woman suffered from PVD, completed the AEE questionnaire. A couple typology of dyadic AEE was created. Dependent measures for both members of the couple were the global measure of sexual satisfaction scale, the Beck depression inventory II, and the revised dyadic adjustment scale. The female sexual function index and the sexual history form were used to assess the sexual function of women and men, respectively. Women also completed the pain rating index of the McGill pain questionnaire. Couples, in which both partners were considered low on AEE, had the highest scores on sexual satisfaction (P = 0.02) and function (P sexual, and relational outcomes. Results indicate that emotional regulation may be important to consider in the assessment and treatment of couples coping with PVD. © 2014 International Society for Sexual Medicine.

  11. Development of amorphous silicon based EUV hardmasks through physical vapor deposition

    Science.gov (United States)

    De Silva, Anuja; Mignot, Yann; Meli, Luciana; DeVries, Scott; Xu, Yongan; Seshadri, Indira; Felix, Nelson M.; Zeng, Wilson; Cao, Yong; Phan, Khoi; Dai, Huixiong; Ngai, Christopher S.; Stolfi, Michael; Diehl, Daniel L.

    2017-10-01

    Extending extreme ultraviolet (EUV) single exposure patterning to its limits requires more than photoresist development. The hardmask film is a key contributor in the patterning stack that offers opportunities to enhance lithographic process window, increase pattern transfer efficiency, and decrease defectivity when utilizing very thin film stacks. This paper introduces the development of amorphous silicon (a-Si) deposited through physical vapor deposited (PVD) as an alternative to a silicon ARC (SiARC) or silicon-oxide-type EUV hardmasks in a typical trilayer patterning scheme. PVD offers benefits such as lower deposition temperature, and higher purity, compared to conventional chemical vapor deposition (CVD) techniques. In this work, sub-36nm pitch line-space features were resolved with a positive-tone organic chemically-amplified resist directly patterned on PVD a-Si, without an adhesion promotion layer and without pattern collapse. Pattern transfer into the underlying hardmask stack was demonstrated, allowing an evaluation of patterning metrics related to resolution, pattern transfer fidelity, and film defectivity for PVD a-Si compared to a conventional tri-layer patterning scheme. Etch selectivity and the scalability of PVD a-Si to reduce the aspect ratio of the patterning stack will also be discussed.

  12. Erosion behaviour of physically vapour-deposited and chemically vapour-deposited SiC films coated on molybdenum during oxygenated argon beam thinning

    International Nuclear Information System (INIS)

    Shikama, T.; Kitajima, M.; Fukutomi, M.; Okada, M.

    1984-01-01

    The erosion behaviour during bombardment with a 5 keV argon beam at room temperature was studied for silicon carbide (SiC) films of thickness of about 10 μm coated on molybdenum by physical vapour deposition (PVD) and chemical vapour deposition (CVD). The PVD SiC (plasma-assisted ion plating) exhibited a greater thinning rate than the CVD SiC film. Electron probe X-ray microanalysis revealed that the chemical composition of PVD SiC was changed to a composition enriched in silicon by the bombardment, and there was a notable change in its surface morphology. The CVD SiC retained its initial chemical composition with only a small change in its surface morphology. Auger electron spectroscopy indicated that silicon oxide was formed on the surface of PVD SiC by the bombardment. The greater thinning rate and easier change in chemical composition in PVD SiC could be attributed to its readier chemical reaction with oxygen due to its more non-uniform structure and weaker chemical bonding. Oxygen was present as one of the impurities in the argon beam. (Auth.)

  13. P-channel transparent thin-film transistor using physical-vapor-deposited NiO layer

    Science.gov (United States)

    Lin, Chiung-Wei; Chung, Wei-Chieh; Zhang, Zhao-De; Hsu, Ming-Chih

    2018-01-01

    The effect of oxygen (O) content on the electrical properties of physical-vapor-deposited nickel oxide (PVD-NiO) was studied. When the NiO target was sputtered, introducing O2 can lead to the formation of Ni3+ ions in the deposited film. These Ni3+ ions can act as acceptors. However, there were too many Ni3+ ions that were obtained following the introduction of O atoms. It resulted in intensive p-type conduction and made the O2-introduced PVD-NiO behave as a conductor. Thus, it was possible to reduce the O content of PVD-NiO to obtain a p-type semiconductor. In this study, a transparent PVD-NiO film with a carrier concentration of 1.62 × 1017 cm-3 and a resistivity of 3.74 Ω cm was sputter-deposited within pure argon plasma. The thin-film transistor (TFT) employing this proposed PVD-NiO can result in good current switching, and even operated at very low drain-source voltage. The ON/OFF current ratio, field-effect carrier mobility, and threshold voltage of the proposed NiO TFT were 3.61 × 104, 1.09 cm2 V-1 s-1 and -3.31 V, respectively.

  14. Improvement of Surface Properties of CP-Titanium by Thermo-Chemical Treatment (TCT) Process

    International Nuclear Information System (INIS)

    Jeong, Hyeon-Gyeong; Hur, Bo-Young; Lee, Dong-Geun; Lee, Yong-Tai; Yaskiv, O.

    2011-01-01

    The thermo-chemical treatment (TCT) process was applied to achieve surface hardening of CP titanium. The following three different surface modification conditions were tested so that the best surface hardening process could be selected:(a) PVD, (b) TCT+PVD, and (c) TCT+Aging+PVD. These specimens were tested and analyzed in terms of surface roughness, wear, friction coefficient, and the gradient of hardening from the surface of the matrix. The three test conditions were all beneficial to improve the surface hardness of CP titanium. Moreover, the TCT treated specimens, that is, (b) and (c), showed significantly improved surface hardness and low friction coefficients through the thickness up to 100um. This is due to the functionally gradient hardened surface improvement by the diffused interstitial elements. The hardened surface also showed improvement in bonding between the PVD and TCT surface, and this leads to improvement in wear resistance. However, TCT after aging treatment did not show much improvement in surface properties compared to TCT only. For the best surface hardening on CP titanium, TCT+PVD has advantages in surface durability and economics.

  15. Diffusion and adhesion properties of Cu films on polyimide substrates

    International Nuclear Information System (INIS)

    Liang, T.X.; Liu, Y.Q.; Fu, Z.Q.; Luo, T.Y.; Zhang, K.Y.

    2005-01-01

    Copper thin films were prepared on polyimide (PI) substrates by physical vapor deposition (PVD) and chemical vapor deposition (CVD). Titanium nitride (TiN) diffusion barrier layers were deposited between the copper films and the PI substrates by PVD. Auger electron spectroscopy compositional depth profile showed that TiN barrier layer was very effective in preventing copper diffusion into PI substrate even after the Cu/TiN/PI samples were annealed at 300 deg. C for 5 h. For the as-deposited CVD-Cu/PI, CVD-Cu/TiN/PI, and as-deposited PVD-Cu/PI samples, the residual stress in Cu films was very small. Relatively larger residual stress existed in Cu films for PVD-Cu/TiN/PI samples. For PVD-Cu/TiN/PI samples, annealing can increase the peeling strength to the level observed without a diffusion barrier. The adhesion improvement of Cu films by annealing treatment can be attributed to lowering of the residual tensile stress in Cu films

  16. Highly selective etching of silicon nitride to physical-vapor-deposited a-C mask in dual-frequency capacitively coupled CH2F2/H2 plasmas

    International Nuclear Information System (INIS)

    Kim, J. S.; Kwon, B. S.; Heo, W.; Jung, C. R.; Park, J. S.; Shon, J. W.; Lee, N.-E.

    2010-01-01

    A multilevel resist (MLR) structure can be fabricated based on a very thin amorphous carbon (a-C) layer ( congruent with 80 nm) and Si 3 N 4 hard-mask layer ( congruent with 300 nm). The authors investigated the selective etching of the Si 3 N 4 layer using a physical-vapor-deposited (PVD) a-C mask in a dual-frequency superimposed capacitively coupled plasma etcher by varying the process parameters in the CH 2 F 2 /H 2 /Ar plasmas, viz., the etch gas flow ratio, high-frequency source power (P HF ), and low-frequency source power (P LF ). They found that under certain etch conditions they obtain infinitely high etch selectivities of the Si 3 N 4 layers to the PVD a-C on both the blanket and patterned wafers. The etch gas flow ratio played a critical role in determining the process window for infinitely high Si 3 N 4 /PVD a-C etch selectivity because of the change in the degree of polymerization. The etch results of a patterned ArF photoresisit/bottom antireflective coating/SiO x /PVD a-C/Si 3 N 4 MLR structure supported the idea of using a very thin PVD a-C layer as an etch-mask layer for the Si 3 N 4 hard-mask pattern with a pattern width of congruent with 80 nm and high aspect ratio of congruent with 5.

  17. Chemical Stability Investigations of Polyisobutylene as New Binder for Application in Lithium Air-Batteries

    International Nuclear Information System (INIS)

    Heine, Jennifer; Rodehorst, Uta; Badillo, Juan Pablo; Winter, Martin; Bieker, Peter

    2015-01-01

    ABSTRACT: The side reactions of LiO 2 , Li 2 O 2 and Li 2 O, formed during the discharge process at the cathode/electrolyte interphase, are still a main challenge of lithium-air batteries. During these reactions, polyvinylidene difluoride (PVdF), as the commonly used cathode binder material, is decomposing, leading to a shorter lifetime of the battery. In this paper, we introduced and investigated polyisobutylene (PIB), a chemically and electrochemically inert polymeric material, to substitute PVdF as binder for lithium-air batteries. Results obtained by X-ray diffraction and spectroscopic methods showed, that PIB is far more stable in the presence of O 2 − , O 2 2− as well as O 2− species compared to PVdF. This distinct inertness makes PIB a promising binder for lithium-air batteries

  18. Residual stress in ion implanted titanium nitride studied by parallel beam glancing incidence x-ray diffraction

    International Nuclear Information System (INIS)

    Geist, D.E.; Perry, A.J.; Treglio, J.R.; Valvoda, V.; Rafaja, D.

    1995-01-01

    Ion implantation is known to increase the lifetime of cutting tools. Current theories are the increase in lifetime is caused by an increase in the residual stress, or by work hardening of the surface associated with the implantation. In this work the effect of ion implantation on the residual stress in titanium nitride coatings made by the standard industrial methods of chemical and physical vapor deposition (CVD and PVD) is studied. It is found in the as-received condition (unimplanted), the residual stress levels are near zero for CVD materials and highly compressive, of the order of 6 GPa, for PVD materials. Ion implantation has no effect on the residual stress in the coatings made by CVD. Nitrogen does increase the compressive residual stress by some 10% in the near surface regions of PVD coatings, while nickel-titanium dual metal ion implantation does not have any effect. It appears that the lifetime increase is not associated with residual stress effects

  19. Development and characterization of Si3N4 coated AlCrN ceramic cutting tool

    International Nuclear Information System (INIS)

    Souza, J.V.C.; Nono, M.C.A.; Martins, G.V.; Machado, J.P.B.; Silva, O.M.M.

    2009-01-01

    Nowadays, silicon nitride based cutting tools are used to machine cast iron from the automotive industry and nickel superalloys from the aero industries. Advances in manufacturing technologies (increased cutting speeds, dry machining, etc.) induced the fast commercial growth of physical vapor deposition (PVD) coatings for cutting tools, in order to increase their life time. In this work, a new composition of the Si 3 N 4 ceramic cutting tool was developed, characterized and subsequently coated, using a PVD process, with aluminum chromium nitride (AlCrN). The Si 3 N 4 substrate properties were analyzed by XRD, AFM, hardness and fracture toughness. The AlCrN coating was analyzed by AFM, grazing incidence X-ray diffraction (GIXRD) and hardness. The results showed that this PVD coating could be formed homogeneously, without cracks and promoted a higher surface hardness to the insert and consequently it can produce a better wear resistance during its application on high speed machining. (author)

  20. Passivation effect on optical and electrical properties of molecular beam epitaxy-grown HgCdTe/CdTe/Si layers

    Science.gov (United States)

    Kiran, Rajni; Mallick, Shubhrangshu; Hahn, Suk-Ryong; Lee, T. S.; Sivananthan, Sivalingam; Ghosh, Siddhartha; Wijewarnasuriya, P. S.

    2006-06-01

    The effects of passivation with two different passivants, ZnS and CdTe, and two different passivation techniques, physical vapor deposition (PVD) and molecular beam epitaxy (MBE), were quantified in terms of the minority carrier lifetime and extracted surface recombination velocity on both MBE-grown medium-wavelength ir (MWIR) and long-wavelength ir HgCdTe samples. A gradual increment of the minority carrier lifetime was reported as the passivation technique was changed from PVD ZnS to PVD CdTe, and finally to MBE CdTe, especially at low temperatures. A corresponding reduction in the extracted surface recombination velocity in the same order was also reported for the first time. Initial data on the 1/ f noise values of as-grown MWIR samples showed a reduction of two orders of noise power after 1200-Å ZnS deposition.

  1. Optical characterization of In{sub 2}S{sub 3} solar cell buffer layers grown by chemical bath and physical vapor deposition

    Energy Technology Data Exchange (ETDEWEB)

    Trigo, J.F.; Asenjo, B.; Herrero, J.; Gutierrez, M.T. [Department of Energy, CIEMAT, Avda. Complutense, 22, 28040 Madrid (Spain)

    2008-09-15

    In this paper, we study the optical properties of indium sulfide thin films to establish the best conditions to obtain a good solar cell buffer layer. The In{sub 2}S{sub 3} buffer layers have been prepared by chemical bath deposition (CBD) and thermal evaporation (PVD). Optical behavior differences have been found between CBD and PVD In{sub 2}S{sub 3} thin films that have been explained as due to structural, morphological and compositional differences observed in the films prepared by both methods. The resultant refractive index difference has to be attributed to the lower density of the CBD films, which can be related to the presence of oxygen. Its higher refractive index makes PVD film better suited to reduce overall reflectance in a typical CIGS solar cell. (author)

  2. Sensory Neuron Fates Are Distinguished by a Transcriptional Switch that Regulates Dendrite Branch Stabilization

    Science.gov (United States)

    Smith, Cody J.; O’Brien, Timothy; Chatzigeorgiou, Marios; Spencer, W. Clay; Feingold-Link, Elana; Husson, Steven J.; Hori, Sayaka; Mitani, Shohei; Gottschalk, Alexander; Schafer, William R.; Miller, David M.

    2013-01-01

    SUMMARY Sensory neurons adopt distinct morphologies and functional modalities to mediate responses to specific stimuli. Transcription factors and their downstream effectors orchestrate this outcome but are incompletely defined. Here, we show that different classes of mechanosensory neurons in C. elegans are distinguished by the combined action of the transcription factors MEC-3, AHR-1, and ZAG-1. Low levels of MEC-3 specify the elaborate branching pattern of PVD nociceptors, whereas high MEC-3 is correlated with the simple morphology of AVM and PVM touch neurons. AHR-1 specifies AVM touch neuron fate by elevating MEC-3 while simultaneously blocking expression of nociceptive genes such as the MEC-3 target, the claudin-like membrane protein HPO-30, that promotes the complex dendritic branching pattern of PVD. ZAG-1 exercises a parallel role to prevent PVM from adopting the PVD fate. The conserved dendritic branching function of the Drosophila AHR-1 homolog, Spineless, argues for similar pathways in mammals. PMID:23889932

  3. Quantitative near-infrared spectroscopy on patients with peripheral vascular disease

    Science.gov (United States)

    Franceschini, Maria-Angela; Fantini, Sergio; Palumbo, Renato; Pasqualini, Leonella; Vaudo, Gaetano; Franceschini, Edoardo; Gratton, Enrico; Palumbo, Barbara; Innocente, Salvatore; Mannarino, Elmo

    1998-01-01

    We have used near-infrared spectroscopy to measure the hemoglobin saturation at rest and during exercise on patients affected by peripheral vascular disease (PVD). The instrument used in our study is a frequency-domain tissue oximeter which employs intensity modulated (110 MHz) laser diodes. We examined 9 subjects, 3 of which were controls and 6 were patients affected by stage II PVD. The optical probe was located on the calf muscle of the subjects. The measurement protocol consisted of: (1) baseline (approximately 5 min); (2) stationary bicycle exercise (approximately 5 min); (3) recovery (approximately 15 min). The change in hemoglobin saturation during exercise ((Delta) Y) and the recovery time after exercise (trec) were significantly greater in the PVD patients ((Delta) Y equals -21 +/- 3%, trec equals 5.9 +/- 3.8 min) than in the control subjects ((Delta) Y equals 2 +/- 3%, trec equals 0.6 +/- 0.1 min).

  4. C-Ni-Pd and CNT-Ni-Pd film's molecular and crystalline structure investigations by FTIR spectroscopy and XRD diffraction

    Science.gov (United States)

    Stepińska, Izabela; Czerwosz, ElŻbieta; Diduszko, Ryszard; Kozłowski, Mirosław; Wronka, Halina

    2017-08-01

    In this work molecular and crystalline structure of new type of nanocomposite films were investigated. These films compose of CNT decorated with palladium nanograins. They were prepared on a base of C-Ni films modified in CVD process. C-Ni nanocomposite films were obtained by PVD process and their modification by CVD leads to a growth of CNT film. CNTs-Ni or C-Ni films were treated with additional PVD process with palladium. Nickel and palladium acetate and fulleren C60 are precursors of films in PVD process. FTIR spectroscopy was used to studied the molecular structure of film in every stage of preparation . The crystalline structure of these films was studied by X-ray diffraction. SEM (scanning electron microscopy) was applied to investigate film's surface topography.

  5. Coordination polyhedra LnFn (Ln=La-Lu) in crystal structure

    International Nuclear Information System (INIS)

    Vologzhanina, A.V.; Pushkin, D.V.; Serezhkin, V.N.

    2006-01-01

    Peculiarities of stereochemistry of lanthanides (Ln) surrounded by fluorine atoms were studied by means of the Voronoi-Dirichlet polyhedra (PVD) and method of crossing spheres, 118 compounds are presented in the structure. It has been found that coordination numbers (CN) of Ln atoms change from 6 to 12, nine types of LnF n coordination polyhedra are formed in the process, Ln-F bond lengths have changes by 0.2-0.7 A in accordance to CN. It is found that in spite of significant variation of bond lengths volume of PVD Ln atoms is determined by their nature and oxidation state. It has been found that the change in radii of spherical domains, which volume is equal to the volume of PVD Ln atoms, is accompanied by tetrad-effect [ru

  6. Evaluation of an isotope washout technique to measure skin vascular resistance and skin perfusion pressure: influence of age, site and arterial surgery

    International Nuclear Information System (INIS)

    Duncan, H.J.; Faris, I.B.

    1986-01-01

    1. A simplified isotope (sup(99m)Tc) washout technique has been devised to calculate the skin perfusion pressure (SPP) and skin vascular resistance (SVR). This test is simple, requires inexpensive equipment and is well tolerated by patients. 2. SPP and SVR were calculated in 20 patients 30 years of age and in 15 patients with peripheral vascular disease (PVD). With increasing age the SPP and SVP were increased. The SPP was similar to the mean arterial pressure in normal individuals but was decreased in patients with PVD. The SPP is a useful indicator of the severity of the PVD. 3. The SPP and SVR were higher in the calf than in the foot. This is probably related to the decrease in pressure in the distal arterial tree. 4. SPP was increased by 110% and skin blood flow by 190% by arterial reconstructive surgery. This test may be of use in assessing the effectiveness of arterial surgery. (author)

  7. Pd-Ni-MWCNT nanocomposite thin films: preparation and structure

    Science.gov (United States)

    Kozłowski, Mirosław; Czerwosz, ElŻbieta; Sobczak, Kamil

    2017-08-01

    The properties of nanocomposite palladium-nickel-multi-walled (Pd-Ni-MWCNT) films deposited on aluminum oxide (Al2O3) substrate have been prepared and investigated. These films were obtained by 3 step process consisted of PVD/CVD/PVD methods. The morphology and structure of the obtained films were characterized by Scanning Electron Microscopy (SEM) and Transmission Electron Microscopy (TEM) techniques at various stages of the film formation. EDX spectrometer was used to measurements of elements segregation in the obtained film. TEM and STEM (Scanning Transmission Electron Microscopy) observations showed MWCNTs decorated with palladium nanoparticles in the film obtained in the last step of film formation (final PVD process). The average size of the palladium nanoparticles observed both on MWCNTs and carbonaceous matrix does not exceed 5 nm. The research was conducted on the use of the obtained films as potential sensors of gases (e.g. H2, NH3, CO2) and bio-sensors or optical sensors.

  8. RAB-10 Regulates Dendritic Branching by Balancing Dendritic Transport

    Science.gov (United States)

    Taylor, Caitlin A.; Yan, Jing; Howell, Audrey S.; Dong, Xintong; Shen, Kang

    2015-01-01

    The construction of a large dendritic arbor requires robust growth and the precise delivery of membrane and protein cargoes to specific subcellular regions of the developing dendrite. How the microtubule-based vesicular trafficking and sorting systems are regulated to distribute these dendritic development factors throughout the dendrite is not well understood. Here we identify the small GTPase RAB-10 and the exocyst complex as critical regulators of dendrite morphogenesis and patterning in the C. elegans sensory neuron PVD. In rab-10 mutants, PVD dendritic branches are reduced in the posterior region of the cell but are excessive in the distal anterior region of the cell. We also demonstrate that the dendritic branch distribution within PVD depends on the balance between the molecular motors kinesin-1/UNC-116 and dynein, and we propose that RAB-10 regulates dendrite morphology by balancing the activity of these motors to appropriately distribute branching factors, including the transmembrane receptor DMA-1. PMID:26633194

  9. Diffusion barriers of Al2O3 to reduce the bondcoat-oxidation of MCrAlY alloys

    International Nuclear Information System (INIS)

    Schmitt-Thomas, K.G.; Dietl, U.

    1992-01-01

    Under operating conditions in gas turbines plasma sprayed MCrAlY bondcoats (M = Co and/or Ni) for thermal barrier coatings are exposed to a strong oxidation attack. One possibility to reduce bondcoat oxidation is the application of diffusion barriers. Onto the bondcoat, diffusion barriers of Al 2 O 3 are deposited by CVD, PVD and plasma pulse process. The oxidation behaviour of these coating systems were examined at a temperature of 1273 K for times up to 250 hours. The CVD and PVD Al 2 O 3 - coated specimens show compared to the uncoated specimens smaller oxidation rates. The porous Al 2 O 3 coatings, produced by plasma pulse process are not fit for oxidation protection of the bondcoat. There is hope for further improvement of the oxidation resistance by optimizing the CVD- and PVD-process parameters. (orig.) [de

  10. Metallographic techniques for evaluation of Thermal Barrier Coatings produced by Electron Beam Physical Vapor Deposition

    International Nuclear Information System (INIS)

    Kelly, Matthew; Singh, Jogender; Todd, Judith; Copley, Steven; Wolfe, Douglas

    2008-01-01

    Thermal Barrier Coatings (TBC) produced by Electron Beam Physical Vapor Deposition (EB-PVD) are primarily applied to critical hot section turbine components. EB-PVD TBC for turbine applications exhibit a complicated structure of porous ceramic columns separated by voids that offers mechanical compliance. Currently there are no standard evaluation methods for evaluating EB-PVD TBC structure quantitatively. This paper proposes a metallographic method for preparing samples and evaluating techniques to quantitatively measure structure. TBC samples were produced and evaluated with the proposed metallographic technique and digital image analysis for columnar grain size and relative intercolumnar porosity. Incorporation of the proposed evaluation technique will increase knowledge of the relation between processing parameters and material properties by incorporating a structural link. Application of this evaluation method will directly benefit areas of quality control, microstructural model development, and reduced development time for process scaling

  11. Prophylactic treatment of retinal breaks

    DEFF Research Database (Denmark)

    Blindbæk, Søren Leer; Grauslund, Jakob

    2015-01-01

    Prophylactic treatment of retinal breaks has been examined in several studies and reviews, but so far, no studies have successfully applied a systematic approach. In the present systematic review, we examined the need of follow-up after posterior vitreous detachment (PVD) - diagnosed by slit...... published before 2012. Four levels of screening identified 13 studies suitable for inclusion in this systematic review. No meta-analysis was conducted as no data suitable for statistical analysis were identified. In total, the initial examination after symptomatic PVD identified 85-95% of subsequent retinal......-47% of cases, respectively. The cumulated incidence of RRD despite prophylactic treatment was 2.1-8.8%. The findings in this review suggest that follow-up after symptomatic PVD is only necessary in cases of incomplete retinal examination at presentation. Prophylactic treatment of symptomatic retinal breaks...

  12. Effect of Pseudomonas fluorescens and pyoverdine on the phytoextraction of cesium by red clover in soil pots and hydroponics.

    Science.gov (United States)

    Hazotte, Alice; Péron, Olivier; Gaudin, Pierre; Abdelouas, Abdesselam; Lebeau, Thierry

    2018-05-12

    With the aim of improving the phytoextraction rate of cesium (Cs), the effect of Pseudomonas fluorescens ATCC 17400 and its siderophore pyoverdine (PVD) on the uptake of Cs by red clover was studied in soil pots. This work also provides a mechanistic understanding of the Cs-bacteria (or PVD)-illite-plant interactions by using a simplified experimental design, i.e., hydroponics with either Cs in solution or Cs-spiked illite in suspension. For soil spiked with 11.2 mmol kg -1 (1480 mg kg -1 ) of Cs, 0.43% of total Cs was taken up by red clover in 12 days (119 μmol g -1 (16 mg g -1 ) of Cs dry matter in roots and 40 μmol g -1 (5 mg g -1 ) in shoots). In hydroponics with Cs in solution (0.1 mmol L -1 or 13 mg L -1 ), 75% of Cs was taken up vs. only 0.86% with Cs-spiked illite suspension. P. fluorescens and PVD did not increase Cs concentrations in aboveground parts and roots of red clover and even decreased them. The damaging effect of PVD on red clover growth was demonstrated with the biomass yielding 66% of the control in soil pots (and 100% mortality after 12 days of exposition) and only 56% in hydroponics (78% with illite in suspension). Nonetheless, PVD and, to a lesser extent, P. fluorescens increased the translocation factor up to a factor of 2.8. This study clearly showed a direct damaging effect of PVD and to a lower extent the retention of Cs by biofilm covering both the roots and illite, both resulting in the lower phytoextraction efficiency.

  13. A prospective study of pelvic floor physical therapy: pain and psychosexual outcomes in provoked vestibulodynia.

    Science.gov (United States)

    Goldfinger, Corrie; Pukall, Caroline F; Gentilcore-Saulnier, Evelyne; McLean, Linda; Chamberlain, Susan

    2009-07-01

    Research suggests that increased tension in the pelvic floor muscles of women with provoked vestibulodynia (PVD, the most common form of chronic vulvar pain) may play an important role in maintaining and exacerbating their pain. However, no prospective studies of pelvic floor physical therapy (PFPT) for PVD have been carried out. This study prospectively examined the effectiveness of a PFPT intervention in treating the pain and sexual and psychological components of PVD, and determined predictors of greater treatment success. Thirteen women with PVD completed eight sessions of PFPT. Participants were assessed at pre- and post-treatment via gynecological examinations, vestibular pain threshold testing, structured interviews, and standardized questionnaires. A 3-month follow-up interview assessed any further changes. Outcome measures included: vestibular pain thresholds, gynecological examination and intercourse pain ratings, sexual function and intercourse frequency, mental health, negative pain cognitions, and success rates. Following treatment, participants had significantly higher vestibular pain thresholds and significantly lower pain ratings during the gynecological examination. Participants reported significant reductions in pain intensity during intercourse and were able to engage in significantly more pain-free activities. Although overall sexual function significantly improved, various components of sexual function and frequency of intercourse did not. Participants' mental health did not significantly improve; however, pain catastrophizing and pain-related anxiety significantly decreased. The treatment was considered to be successful for 10 of the 13 participants, and predictors of greater treatment success included greater reductions in helplessness and a longer period of time in treatment. Results provide preliminary support for the effectiveness of PFPT in treating the pain of PVD, as well as some of the sexual and cognitive correlates of PVD. The

  14. Associations Between Penetration Cognitions, Genital Pain, and Sexual Well-being in Women with Provoked Vestibulodynia.

    Science.gov (United States)

    Anderson, Alexandra B; Rosen, Natalie O; Price, Lisa; Bergeron, Sophie

    2016-03-01

    Provoked vestibulodynia (PVD) is a common vulvovaginal pain condition that negatively impacts women's psychological and sexual well-being. Controlled studies have found that women with PVD report greater negative and less positive cognitions about penetration; however, associations between these types of cognitions and women's pain and sexual well-being remain unknown. Further, researchers have yet to examine how interpersonal variables such as sexual communication may impact the association between women's penetration cognitions and PVD outcomes. We examined associations between vaginal penetration cognitions and sexual satisfaction, sexual function, and pain in women with PVD, as well as the moderating role of sexual communication. Seventy-seven women (M age = 28.32, SD = 6.19) diagnosed with PVD completed the catastrophic and pain cognitions and positive cognitions subscales of the Vaginal Penetration Cognition Questionnaire, as well as the Dyadic Sexual Communication Scale. Participants also completed measures of sexual satisfaction, sexual function, and pain. Dependent measures were the (i) Global Measure of Sexual Satisfaction Scale; (ii) Female Sexual Function Index; and (iii) Present Pain Intensity scale of the McGill Pain Questionnaire, with reference to pain during vaginal intercourse. Women's lower catastrophic and pain cognitions, higher positive cognitions, and higher sexual communication were each uniquely associated with higher sexual satisfaction and sexual function. Lower catastrophic and pain cognitions also were associated with women's lower pain. For women who reported higher sexual communication, as positive cognitions increased, there was a significantly greater decrease in pain intensity during intercourse compared to women who reported lower levels of sexual communication. Findings may inform cognitive-behavioral interventions aimed at improving the pain and sexual well-being of women with PVD. Targeting the couple's sexual communication

  15. Mismatch negativity as a potential neurobiological marker of early-stage Alzheimer disease and vascular dementia.

    Science.gov (United States)

    Jiang, Shixiang; Yan, Chang; Qiao, Zhengxue; Yao, Haiqian; Jiang, Shiquan; Qiu, Xiaohui; Yang, Xiuxian; Fang, Deyu; Yang, Yanjie; Zhang, Limei; Wang, Lina; Zhang, Liming

    2017-04-24

    Alzheimer's disease (AD) and vascular dementia (VD) are serious, irreversible forms of cognitive impairment, which means that an early diagnosis is essential to slow down their progression. One potential neurophysiological biomarker of these diseases is the mismatch negativity (MMN) event-related potentials (ERP) component, which reflects an automatic detection mechanism at the pre-attentive stages of information processing. We evaluated the auditory MMN response in individuals from two patient groups: those in the prodromal stages of AD (P-AD) and those in the prodromal stages of VD (P-VD). Thirty patients (15 P-AD patients and 15 P-VD patients) and 30 age-matched controls were recruited to undergo electrophysiological recordings during the presentation of an auditory deviant-standard-reverse oddball paradigm that was used to elicit genuine MMN responses. We show that over the frontal-central area, the mean amplitude of the MMN was significantly reduced in both the P-AD (p=0.017) and P-VD groups (p=0.013) compared with controls. The MMN peak latency in P-VD patients was significantly shorter than in controls (p=0.027). No MMN response differences between the P-AD and P-VD were found in either the frontal-central or the temporal areas. These results indicate that P-AD and P-VD patients exhibit impaired pre-attentive information processing mechanisms as revealed by the frontal-central area MMN response, which is associated with sensory memory and cognitive deficits. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Women with provoked vestibulodynia experience clinically significant reductions in pain regardless of treatment: results from a 2-year follow-up study.

    Science.gov (United States)

    Davis, Seth N P; Bergeron, Sophie; Binik, Yitzchak M; Lambert, Bernard

    2013-12-01

    Provoked vestibulodynia (PVD) is a prevalent genital pain syndrome that has been assumed to be chronic, with little spontaneous remission. Despite this assumption, there is a dearth of empirical evidence regarding the progression of PVD in a natural setting. Although many treatments are available, there is no single treatment that has demonstrated efficacy above others. The aims of this secondary analysis of a prospective study were to (i) assess changes over a 2-year period in pain, depressive symptoms, and sexual outcomes in women with PVD; and (ii) examine changes based on treatment(s) type. Participants completed questionnaire packages at Time 1 and a follow-up package 2 years later. Visual analog scale of genital pain, Global Measure of Sexual Satisfaction, Female Sexual Function Index, Beck Depression Inventory, Dyadic Adjustment Scale, and sexual intercourse attempts over the past month. Two hundred thirty-nine women with PVD completed both time one and two questionnaires. For the sample as a whole, there was significant improvement over 2 years on pain ratings, sexual satisfaction, sexual function, and depressive symptoms. The most commonly received treatments were physical therapy, sex/psychotherapy, and medical treatment, although 41.0% did not undergo any treatment. Women receiving no treatment also improved significantly on pain ratings. No single treatment type predicted better outcome for any variable except depressive symptoms, in which women who underwent surgery were more likely to improve. These results suggest that PVD may significantly reduce in severity over time. Participants demonstrated clinically significant pain improvement, even when they did not receive treatment. Furthermore, the only single treatment type predicting better outcomes was surgery, and only for depressive symptoms, accounting for only 2.3% of the variance. These data do not demonstrate the superiority of any one treatment and underscore the need to have control groups in

  17. Arsenic exposure, urinary arsenic speciation, and peripheral vascular disease in blackfoot disease-hyperendemic villages in Taiwan

    International Nuclear Information System (INIS)

    Tseng, C.-H.; Huang, Y.-K.; Huang, Y.-L.; Chung, C.-J.; Yang, M.-H.; Chen, C.-J.; Hsueh, Y.-M.

    2005-01-01

    Long-term exposure to ingested inorganic arsenic is associated with peripheral vascular disease (PVD) in the blackfoot disease (BFD)-hyperendemic area in Taiwan. This study further examined the interaction between arsenic exposure and urinary arsenic speciation on the risk of PVD. A total of 479 (220 men and 259 women) adults residing in the BFD-hyperendemic area were studied. Doppler ultrasound was used to diagnose PVD. Arsenic exposure was estimated by an index of cumulative arsenic exposure (CAE). Urinary levels of total arsenic, inorganic arsenite (As III ) and arsenate (As V ), monomethylarsonic acid (MMA V ), and dimethylarsinic acid (DMA V ) were determined. Primary methylation index [PMI = MMA V /(As III + As V )] and secondary methylation index (SMI = DMA V /MMA V ) were calculated. The association between PVD and urinary arsenic parameters was evaluated with consideration of the interaction with CAE and the confounding effects of age, sex, body mass index, total cholesterol, triglycerides, cigarette smoking, and alcohol consumption. Results showed that aging was associated with a diminishing capacity to methylate inorganic arsenic and women possessed a more efficient arsenic methylation capacity than men did. PVD risk increased with a higher CAE and a lower capacity to methylate arsenic to DMA V . The multivariate-adjusted odds ratios for CAE of 0, 0.1-15.4, and >15.4 mg/L x year were 1.00, 3.41 (0.74-15.78), and 4.62 (0.96-22.21), respectively (P 6.93, PMI > 1.77 and SMI > 6.93, PMI > 1.77 and SMI ≤ 6.93, and PMI ≤ 1.77 and SMI ≤ 6.93 were 1.00, 2.93 (0.90-9.52), 2.85 (1.05-7.73), and 3.60 (1.12-11.56), respectively (P V have a higher risk of developing PVD in the BFD-hyperendemic area in Taiwan

  18. The primary vascular dysregulation syndrome: implications for eye diseases

    Science.gov (United States)

    2013-01-01

    Vascular dysregulation refers to the regulation of blood flow that is not adapted to the needs of the respective tissue. We distinguish primary vascular dysregulation (PVD, formerly called vasospastic syndrome) and secondary vascular dysregulation (SVD). Subjects with PVD tend to have cold extremities, low blood pressure, reduced feeling of thirst, altered drug sensitivity, increased pain sensitivity, prolonged sleep onset time, altered gene expression in the lymphocytes, signs of oxidative stress, slightly increased endothelin-1 plasma level, low body mass index and often diffuse and fluctuating visual field defects. Coldness, emotional or mechanical stress and starving can provoke symptoms. Virtually all organs, particularly the eye, can be involved. In subjects with PVD, retinal vessels are stiffer and more irregular, and both neurovascular coupling and autoregulation capacity are reduced while retinal venous pressure is often increased. Subjects with PVD have increased risk for normal-tension glaucoma, optic nerve compartment syndrome, central serous choroidopathy, Susac syndrome, retinal artery and vein occlusions and anterior ischaemic neuropathy without atherosclerosis. Further characteristics are their weaker blood–brain and blood-retinal barriers and the higher prevalence of optic disc haemorrhages and activated astrocytes. Subjects with PVD tend to suffer more often from tinnitus, muscle cramps, migraine with aura and silent myocardial ischaemic and are at greater risk for altitude sickness. While the main cause of vascular dysregulation is vascular endotheliopathy, dysfunction of the autonomic nervous system is also involved. In contrast, SVD occurs in the context of other diseases such as multiple sclerosis, retrobulbar neuritis, rheumatoid arthritis, fibromyalgia and giant cell arteritis. Taking into consideration the high prevalence of PVD in the population and potentially linked pathologies, in the current article, the authors provide

  19. Increased peripheral vascular disease risk progressively constrains perfusion adaptability in the skeletal muscle microcirculation

    Science.gov (United States)

    Butcher, Joshua T.; Frisbee, Stephanie J.; Olfert, I. Mark; Chantler, Paul D.; Tabone, Lawrence E.; d'Audiffret, Alexandre C.; Shrader, Carl D.; Goodwill, Adam G.; Stapleton, Phoebe A.; Brooks, Steven D.; Brock, Robert W.; Lombard, Julian H.

    2015-01-01

    To determine the impact of progressive elevations in peripheral vascular disease (PVD) risk on microvascular function, we utilized eight rat models spanning “healthy” to “high PVD risk” and used a multiscale approach to interrogate microvascular function and outcomes: healthy: Sprague-Dawley rats (SDR) and lean Zucker rats (LZR); mild risk: SDR on high-salt diet (HSD) and SDR on high-fructose diet (HFD); moderate risk: reduced renal mass-hypertensive rats (RRM) and spontaneously hypertensive rats (SHR); high risk: obese Zucker rats (OZR) and Dahl salt-sensitive rats (DSS). Vascular reactivity and biochemical analyses demonstrated that even mild elevations in PVD risk severely attenuated nitric oxide (NO) bioavailability and caused progressive shifts in arachidonic acid metabolism, increasing thromboxane A2 levels. With the introduction of hypertension, arteriolar myogenic activation and adrenergic constriction were increased. However, while functional hyperemia and fatigue resistance of in situ skeletal muscle were not impacted with mild or moderate PVD risk, blood oxygen handling suggested an increasingly heterogeneous perfusion within resting and contracting skeletal muscle. Analysis of in situ networks demonstrated an increasingly stable and heterogeneous distribution of perfusion at arteriolar bifurcations with elevated PVD risk, a phenomenon that was manifested first in the distal microcirculation and evolved proximally with increasing risk. The increased perfusion distribution heterogeneity and loss of flexibility throughout the microvascular network, the result of the combined effects on NO bioavailability, arachidonic acid metabolism, myogenic activation, and adrenergic constriction, may represent the most accurate predictor of the skeletal muscle microvasculopathy and poor health outcomes associated with chronic elevations in PVD risk. PMID:26702145

  20. [The incidence of retinal tears in patients with posterior vitreous detachment].

    Science.gov (United States)

    Karaman, Ksenija; Gverović-Antunica, Antonela; Bućan, Kajo; Znaor, Ljubo; Bulović, Dijana; Skelin, Sinia

    2006-01-01

    Posterior vitreous detachment (PVD) is a common finding in older patients, characterized by detachment of the posterior hyaloid membrane (PHM) from the retinal surface. The detachment of PHM normally occurs without complications, however, one has to be aware that retinal tear is its most common complication. The aim of the study was to determine the incidence of retinal tears in eyes with PVD. A series of 40 patients (70 eyes) with PVD were included in this retrospective study. Eyes with a history of ocular trauma, surgery or intraocular inflammation were excluded. Patient charts were reviewed to collect the following information: age, sex, profession, type and duration of symptoms, best corrected visual acuity, refractive status, prior ocular disease, coincidental retinal pathology-lattice degeneration, number, type and location of retinal tears and treatment. Statistical analysis was done with the SPSS 11.0.3 software (SPSS Inc., USA). Besides descriptive statistics, Student's t-test and chi2-test were used. Among all study eyes with PVD, 34 (48.6%) were myopic, 24 (34.3%) hypermetropic and 12 (17.1%) emetropic; statistical analysis showed a significant difference (chi2 = 10.40, df=2, p lattice malignant degeneration of peripheral retinal was diagnosed. Thorough examination of the fundus periphery revealed 16 (22.8%) eyes with PVD were found to have retinal tears, 11 (15.7%) had only one retinal tear and 5 (7.1%) two retinal tears. All retinal tears were treated with argon laser photocoagulation. Superotemporal eye quadrant was the most common localization of retinal tears (56.25%). These results indicate that thorough fundus periphery examination should be done in all patients with PVD because it can cause rather rarely though retinal tears that represent a potentially sight threatening condition.

  1. New pulmonary vein Doppler echocardiographic index predicts significant interatrial shunting in secundum atrial septal defect.

    Science.gov (United States)

    Lam, Yat-Yin; Fang, Fang; Yip, Gabriel Wai-Kwok; Li, Zhi-An; Yang, Ya; Yu, Cheuk-Man

    2012-09-20

    The relation between pulmonary venous flow (PVF) pattern and degree of left-to-right interatrial shunting (IAS) in patients with secundum atrial septal defect (ASD) is unknown. Fifty consecutive ASD patients (14 males, 36 ± 17 years) received transthoracic echocardiography (TTE) before and 1 day after transcatheter closure and their results were compared to 40 controls. The ratio of pulmonary-to-systemic flows (Qp/Qs) was assessed by TTE and invasive oximetry. Pre-closure PV systolic (PVs), diastolic (PVd) velocities and velocity-time integral (PV-VTI) increased, time from onset of ECG Q-wave to the peak PV diastolic wave (Q-PVd) shortened and atrial reversal (PVar) velocity significantly decreased as compared to normals. These findings normalized after closure. Patients with large IAS (defined as invasive Qp/Qs ≥ 2) had higher PVs, PVd and PV-VTI, shorter Q-PVd but lower PVar (all pIAS. Invasive Qp/Qs ratios correlated with PVs, PVd, PV-VTI, Q-PVd and TTE-derived Qp/Qs ratios, ASD sizes and RV end-diastolic dimensions (all pIAS after multivariate analysis. The corresponding sensitivity, specificity and AUC were 89%, 82% and 0.90 respectively for a PV-VTI of 30 cm (pIAS have distinguishable PVF features. Doppler evaluation of PV-VTI is a novel additional tool for assessing the magnitude of shunting in these patients non-invasively. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  2. Role of interfaces on the trapping of He in 2D and 3D Cu–Nb nanocomposites

    International Nuclear Information System (INIS)

    Lach, Timothy G.; Ekiz, Elvan H.; Averback, Robert S.; Mara, Nathan A.; Bellon, Pascal

    2015-01-01

    The role of interface structure on the trapping of He in Cu–Nb nanocomposites was investigated by comparing He bubble formation in nano-multilayers grown by PVD, nanolaminates fabricated by accumulative roll bonding (ARB), and 3D nanocomposites obtained by high pressure torsion (HPT). All samples were implanted with 1 MeV He ions at room temperature and characterized by cross section transmission electron microscopy (TEM). The critical He concentration leading to bubble formation was determined by correlating the He bubble depth distribution detected by TEM with the implanted He depth profile obtained by SRIM. The critical He dose per unit interfacial area for bubble formation was largest for the PVD multilayers, lower by a factor of ∼1.4 in the HPT nanocomposites annealed at 500 °C, and lower by a factor of ∼4.6 in the ARB nanolaminates relative to the PVD multilayers. The results indicate that the (111)FCC||(110)BCC Kurdjumov-Sachs (KS) interfaces predominant in PVD and annealed HPT samples provide more effective traps than the (112)KS interfaces predominant in ARB nanolaminates; however, the good trapping efficiency and high interface area of 3D HPT structures make them most attractive for applications. - Highlights: • Cu–Nb nanocomposites with varying interface structure were implanted with He. • PVD multilayers trap the most He per interfacial area before bubbles form. • ARB nanolaminates held ∼4.6 times less He relative to the PVD multilayers. • 3D nanocomposites with high interface area can trap more He than 2D nanocomposites. • Interface structure and interfacial area density play key role in trapping He.

  3. Efectos ópticos especiales de los recubrimientos de dióxido de titanio sobre mica

    OpenAIRE

    Castaño Londoño, Carlos Eduardo

    2009-01-01

    En las aplicaciones decorativas, los fabricantes utilizan técnicas PVD para crear colores con nuevos matices y efectos ópticos especiales, sin embargo, los resultados y productos obtenidos hacen parte del Know-How de esas empresas y acceder al conocimiento involucrado para la fabricación de dispositivos a través de procesos PVD es difícil. El presente trabajo se orientó al estudio de las propiedades ópticas de películas delgadas de TiO2 depositadas mediante Magnetrón Sputtering RF sobre sustr...

  4. The transient creep of vapor deposited Ti-6Al-4V

    International Nuclear Information System (INIS)

    Warren, J.; Wadley, H.N.G.

    1996-01-01

    Titanium matrix composites can be synthesized by the consolidation of ceramic fibers (for example, alumina and silicon carbide monofilaments) coated with titanium alloy deposited on the fiber by physical vapor deposition (PVD). Consolidation involves deformation of the matrix coating by both transient and steady-state creep. In a recent paper the mechanisms responsible for steady-state creep in PVD Ti-6Al-4V, between 600 and 900 C, were determined. The analysis of the data first presented has been extended here to consider the transient creep behavior of the material and identify an analogous constitutive law for use in simulating the transient creep contribution to consolidation

  5. Physical vapor deposited thin films of lignins extracted from sugar cane bagasse: morphology, electrical properties, and sensing applications.

    Science.gov (United States)

    Volpati, Diogo; Machado, Aislan D; Olivati, Clarissa A; Alves, Neri; Curvelo, Antonio A S; Pasquini, Daniel; Constantino, Carlos J L

    2011-09-12

    The concern related to the environmental degradation and to the exhaustion of natural resources has induced the research on biodegradable materials obtained from renewable sources, which involves fundamental properties and general application. In this context, we have fabricated thin films of lignins, which were extracted from sugar cane bagasse via modified organosolv process using ethanol as organic solvent. The films were made using the vacuum thermal evaporation technique (PVD, physical vapor deposition) grown up to 120 nm. The main objective was to explore basic properties such as electrical and surface morphology and the sensing performance of these lignins as transducers. The PVD film growth was monitored via ultraviolet-visible (UV-vis) absorption spectroscopy and quartz crystal microbalance, revealing a linear relationship between absorbance and film thickness. The 120 nm lignin PVD film morphology presented small aggregates spread all over the film surface on the nanometer scale (atomic force microscopy, AFM) and homogeneous on the micrometer scale (optical microscopy). The PVD films were deposited onto Au interdigitated electrode (IDE) for both electrical characterization and sensing experiments. In the case of electrical characterization, current versus voltage (I vs V) dc measurements were carried out for the Au IDE coated with 120 nm lignin PVD film, leading to a conductivity of 3.6 × 10(-10) S/m. Using impedance spectroscopy, also for the Au IDE coated with the 120 nm lignin PVD film, dielectric constant of 8.0, tan δ of 3.9 × 10(-3), and conductivity of 1.75 × 10(-9) S/m were calculated at 1 kHz. As a proof-of-principle, the application of these lignins as transducers in sensing devices was monitored by both impedance spectroscopy (capacitance vs frequency) and I versus time dc measurements toward aniline vapor (saturated atmosphere). The electrical responses showed that the sensing units are sensible to aniline vapor with the process being

  6. On the Cutting Performance of Coated HSS Taps When Machining of Austenitic Steel

    Science.gov (United States)

    Sliwkova, Petra; Piska, Miroslav

    2014-12-01

    The paper deals with a quality of the PVD coated HSS taps when cutting the stainless austenitic chromiumnickel non-stabilized steel DIN 1.4301 (X5CrNi 18-10). The main attention is focused on the analysis of loading (cutting moment, specific energy) of the HSS taps by means of pieso-electrical dynamometer Kistler 9272 and the relation between the quality of duplex and triplex PVD coatings and their effects on the quality of machined thread surfaces and tool life of the taps. The results showed a safe and stabilized cutting with acceptable quality of threads for HSSE with the TiN+TiCN+DLC coating.

  7. Thermal shock testing of low-Z coatings with pulsed hydrogen beams

    International Nuclear Information System (INIS)

    Nakamura, Kazuyuki

    1982-03-01

    Thermal shock testing of candidate low-Z surface coatings for JT-60 application has been made by using a pulsed hydrogen beam apparatus which is operated at a power density of 2KW/cm 2 . The materials tested are PVD (Physical Vapor Deposited) TiC and PVD and CVD (Chemical Vapor Deposited) TiN on molybdenum and Inconel 625. The result shows that CVD TiC on Mo and CVD TiN on Inconel are the most interesting choices for the coating-substrate combinations. (author)

  8. Polyarteritis nodosa presenting as peripheral vascular disease and acute limb ischemia

    Directory of Open Access Journals (Sweden)

    A Shukla

    2017-01-01

    Full Text Available Acute limb ischemia and peripheral vascular disease (PVD are unusual presentations of polyarteritis nodosa (PAN. Here, we present a case with PVD of both lower limbs leading to foot claudication. Digital subtraction angiography showed narrowing, irregularity, and occlusion of both lower limb arteries with no involvement of the abdomen visceral arteries. Based on significant weight loss, diastolic blood pressure >90 mmHg, myalgia, testicular pain, and angiographic abnormalities in medium-sized arteries, he was diagnosed as having PAN. He was treated with corticosteroid and bolus intravenous cyclophosphamide following which he had prompt and near-complete recovery of the symptoms without any tissue loss.

  9. Effects of exogenous pyoverdines on Fe availability and their impacts on Mn(II) oxidation by Pseudomonas putida GB-1

    Science.gov (United States)

    Lee, Sung-Woo; Parker, Dorothy L.; Geszvain, Kati; Tebo, Bradley M.

    2014-01-01

    Pseudomonas putida GB-1 is a Mn(II)-oxidizing bacterium that produces pyoverdine-type siderophores (PVDs), which facilitate the uptake of Fe(III) but also influence MnO2 formation. Recently, a non-ribosomal peptide synthetase mutant that does not synthesize PVD was described. Here we identified a gene encoding the PVDGB-1 (PVD produced by strain GB-1) uptake receptor (PputGB1_4082) of strain GB-1 and confirmed its function by in-frame mutagenesis. Growth and other physiological responses of these two mutants and of wild type were compared during cultivation in the presence of three chemically distinct sets of PVDs (siderotypes n°1, n°2, and n°4) derived from various pseudomonads. Under iron-limiting conditions, Fe(III) complexes of various siderotype n°1 PVDs (including PVDGB-1) allowed growth of wild type and the synthetase mutant, but not the receptor mutant, confirming that iron uptake with any tested siderotype n°1 PVD depended on PputGB1_4082. Fe(III) complexes of a siderotype n°2 PVD were not utilized by any strain and strongly induced PVD synthesis. In contrast, Fe(III) complexes of siderotype n°4 PVDs promoted the growth of all three strains and did not induce PVD synthesis by the wild type, implying these complexes were utilized for iron uptake independent of PputGB1_4082. These differing properties of the three PVD types provided a way to differentiate between effects on MnO2 formation that resulted from iron limitation and others that required participation of the PVDGB-1 receptor. Specifically, MnO2 production was inhibited by siderotype n°1 but not n°4 PVDs indicating PVD synthesis or PputGB1_4082 involvement rather than iron-limitation caused the inhibition. In contrast, iron limitation was sufficient to explain the inhibition of Mn(II) oxidation by siderotype n°2 PVDs. Collectively, our results provide insight into how competition for iron via siderophores influences growth, iron nutrition and MnO2 formation in more complex environmental

  10. Protective amorphous carbon coatings on glass substrates

    Science.gov (United States)

    Silins, Kaspars; Baránková, Hana; Bardos, Ladislav

    2017-11-01

    Thick amorphous carbon films were deposited by the Magnets-in-Motion (M-M) rf linear hollow cathode at varying acetylene contents in Ar in a hybrid PVD/PE-CVD process directly on glass substrates. The hollow cathode plates manufactured from graphite were used as the PVD target. The measurements show that the films can reach thickness of up to 50 μm at deposition rates of up to 2.5 μm/min. Scratch test measurements confirm that well adhering films several μm thick can be achieved at C2H2 contents of up to 0.5%.

  11. Application of Prefabricated Vertical Drain in Soil Improvement

    Directory of Open Access Journals (Sweden)

    Tedjakusuma B.

    2012-01-01

    Full Text Available Although the use of Prefabricated Vertical Drain (PVD in soil improvement is not new, this paper is interesting since it gives the full spectrum from preliminary design stage; trial embankment and pilot test to final soil improvement. The final installation of the PVD was based on the soil investigation report and the results of instrumentation monitoring. Finally, using back analysis, vertical and horizontal coefficients of consolidation and compression index can be determined, which can be applied to predict a more accurate prediction of settlement.

  12. Galvanostatic methods for stripping of crn coatings; Estudio para la recuperacion de herramientas recubiertas con nitrogeno de cromo mediante ensayos galvanostaticos

    Energy Technology Data Exchange (ETDEWEB)

    Cristobal, A. B.; Conde, A.; Rodriguez, R.; Fuentes, G. G.; Montala, F.; Carreras, L.; Damborenea, J. de

    2006-07-01

    The improvements of the corrosion, wear and tribological behaviour by searching for new materials has entailed a greater expansion of PVD technology. Introduction of PVD systems in the industry is a real fact because this technique has been able to develop coatings whose response for many applications goes beyond used them until now. However the evolution of this technology requires minimize the economic costs in order to be a competitive process. A way to achieve this objective consists on recover the tool when the life time of the coating has finished or when deposition process has failed. (Author)

  13. Purulent vaginal discharge in grazing dairy cows: Risk factors, reproductive performance, and prostaglandin F2α treatment.

    Science.gov (United States)

    Giuliodori, M J; Magnasco, M; Magnasco, R P; Lacau-Mengido, I M; de la Sota, R L

    2017-05-01

    The objectives of this study were to assess the association of a 4-point scale of vaginal discharge score (VDS) with time to pregnancy to define criteria for a practical case of purulent vaginal discharge (PVD) in dairy cows, to test the risk factors for PVD, and, finally, the effect of a dose of PGF 2α on cure and reproductive performance. In experiment 1, grazing Holstein cows (n = 2,414) had their vaginal discharge scored at ∼32 d in milk (DIM) on a 4-point scale, the effect of VDS on the hazard of pregnancy by 300 DIM was then assessed to derive a case definition of PVD. Risk factors for PVD and self-cure were also assessed. In experiment 2, grazing Holstein cows (n = 6,326) from 5 herds were checked for PVD at ∼30 DIM. Cows with PVD were assigned to receive one dose of 500 μg of PGF 2α analog (Cloprostenol; Ciclase, Syntex SA, Buenos Aires, Argentina) per cow (odd ear tag number) or to remain untreated (even tag number). Cure was declared if cows presented clear normal vaginal discharge (VDS-0) at visit 2 (∼62 DIM). Data were analyzed with Cox's regression and mixed logistic models. In experiment 1, cows with VDS ≥1 had lower hazard of pregnancy and longer calving to pregnancy interval than cows with VDS-0. This finding was not affected by the time at which the diagnosis was performed. Therefore, a cow ≥21 DIM and having VDS ≥1 was used to define a case of PVD. The odds of PVD were greater in primiparous cows compared with multiparous, in cows with abnormal calving compared with those with normal calving, and in those losing BCS peripartum. In experiment 2, PGF 2α treatment tended to slightly increase the hazard of pregnancy (adjusted hazard ratio = 1.13). Conversely, PGF 2α had no effect on the odds of cure of PVD [adjusted odds ratio (AOR) = 1.19], pregnancy at first service (AOR = 1.03), or pregnancy by 100 DIM (AOR = 0.89) or 200 DIM (AOR = 1.27). In conclusion, cows with VDS ≥1 can be considered to have PVD because of their lower hazard

  14. Prevalence of purulent vaginal discharge in dairy herds depends on timing but not method of detection

    Science.gov (United States)

    A review of existing literature was conducted to determine the prevalence of purulent vaginal discharge (PVD) in dairy herds around the world and detection methodologies that influence prevalence estimates. Four databases (PubMed, Google Scholar, Web of Science, and Scopus) were queried with the sea...

  15. Coatings for transport industry

    Directory of Open Access Journals (Sweden)

    Krzysztof LUKASZKOWICZ

    2014-09-01

    Full Text Available The investigations concerned structural analysis, as well as mechanical properties and wear resistant of MeN/DLC double-layer coating deposited by hybrid PVD/PACVD method. In sliding dry friction conditions, after the break-in time, the friction coefficient for the investigated elements is set in the range between 0.03-0.06.

  16. Talking About Sex When Sex Is Painful: Dyadic Sexual Communication Is Associated With Women's Pain, and Couples' Sexual and Psychological Outcomes in Provoked Vestibulodynia.

    Science.gov (United States)

    Rancourt, Kate M; Rosen, Natalie O; Bergeron, Sophie; Nealis, Logan J

    2016-11-01

    Provoked vestibulodynia (PVD) is a recurrent vulvovaginal pain condition associated with psychological and sexual consequences for affected women and their partners, including lower quality of dyadic sexual communication compared to pain-free couples. Although greater sexual communication is associated with positive sexual and relational outcomes for both pain-free couples and couples experiencing painful sex, little is known about its role in women's pain and psychological outcomes, especially in a relational context. The present study examined associations between dyadic sexual communication and pain, sexual satisfaction, sexual functioning, and depressive symptoms in a sample of 107 couples in which the woman was diagnosed with PVD via a standardized gynecological assessment. Women completed a measure of pain intensity, and both members of the couple completed measures of their dyadic sexual communication, sexual satisfaction, sexual functioning, and depressive symptoms. Analyses were guided by the actor-partner interdependence model. Women and partners' own perceptions of greater dyadic sexual communication were associated with their own greater sexual satisfaction and sexual functioning, and lower depressive symptoms. Partners' perceptions of greater dyadic sexual communication were also associated with women's lower pain and greater sexual satisfaction. Results point to the importance of dyadic coping conceptualizations for both individual and interpersonal outcomes in PVD. Dyadic sexual communication may be a key treatment target for interventions aimed at improving the pain and psychological and sexual impairments of women with PVD and their partners.

  17. Photovoltaic device and method

    Science.gov (United States)

    Cleereman, Robert J; Lesniak, Michael J; Keenihan, James R; Langmaid, Joe A; Gaston, Ryan; Eurich, Gerald K; Boven, Michelle L

    2015-01-27

    The present invention is premised upon an improved photovoltaic device ("PVD") and method of use, more particularly to an improved photovoltaic device with an integral locator and electrical terminal mechanism for transferring current to or from the improved photovoltaic device and the use as a system.

  18. Application of Hard Coatings for Improved Tribological Performance of Blanking and Piercing Tools

    DEFF Research Database (Denmark)

    Podgornik, B.; Zajec, B.; Bay, Niels

    2010-01-01

    The aim of the present investigation was to examine the possibility of reducing lubrication and replacing expensive tungsten carbide material in blanking/piercing through introduction of hard tool coatings. Results show that hard PVD coatings can be successfully used in blanking/piercing applicat...

  19. Intravitreal gas injection for the treatment of diabetic macular edema

    Directory of Open Access Journals (Sweden)

    McHugh D

    2011-10-01

    Full Text Available Dominic McHugh, Bhaskar Gupta, Manzar Saeed King's College Hospital, Denmark Hill, London, England, UK Purpose: This study investigates the efficacy of an intravitreal gas injection in inducing a posterior vitreous detachment (PVD in patients with clinically significant diabetic macular edema refractory to laser therapy. Methods: A local ethics committee-approved technique of an intravitreal injection of pure perfluoropropane gas (C3F8 was performed for all participants. After a period of prone positioning, the patients underwent regular and detailed clinical review. Main outcome measures: The induction of a PVD, change in macular thickness, change in visual acuity. Results: A PVD was induced in all five eyes with subsequent signs of reduction in macular thickness and resolution of exudates. Mean visual improvement was 11 ETDRS (Early Treatment Diabetic Retinopathy Study letters (range 4–21. Apart from a transient vitreous hemorrhage in one eye, there were no significant treatment-related complications. Conclusion: The induction of a PVD by pneumatic retinopexy appears to have a significant influence on diabetic macular edema in eyes which have not successfully responded to macular laser therapy. A randomized clinical trial is justified on the basis of the initial promising data. Keywords: optical coherence tomography, OCT, posterior vitreous detachment, perfluoropropane

  20. Are there still roles for exocrine bladder drainage and portal venous drainage for pancreatic allografts?

    Science.gov (United States)

    Young, Carlton J

    2009-02-01

    Controversy remains regarding the best methodology of handling exocrine pancreatic fluid and pancreatic venous effluent. Bladder drainage has given way to enteric drainage. However, is there an instance in which bladder drainage is preferable? Also, hyperinsulinemia, as a result of systemic venous drainage (SVD), is claimed to be proatherosclerotic, whereas portal venous drainage (PVD) is more physiologic and less atherosclerotic. Bladder drainage remains a viable method of exocrine pancreas drainage, but evidence is sparse that measuring urinary amylase has a substantial benefit in the early detection of acute rejection in all types of pancreas transplants. Currently, there is no incontrovertible evidence that systemic hyperinsulinemia is proatherosclerotic, whereas recent metabolic studies on SVD and PVD showed that there was no benefit to PVD. Given the advent of newer immunosuppressive agents and overall lower acute rejection rates, the perceived benefit of bladder drainage as a means to measure urinary amylase as an early marker of rejection has not been substantiated. However, there may be a selective role for bladder drainage in 'high risk' pancreases. Also, without a clear-cut metabolic benefit to PVD over SVD, it remains the surgeon's choice as to which method to use.

  1. Characterization of a Stabilized Form of Microplasmin for the Induction of Posterior Vitreous Detachment

    NARCIS (Netherlands)

    Gad Elkareem, Ashraf M.; Willekens, Ben; Vanhove, Marc; Noppen, Bernard; Stassen, Jean Marie; de Smet, Marc D.

    2010-01-01

    Purpose: To investigate the stability and safety of a diluted acidified form of microplasmin and its ability to induce a posterior vitreous detachment (PVD) following intravitreal injection in postmortem porcine eyes. Methods: Microplasmin diluted in normal saline (NS) and balanced salt solution

  2. Technology and Environmental Education: Friend or Foe?

    Science.gov (United States)

    Athman, Julie; Bates, Tim

    1998-01-01

    Discusses the pros and cons often mentioned concerning technology in education. Describes measures of effectiveness of technology-enhanced educational programs, ranging from active learning and multidisciplinary tasks to performance-based assessments. Argues that technology should enhance rather than replace direct experiences. (PVD)

  3. Enzyme-mediated quenching of the Pseudomonas quinolone signal (PQS promotes biofilm formation of Pseudomonas aeruginosa by increasing iron availability

    Directory of Open Access Journals (Sweden)

    Beatrix Tettmann

    2016-12-01

    Full Text Available The 2-alkyl-3-hydroxy-4(1H-quinolone 2,4-dioxygenase HodC was previously described to cleave the Pseudomonas quinolone signal, PQS, which is exclusively used in the complex quorum sensing (QS system of Pseudomonas aeruginosa, an opportunistic pathogen employing QS to regulate virulence and biofilm development. Degradation of PQS by exogenous addition of HodC to planktonic cells of P. aeruginosa attenuated production of virulence factors, and reduced virulence in planta. However, proteolytic cleavage reduced the efficacy of HodC. Here, we identified the secreted protease LasB of P. aeruginosa to be responsible for HodC degradation. In static biofilms of the P. aeruginosa PA14 lasB::Tn mutant, the catalytic activity of HodC led to an increase in viable biomass in newly formed but also in established biofilms, and reduced the expression of genes involved in iron metabolism and siderophore production, such as pvdS, pvdL, pvdA and pvdQ. This is likely due to an increase in the levels of bioavailable iron by degradation of PQS, which is able to sequester iron from the surrounding environment. Thus, HodC, despite its ability to quench the production of virulence factors, is contraindicated for combating P. aeruginosa biofilms.

  4. Janice VanCleave's World: Trapper.

    Science.gov (United States)

    VanCleave, Janice

    2000-01-01

    Introduces young children to the safe study of insects and promotes respect for the study specimen. Children craft insects out of marshmallows, toothpicks, and cardboard and practice using a clear plastic cup to collect and observe insects through a magnifying lens. With their new skills, they can move on to studying real insects. (PVD)

  5. P-6 : Impact of buffer layers on the self-aligned top-gate a-IGZO TFT characteristics

    NARCIS (Netherlands)

    Nag, M.; en de rest

    2015-01-01

    In this work we present the impact of buffer layers deposited by various techniques such as plasma enhanced chemical deposition (PECVD), physical vapor deposition (PVD) and atomic layer deposition (ALD) techniques on self-aligned (SA) top gate amorphous-Indium-Gallium-Zinc-Oxide (a-IGZO) TFT

  6. based gel polymer electrolytes

    Indian Academy of Sciences (India)

    (PVdF) as a host polymer, lithium perchlorate (LiClO4), lithium triflate ... TG/DTA studies showed the thermal stability of the polymer electrolytes. .... are observed while comparing pure XRD spectra with .... batteries as its operating temperature is normally in the .... chain ion movements and the conductivity of the polymer.

  7. Teaching the Rock Cycle with Ease.

    Science.gov (United States)

    Bereki, Debra

    2000-01-01

    Describes a hands-on lesson for teaching high school students the concept of the rock cycle using sedimentary, metamorphic, and igneous rocks. Students use a rock cycle diagram to identify pairs of rocks. From the rock cycle, students explain on paper how their first rock became the second rock and vice versa. (PVD)

  8. Attachment, Sexual Assertiveness, and Sexual Outcomes in Women with Provoked Vestibulodynia and Their Partners: A Mediation Model.

    Science.gov (United States)

    Leclerc, Bianca; Bergeron, Sophie; Brassard, Audrey; Bélanger, Claude; Steben, Marc; Lambert, Bernard

    2015-08-01

    Provoked vestibulodynia (PVD) is a prevalent women's sexual pain disorder, which is associated with sexual function difficulties. Attachment theory has been used to understand adult sexual outcomes, providing a useful framework for examining sexual adaptation in couples confronted with PVD. Research to date indicates that anxious and avoidant attachment dimensions correlate with worse sexual outcomes in community and clinical samples. The present study examined the association between attachment, pain, sexual function, and sexual satisfaction in a sample of 101 couples in which the women presented with PVD. The actor-partner interdependence model was used in order to investigate both actor and partner effects. This study also examined the role of sexual assertiveness as a mediator of these associations via structural equation modeling. Women completed measures of pain intensity and both members of the couple completed measures of romantic attachment, sexual assertiveness, sexual function, and satisfaction. Results indicated that attachment dimensions did not predict pain intensity. Both anxious and avoidant attachment were associated with lower sexual satisfaction. Only attachment avoidance predicted lower sexual function in women. Partner effects indicated that higher sexual assertiveness in women predicted higher sexual satisfaction in men. Finally, women's sexual assertiveness was found to be a significant mediator of the relationship between their attachment dimensions, sexual function, and satisfaction. Findings highlight the importance of examining how anxious and avoidant attachment may lead to difficulties in sexual assertiveness and to less satisfying sexual interactions in couples where women suffer from PVD.

  9. Enhancing the oxidation resistance of graphite by applying an SiC coat with crack healing at an elevated temperature

    Science.gov (United States)

    Park, Jae-Won; Kim, Eung-Seon; Kim, Jae-Un; Kim, Yootaek; Windes, William E.

    2016-08-01

    The potential of reducing the oxidation of the supporting graphite components during normal and/or accident conditions in the Very High Temperature Reactor (VHTR) design has been studied. In this work efforts have been made to slow the oxidation process of the graphite with a thin SiC coating (∼ 10 μm). Upon heating at ≥ 1173 K in air, the spallations and cracks were formed in the dense columnar structured SiC coating layer grown on the graphite with a functionally gradient electron beam physical vapor deposition (EB-PVD. In accordance with the formations of these defects, the sample was vigorously oxidized, leaving only the SiC coating layer. Then, efforts were made to heal the surface defects using additional EB-PVD with ion beam bombardment and chemical vapor deposition (CVD). The EB-PVD did not effectively heal the cracks. But, the CVD was more appropriate for crack healing, likely due to its excellent crack line filling capability with a high density and high aspect ratio. It took ∼ 34 min for the 20% weight loss of the CVD crack healed sample in the oxidation test with annealing at 1173 K, while it took ∼ 8 min for the EB-PVD coated sample, which means it took ∼4 times longer at 1173 K for the same weight reduction in this experimental set-up.

  10. The inter-arm blood pressure difference and peripheral vascular disease: cross-sectional study.

    Science.gov (United States)

    Clark, Christopher E; Campbell, John L; Powell, Roy J; Thompson, John F

    2007-10-01

    A blood pressure (BP) difference between the upper limbs is often encountered in primary care. Knowledge of its prevalence and importance in the accurate measurement of BP is poor, representing a source of error. Current hypertension guidelines do not emphasize this. To establish the prevalence of an inter-arm blood pressure difference (IAD) and explore its association with other indicators of peripheral vascular disease (PVD) in a hypertensive primary care population. This was a cross-sectional study. Primary care, one rural general practice, was the setting of the study. The methods were controlled simultaneous measurement of brachial BPs, ankle-brachial pressure index (ABPI) and tiptoe stress testing in 94 subjects. In all, 18 of 94 [19%, 95% confidence interval (CI) 11-27%] subjects had mean systolic inter-arm difference (sIAD) > or =10 mmHg and seven of 94 (7%, 95% CI 2-12%) had mean diastolic inter-arm difference (dIAD) > or =10 mmHg. Nineteen of 91 (20%, 95% CI 12-28%) had a reduced ABPI pressure drop > or =20%. An IAD and asymptomatic PVD are common in a primary care hypertensive population. Magnitude of the IAD is inversely correlated with ABPI, supporting the hypotheses that IADs are causally linked to PVD, and that IAD is a useful marker for the presence of PVD. Consequently, detection of an IAD should prompt the clinician to screen subjects for other signs of vascular disease and target them for aggressive cardiovascular risk factor modification.

  11. PA0305 of Pseudomonas aeruginosa is a quorum quenching acylhomoserine lactone acylase belonging to the Ntn hydrolase superfamily

    NARCIS (Netherlands)

    Wahjudi, Mariana; Papaioannou, Evelina; Hendrawati, Oktavia; van Assen, Aart H. G.; van Merkerk, Ronald; Cool, Robbert H.; Poelarends, Gerrit J.; Quax, Wim

    The Pseudomonas aeruginosa PAO1 genome has at least two genes, pvdQ and quiP, encoding acylhomoserine lactone (AHL) acylases. Two additional genes, pa 1893 and pa0305, have been predicted to encode penicillin acylase proteins, but have not been characterized. Initial studies on a pa0305 transposon

  12. Study of Stress Migration Failure in SiLKTM/SiO2 Hybrid Cu Interconnects

    International Nuclear Information System (INIS)

    Tsuchikawa, Haruo; Nakamura, Tomoji; Suzuki, Takashi; Mori, Hiroko; Shono, Ken

    2004-01-01

    Stress migration (SM) behavior is studied for a 130nm-node SiLK TM /SiO2 hybrid structure in which the interlevel dielectrics (ILD) consist of SiLK TM for trench levels and SiO2 for via levels. The failure rate dependence on the temperature, line width and circuit is examined in detail. Furthermore, an effect of dielectric deposition process on the reliability of the hybrid interconnects is investigated. It has been found that SM behavior is essentially similar to that reported in Cu/SiO2 systems. It has also been clarified that SiO2 PVD conditions at via level had a large impact on the failure rate. Therefore, the control of ILD deposition conditions is found to be one of the key factors in suppressing the SM failure. In order to examine the effect of the PVD conditions, the residual stress in vias were measured by using X-ray diffraction method. The results show that σx (the stress component parallel to the surface) in vias greatly depends on the PVD conditions. Then, the relationship between the PVD conditions and the SM failure rate is clarified

  13. Aeronautical Engineering Education in Spain: Changing Needs in an Evolving Environment.

    Science.gov (United States)

    Martinez-Val, Rodrigo

    1997-01-01

    Describes the successive stages of the School of Aeronautical Engineering of Madrid, Spain, in terms of entry requirements, curricula guidelines, options or specialties, duration of studies, and number of graduates. Also includes a description of the Spanish aeronautical industry and its evolution. (Author/PVD)

  14. Environmental Reporting for Global Higher Education Institutions using the World Wide Web.

    Science.gov (United States)

    Walton, J.; Alabaster, T.; Richardson, S.; Harrison, R.

    1997-01-01

    Proposes the value of voluntary environmental reporting by higher education institutions as an aid to implementing environmental policies. Suggests that the World Wide Web can provide a fast, up-to-date, flexible, participatory, multidimensional medium for information exchange and management. Contains 29 references. (PVD)

  15. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The stainless steels, in general, are considered to be difficult-to-machine materials. In order to machine these materials the surface of the tool is generally coated with physical vapour deposition (PVD) hard coatings such as titanium nitride (TiN), titanium aluminum nitride (TiAlN), etc. The adhesion is of vital importance for ...

  16. Study of the indentation response of nanocomposite n-TiC/a-C:H coatings

    Czech Academy of Sciences Publication Activity Database

    Zábranský, L.; Buršíková, V.; Buršík, Jiří; Vašina, P.; Souček, P.; Caha, O.; Jílek, M.; Peřina, Vratislav

    2012-01-01

    Roč. 106, SI (2012), s1508-s1511 ISSN 0009-2770 Institutional support: RVO:68081723 ; RVO:61389005 Keywords : nanocomposite coatings * PVD * mechanical properties Subject RIV: BL - Plasma and Gas Discharge Physics; BG - Nuclear, Atomic and Molecular Physics, Colliders (UJF-V) Impact factor: 0.453, year: 2012

  17. Untitled

    African Journals Online (AJOL)

    NG-methyl-L-arginine inhibitor of nitric oxide formation acts synergistically with dobutamine to improve cardiovascular performance in endotoxemic dogs. Intem. Care Med, 1994;22:1835-1840. 2. Vincent JL, and Linder PVD. Septic shock: particular type of acute circulatory failure. Critic Caare Med, 1990;18:570-574. 3.

  18. Srovnání kontaktního a optického měření povrchu laserem natavených vrstev

    Czech Academy of Sciences Publication Activity Database

    Chmelíčková, Hana; Lapšanská, Hana; Hiklová, Helena; Havelková, Martina

    2007-01-01

    Roč. 52, 11-12 (2007), s. 307-310 ISSN 0447-6441 R&D Projects: GA AV ČR KAN301370701 Institutional research plan: CEZ:AV0Z10100522 Keywords : PVD -coatings * laser * re-melting * confocal laser microscopy * inductive profilometer Subject RIV: BH - Optics, Masers, Lasers

  19. Anti corrosion layer for stainless steel in molten carbonate fuel cell - comprises phase vapour deposition of titanium nitride, aluminium nitride or chromium nitride layer then oxidising layer in molten carbonate electrolyte

    DEFF Research Database (Denmark)

    2000-01-01

    Forming an anticorrosion protective layer on a stainless steel surface used in a molten carbonate fuel cell (MCFC) - comprises the phase vapour deposition (PVD) of a layer comprising at least one of titanium nitride, aluminium nitride or chromium nitride and then forming a protective layer in situ...

  20. Nutrition in the prevention of Coronary Heart Disease and the management of lipoprotein disorders

    Science.gov (United States)

    Cardiovascular disease (CVD) is comprised of coronary heart disease (CHD), stroke, and peripheral vascular disease (PVD). CVD is caused by progressive narrowing and blockage of arteries supplying the heart, brain, and other tissues and organs. CVD is the leading cause of death and disability in our ...

  1. Microstructural Effects and Properties of Non-line-of-Sight Coating Processing via Plasma Spray-Physical Vapor Deposition

    Science.gov (United States)

    Harder, Bryan J.; Zhu, Dongming; Schmitt, Michael P.; Wolfe, Douglas E.

    2017-08-01

    Plasma spray-physical vapor deposition (PS-PVD) is a unique processing method that bridges the gap between conventional thermal spray and vapor phase methods, and enables highly tailorable coatings composed of a variety of materials in thin, dense layers or columnar microstructures with modification of the processing conditions. The strengths of this processing technique are material and microstructural flexibility, deposition speed, and potential for non-line-of-sight (NLOS) capability by vaporization of the feedstock material. The NLOS capability of PS-PVD is investigated here using yttria-stabilized zirconia and gadolinium zirconate, which are materials of interest for turbine engine applications. PS-PVD coatings were applied to static cylindrical substrates approximately 6-19 mm in diameter to study the coating morphology as a function of angle. In addition, coatings were deposited on flat substrates under various impingement configurations. Impingement angle had significant effects on the deposition mode, and microscopy of coatings indicated that there was a shift in the deposition mode at approximately 90° from incidence on the cylindrical samples, which may indicate the onset of more turbulent flow and PVD-like growth. Coatings deposited at non-perpendicular angles exhibited a higher density and nearly a 2× improvement in erosion performance when compared to coatings deposited with the torch normal to the surface.

  2. Caenorhabditis elegans nicotinic acetylcholine receptors are required for nociception

    Science.gov (United States)

    Cohen, Emiliano; Chatzigeorgiou, Marios; Husson, Steven J.; Steuer-Costa, Wagner; Gottschalk, Alexander; Schafer, William R.; Treinin, Millet

    2014-01-01

    Polymodal nociceptors sense and integrate information on injurious mechanical, thermal, and chemical stimuli. Chemical signals either activate nociceptors or modulate their responses to other stimuli. One chemical known to activate or modulate responses of nociceptors is acetylcholine (ACh). Across evolution nociceptors express subunits of the nicotinic acetylcholine receptor (nAChR) family, a family of ACh-gated ion channels. The roles of ACh and nAChRs in nociceptor function are, however, poorly understood. Caenorhabditis elegans polymodal nociceptors, PVD, express nAChR subunits on their sensory arbor. Here we show that mutations reducing ACh synthesis and mutations in nAChR subunits lead to defects in PVD function and morphology. A likely cause for these defects is a reduction in cytosolic calcium measured in ACh and nAChR mutants. Indeed, overexpression of a calcium pump in PVD mimics defects in PVD function and morphology found in nAChR mutants. Our results demonstrate, for the first time, a central role for nAChRs and ACh in nociceptor function and suggest that calcium permeating via nAChRs facilitates activity of several signaling pathways within this neuron. PMID:24518198

  3. Morphological characteristics associated with rupture risk of multiple intracranial aneurysms.

    Science.gov (United States)

    Wang, Guang-Xian; Liu, Lan-Lan; Wen, Li; Cao, Yun-Xing; Pei, Yu-Chun; Zhang, Dong

    2017-10-01

    To identify the morphological parameters that are related to intracranial aneurysms (IAs) rupture using a case-control model. A total of 107 patients with multiple IAs and aneurysmal subarachnoid hemorrhage between August 2011 and February 2017 were enrolled in this study. Characteristics of IAs location, shape, neck width, perpendicular height, depth, maximum size, flow angle, parent vessel diameter (PVD), aspect ratio (AR) and size ratio (SR) were evaluated using CT angiography. Multiple logistic regression analysis was used to identify the independent risk factors associated with IAs rupture. Receiver operating characteristic curve analysis was performed on the final model, and the optimal thresholds were obtained. IAs located in the internal carotid artery (ICA) was associated with a negative risk of rupture, whereas AR, SR1 (height/PVD) and SR2 (depth/PVD) were associated with increased risk of rupture. When SR was calculated differently, the odds ratio values of these factors were also different. The receiver operating characteristic curve showed that AR, SR1 and SR2 had cut-off values of 1.01, 1.48 and 1.40, respectively. SR3 (maximum size/PVD) was not associated with IAs rupture. IAs located in the ICA are associated with a negative risk of rupture, while high AR (>1.01), SR1 (>1.48) or SR2 (>1.40) are risk factors for multiple IAs rupture. Copyright © 2017 Hainan Medical University. Production and hosting by Elsevier B.V. All rights reserved.

  4. Posterior vitreous detachment induced by nattokinase (subtilisin NAT): a novel enzyme for pharmacologic vitreolysis.

    Science.gov (United States)

    Takano, Akiomi; Hirata, Akira; Ogasawara, Kazuya; Sagara, Nina; Inomata, Yasuya; Kawaji, Takahiro; Tanihara, Hidenobu

    2006-05-01

    To investigate the effects of intravitreal injection of nattokinase (subtilisin NAT), a serine protease that is produced by Bacillus subtilis (natto), for induction of posterior vitreous detachment (PVD). Different doses of nattokinase (1, 0.1, or 0.01 fibrin-degradation units [FU]) or physiologic saline as a control were injected into the vitreous cavity of rabbit eyes. Scanning electron microscopy was used to observe the retinal surfaces of four rabbit eyes per concentration. Histologic alterations were assessed by light microscopy, using four eyes from each group. Electroretinography (ERG) was performed to observe retinal function, ranging from 1 hour to 1 week after the nattokinase (1 or 0.1 FU) or saline solution administration, using four eyes from each group at each time point. Also, findings in all rabbits were monitored by slit lamp examination and by indirect ophthalmoscopy with a 20-D lens. Scanning electron microscopy showed smooth retinal surfaces, indicating the occurrence of PVD at 30 minutes after intervention in all the experimental eyes injected with 0.1 or 1.0 FU nattokinase, but none of the control eyes. Light microscopy and ERG analysis showed no critical change even after the use of 0.1 FU nattokinase, an amount sufficient to induce PVD. However, toxicity in the forms of preretinal hemorrhage and ERG changes was noted with the higher dose (1 FU) of nattokinase. The results suggested that nattokinase is a useful enzyme for pharmacologic vitreolysis because of its efficacy in inducing PVD.

  5. Nanocomposite C-Pd thin films – a new material with specific spectral properties

    Directory of Open Access Journals (Sweden)

    M. Suchańska

    2013-09-01

    Full Text Available In this paper, the results of optical investigations for thin films of carbon-palladium (C-Pd nanocomposites are presented. This films were prepared using two steps method (PVD/ CVD. The optical and Raman spectroscopy has been used to characterize the material. The multinanolayer model was used to explain the specific spectral properties.

  6. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    propylene), poly(methyl methacrylate) and 1.0 M NaI as salt have been synthesized using solution caste technique by varying the PVdF(HFP)–PMMA blend concentration ratio systematically. A.c. impedance studies were performed to evaluate ...

  7. Testing of the Impact Load and Tribological Behaviour of W-C:H Hard Composite Coatings

    Czech Academy of Sciences Publication Activity Database

    Fořt, Tomáš; Vítů, T.; Novák, R.; Grossman, Jan; Sobota, Jaroslav; Vyskočil, J.

    2011-01-01

    Roč. 105, č. 14 (2011), s102-s104 ISSN 0009-2770 R&D Projects: GA MPO 2A-1TP1/031 Institutional research plan: CEZ:AV0Z20650511 Keywords : PVD * DLC * impact test * pin-on-disc * friction coefficient Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.529, year: 2011

  8. Risk Factors for 30-Day Mortality in Patients with Methicillin-Resistant Staphylococcus aureus Bloodstream Infections

    Directory of Open Access Journals (Sweden)

    Pedro Ayau

    2017-08-01

    Conclusions: Our study identified significant risk factors for 30-day mortality in patients with MRSA BSI. Interestingly, diabetes mellitus, PVD and readmission were protective effects on 30-day mortality. There was no statistically significant variability in 30-day mortality over the 9-year study period.

  9. A Dyadic Perspective on Childhood Maltreatment for Women With Provoked Vestibulodynia and Their Partners: Associations With Pain and Sexual and Psychosocial Functioning.

    Science.gov (United States)

    Corsini-Munt, Serena; Bergeron, Sophie; Rosen, Natalie O; Beaulieu, Noémie; Steben, Marc

    2017-01-01

    Childhood maltreatment is robustly associated with adult-onset vulvodynia, a common form of female genito-pelvic pain/penetration disorder. However, little is known about the impact of childhood maltreatment on current sexual, psychological, and relationship adaptation for couples with provoked vestibulodynia (PVD). This study examined the associations between childhood maltreatment and sexual and psychosocial functioning and pain in women with PVD, the most common subtype of vulvodynia, and their partners. A total of 49 couples (M age women = 27.80, SD = 6.05; M age men = 30.04; SD = 6.48) with PVD completed the Childhood Trauma Questionnaire (CTQ), as well as measures of sexual functioning, couple satisfaction, and anxiety. Women also reported on their pain during intercourse. Analyses were guided by the actor-partner interdependence model. Women's higher reports of childhood maltreatment were associated with their lower sexual functioning and higher anxiety. Partners' higher reports of childhood maltreatment were associated with their lower sexual functioning, lower couple satisfaction, and higher anxiety, as well as women's lower couple satisfaction and higher anxiety. Both women's and partners' higher reports of childhood maltreatment were associated with higher affective pain for women. Findings suggest childhood maltreatment experienced by women with PVD and their partners should be considered as part of treatment planning.

  10. Using Chemistry and Color To Analyze Household Products: A 10-12-Hour Laboratory Project at the General Chemistry Level.

    Science.gov (United States)

    Bosma, Wayne B.

    1998-01-01

    Describes a set of experiments using a UV-VIS spectrometer to identify food colorings and to measure the pH of soft drinks. The first laboratory component uses locations and shapes of visible absorption peaks as a means of identifying dyes while the second portion uses the spectrometer for determining pH. (PVD)

  11. The predisposing pathology and clinical characteristics in the Scottish retinal detachment study.

    Science.gov (United States)

    Mitry, Danny; Singh, Jaswinder; Yorston, David; Siddiqui, M A Rehman; Wright, Alan; Fleck, Brian W; Campbell, Harry; Charteris, David G

    2011-07-01

    To describe the predisposing pathology and clinical features of all incident cases of rhegmatogenous retinal detachment (RRD) recruited in Scotland during a 2-year period. Prospective surveillance study of incident cases of RRD. All incident cases of RRD recruited as part of the Scottish Retinal Detachment Study. During a 2-year period, we coordinated a comprehensive system in which every case of primary RRD presenting to 1 of 6 vitreoretinal surgical sites in Scotland was examined and approached for study inclusion. Rhegmatogenous retinal detachment incidence, predisposing features, and clinical characteristics. A total of 1202 cases were recruited. Detailed clinical information was available on 1130 (94%) of cases. By causative break, the proportions of RRD were horseshoe tear (HST) associated with posterior vitreous detachment (PVD) in 86.2%, giant retinal tear (GRT) and PVD in 1.3%, non-PVD round hole (RH) in 4.9%, retinal dialysis in 5.9%, and retinoschisis RRD in 1.6%. One in 10 cases reported significant ocular trauma. One in 5 cases were pseudophakic. Round hole RRD more frequently presented with multiple retinal breaks compared with HST RRD (67.8% vs. 48.7%; P = 0.003). In PVD-associated RRD, 56.1% (95% confidence interval [CI], 53.8-58.3) of breaks were identified in the superotemporal retina. In non-PVD RRD, 54.6% (95% CI, 47.9-61.1) of breaks were inferotemporal, followed by superotemporal in 34.9% (95% CI, 28.7-41.5). Lattice degeneration was present in 18.7% of affected eyes and more common in RH RRD (35.7%) than in HST RRD (19.3%) (P = 0.003). Seven percent reported an affected first-degree relative, and these cases were significantly more myopic than nonfamilial cases. More than 85% of RRD cases are associated with PVD and related tractional tears. Non-PVD RH RRD occurred in younger and more myopic individuals. The majority of cases are caused by more than 1 retinal break, and the macula is affected in more than 50% at presentation. Ocular trauma

  12. Preparation and analysis of new proton conducting membranes for fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Soegaard, Susanne R. [University of Southern Denmark, Department of Physics and Chemistry, Campusvej 55, 5230 Odense M (Denmark); University of Perugia, Chemistry Department, Via Elce di Sotto 8, 06123, Perugia (Italy); Huan, Qian [University of Southern Denmark, Department of Physics and Chemistry, Campusvej 55, 5230 Odense M (Denmark); IRD Fuel Cells A/S, Kullinggade 31, 5700 Svendborg (Denmark); Lund, Peter [IRD Fuel Cells A/S, Kullinggade 31, 5700 Svendborg (Denmark); Donnadio, Anna; Casciola, Mario [University of Perugia, Chemistry Department, Via Elce di Sotto 8, 06123, Perugia (Italy); Skou, Eivind M. [University of Southern Denmark, Department of Physics and Chemistry, Campusvej 55, 5230 Odense M (Denmark); University of Southern Denmark, Department of Chemical Engineering, Biotechnology and Enviromental Technology, Niels Bohrs Alle 1, 5230 Odense M (Denmark)

    2007-04-15

    A range of potential new fuel cell membranes were prepared by inserting zirconium phosphate (ZrP) into divinylbenzene (DVB) crosslinked, sulfonated, polystyrene grafted poly(ethylene-alt-tetrafluoroethylene) and poly(vinyl difluoride) membranes using an ion exchange procedure. In short, the preformed membranes are called ETFE-g-PSSA and PVdF-g-PSSA. The ETFE based membranes represented various degrees of grafting (DOG) and degrees of sulfonation (DOS) whereas all of the PVdF based membranes had a DOG of app. 30% and a DOS of app. 90%. The ion exchange capacity (IEC) values of the ETFE based starting materials were in the range 0.5-2, and those of the PVdF based materials were in the range 1.8-2. A proton conductivity of 40 mS/cm was determined at 130 C and 90% RH for one of the ETFE based preformed membranes. The ETFE based composite samples had slightly lower proton conductivities. Additional zirconium phosphate treatment resulted in composite ETFE samples containing up to 15 wt.% ZrP and composite PVdF samples containing up to 27 wt.%. TG analyses of the ETFE-g-PSSA and PVdF-g-PSSA composite membranes indicated no significant changes of the thermal stability in comparison to the starting materials. The presence of {alpha}-ZrP in the product membranes was indicated by 31P MAS NMR analysis, while transmission electron microscopy (TEM) and powder X-ray diffraction analyses proved the samples to be homogeneous. (author)

  13. Modulation of lung inflammation by vessel dilator in a mouse model of allergic asthma

    Directory of Open Access Journals (Sweden)

    Cormier Stephania A

    2009-07-01

    Full Text Available Abstract Background Atrial natriuretic peptide (ANP and its receptor, NPRA, have been extensively studied in terms of cardiovascular effects. We have found that the ANP-NPRA signaling pathway is also involved in airway allergic inflammation and asthma. ANP, a C-terminal peptide (amino acid 99–126 of pro-atrial natriuretic factor (proANF and a recombinant peptide, NP73-102 (amino acid 73–102 of proANF have been reported to induce bronchoprotective effects in a mouse model of allergic asthma. In this report, we evaluated the effects of vessel dilator (VD, another N-terminal natriuretic peptide covering amino acids 31–67 of proANF, on acute lung inflammation in a mouse model of allergic asthma. Methods A549 cells were transfected with pVD or the pVAX1 control plasmid and cells were collected 24 hrs after transfection to analyze the effect of VD on inactivation of the extracellular-signal regulated receptor kinase (ERK1/2 through western blot. Luciferase assay, western blot and RT-PCR were also performed to analyze the effect of VD on NPRA expression. For determination of VD's attenuation of lung inflammation, BALB/c mice were sensitized and challenged with ovalbumin and then treated intranasally with chitosan nanoparticles containing pVD. Parameters of airway inflammation, such as airway hyperreactivity, proinflammatory cytokine levels, eosinophil recruitment and lung histopathology were compared with control mice receiving nanoparticles containing pVAX1 control plasmid. Results pVD nanoparticles inactivated ERK1/2 and downregulated NPRA expression in vitro, and intranasal treatment with pVD nanoparticles protected mice from airway inflammation. Conclusion VD's modulation of airway inflammation may result from its inactivation of ERK1/2 and downregulation of NPRA expression. Chitosan nanoparticles containing pVD may be therapeutically effective in preventing allergic airway inflammation.

  14. Enhancing the oxidation resistance of graphite by applying an SiC coat with crack healing at an elevated temperature

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jae-Won, E-mail: pjw@kaeri.re.kr [Korea Atomic Energy Research Institute, 1045 Daedeok-Daero, Yuseong-Gu, Daejeon-City (Korea, Republic of); Kim, Eung-Seon; Kim, Jae-Un [Korea Atomic Energy Research Institute, 1045 Daedeok-Daero, Yuseong-Gu, Daejeon-City (Korea, Republic of); Kim, Yootaek [Dept. of Materials Engineering, Kyonggi Universtiy, Suwon (Korea, Republic of); Windes, William E. [Idaho National Laboratory, Idaho Falls, ID 83415 (United States)

    2016-08-15

    Highlights: • Ion beam mixed SiC coating was performed on the graphite for the enhanced adhesion. • The SiC coated was cracked at the elevated temperature, confirming the strong bonding, and then was vigorously oxidized leaving only the SiC layer. • For crack healing, CVD crack healing increased by ∼4 times in 20% weight reduction in air at 900 °C as compared to PVD crack healing. - Abstract: The potential of reducing the oxidation of the supporting graphite components during normal and/or accident conditions in the Very High Temperature Reactor (VHTR) design has been studied. In this work efforts have been made to slow the oxidation process of the graphite with a thin SiC coating (∼ 10 μm). Upon heating at ≥ 1173 K in air, the spallations and cracks were formed in the dense columnar structured SiC coating layer grown on the graphite with a functionally gradient electron beam physical vapor deposition (EB-PVD. In accordance with the formations of these defects, the sample was vigorously oxidized, leaving only the SiC coating layer. Then, efforts were made to heal the surface defects using additional EB-PVD with ion beam bombardment and chemical vapor deposition (CVD). The EB-PVD did not effectively heal the cracks. But, the CVD was more appropriate for crack healing, likely due to its excellent crack line filling capability with a high density and high aspect ratio. It took ∼ 34 min for the 20% weight loss of the CVD crack healed sample in the oxidation test with annealing at 1173 K, while it took ∼ 8 min for the EB-PVD coated sample, which means it took ∼4 times longer at 1173 K for the same weight reduction in this experimental set-up.

  15. Super-capacitive electro-chemical performance of polymer blend gel polymer electrolyte (GPE) in carbon-based electrical double-layer capacitors

    International Nuclear Information System (INIS)

    Syahidah, S. Nuur; Majid, S.R.

    2013-01-01

    This study reports on the fabrication and comparative performance characteristics of a symmetrical electrical double-layer capacitor (EDLC) employed gel polymer electrolyte (GPE) assembled between carbon based electrodes. Three cells, A, B and C were fabricated using different composition of active materials (activated or porous carbon), binder (PVdF-HFP) and conductivity enhancer (super-P). The configuration of cell A: 0.9 porous carbon/0.1 PVdF-HFP, cell B: 0.45 activated carbon/0.45 porous carbon/0.1 PVdF-HFP and cell C: 0.8 activated carbon/0.1 super-P/0.1 PVdF-HFP. The GPE, comprising a poly(vinyl pyrrolidone) (PVP)/poly(vinylidene fluoride co-hexafluoroproplyne) (PVdF-HFP) blend complexed with magnesium triflate, Mg(CF 3 SO 3 ) 2 , was prepared by the solution casting technique at 60 °C. The physico-chemical properties of the GPEs were characterized by electrochemical impedance spectroscopy (EIS), scanning electron microscopy (SEM), linear sweep voltammetry (LSV) and cyclic voltammetry (CV). The ionic conductivity at the ambient temperature of the GPE is 2.16 × 10 −4 S cm −1 at 7.5 wt.% of Mg(CF 3 SO 3 ) 2 with a ∼2.6 V electro-chemical stability window. At the 1000th cycle, the specific capacitance, C s of cell A is 89 F g −1 while cell B and C are 63 and 49 F g −1 . Cell A shows excellent long-term cyclic stability (less than a 5% decrease in specific capacitance after 1000 cycles). The best operating voltage for cell A is 1.6 V with the specific capacitance 106 F g −1 after 500 cycles

  16. Active and Passive Components of Pelvic Floor Muscle Tone in Women with Provoked Vestibulodynia: A Perspective Based on a Review of the Literature.

    Science.gov (United States)

    Thibault-Gagnon, Stéphanie; Morin, Mélanie

    2015-11-01

    Pelvic floor muscle (PFM) dysfunctions, especially elevated tone or tension, are suggested to play an important role in the pathophysiology of provoked vestibulodynia (PVD). However, the involvement of the PFMs remains misunderstood as the assessment of muscle tone is complex and requires a thorough understanding of muscle physiology in relation to the characteristics and limitations of current PFM assessment tools. The aim of this review was to describe the structures and mechanisms involved in muscle tone in normally innervated muscle, and to discuss and relate these concepts to the PFM findings in women with PVD. A narrative overview of the literature retrieved from searches of electronic databases and hand searches. Muscle tone in a normally innervated muscle comprises both active (contractile) and passive (viscoelastic) components. Current methods for evaluating PFM tone such as digital palpation, ultrasound imaging, pressure perineometry, dynamometry, and electromyography may evaluate different components. Research findings suggestive of PFM hypertonicity in women with PVD include elevated general PFM tone, changes in viscoelastic properties, and at least in some women, abnormal increases in electrogenic activity. There is a growing body of evidence to support the involvement of PFM hypertonicity in the pathophysiology of PVD. Limitations of the instruments as well as their properties should be considered when evaluating PFM tone in order to obtain better insight into which component of PFM tone is assessed. Future research is required for further investigating the underlying mechanisms of PFM hypertonicity, and studying the specific effects of physiotherapeutic interventions on PFM tone in women with PVD. © 2015 International Society for Sexual Medicine.

  17. Approach and Avoidance Sexual Goals in Couples with Provoked Vestibulodynia: Associations with Sexual, Relational, and Psychological Well-Being.

    Science.gov (United States)

    Rosen, Natalie O; Muise, Amy; Bergeron, Sophie; Impett, Emily A; Boudreau, Gillian K

    2015-08-01

    Provoked vestibulodynia (PVD) is a prevalent vulvovaginal pain condition that is triggered primarily during sexual intercourse. PVD adversely impacts women's and their partners' sexual relationship and psychological well-being. Over 80% of women with PVD continue to have intercourse, possibly because of sexual goals that include wanting to pursue desirable outcomes (i.e., approach goals; such as a desire to maintain intimacy) and avoid negative outcomes (i.e., avoidance goals; such as avoiding a partner's disappointment). The aim of this study was to investigate associations between approach and avoidance sexual goals and women's pain, as well as the sexual, relational, and psychological well-being of affected couples. Women with PVD (N = 107) and their partners completed measures of sexual goals, sexual satisfaction, relationship satisfaction, and depression. Women also completed measures of pain during intercourse and sexual functioning. (1) Global Measure of Sexual Satisfaction Scale, (2) Dyadic Adjustment Scale-Revised or the Couple Satisfaction Index, (3) Beck Depression Inventory-II, (4) numerical rating scale of pain during intercourse, and (5) Female Sexual Function Index. When women reported higher avoidance sexual goals, they reported lower sexual and relationship satisfaction, and higher levels of depressive symptoms. In addition, when partners of women reported higher avoidance sexual goals, they reported lower relationship satisfaction. When women reported higher approach sexual goals, they also reported higher sexual and relationship satisfaction. Targeting approach and avoidance sexual goals could enhance the quality and efficacy of psychological couple interventions for women with PVD and their partners. © 2015 International Society for Sexual Medicine.

  18. Why Us? Perceived Injustice is Associated With More Sexual and Psychological Distress in Couples Coping With Genito-Pelvic Pain.

    Science.gov (United States)

    Pâquet, Myriam; Bois, Katy; Rosen, Natalie O; Mayrand, Marie-Hélène; Charbonneau-Lefebvre, Véronique; Bergeron, Sophie

    2016-01-01

    Provoked vestibulodynia (PVD) is the most frequent cause of genito-pelvic pain/penetration disorder (GPPPD) and is associated with negative psychological and sexual consequences for affected women and their partners. PVD is often misdiagnosed or ignored and many couples may experience a sense of injustice, due to the loss of their ability to have a normal sexual life. Perceiving injustice has been documented to have important consequences in individuals with chronic pain. However, no quantitative research has investigated the experience of injustice in this population. The aim of this study was to investigate the associations between perceived injustice and pain, sexual satisfaction, sexual distress, and depression among women with PVD and their partners. Women diagnosed with PVD (N = 50) and their partners completed questionnaires of perceived injustice, pain, sexual satisfaction, sexual distress, and depression. (1) Global Measure of Sexual Satisfaction Scale; (2) Female Sexual Distress Scale; (3) Beck Depression Inventory-II; and (4) McGill-Melzack Pain Questionnaire. After controlling for partners' age, women's higher level of perceived injustice was associated with their own greater sexual distress, and the same pattern was found for partners. Women's higher level of perceived injustice was associated with their own greater depression, and the same pattern was found for partners. Women's higher perceived injustice was not associated with their own lower sexual satisfaction but partners' higher perceived injustice was associated with their own lower sexual satisfaction. Perceived injustice was not associated with women's pain intensity. Results suggest that perceiving injustice may have negative consequences for the couple's sexual and psychological outcomes. However, the effects of perceived injustice appear to be intra-individual. Targeting perceived injustice could enhance the efficacy of psychological interventions for women with PVD and their partners

  19. Acceptance of vulvovaginal pain in women with provoked vestibulodynia and their partners: associations with pain, psychological, and sexual adjustment.

    Science.gov (United States)

    Boerner, Katelynn E; Rosen, Natalie O

    2015-06-01

    Provoked vestibulodynia (PVD) is a common vulvovaginal pain condition associated with negative psychological and sexual consequences for affected women and their sexual partners. Greater pain acceptance has been found to be associated with better functional and psychological outcomes in individuals with chronic pain, and acceptance-based strategies are being increasingly incorporated into treatment protocols. The present study is a novel investigation of pain acceptance in PVD couples. The aim was to examine the associations between acceptance of vulvovaginal pain and women's pain during intercourse, as well as the psychological and sexual adjustment of both women with PVD and their partners. Sixty-one couples (M(age) for women = 27.95 years, SD = 5.87; M(age) for men = 30.48 years, SD = 6.70) in which the woman was diagnosed with PVD completed the Chronic Pain Acceptance Questionnaire, in reference to women's vulvovaginal pain. Women also rated their pain during intercourse, and couples completed measures of anxiety, depression, sexual function, and sexual satisfaction. Dependent measures were (i) women's self-reported pain during intercourse on a numerical rating scale; (ii) State-Trait Anxiety Inventory trait subscale; (iii) Beck Depression Inventory-II; (iv) Derogatis Interview for Sexual Functioning; and (v) Global Measure of Sexual Satisfaction Scale. Women's greater pain acceptance was associated with their lower self-reported pain during intercourse, controlling for partner's pain acceptance. Greater pain acceptance among women was associated with their own lower anxiety and depression, greater sexual functioning, as well as their own and their partner's greater sexual satisfaction, controlling for the partner's pain acceptance. Additionally, greater pain acceptance among male partners was associated with their own lower depression. Findings suggest that psychological interventions for PVD should target increasing couples' vulvovaginal pain acceptance in

  20. Effect of Suspension Plasma-Sprayed YSZ Columnar Microstructure and Bond Coat Surface Preparation on Thermal Barrier Coating Properties

    Science.gov (United States)

    Bernard, Benjamin; Quet, Aurélie; Bianchi, Luc; Schick, Vincent; Joulia, Aurélien; Malié, André; Rémy, Benjamin

    2017-08-01

    Suspension plasma spraying (SPS) is identified as promising for the enhancement of thermal barrier coating (TBC) systems used in gas turbines. Particularly, the emerging columnar microstructure enabled by the SPS process is likely to bring about an interesting TBC lifetime. At the same time, the SPS process opens the way to a decrease in thermal conductivity, one of the main issues for the next generation of gas turbines, compared to the state-of-the-art deposition technique, so-called electron beam physical vapor deposition (EB-PVD). In this paper, yttria-stabilized zirconia (YSZ) coatings presenting columnar structures, performed using both SPS and EB-PVD processes, were studied. Depending on the columnar microstructure readily adaptable in the SPS process, low thermal conductivities can be obtained. At 1100 °C, a decrease from 1.3 W m-1 K-1 for EB-PVD YSZ coatings to about 0.7 W m-1 K-1 for SPS coatings was shown. The higher content of porosity in the case of SPS coatings increases the thermal resistance through the thickness and decreases thermal conductivity. The lifetime of SPS YSZ coatings was studied by isothermal cyclic tests, showing equivalent or even higher performances compared to EB-PVD ones. Tests were performed using classical bond coats used for EB-PVD TBC coatings. Thermal cyclic fatigue performance of the best SPS coating reached 1000 cycles to failure on AM1 substrates with a β-(Ni,Pt)Al bond coat. Tests were also performed on AM1 substrates with a Pt-diffused γ-Ni/γ'-Ni3Al bond coat for which more than 2000 cycles to failure were observed for columnar SPS YSZ coatings. The high thermal compliance offered by both the columnar structure and the porosity allowed the reaching of a high lifetime, promising for a TBC application.

  1. Perbaikan Tanah Dasar Menggunakan Pre-Fabricated Vertical Drain Dengan Variasi Kedalaman Dan Perkuatan Lereng Dengan Turap Studi Kasus : Lapangan Penumpukan Peti Kemas, Pelabuhan Trisakti, Banjarmasin, Kalimantan Selatan

    Directory of Open Access Journals (Sweden)

    Dofran Winner

    2017-03-01

    Full Text Available Metode perbaikan tanah dasar menggunakan preloading yang dikombinasikan dengan Pre-fabricated Vertical Drain (PVD dipilih untuk proyek pengembangan lapangan penumpukan peti kemas di Pelabuhan Trisakti, Banjarmasin, Kalimantan Selatan. Selama masa preloading, ternyata kelongsoran selebar 37 meter terjadi di area penumpukan. Diketahui bahwa kelongsoran terjadi saat preloading setinggi 4,0 meter. Agar lapangan penumpukan dapat beroperasi kembali, diperlukan perencanaan untuk perkuatan lereng dan untuk menghilangkan pemampatan tanah dasar di area lapangan penumpukan. Perbaikan tanah dasar menggunakan preloading yang dikombinasikan dengan Pre-fabricated Vertical Drain (PVD digunakan untuk Zona 3, 4, dan 5, dan perkuatan lereng dengan turap digunakan untuk Zona-1 dan Zona-2 yang merupakan bagian lereng dari lapangan penumpukan. Direncanakan PVD dipasang pada kedalaman yang berbeda: 1/3H, 2/3H, dan H (H adalah ketebalan lapisan tanah lunak untuk melihat kondisi yang menghasilkan biaya paling murah. Dari hasil perencanaan yang dilakukan, diketahui bahwa turap yang digunakan adalah Corrugated Concrete sheet pile type W-600 A1000. Turap dipasang sedalam 18 meter di Zona-1 dan sedalam 22 meter di Zona-2; selain itu, angker dipasang pada turap untuk meningkatkan kekakuan turap. Hasil perencanaan juga menunjukkan bahwa biaya yang paling ekonomis adalah PVD dipasang sampai 2/3H di Zona-3, dan tanpa PVD di Zona-4 dan Zona-5. Total biaya konstruksi adalah sebesar Rp 843.106.053,00 untuk Zona-1 dan Zona-2; Rp 9.446.530.597,00 untuk Zona-3; Rp 1.869.613.200,00 untuk Zona 4; dan Rp 3.577.392.000,00 untuk Zona 5.

  2. Synthesis of nanocrystalline Cu1-xTax composites using physical vapor deposition

    International Nuclear Information System (INIS)

    Savage, H.S.; Wang, H.; Rigsbee, J.M.

    1993-01-01

    Physical vapor deposition (PVD) processes provide the capability for creating new types of metallic, ceramic, and polymeric composites by allowing atomic-scale engineering of structure and chemistry. Because PVD processes provide the capacity for circumventing thermodynamic factors, such as solubility limits, it is possible to produce nonequilibrium alloys and materials with unique mixtures of phases. The ease by which PVD produces materials with nanocrystalline microstructures is an added benefit of these processes. This paper describes ion plating, a plasma-assisted PVD process, and its application for the development of a new class of nanoscale dispersion-strengthened Cu 1-x Ta x alloys. Copper-tantalum was selected as a model system because the extensive liquid miscibility gap and nearly zero mutual solid solubilities prevent creation of Cu-Ta alloys by conventional or rapid solidification processes. Microchemical analyses of the family of Cu 1-x Ta x alloys indicate that PVD can produce materials with any desired level of Ta. X-ray diffraction and transmission electron microscopy analyses show that the as-deposited microstructures consist generally of a Cu matrix supersaturated with Ta and containing a uniform dispersion of Ta particles with diameters below 10 nm. The Ta particles are face centered cubic (exceptionally large Ta particles, larger than ∼100 nm, are body centered cubic) and are oriented identically with the Cu matrix. Particle coarsening studies, at temperatures up to 900C and for times as long as 100 hours, indicate an extreme degree of microstructural stability. The Ta particles also appear highly effective at maintaining a submicron Cu matrix grain size even after annealing at 900C

  3. Hard coatings

    International Nuclear Information System (INIS)

    Dan, J.P.; Boving, H.J.; Hintermann, H.E.

    1993-01-01

    Hard, wear resistant and low friction coatings are presently produced on a world-wide basis, by different processes such as electrochemical or electroless methods, spray technologies, thermochemical, CVD and PVD. Some of the most advanced processes, especially those dedicated to thin film depositions, basically belong to CVD or PVD technologies, and will be looked at in more detail. The hard coatings mainly consist of oxides, nitrides, carbides, borides or carbon. Over the years, many processes have been developed which are variations and/or combinations of the basic CVD and PVD methods. The main difference between these two families of deposition techniques is that the CVD is an elevated temperature process (≥ 700 C), while the PVD on the contrary, is rather a low temperature process (≤ 500 C); this of course influences the choice of substrates and properties of the coating/substrate systems. Fundamental aspects of the vapor phase deposition techniques and some of their influences on coating properties will be discussed, as well as the very important interactions between deposit and substrate: diffusions, internal stress, etc. Advantages and limitations of CVD and PVD respectively will briefly be reviewed and examples of applications of the layers will be given. Parallel to the development and permanent updating of surface modification technologies, an effort was made to create novel characterisation methods. A close look will be given to the coating adherence control by means of the scratch test, at the coating hardness measurement by means of nanoindentation, at the coating wear resistance by means of a pin-on-disc tribometer, and at the surface quality evaluation by Atomic Force Microscopy (AFM). Finally, main important trends will be highlighted. (orig.)

  4. Enhancing the oxidation resistance of graphite by applying an SiC coat with crack healing at an elevated temperature

    International Nuclear Information System (INIS)

    Park, Jae-Won; Kim, Eung-Seon; Kim, Jae-Un; Kim, Yootaek; Windes, William E.

    2016-01-01

    Highlights: • Ion beam mixed SiC coating was performed on the graphite for the enhanced adhesion. • The SiC coated was cracked at the elevated temperature, confirming the strong bonding, and then was vigorously oxidized leaving only the SiC layer. • For crack healing, CVD crack healing increased by ∼4 times in 20% weight reduction in air at 900 °C as compared to PVD crack healing. - Abstract: The potential of reducing the oxidation of the supporting graphite components during normal and/or accident conditions in the Very High Temperature Reactor (VHTR) design has been studied. In this work efforts have been made to slow the oxidation process of the graphite with a thin SiC coating (∼ 10 μm). Upon heating at ≥ 1173 K in air, the spallations and cracks were formed in the dense columnar structured SiC coating layer grown on the graphite with a functionally gradient electron beam physical vapor deposition (EB-PVD. In accordance with the formations of these defects, the sample was vigorously oxidized, leaving only the SiC coating layer. Then, efforts were made to heal the surface defects using additional EB-PVD with ion beam bombardment and chemical vapor deposition (CVD). The EB-PVD did not effectively heal the cracks. But, the CVD was more appropriate for crack healing, likely due to its excellent crack line filling capability with a high density and high aspect ratio. It took ∼ 34 min for the 20% weight loss of the CVD crack healed sample in the oxidation test with annealing at 1173 K, while it took ∼ 8 min for the EB-PVD coated sample, which means it took ∼4 times longer at 1173 K for the same weight reduction in this experimental set-up.

  5. When Self-Worth Is Tied to One's Sexual and Romantic Relationship: Associations with Well-Being in Couples Coping with Genito-Pelvic Pain.

    Science.gov (United States)

    Glowacka, Maria; Bergeron, Sophie; Dubé, Justin; Rosen, Natalie O

    2018-01-05

    Contingent self-worth (CSW; the pursuit of self-esteem via a particular domain in one's life) impacts well-being based on one's perceived success or failure in the contingent domain. In a community sample, individuals with sexual problems reported greater sexual CSW-self-worth dependent on maintaining a sexual relationship-than those without problems. Couples coping with provoked vestibulodynia (PVD), a genito-pelvic pain condition, perceive failures in their sexual relationship, which could be associated with more pain and poorer well-being. In contrast, relationship CSW-self-worth dependent on the overall romantic relationship-may act as a buffer against adverse outcomes. Eighty-two women with PVD and their partners completed online standardized measures of sexual and relationship CSW, sexual distress and satisfaction, relationship satisfaction, and depressive symptoms, and women reported their pain intensity. Analyses were based on the actor-partner interdependence model. Women with PVD who reported greater sexual CSW experienced more sexual distress and pain. Additionally, when partners reported greater sexual CSW, they were less sexually and relationally satisfied and more sexually distressed, and women had greater depressive symptoms and lower relationship satisfaction. In contrast, when partners reported higher relationship CSW, they were more sexually and relationally satisfied and less sexually distressed, and women reported lower depressive symptoms and greater relationship satisfaction. Results suggest that couples' (particularly partners') greater sexual CSW is linked to poorer sexual, relational, and psychological well-being in couples affected by PVD, whereas partners' greater relationship CSW is associated with better well-being. Thus, sexual and relationship CSW may be important treatment targets for interventions aimed at improving how couples adjust to PVD.

  6. Perceptual visual dysfunction, physical impairment and quality of life in Bangladeshi children with cerebral palsy.

    Science.gov (United States)

    Mitry, D; Williams, C; Northstone, K; Akter, A; Jewel, J; Khan, N; Muhit, M; Gilbert, C E; Bowman, R

    2016-09-01

    Cerebral palsy (CP) is the most common cause of motor disability in children and is often accompanied by sensory and/or cognitive impairment. The aim of this study was to characterise visual acuity impairment, perceptual visual dysfunction (PVD) and physical disability in a community-based sample of Bangladeshi children with CP and to assess the impact of these factors on the quality of life of the children. A key informant study was used to recruit children with CP from Sirajganj district. Gross Motor Function Classification System (GMFCS) levels and visual impairment were assessed by a physiotherapist and an optometrist, respectively. Assessments of visual perception were performed and standardised questionnaires were administered to each child's main carer to elicit indicators of PVD and parent-reported health-related quality of life. A generalised linear regression analysis was conducted to assess the determinants of the quality of life scores. 180 children were recruited. The median age was 8 years (IQR: 6-11 years); 112 (62%) were male; 57 (32%) had visual acuity impairment and 95 (53%) had some parent-reported PVD. In analyses adjusted for age, sex, GMFCS and acuity impairment, visual attention (pvisual search (p=0.020). PVD is an important contributor in reducing quality of life in children with CP, independent of motor disability and acuity impairment. Better characterisation of PVD is important to help design interventions for affected children, which may improve their quality of life. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  7. Posterior vitreous detachment - prevalence of and risk factors for retinal tears

    Directory of Open Access Journals (Sweden)

    Bond-Taylor M

    2017-09-01

    Full Text Available Martin Bond-Taylor,1 Gunnar Jakobsson,1,2 Madeleine Zetterberg1,2 1Department of Ophthalmology, Sahlgrenska University Hospital, Mölndal, 2Department of Clinical Neuroscience/Ophthalmology, Institute of Neuroscience and Physiology, Sahlgrenska Academy at University of Gothenburg, Gothenburg, Sweden Purpose: The present study aimed to describe clinical characteristics of patients with posterior vitreous detachment (PVD, to determine the prevalence of retinal tears in PVD patients, and to find predictors for retinal tears in this patient group. Methods: Retrospective analysis of medical records on patients diagnosed with PVD, retinal tears, or vitreous hemorrhage at the Department of Ophthalmology at Sahlgrenska University Hospital, a tertiary eye center. Results: Between February and July 2009, 365 patients consulted the Department of Ophthalmology for PVD-related symptoms. The incidence of retinal tears was 14.5% (n=53 and that of vitreous and/or retinal hemorrhage was 22.7% (n=83. For analysis of possible predictors for complications to PVD, patients diagnosed with retinal tears or vitreous hemorrhage between May and July 2009 were also included in the study, resulting in a total of 426 patients. Predictors of a retinal tear were symptoms of visual impairment (P=0.024, the presence of vitreous or retinal hemorrhage at examination (P<0.001, and a duration of symptoms for <24 hours (P=0.004. Symptoms of flashes did not constitute an extra risk of retinal tears (P=0.135. Subsequent retinal pathology (follow-up time 4.5 years, including vitreous detachment/hemorrhage or retinal tears/detachment, occurred more often in patients presenting with a retinal tear. For patients with a retinal tear, the relative risk of having a retinal detachment in the same eye during the follow-up time was 17.7 when compared to patients without a retinal tear (risk ratio 17.7, 95% confidence interval 2.2–145. Conclusion: Patients seeking care on the first day have a

  8. Pyoverdine synthesis by the Mn(II-oxidizing bacterium Pseudomonas putida GB-1

    Directory of Open Access Journals (Sweden)

    Dorothy Lundquist Parker

    2014-05-01

    Full Text Available When iron-starved, the Mn(II-oxidizing bacteria Pseudomonas putida strains GB-1 and MnB1 produce pyoverdines (PVDGB-1 and PVDMnB1, siderophores that both influence iron uptake and inhibit manganese(II oxidation by these strains. To explore the properties and genetics of a PVD that can affect manganese oxidation, LC-MS/MS and various siderotyping techniques were used to identify the peptides of PVDGB-1 and PVDMnB1 as being (for both PVDs: chromophore-Asp-Lys-OHAsp-Ser-Gly-aThr-Lys-cOHOrn, resembling a structure previously reported for P. putida CFML 90-51, which does not oxidize Mn. All three strains also produced an azotobactin and a sulfonated PVD, each with the peptide sequence above, but with unknown regulatory or metabolic effects. Bioinformatic analysis of the sequenced genome of P. putida GB-1 suggested that a particular non-ribosomal peptide synthetase, coded by the operon PputGB1_4083-4086, could produce the peptide backbone of PVDGB-1. To verify this prediction, plasmid integration disruption of PputGB1_4083 was performed and the resulting mutant failed to produce detectable PVD. In silico analysis of the modules in PputGB1_4083-4086 predicted a peptide sequence of Asp-Lys-Asp-Ser-Ala-Thr-Lsy-Orn, which closely matches the peptide determined by MS/MS. To extend these studies to other organisms, various Mn(II-oxidizing and non-oxidizing isolates of P. putida, P. fluorescens, P. marincola, P. fluorescens-syringae group, P. mendocina-resinovorans group and P. stutzerii group were screened for PVD synthesis. The PVD producers (12 out of 16 tested strains were siderotyped and placed into four sets of differing PVD structures, some corresponding to previously characterized PVDs and some to novel PVDs. These results combined with previous studies suggested that the presence of OHAsp or the flexibility of the pyoverdine polypeptide may enable efficient binding of Mn(III.

  9. Sexual and relationship intimacy among women with provoked vestibulodynia and their partners: associations with sexual satisfaction, sexual function, and pain self-efficacy.

    Science.gov (United States)

    Bois, Katy; Bergeron, Sophie; Rosen, Natalie O; McDuff, Pierre; Grégoire, Catherine

    2013-08-01

    Provoked vestibulodynia (PVD) is the most frequent subtype of vulvodynia. Women report negative consequences of PVD on their sexual and romantic relationships. Researchers have recently highlighted the importance of examining interpersonal factors such as intimacy, and of including both women and their partners in study designs. The aim of this study was to investigate sexual and relationship intimacy as defined by the Interpersonal Process Model of Intimacy and their associations with sexual satisfaction, sexual function, pain self-efficacy, and pain intensity among women with PVD and their partners. Ninety-one heterosexual women (M age = 27.38, SD = 6.04) diagnosed with PVD and their partners (M age = 29.37, SD = 7.79) completed measures of sexual and relationship intimacy, sexual satisfaction, sexual function, pain self-efficacy, and pain intensity. Dependent measures were the (i) Global Measure of Sexual Satisfaction Scale; (ii) Female Sexual Function Index; (iii) Painful Intercourse Self-Efficacy Scale; and (iv) visual analog scale of pain intensity during intercourse. After controlling for women's age, women's greater sexual intimacy (β = 0.49, P sexual satisfaction and higher pain self-efficacy (β = 0.39, P = 0.001), beyond the effects of partners' sexual intimacy. Also, women's greater sexual intimacy (β = 0.24, P = 0.05) and women's greater relationship intimacy (β = 0.54, P = 0.003) were associated with greater women's sexual function, beyond the effects of partners' sexual and relationship intimacy. Women's self-reported sexual and relationship intimacy in the couple relationship may promote higher sexual satisfaction, sexual function, and pain self-efficacy, as well as possibly foster greater sexual well-being among women with PVD. The authors discuss implications for the inclusion of emotional and interpersonal aspects of the couple's dynamic in clinical interventions and future research in PVD. © 2013

  10. It Takes Two: Sexual Communication Patterns and the Sexual and Relational Adjustment of Couples Coping With Provoked Vestibulodynia.

    Science.gov (United States)

    Rancourt, Kate M; Flynn, Michelle; Bergeron, Sophie; Rosen, Natalie O

    2017-03-01

    Provoked vestibulodynia (PVD) is a prevalent vulvovaginal pain condition that is associated with sexual and relational consequences for women and their partners. Greater perceived quality of sexual communication has been associated with women's lower pain during intercourse and with couples' better sexual and relational well-being. Whether couples' collaborative (eg, expressing feelings or problem solving) and negative (eg, withdrawing or criticizing) sexual communication patterns (SCPs) are differentially associated with couples' adjustment to PVD is unknown. To examine associations between collaborative and negative SCPs and women's pain and the sexual and relationship adjustment of women with PVD and their partners. Women diagnosed with PVD (N = 87) and their partners completed the Sexual Communication Patterns Questionnaire and measurements of pain (women only), sexual functioning, sexual satisfaction, sexual distress, and relationship satisfaction. (i) Numerical rating scale of pain during intercourse, (ii) Female Sexual Function Index and International Index of Erectile Function, (iii) Global Measure of Sexual Satisfaction, (iv) Female Sexual Distress Scale-Revised, and (v) Couple Satisfaction Index. When women reported greater collaborative SCP, they also reported higher sexual and relationship satisfaction. When women reported greater negative SCP, they reported less relationship satisfaction and had partners who reported greater sexual distress. When partners reported greater collaborative SCP, they also reported higher relationship satisfaction and had female partners who were less sexually distressed. When partners reported higher negative SCP, they also reported less relationship satisfaction. There were no associations between SCP and women's or partners' sexual functioning or women's pain. Collaborative SCP may benefit couples' sexual and relational well-being, whereas negative SCP may impede sexual and relational adjustment to PVD. Findings

  11. Pyoverdine synthesis by the Mn(II)-oxidizing bacterium Pseudomonas putida GB-1

    Science.gov (United States)

    Parker, Dorothy L.; Lee, Sung-Woo; Geszvain, Kati; Davis, Richard E.; Gruffaz, Christelle; Meyer, Jean-Marie; Torpey, Justin W.; Tebo, Bradley M.

    2014-01-01

    When iron-starved, the Mn(II)-oxidizing bacteria Pseudomonas putida strains GB-1 and MnB1 produce pyoverdines (PVDGB-1 and PVDMnB1), siderophores that both influence iron uptake and inhibit manganese(II) oxidation by these strains. To explore the properties and genetics of a PVD that can affect manganese oxidation, LC-MS/MS, and various siderotyping techniques were used to identify the peptides of PVDGB-1 and PVDMnB1 as being (for both PVDs): chromophore-Asp-Lys-OHAsp-Ser-Gly-aThr-Lys-cOHOrn, resembling a structure previously reported for P. putida CFML 90-51, which does not oxidize Mn. All three strains also produced an azotobactin and a sulfonated PVD, each with the peptide sequence above, but with unknown regulatory or metabolic effects. Bioinformatic analysis of the sequenced genome of P. putida GB-1 suggested that a particular non-ribosomal peptide synthetase (NRPS), coded by the operon PputGB1_4083-4086, could produce the peptide backbone of PVDGB-1. To verify this prediction, plasmid integration disruption of PputGB1_4083 was performed and the resulting mutant failed to produce detectable PVD. In silico analysis of the modules in PputGB1_4083-4086 predicted a peptide sequence of Asp-Lys-Asp-Ser-Ala-Thr-Lsy-Orn, which closely matches the peptide determined by MS/MS. To extend these studies to other organisms, various Mn(II)-oxidizing and non-oxidizing isolates of P. putida, P. fluorescens, P. marincola, P. fluorescens-syringae group, P. mendocina-resinovorans group, and P. stutzerii group were screened for PVD synthesis. The PVD producers (12 out of 16 tested strains) were siderotyped and placed into four sets of differing PVD structures, some corresponding to previously characterized PVDs and some to novel PVDs. These results combined with previous studies suggested that the presence of OHAsp or the flexibility of the pyoverdine polypeptide may enable efficient binding of Mn(III). PMID:24847318

  12. Upregulation of Mir-21 Levels in the Vitreous Humor Is Associated with Development of Proliferative Vitreoretinal Disease.

    Directory of Open Access Journals (Sweden)

    Ayumi Usui-Ouchi

    Full Text Available MicroRNAs (miRNAs are small noncoding RNAs that regulate gene expression by post-transcriptional inhibition of mRNA translation. Dysregulation of miRNAs, including circulating miRNAs, has been reported to play an important role in the development of various diseases, including fibrotic diseases. Aberrant expression of miRNAs in the vitreous humor of vitreoretinal diseased eyes has been reported. However, the expression pattern of miRNAs present in the vitreous humor of proliferative vitreoretinal disease (PVD patients, including proliferative diabetic retinopathy (PDR, and proliferative vitreoretinopathy (PVR, remains unknown. To investigate the factors important for the development of PVD, we characterized the miRNAs present in the vitreous humor of PVD patients and analyzed the expression profiles of 377 miRNAs using quantitative polymerase chain reaction-based miRNA arrays. The expression of a specific subset of miRNAs, previously reported to be associated with the development of angiogenesis and fibrosis, was significantly altered in the vitreous of PVD patients. Among these miRNAs, we identified miR-21 as a candidate fibrotic miRNA with an important role in the pathogenesis of PVD. Increased miR-21 levels in the vitreous were associated with retinal fibrosis, including PVR and PDR. Because epithelial-mesenchymal transition (EMT of retinal pigment epithelial cells (RPECs plays a critical role in retinal fibrosis, the expression of miR-21 in human RPECs was determined. Its expression in RPECs was induced by transforming growth factor-β, a key growth factor involved in fibrogenesis, and was enhanced by high glucose culture conditions, suggesting that miR-21 expression positively correlates with disease progression. Gain- and loss-of-function studies revealed that miR-21 promoted cell proliferation and migration of ARPE-19 cells without affecting EMT-related gene expression. Together, our studies have identified miR-21 as a potential disease

  13. Clinical research on the development of posterior vitreous detachments after coaxial microincision phacoemulsification

    Directory of Open Access Journals (Sweden)

    Rong Xu

    2013-09-01

    Full Text Available AIM: To explore the development process of when posterior vitreous detachments(PVDsafter coaxial micro-incision phacoemulsification and aspiration combined with foldable intraocular lens implantation.METHODS: Clinical data of 917 patients with cataract were collected after coaxial microincision phacoemulsification and aspiration combined with foldable intraocular lens implantation. The 917 operating eyes forms observation group and the 917 corresponding normal eyes serve as control group. All patients underwent a comprehensive ocular examination before surgery. The vitreous and retinal condition was tested by B-scan ultrasonography and biomicroscope with a 90-diopter(Dpreset lens after 1 week and 1, 3, 6, and 12 months postoperatively. RESULTS: The incident rate of eyes in the observation group that developed PVD after operation were 8(0.9%, 31(3.4%, 53(5.8%, 78(8.5%, 129(14.1%within 1 week and 1, 3, 6, 12 months, respectively. Ten(7.8%of the 129 eyes in which PVD developed during the one year follow-up period had new retinal breaks with or without a retinal detachment; One(0.1%of the 788 eyes in which a PVD did not developed during the follow-up period had new retinal tear with or without a retinal detachment; these percentages were statistically significant(P=0.009. Eight(14.8%of 54 eyes with lattice degeneration and 2(2.7%of 75 eyes without lattice degeneration had retinal tears associated with a PVD; the difference was statistically significant(P=0.004.CONCLUSION: Development of PVDs seems to accelerate after coaxial microincision phacoemulsification and linearly accumulated for 1 year postoperatively. Approximately 7.8% of eyes with a PVD had retinal tears. Compared with patients having no lattice degeneration, Patients' eyes with lattice degeneration had a 5.5-fold higher risk of developing retinal breaks associated with a PVD. This indicates long-term follow-up is necessary after phacoemulsification is performed.

  14. Development of durable and efficient electrodes for large-scale alkaline water electrolysis

    DEFF Research Database (Denmark)

    Kjartansdóttir, Cecilia Kristin; Nielsen, Lars Pleth; Møller, Per

    2013-01-01

    A new type of electrodes for alkaline water electrolysis is produced by physical vapour depositing (PVD) of aluminium onto a nickel substrate. The PVD Al/Ni is heat-treated to facilitate alloy formation followed by a selective aluminium alkaline leaching. The obtained porous Ni surface is uniform...... and characterized by a unique interlayer adhesion, which is critical for industrial application. IR-compensated polarisation curves prepared in a half-cell setup with 1 M KOH electrolyte at room temperature reveals that at least 400 mV less potential is needed to decompose water into hydrogen and oxygen...... produced bipolar electrolyser stack. The developed electrodes showed stable behaviour under intermittent operation for over 9000 h indicating no serious deactivation in the density of active sites....

  15. Control of the interfacial reactions in Nb-toughened MoSi2

    International Nuclear Information System (INIS)

    Shaw, L.; Abbaschian, R.

    1993-01-01

    Toughening of MoSi 2 for high-temperature applications can be achieved by incorporating ductile refractory-metal reinforcements, provided that a coating is applied to prevent interdiffusion and reaction between the matrix and the reinforcements. In the present study, three different coating techniques for applying a thin Al 2 O 3 film on Nb reinforcements as a diffusion barrier have been studied. The techniques consisted of (1) sol-gel coating; (2) physical vapor deposition (PVD); (3) hot dipping in molten Al, followed by anodizing Al to form Al 2 O 3 . The processing parameters for the techniques were evaluated and the effectiveness of each coating as a diffusion barrier was assessed. For the present MoSi 2 matrix which contains SiO 2 , PVD coatings provided the most effective diffusion barrier for processing MoSi 2 /Nb composites

  16. Fabricating and strengthening the carbon nanotube/copper composite fibers with high strength and high electrical conductivity

    Science.gov (United States)

    Han, Baoshuai; Guo, Enyu; Xue, Xiang; Zhao, Zhiyong; Li, Tiejun; Xu, Yanjin; Luo, Liangshun; Hou, Hongliang

    2018-05-01

    Combining the excellent properties of carbon nanotube (CNT) and copper, CNT/Cu composite fibers were fabricated by physical vapor deposition (PVD) and rolling treatment. Dense and continuous copper film (∼2 μm) was coated on the surface of the CNT fibers by PVD, and rolling treatment was adopt to strengthen the CNT/Cu composite fibers. After the rolling treatment, the defects between the Cu grains and the CNT bundles were eliminated, and the structure of both the copper film and the core CNT fibers were optimized. The rolled CNT/Cu composite fibers possess high tensile effective strength (1.01 ± 0.13 GPa) and high electrical conductivity ((2.6 ± 0.3) × 107 S/m), and thus, this material may become a promising wire material.

  17. Preparation and analysis of new proton conducting membranes for fuel cells

    DEFF Research Database (Denmark)

    Søgaard, Susanne Roslev; Huan, Qian; Lund, Peter Brilner

    2007-01-01

    A range of potential new fuel cell membranes were prepared by inserting zirconium phosphate (ZrP) into divinylbenzene (DVB) crosslinked, sulfonated, polystyrene grafted poly(ethylene-alt-tetrafluoroethylene) and poly(vinyl difluoride) membranes using an ion exchange procedure. In short, the prefo......A range of potential new fuel cell membranes were prepared by inserting zirconium phosphate (ZrP) into divinylbenzene (DVB) crosslinked, sulfonated, polystyrene grafted poly(ethylene-alt-tetrafluoroethylene) and poly(vinyl difluoride) membranes using an ion exchange procedure. In short....... Additional zirconium phosphate treatment resulted in composite ETFE samples containing up to 15 wt.% ZrP and composite PVdF samples containing up to 27 wt.%. TG analyses of the ETFE-g-PSSA and PVdF-g-PSSA composite membranes indicated no significant changes of the thermal stability in comparison...

  18. Electrospun nanocomposite fibrous polymer electrolyte for secondary lithium battery applications

    International Nuclear Information System (INIS)

    Padmaraj, O.; Rao, B. Nageswara; Jena, Paramananda; Satyanarayana, N.; Venkateswarlu, M.

    2014-01-01

    Hybrid nanocomposite [poly(vinylidene fluoride -co- hexafluoropropylene) (PVdF-co-HFP)/magnesium aluminate (MgAl 2 O 4 )] fibrous polymer membranes were prepared by electrospinning method. The prepared pure and nanocomposite fibrous polymer electrolyte membranes were soaked into the liquid electrolyte 1M LiPF 6 in EC: DEC (1:1,v/v). XRD and SEM are used to study the structural and morphological studies of nanocomposite electrospun fibrous polymer membranes. The nanocomposite fibrous polymer electrolyte membrane with 5 wt.% of MgAl 2 O 4 exhibits high ionic conductivity of 2.80 × 10 −3 S/cm at room temperature. The charge-discharge capacity of Li/LiCoO 2 coin cells composed of the newly prepared nanocomposite [(16 wt.%) PVdF-co-HFP+(5 wt.%) MgAl 2 O 4 ] fibrous polymer electrolyte membrane was also studied and compared with commercial Celgard separator

  19. Retinal Changes Induced by Epiretinal Tangential Forces

    Directory of Open Access Journals (Sweden)

    Mario R. Romano

    2015-01-01

    Full Text Available Two kinds of forces are active in vitreoretinal traction diseases: tangential and anterior-posterior forces. However, tangential forces are less characterized and classified in literature compared to the anterior-posterior ones. Tangential epiretinal forces are mainly due to anomalous posterior vitreous detachment (PVD, vitreoschisis, vitreopapillary adhesion (VPA, and epiretinal membranes (ERMs. Anomalous PVD plays a key role in the formation of the tangential vectorial forces on the retinal surface as consequence of gel liquefaction (synchysis without sufficient and fast vitreous dehiscence at the vitreoretinal interface. The anomalous and persistent adherence of the posterior hyaloid to the retina can lead to vitreomacular/vitreopapillary adhesion or to a formation of avascular fibrocellular tissue (ERM resulting from the proliferation and transdifferentiation of hyalocytes resident in the cortical vitreous remnants after vitreoschisis. The right interpretation of the forces involved in the epiretinal tangential tractions helps in a better definition of diagnosis, progression, prognosis, and surgical outcomes of vitreomacular interfaces.

  20. Evaluation and percutaneous management of atherosclerotic peripheral vascular disease

    International Nuclear Information System (INIS)

    Widlus, D.M.; Osterman, F.A. Jr.

    1989-01-01

    Atherosclerotic peripheral vascular disease (PVD) of the lower extremities deprives a person of the ability to exercise to their satisfaction, later of the ability to perform the activities of their daily life, and finally of their legs themselves. Peripheral vascular disease has long been managed by the vascular surgeon utilizing endarterectomy and peripheral arterial bypass. Patient acceptance of nonsurgical, percutaneous procedures such as percutaneous transluminal balloon angioplasty (PTA) is high. Increased utilization of these procedures has led to improved techniques and adjuncts to therapy, as well as more critical review of long-term results. This article will review the evaluation and nonoperative management of PVD, with an emphasis on the newer modalities of management presently being investigated